BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27996_g1_i1 len=2766 path=[2744:0-2765]

Length=2766
                                                                      Score     E

ref|XP_009766374.1|  PREDICTED: cation/H(+) antiporter 18-like         1195   0.0      
ref|XP_009620181.1|  PREDICTED: cation/H(+) antiporter 18-like         1189   0.0      
ref|XP_004245552.1|  PREDICTED: cation/H(+) antiporter 18-like is...   1183   0.0      
ref|XP_009586863.1|  PREDICTED: cation/H(+) antiporter 18-like         1178   0.0      
ref|XP_009765985.1|  PREDICTED: cation/H(+) antiporter 18-like         1176   0.0      
ref|XP_009802616.1|  PREDICTED: cation/H(+) antiporter 18-like         1170   0.0      
ref|XP_006343907.1|  PREDICTED: cation/H(+) antiporter 18-like         1162   0.0      
ref|XP_009586862.1|  PREDICTED: cation/H(+) antiporter 18-like         1150   0.0      
ref|XP_004245551.1|  PREDICTED: cation/H(+) antiporter 18-like         1147   0.0      
ref|XP_004244724.1|  PREDICTED: cation/H(+) antiporter 18-like         1144   0.0      
ref|XP_006343906.1|  PREDICTED: cation/H(+) antiporter 18-like         1144   0.0      
emb|CDP12106.1|  unnamed protein product                               1124   0.0      
gb|EYU23396.1|  hypothetical protein MIMGU_mgv1a001514mg               1121   0.0      
ref|XP_011080876.1|  PREDICTED: cation/H(+) antiporter 18-like         1104   0.0      
ref|XP_009608562.1|  PREDICTED: cation/H(+) antiporter 18-like         1104   0.0      
ref|XP_009782586.1|  PREDICTED: cation/H(+) antiporter 18-like         1102   0.0      
ref|XP_011073516.1|  PREDICTED: cation/H(+) antiporter 18-like         1094   0.0      
gb|EYU40046.1|  hypothetical protein MIMGU_mgv1a001527mg               1088   0.0      
ref|XP_007040407.1|  Cation/H+ exchanger 18                            1081   0.0      
ref|XP_004233089.1|  PREDICTED: cation/H(+) antiporter 18-like         1066   0.0      
ref|XP_010106576.1|  Cation/H(+) antiporter 18                         1066   0.0      
ref|XP_006355611.1|  PREDICTED: cation/H(+) antiporter 18-like         1062   0.0      
ref|XP_004298855.1|  PREDICTED: cation/H(+) antiporter 18-like         1051   0.0      
gb|KHG06330.1|  hypothetical protein F383_32801                        1048   0.0      
ref|XP_009334467.1|  PREDICTED: cation/H(+) antiporter 18              1048   0.0      
gb|KHG06329.1|  hypothetical protein F383_32801                        1047   0.0      
ref|XP_008238994.1|  PREDICTED: cation/H(+) antiporter 18-like         1046   0.0      
ref|XP_007210366.1|  hypothetical protein PRUPE_ppa001527mg            1046   0.0      
ref|XP_008385052.1|  PREDICTED: cation/H(+) antiporter 18              1045   0.0      
ref|XP_002509895.1|  Na(+)/H(+) antiporter, putative                   1044   0.0      Ricinus communis
ref|XP_007040405.1|  Cation/H+ exchanger 18 isoform 1                  1039   0.0      
ref|XP_007210361.1|  hypothetical protein PRUPE_ppa001551mg            1039   0.0      
ref|XP_008238996.1|  PREDICTED: cation/H(+) antiporter 18-like         1038   0.0      
gb|KHG13786.1|  Cation/H(+) antiporter 18 -like protein                1036   0.0      
ref|XP_011022576.1|  PREDICTED: cation/H(+) antiporter 18-like         1036   0.0      
ref|XP_002304537.2|  hypothetical protein POPTR_0003s13470g            1036   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004298856.1|  PREDICTED: cation/H(+) antiporter 17-like         1036   0.0      
ref|XP_010676379.1|  PREDICTED: cation/H(+) antiporter 18-like         1035   0.0      
gb|KDP25351.1|  hypothetical protein JCGZ_20507                        1032   0.0      
gb|EYU23392.1|  hypothetical protein MIMGU_mgv1a024127mg               1030   0.0      
gb|EPS69500.1|  hypothetical protein M569_05263                        1026   0.0      
ref|XP_002276249.1|  PREDICTED: cation/H(+) antiporter 18              1019   0.0      Vitis vinifera
ref|XP_002509894.1|  Na(+)/H(+) antiporter, putative                   1014   0.0      Ricinus communis
emb|CAN81240.1|  hypothetical protein VITISV_031075                    1013   0.0      Vitis vinifera
ref|XP_010055811.1|  PREDICTED: cation/H(+) antiporter 18              1011   0.0      
ref|XP_010261446.1|  PREDICTED: cation/H(+) antiporter 18 isoform X1   1011   0.0      
gb|KHG26273.1|  Cation/H(+) antiporter 18 -like protein                1009   0.0      
ref|XP_006439425.1|  hypothetical protein CICLE_v10018903mg            1009   0.0      
ref|XP_010261447.1|  PREDICTED: cation/H(+) antiporter 18 isoform X2   1009   0.0      
ref|XP_002272080.1|  PREDICTED: cation/H(+) antiporter 18              1008   0.0      Vitis vinifera
gb|KDO76404.1|  hypothetical protein CISIN_1g003702mg                  1006   0.0      
ref|XP_008341283.1|  PREDICTED: cation/H(+) antiporter 18-like         1005   0.0      
ref|XP_006476453.1|  PREDICTED: cation/H(+) antiporter 18-like is...   1004   0.0      
ref|XP_002276346.1|  PREDICTED: cation/H(+) antiporter 18              1000   0.0      Vitis vinifera
emb|CAN81239.1|  hypothetical protein VITISV_031074                     994   0.0      Vitis vinifera
ref|XP_006573800.1|  PREDICTED: cation/H(+) antiporter 18-like is...    991   0.0      
ref|XP_010101602.1|  Cation/H(+) antiporter 18                          989   0.0      
ref|XP_006360740.1|  PREDICTED: cation/H(+) antiporter 18-like          989   0.0      
ref|XP_006476457.1|  PREDICTED: cation/H(+) antiporter 18-like is...    989   0.0      
gb|KHN25663.1|  Cation/H(+) antiporter 18                               989   0.0      
ref|XP_006476456.1|  PREDICTED: cation/H(+) antiporter 18-like is...    989   0.0      
ref|XP_006439427.1|  hypothetical protein CICLE_v10018864mg             986   0.0      
ref|XP_006439426.1|  hypothetical protein CICLE_v10018864mg             986   0.0      
ref|XP_004164366.1|  PREDICTED: cation/H(+) antiporter 18-like          983   0.0      
ref|XP_002297994.1|  cation/hydrogen exchanger family protein           982   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004252574.1|  PREDICTED: cation/H(+) antiporter 18               982   0.0      
ref|XP_004511538.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    982   0.0      
ref|XP_004146576.1|  PREDICTED: cation/H(+) antiporter 18-like          980   0.0      
ref|XP_003538685.1|  PREDICTED: cation/H(+) antiporter 18-like is...    980   0.0      
ref|XP_008451983.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    979   0.0      
ref|XP_008451984.1|  PREDICTED: cation/H(+) antiporter 18-like          979   0.0      
ref|XP_009614856.1|  PREDICTED: cation/H(+) antiporter 18-like          975   0.0      
ref|XP_011026948.1|  PREDICTED: cation/H(+) antiporter 18-like          975   0.0      
ref|XP_010325375.1|  PREDICTED: cation/H(+) antiporter 18-like is...    974   0.0      
ref|XP_006285823.1|  hypothetical protein CARUB_v10007299mg             974   0.0      
ref|XP_010096456.1|  Cation/H(+) antiporter 18                          972   0.0      
gb|AAX49546.1|  cation/H+ exchanger                                     970   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_198976.3|  cation/H(+) antiporter 18                             970   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868583.1|  ATCHX18                                            970   0.0      
ref|XP_010910508.1|  PREDICTED: cation/H(+) antiporter 18-like          968   0.0      
gb|KHN35057.1|  Cation/H(+) antiporter 18                               967   0.0      
ref|XP_003611041.1|  Na+/H+ antiporter-like protein                     966   0.0      
ref|XP_010441325.1|  PREDICTED: cation/H(+) antiporter 18               965   0.0      
ref|XP_010447730.1|  PREDICTED: cation/H(+) antiporter 18-like          965   0.0      
ref|XP_007158549.1|  hypothetical protein PHAVU_002G161600g             964   0.0      
ref|XP_009796404.1|  PREDICTED: cation/H(+) antiporter 18-like          964   0.0      
ref|XP_003611042.1|  Cation proton exchanger                            964   0.0      
ref|XP_010533613.1|  PREDICTED: cation/H(+) antiporter 18-like          962   0.0      
ref|XP_010436112.1|  PREDICTED: cation/H(+) antiporter 18-like          962   0.0      
gb|KDP25352.1|  hypothetical protein JCGZ_20508                         962   0.0      
ref|XP_004146577.1|  PREDICTED: cation/H(+) antiporter 18-like          961   0.0      
ref|XP_008798688.1|  PREDICTED: cation/H(+) antiporter 18-like          960   0.0      
gb|EPS69438.1|  hypothetical protein M569_05328                         958   0.0      
ref|XP_004146578.1|  PREDICTED: cation/H(+) antiporter 18-like          954   0.0      
ref|XP_010043343.1|  PREDICTED: cation/H(+) antiporter 19               954   0.0      
emb|CDY39729.1|  BnaA04g11240D                                          951   0.0      
ref|XP_009140104.1|  PREDICTED: cation/H(+) antiporter 18               950   0.0      
emb|CDP12105.1|  unnamed protein product                                947   0.0      
ref|XP_006405324.1|  hypothetical protein EUTSA_v10027645mg             937   0.0      
emb|CDY44462.1|  BnaCnng11150D                                          936   0.0      
ref|XP_008451982.1|  PREDICTED: cation/H(+) antiporter 18-like          934   0.0      
ref|XP_010541366.1|  PREDICTED: cation/H(+) antiporter 17-like          930   0.0      
ref|XP_007028838.1|  Cation/H+ exchanger 19                             927   0.0      
ref|NP_188390.2|  cation/H(+) antiporter 19                             925   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883073.1|  predicted protein                                  923   0.0      
emb|CDY24802.1|  BnaA08g15080D                                          918   0.0      
emb|CDY35447.1|  BnaC03g62130D                                          917   0.0      
gb|AES94002.2|  cation/H+ exchanger 3                                   917   0.0      
ref|XP_003611044.1|  Cation proton exchanger                            917   0.0      
ref|XP_009109299.1|  PREDICTED: cation/H(+) antiporter 17-like          916   0.0      
gb|KDO76398.1|  hypothetical protein CISIN_1g0036452mg                  916   0.0      
ref|XP_007225273.1|  hypothetical protein PRUPE_ppa001482mg             913   0.0      
ref|XP_006297013.1|  hypothetical protein CARUB_v10013004mg             912   0.0      
ref|XP_004162369.1|  PREDICTED: cation/H(+) antiporter 18-like          912   0.0      
ref|XP_004149769.1|  PREDICTED: cation/H(+) antiporter 18-like          912   0.0      
gb|ACC91238.1|  putative cation/hydrogen exchanger                      912   0.0      Arabidopsis halleri
ref|XP_010541354.1|  PREDICTED: cation/H(+) antiporter 17-like          911   0.0      
gb|KGN53374.1|  hypothetical protein Csa_4G050780                       911   0.0      
emb|CDY47629.1|  BnaA01g13360D                                          909   0.0      
ref|XP_010246811.1|  PREDICTED: cation/H(+) antiporter 19               909   0.0      
emb|CDY03530.1|  BnaC01g15520D                                          907   0.0      
ref|XP_002270854.1|  PREDICTED: cation/H(+) antiporter 19               906   0.0      Vitis vinifera
ref|XP_009137322.1|  PREDICTED: cation/H(+) antiporter 17               905   0.0      
ref|XP_010465813.1|  PREDICTED: cation/H(+) antiporter 19 isoform X1    904   0.0      
ref|XP_010448669.1|  PREDICTED: cation/H(+) antiporter 17-like          904   0.0      
ref|XP_010433872.1|  PREDICTED: cation/H(+) antiporter 17-like          903   0.0      
ref|NP_194101.1|  cation/H(+) antiporter 17                             903   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007131515.1|  hypothetical protein PHAVU_011G019400g             901   0.0      
emb|CDY69175.1|  BnaCnng62230D                                          899   0.0      
ref|XP_006413527.1|  hypothetical protein EUTSA_v10024412mg             899   0.0      
ref|XP_010433871.1|  PREDICTED: cation/H(+) antiporter 17               899   0.0      
ref|XP_009353458.1|  PREDICTED: cation/H(+) antiporter 19               899   0.0      
ref|XP_010999352.1|  PREDICTED: cation/H(+) antiporter 19-like          898   0.0      
ref|XP_008451981.1|  PREDICTED: cation/H(+) antiporter 18-like          897   0.0      
ref|XP_006406710.1|  hypothetical protein EUTSA_v10020094mg             897   0.0      
ref|XP_003543796.1|  PREDICTED: cation/H(+) antiporter 19-like          897   0.0      
ref|XP_006283122.1|  hypothetical protein CARUB_v10004144mg             896   0.0      
ref|XP_010439142.1|  PREDICTED: cation/H(+) antiporter 17-like          896   0.0      
ref|XP_009135538.1|  PREDICTED: cation/H(+) antiporter 19               896   0.0      
ref|XP_009137382.1|  PREDICTED: cation/H(+) antiporter 17-like          895   0.0      
emb|CDY67925.1|  BnaA03g58740D                                          895   0.0      
ref|XP_008369567.1|  PREDICTED: cation/H(+) antiporter 19-like          895   0.0      
emb|CDX82359.1|  BnaA03g34620D                                          894   0.0      
ref|XP_008390248.1|  PREDICTED: cation/H(+) antiporter 19               894   0.0      
ref|XP_009402107.1|  PREDICTED: cation/H(+) antiporter 19-like          892   0.0      
ref|XP_004298244.1|  PREDICTED: cation/H(+) antiporter 19-like          892   0.0      
ref|XP_009359907.1|  PREDICTED: cation/H(+) antiporter 19-like          891   0.0      
ref|XP_008776559.1|  PREDICTED: cation/H(+) antiporter 19-like          890   0.0      
ref|XP_002867692.1|  ATCHX17                                            890   0.0      
ref|XP_010505628.1|  PREDICTED: cation/H(+) antiporter 19-like          890   0.0      
emb|CDX94208.1|  BnaC07g38420D                                          889   0.0      
ref|XP_002314344.2|  hypothetical protein POPTR_0010s00740g             889   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011012790.1|  PREDICTED: cation/H(+) antiporter 19-like          887   0.0      
ref|XP_009383924.1|  PREDICTED: cation/H(+) antiporter 19-like          886   0.0      
ref|XP_002440851.1|  hypothetical protein SORBIDRAFT_09g008200          884   0.0      Sorghum bicolor [broomcorn]
ref|XP_008654236.1|  PREDICTED: uncharacterized protein LOC100191...    883   0.0      
ref|XP_003542393.1|  PREDICTED: cation/H(+) antiporter 19-like          880   0.0      
gb|KHN45029.1|  Cation/H(+) antiporter 19                               880   0.0      
ref|XP_006654211.1|  PREDICTED: cation/H(+) antiporter 19-like          880   0.0      
ref|NP_974866.1|  cation/H(+) antiporter 18                             880   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004505591.1|  PREDICTED: cation/H(+) antiporter 19-like          879   0.0      
gb|KEH32403.1|  cation/H+ exchanger 3                                   879   0.0      
ref|XP_008800286.1|  PREDICTED: cation/H(+) antiporter 19-like          878   0.0      
ref|XP_006478542.1|  PREDICTED: cation/H(+) antiporter 19-like          877   0.0      
ref|XP_006841531.1|  hypothetical protein AMTR_s00003p00155190          876   0.0      
ref|XP_003550583.1|  PREDICTED: cation/H(+) antiporter 19-like          876   0.0      
ref|XP_010909726.1|  PREDICTED: cation/H(+) antiporter 19               875   0.0      
ref|XP_009393134.1|  PREDICTED: cation/H(+) antiporter 19-like          874   0.0      
ref|XP_008222309.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    872   0.0      
gb|AES89643.2|  cation/H+ exchanger 3                                   870   0.0      
emb|CBI26043.3|  unnamed protein product                                867   0.0      
ref|XP_009402488.1|  PREDICTED: cation/H(+) antiporter 19-like          864   0.0      
ref|XP_009402780.1|  PREDICTED: cation/H(+) antiporter 19-like          863   0.0      
gb|KDO76396.1|  hypothetical protein CISIN_1g0036452mg                  861   0.0      
emb|CBI34425.3|  unnamed protein product                                862   0.0      
gb|KDO46881.1|  hypothetical protein CISIN_1g003517mg                   863   0.0      
ref|XP_006441942.1|  hypothetical protein CICLE_v10018885mg             863   0.0      
ref|XP_007154518.1|  hypothetical protein PHAVU_003G125300g             863   0.0      
gb|KHN17780.1|  Cation/H(+) antiporter 19                               862   0.0      
ref|NP_001055076.1|  Os05g0276100                                       861   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004508061.1|  PREDICTED: cation/H(+) antiporter 19-like          860   0.0      
ref|XP_010436413.1|  PREDICTED: cation/H(+) antiporter 17-like          857   0.0      
ref|XP_006841535.1|  hypothetical protein AMTR_s00003p00159310          848   0.0      
gb|KEH27421.1|  cation/H+ exchanger 3                                   837   0.0      
ref|XP_010436414.1|  PREDICTED: cation/H(+) antiporter 17-like          838   0.0      
ref|XP_004963208.1|  PREDICTED: cation/H(+) antiporter 19-like          834   0.0      
ref|NP_001067282.2|  Os12g0616500                                       832   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_011007076.1|  PREDICTED: cation/H(+) antiporter 19-like          826   0.0      
gb|KHN33866.1|  Cation/H(+) antiporter 19                               828   0.0      
gb|EEC69681.1|  hypothetical protein OsI_39126                          828   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006664208.1|  PREDICTED: cation/H(+) antiporter 19-like          827   0.0      
gb|KDO76397.1|  hypothetical protein CISIN_1g0036452mg                  819   0.0      
ref|XP_002442551.1|  hypothetical protein SORBIDRAFT_08g021730          823   0.0      Sorghum bicolor [broomcorn]
ref|XP_008662071.1|  PREDICTED: cation/H(+) antiporter 19-like          817   0.0      
dbj|BAJ98631.1|  predicted protein                                      811   0.0      
ref|XP_006664748.1|  PREDICTED: cation/H(+) antiporter 19-like          805   0.0      
tpg|DAA47524.1|  TPA: hypothetical protein ZEAMMB73_165935              806   0.0      
ref|XP_002463597.1|  hypothetical protein SORBIDRAFT_01g002640          799   0.0      Sorghum bicolor [broomcorn]
emb|CBI34422.3|  unnamed protein product                                786   0.0      
ref|XP_006846157.1|  hypothetical protein AMTR_s00012p00187890          788   0.0      
ref|NP_176599.2|  cation/H(+) antiporter 16                             784   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EMS54712.1|  Cation/H(+) antiporter 19                               782   0.0      
ref|XP_004981194.1|  PREDICTED: cation/H(+) antiporter 19-like          775   0.0      
gb|EAY92425.1|  hypothetical protein OsI_14159                          775   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001173696.1|  Os03g0828600                                       774   0.0      
gb|EMT05569.1|  K(+)/H(+) antiporter 13                                 771   0.0      
ref|XP_003607446.1|  K(+)/H(+) antiporter                               769   0.0      
ref|XP_002442550.1|  hypothetical protein SORBIDRAFT_08g021720          770   0.0      Sorghum bicolor [broomcorn]
ref|XP_010237010.1|  PREDICTED: cation/H(+) antiporter 19-like          768   0.0      
ref|XP_004963207.1|  PREDICTED: cation/H(+) antiporter 19-like is...    763   0.0      
ref|XP_002886359.1|  hypothetical protein ARALYDRAFT_315017             761   0.0      
ref|NP_001159300.1|  uncharacterized protein LOC100304392               759   0.0      Zea mays [maize]
ref|XP_003607437.1|  Cation proton exchanger                            769   0.0      
gb|EMT05571.1|  K(+)/H(+) antiporter 1                                  744   0.0      
ref|XP_010533612.1|  PREDICTED: cation/H(+) antiporter 16               739   0.0      
gb|EMS54713.1|  Cation/H(+) antiporter 19                               736   0.0      
ref|XP_001773370.1|  predicted protein                                  725   0.0      
gb|AAF24561.1|AC007764_3  F22C12.7                                      721   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_001770267.1|  predicted protein                                  712   0.0      
ref|XP_010227421.1|  PREDICTED: cation/H(+) antiporter 19-like          711   0.0      
gb|EEE53617.1|  hypothetical protein OsJ_36882                          711   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KFK36591.1|  hypothetical protein AALP_AA4G143600                    710   0.0      
emb|CBI34426.3|  unnamed protein product                                702   0.0      
ref|XP_006432183.1|  hypothetical protein CICLE_v10000276mg             693   0.0      
gb|KDO50743.1|  hypothetical protein CISIN_1g043446mg                   689   0.0      
emb|CDP09934.1|  unnamed protein product                                688   0.0      
gb|EYU30300.1|  hypothetical protein MIMGU_mgv1a026576mg                683   0.0      
ref|XP_010034375.1|  PREDICTED: cation/H(+) antiporter 15               685   0.0      
ref|XP_002269591.1|  PREDICTED: cation/H(+) antiporter 20               684   0.0      Vitis vinifera
ref|XP_010090834.1|  Cation/H(+) antiporter 15                          682   0.0      
ref|XP_010037849.1|  PREDICTED: cation/H(+) antiporter 20               682   0.0      
emb|CBI37527.3|  unnamed protein product                                680   0.0      
ref|XP_002974580.1|  hypothetical protein SELMODRAFT_102077             679   0.0      
gb|KFK34621.1|  hypothetical protein AALP_AA5G169800                    680   0.0      
ref|XP_008342861.1|  PREDICTED: cation/H(+) antiporter 15               680   0.0      
ref|XP_002963280.1|  hypothetical protein SELMODRAFT_80221              678   0.0      
ref|XP_007048418.1|  Cation/hydrogen exchanger 15                       678   0.0      
ref|XP_010260095.1|  PREDICTED: cation/H(+) antiporter 20               677   0.0      
ref|XP_009112897.1|  PREDICTED: cation/H(+) antiporter 16               675   0.0      
ref|XP_004147368.1|  PREDICTED: cation/H(+) antiporter 15-like          677   0.0      
ref|XP_002262677.2|  PREDICTED: cation/H(+) antiporter 15               677   0.0      Vitis vinifera
ref|XP_006409680.1|  hypothetical protein EUTSA_v10023201mg             676   0.0      
emb|CAN66285.1|  hypothetical protein VITISV_011183                     675   0.0      Vitis vinifera
ref|XP_008461025.1|  PREDICTED: cation/H(+) antiporter 15               674   0.0      
ref|XP_002970274.1|  hypothetical protein SELMODRAFT_231581             671   0.0      
ref|XP_006366744.1|  PREDICTED: cation/H(+) antiporter 15-like          672   0.0      
ref|XP_010273345.1|  PREDICTED: cation/H(+) antiporter 15-like          672   0.0      
emb|CBI30584.3|  unnamed protein product                                672   0.0      
emb|CAN63422.1|  hypothetical protein VITISV_023524                     672   0.0      Vitis vinifera
ref|XP_006299510.1|  hypothetical protein CARUB_v10015680mg             670   0.0      
ref|XP_006837063.1|  hypothetical protein AMTR_s00110p00080970          671   0.0      
ref|XP_006480781.1|  PREDICTED: cation/H(+) antiporter 20-like          669   0.0      
ref|NP_178985.1|  cation/H(+) antiporter 15                             668   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006429040.1|  hypothetical protein CICLE_v10011060mg             669   0.0      
ref|XP_010111492.1|  Cation/H(+) antiporter 20                          669   0.0      
ref|XP_009124800.1|  PREDICTED: cation/H(+) antiporter 15               667   0.0      
ref|XP_009616485.1|  PREDICTED: cation/H(+) antiporter 15-like          668   0.0      
ref|XP_010518406.1|  PREDICTED: cation/H(+) antiporter 15-like          666   0.0      
gb|KFK39941.1|  hypothetical protein AALP_AA3G309700                    664   0.0      
ref|XP_002877937.1|  cation/H+ exchanger                                665   0.0      
ref|XP_007213030.1|  hypothetical protein PRUPE_ppa023146mg             664   0.0      
ref|XP_002516306.1|  Na(+)/H(+) antiporter, putative                    664   0.0      Ricinus communis
ref|XP_002527747.1|  monovalent cation:proton antiporter, putative      664   0.0      Ricinus communis
ref|XP_009399874.1|  PREDICTED: cation/H(+) antiporter 20-like          664   0.0      
ref|XP_002310518.2|  hypothetical protein POPTR_0007s04230g             663   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009801607.1|  PREDICTED: cation/H(+) antiporter 15-like          663   0.0      
ref|XP_002883804.1|  hypothetical protein ARALYDRAFT_480314             662   0.0      
ref|XP_011020326.1|  PREDICTED: cation/H(+) antiporter 20               663   0.0      
gb|AAX49548.1|  cation/H+ exchanger                                     662   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011081225.1|  PREDICTED: cation/H(+) antiporter 15-like          662   0.0      
ref|NP_190940.1|  cation/H(+) antiporter 20                             662   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002308966.2|  hypothetical protein POPTR_0006s05340g             662   0.0      Populus trichocarpa [western balsam poplar]
gb|KGN54233.1|  hypothetical protein Csa_4G294410                       662   0.0      
ref|XP_008795058.1|  PREDICTED: cation/H(+) antiporter 20               662   0.0      
ref|XP_009112379.1|  PREDICTED: cation/H(+) antiporter 15               660   0.0      
ref|XP_004142208.1|  PREDICTED: cation/H(+) antiporter 20-like          662   0.0      
emb|CDX81450.1|  BnaC09g08610D                                          660   0.0      
emb|CDY47435.1|  BnaA08g29740D                                          660   0.0      
emb|CDY37213.1|  BnaA09g08340D                                          660   0.0      
ref|XP_010468568.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    659   0.0      
ref|XP_008447651.1|  PREDICTED: cation/H(+) antiporter 20               660   0.0      
ref|XP_003520628.2|  PREDICTED: cation/H(+) antiporter 20-like          659   0.0      
ref|XP_002978431.1|  hypothetical protein SELMODRAFT_50946              656   0.0      
ref|XP_010504142.1|  PREDICTED: cation/H(+) antiporter 20               658   0.0      
ref|XP_010515872.1|  PREDICTED: cation/H(+) antiporter 20-like          657   0.0      
gb|KDP39397.1|  hypothetical protein JCGZ_03679                         657   0.0      
ref|XP_010527098.1|  PREDICTED: cation/H(+) antiporter 15               655   0.0      
ref|XP_006290596.1|  hypothetical protein CARUB_v10016685mg             655   0.0      
ref|XP_003625495.1|  K(+)/H(+) antiporter                               656   0.0      
emb|CDY30847.1|  BnaC04g27020D                                          655   0.0      
ref|XP_010680215.1|  PREDICTED: cation/H(+) antiporter 15               655   0.0      
ref|XP_009103880.1|  PREDICTED: cation/H(+) antiporter 20-like          655   0.0      
ref|XP_010277628.1|  PREDICTED: cation/H(+) antiporter 15-like          654   0.0      
ref|XP_010427030.1|  PREDICTED: cation/H(+) antiporter 20-like          654   0.0      
ref|XP_011023089.1|  PREDICTED: cation/H(+) antiporter 15               653   0.0      
emb|CDX71162.1|  BnaC07g04410D                                          652   0.0      
ref|XP_006403661.1|  hypothetical protein EUTSA_v10010121mg             653   0.0      
emb|CDY07571.1|  BnaC06g14930D                                          652   0.0      
ref|XP_009776809.1|  PREDICTED: cation/H(+) antiporter 15-like          652   0.0      
emb|CDY34401.1|  BnaA09g11430D                                          647   0.0      
ref|XP_009595814.1|  PREDICTED: cation/H(+) antiporter 15-like is...    646   0.0      
ref|XP_007137799.1|  hypothetical protein PHAVU_009G156500g             645   0.0      
ref|XP_007162657.1|  hypothetical protein PHAVU_001G169300g             645   0.0      
ref|XP_008227634.1|  PREDICTED: cation/H(+) antiporter 15               645   0.0      
ref|XP_009139379.1|  PREDICTED: cation/H(+) antiporter 20               644   0.0      
emb|CDX78197.1|  BnaA09g33920D                                          641   0.0      
gb|EAY97346.1|  hypothetical protein OsI_19269                          631   0.0      
ref|XP_008648635.1|  PREDICTED: cation/H(+) antiporter 20               641   0.0      
ref|XP_008241256.1|  PREDICTED: cation/H(+) antiporter 20               641   0.0      
ref|XP_010678053.1|  PREDICTED: cation/H(+) antiporter 20               640   0.0      
ref|XP_006429043.1|  hypothetical protein CICLE_v10011096mg             638   0.0      
ref|XP_007208406.1|  hypothetical protein PRUPE_ppa001365mg             637   0.0      
ref|XP_006480783.1|  PREDICTED: cation/H(+) antiporter 20-like          635   0.0      
ref|NP_001054455.1|  Os05g0113300                                       636   0.0      
ref|XP_004486258.1|  PREDICTED: cation/H(+) antiporter 15-like          635   0.0      
ref|XP_003522484.1|  PREDICTED: cation/H(+) antiporter 15-like          633   0.0      
ref|XP_006429042.1|  hypothetical protein CICLE_v10011092mg             632   0.0      
gb|KDP35607.1|  hypothetical protein JCGZ_09045                         631   0.0      
ref|XP_002439158.1|  hypothetical protein SORBIDRAFT_09g001490          632   0.0      
ref|XP_009338768.1|  PREDICTED: cation/H(+) antiporter 20-like          630   0.0      
gb|KDP35609.1|  hypothetical protein JCGZ_09047                         628   0.0      
ref|XP_004960505.1|  PREDICTED: cation/H(+) antiporter 20-like          629   0.0      
ref|XP_011070107.1|  PREDICTED: cation/H(+) antiporter 15-like          628   0.0      
ref|XP_010529842.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    627   0.0      
ref|XP_004502946.1|  PREDICTED: cation/H(+) antiporter 15-like          636   0.0      
ref|XP_002527748.1|  conserved hypothetical protein                     623   0.0      
dbj|BAJ87099.1|  predicted protein                                      624   0.0      
ref|XP_008649801.1|  PREDICTED: cation/H(+) antiporter 15-like          625   0.0      
ref|XP_009406978.1|  PREDICTED: cation/H(+) antiporter 20-like          623   0.0      
ref|XP_003566598.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    623   0.0      
ref|XP_010490208.1|  PREDICTED: cation/H(+) antiporter 15-like          620   0.0      
ref|XP_003630280.1|  Cation proton exchanger                            621   0.0      
gb|KHN31156.1|  Cation/H(+) antiporter 15                               621   0.0      
ref|XP_002262680.2|  PREDICTED: cation/H(+) antiporter 20               622   0.0      
ref|XP_011077450.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    619   0.0      
ref|NP_001055872.1|  Os05g0485000                                       622   0.0      
ref|XP_003566124.1|  PREDICTED: cation/H(+) antiporter 15-like          620   0.0      
ref|XP_002441279.1|  hypothetical protein SORBIDRAFT_09g023730          620   0.0      
ref|XP_004503932.1|  PREDICTED: cation/H(+) antiporter 15-like          618   0.0      
ref|XP_006355520.1|  PREDICTED: cation/H(+) antiporter 15-like          618   0.0      
gb|EAY98474.1|  hypothetical protein OsI_20388                          620   0.0      
ref|XP_002527749.1|  monovalent cation:proton antiporter, putative      617   0.0      
ref|XP_008804682.1|  PREDICTED: cation/H(+) antiporter 15               620   0.0      
ref|XP_008657132.1|  PREDICTED: cation/H(+) antiporter 15-like          617   0.0      
ref|XP_002456534.1|  hypothetical protein SORBIDRAFT_03g038000          617   0.0      
ref|XP_004246149.1|  PREDICTED: cation/H(+) antiporter 15               615   0.0      
ref|XP_003602627.1|  Cation proton exchanger                            614   0.0      
gb|AES81712.2|  cation/H+ exchanger 3                                   612   0.0      
ref|XP_010277629.1|  PREDICTED: cation/H(+) antiporter 15-like          612   0.0      
gb|EYU18565.1|  hypothetical protein MIMGU_mgv1a022165mg                609   0.0      
ref|XP_003547128.2|  PREDICTED: cation/H(+) antiporter 15-like          610   0.0      
gb|EYU26575.1|  hypothetical protein MIMGU_mgv1a001541mg                608   0.0      
dbj|BAB62576.1|  Na+/H+ antiporter-like protein                         610   0.0      
gb|EAY76275.1|  hypothetical protein OsI_04210                          609   0.0      
ref|XP_007027071.1|  Cation/H+ exchanger 20 isoform 1                   601   0.0      
ref|XP_007027077.1|  Monovalent cation:proton antiporter, putative      607   0.0      
ref|XP_007208355.1|  hypothetical protein PRUPE_ppa001677mg             605   0.0      
ref|XP_008241268.1|  PREDICTED: cation/H(+) antiporter 20-like is...    604   0.0      
emb|CBI30585.3|  unnamed protein product                                603   0.0      
ref|XP_010923024.1|  PREDICTED: cation/H(+) antiporter 15               605   0.0      
ref|XP_003564480.1|  PREDICTED: cation/H(+) antiporter 15-like          605   0.0      
emb|CDM84725.1|  unnamed protein product                                603   0.0      
ref|XP_009338769.1|  PREDICTED: cation/H(+) antiporter 20-like is...    599   0.0      
ref|XP_009374674.1|  PREDICTED: cation/H(+) antiporter 20-like          602   0.0      
ref|XP_008366721.1|  PREDICTED: cation/H(+) antiporter 20-like          600   0.0      
gb|EEE62090.1|  hypothetical protein OsJ_16874                          596   0.0      
gb|EMS62572.1|  Cation/H(+) antiporter 15                               597   0.0      
dbj|BAK06977.1|  predicted protein                                      597   0.0      
ref|XP_008776558.1|  PREDICTED: cation/H(+) antiporter 20-like          593   0.0      
ref|XP_004972230.1|  PREDICTED: cation/H(+) antiporter 15-like          595   0.0      
ref|XP_009787989.1|  PREDICTED: cation/H(+) antiporter 20               591   0.0      
ref|XP_008369866.1|  PREDICTED: cation/H(+) antiporter 20               589   0.0      
ref|XP_010322904.1|  PREDICTED: cation/H(+) antiporter 15-like          588   0.0      
ref|XP_007148262.1|  hypothetical protein PHAVU_006G193500g             589   0.0      
ref|XP_008345449.1|  PREDICTED: cation/H(+) antiporter 20-like          586   0.0      
gb|EYU24742.1|  hypothetical protein MIMGU_mgv1a026419mg                587   0.0      
ref|XP_010907062.1|  PREDICTED: cation/H(+) antiporter 20               586   0.0      
ref|XP_010433870.1|  PREDICTED: cation/H(+) antiporter 17-like          575   0.0      
gb|KEH36491.1|  cation/H+ exchanger 3                                   584   0.0      
ref|XP_004302732.1|  PREDICTED: cation/H(+) antiporter 20-like          579   0.0      
gb|EPS59894.1|  hypothetical protein M569_14908                         578   0.0      
gb|EPS60468.1|  hypothetical protein M569_14334                         578   0.0      
ref|XP_009611526.1|  PREDICTED: cation/H(+) antiporter 20               578   0.0      
ref|XP_003625497.1|  K(+)/H(+) antiporter                               576   0.0      
ref|XP_006341222.1|  PREDICTED: cation/H(+) antiporter 20-like          575   0.0      
ref|XP_010528361.1|  PREDICTED: cation/H(+) antiporter 20-like          574   0.0      
ref|XP_009391148.1|  PREDICTED: cation/H(+) antiporter 15               575   0.0      
ref|XP_010037850.1|  PREDICTED: cation/H(+) antiporter 20-like          574   0.0      
gb|AIG92838.1|  CHX1                                                    573   0.0      
ref|XP_003520629.1|  PREDICTED: cation/H(+) antiporter 20-like          572   0.0      
ref|XP_008241276.1|  PREDICTED: cation/H(+) antiporter 20-like is...    569   0.0      
dbj|BAK03649.1|  predicted protein                                      573   0.0      
gb|EMS52978.1|  Cation/H(+) antiporter 15                               570   0.0      
ref|XP_009338770.1|  PREDICTED: cation/H(+) antiporter 20-like is...    562   0.0      
emb|CDP05548.1|  unnamed protein product                                566   0.0      
ref|XP_004246412.1|  PREDICTED: cation/H(+) antiporter 20               563   0.0      
ref|XP_010999354.1|  PREDICTED: cation/H(+) antiporter 19-like          558   0.0      
gb|KEH23991.1|  cation/H+ exchanger 3                                   556   0.0      
ref|XP_009595815.1|  PREDICTED: cation/H(+) antiporter 15-like is...    555   0.0      
ref|XP_003542459.1|  PREDICTED: cation/H(+) antiporter 20-like          558   0.0      
ref|XP_010111493.1|  Cation/H(+) antiporter 20                          559   0.0      
ref|XP_006388233.1|  hypothetical protein POPTR_0271s00200g             540   4e-180   
gb|AFW82335.1|  hypothetical protein ZEAMMB73_343625                    558   7e-180   
ref|XP_009338771.1|  PREDICTED: cation/H(+) antiporter 20-like is...    548   2e-179   
dbj|BAJ85710.1|  predicted protein                                      546   2e-178   
ref|XP_010273236.1|  PREDICTED: cation/H(+) antiporter 15-like          545   1e-177   
ref|XP_007159847.1|  hypothetical protein PHAVU_002G272700g             545   1e-176   
ref|XP_006846040.1|  hypothetical protein AMTR_s00012p00029570          544   1e-175   
ref|XP_004168295.1|  PREDICTED: cation/H(+) antiporter 20-like          526   7e-173   
gb|KHN33638.1|  Cation/H(+) antiporter 15                               528   4e-171   
ref|XP_003524307.1|  PREDICTED: cation/H(+) antiporter 15-like          522   1e-167   
emb|CDY25564.1|  BnaC09g11890D                                          513   5e-167   
gb|AAS75243.2|  putative Na+/H+ antiporter                              514   1e-166   
ref|NP_001130342.1|  uncharacterized protein LOC100191437               504   9e-166   
ref|XP_010512999.1|  PREDICTED: cation/H(+) antiporter 20-like          514   1e-165   
ref|XP_010412915.1|  PREDICTED: cation/H(+) antiporter 20-like          513   3e-165   
ref|XP_006410943.1|  hypothetical protein EUTSA_v10016301mg             513   5e-165   
gb|EMS63173.1|  Cation/H(+) antiporter 15                               508   6e-163   
emb|CDY71641.1|  BnaCnng73770D                                          497   2e-161   
ref|XP_009144111.1|  PREDICTED: cation/H(+) antiporter 20-like          500   2e-160   
ref|XP_010487651.1|  PREDICTED: cation/H(+) antiporter 19-like          482   1e-157   
ref|XP_006646431.1|  PREDICTED: cation/H(+) antiporter 15-like          504   2e-155   
ref|XP_010931514.1|  PREDICTED: cation/H(+) antiporter 15-like          485   3e-153   
ref|XP_008804681.1|  PREDICTED: cation/H(+) antiporter 15-like          474   5e-149   
ref|XP_009117167.1|  PREDICTED: cation/H(+) antiporter 20-like          456   1e-146   
gb|KHN34084.1|  Cation/H(+) antiporter 15                               460   7e-145   
ref|XP_011096534.1|  PREDICTED: cation/H(+) antiporter 15-like          462   1e-144   
ref|XP_004494000.1|  PREDICTED: cation/H(+) antiporter 20-like          457   4e-143   
ref|XP_009420052.1|  PREDICTED: cation/H(+) antiporter 15-like          451   1e-141   
ref|XP_009413172.1|  PREDICTED: cation/H(+) antiporter 15-like          454   3e-141   
ref|XP_008784477.1|  PREDICTED: cation/H(+) antiporter 15-like          449   2e-140   
ref|XP_009402776.1|  PREDICTED: cation/H(+) antiporter 15-like          449   9e-140   
ref|XP_009383032.1|  PREDICTED: cation/H(+) antiporter 15-like          447   9e-139   
ref|XP_010921563.1|  PREDICTED: cation/H(+) antiporter 15-like          447   1e-138   
emb|CDO99423.1|  unnamed protein product                                444   1e-137   
ref|XP_008782791.1|  PREDICTED: cation/H(+) antiporter 15-like          444   4e-137   
ref|NP_001044623.2|  Os01g0817400                                       433   6e-137   
gb|EAZ29140.1|  hypothetical protein OsJ_13203                          437   2e-136   
emb|CBI30847.3|  unnamed protein product                                439   2e-135   
ref|XP_010655643.1|  PREDICTED: cation/H(+) antiporter 15-like          438   3e-135   
ref|XP_009416716.1|  PREDICTED: cation/H(+) antiporter 15-like          436   8e-135   
ref|XP_011082524.1|  PREDICTED: cation/H(+) antiporter 15-like          433   9e-134   
gb|EYU33342.1|  hypothetical protein MIMGU_mgv1a001430mg                432   4e-133   
ref|XP_010424311.1|  PREDICTED: cation/H(+) antiporter 15-like          420   6e-133   
gb|EMT30539.1|  K(+)/H(+) antiporter 13                                 419   5e-132   
ref|XP_010931502.1|  PREDICTED: cation/H(+) antiporter 15-like          427   9e-132   
ref|XP_010436415.1|  PREDICTED: cation/H(+) antiporter 17-like          416   1e-131   
ref|XP_004244795.1|  PREDICTED: cation/H(+) antiporter 15-like          427   3e-131   
ref|XP_004146404.1|  PREDICTED: cation/H(+) antiporter 15-like          428   4e-131   
gb|KGN54815.1|  hypothetical protein Csa_4G507450                       427   5e-131   
gb|KDO78131.1|  hypothetical protein CISIN_1g040629mg                   420   3e-129   
ref|XP_011041839.1|  PREDICTED: cation/H(+) antiporter 15-like          421   3e-129   
ref|XP_007025120.1|  Cation proton exchanger, putative                  420   2e-128   
ref|XP_006366098.1|  PREDICTED: cation/H(+) antiporter 15-like          419   2e-128   
ref|XP_010932717.1|  PREDICTED: cation/H(+) antiporter 15-like          419   2e-128   
ref|XP_010257007.1|  PREDICTED: cation/H(+) antiporter 15-like          420   4e-128   
ref|XP_010251667.1|  PREDICTED: cation/H(+) antiporter 15-like          417   8e-128   
ref|XP_009773648.1|  PREDICTED: cation/H(+) antiporter 15-like          417   1e-127   
ref|XP_008793392.1|  PREDICTED: cation/H(+) antiporter 15-like          413   7e-127   
ref|XP_010058865.1|  PREDICTED: cation/H(+) antiporter 15-like          412   6e-126   
dbj|BAK06259.1|  predicted protein                                      412   2e-125   
ref|XP_010650846.1|  PREDICTED: cation/H(+) antiporter 15-like is...    410   2e-125   
ref|XP_006449661.1|  hypothetical protein CICLE_v10014327mg             409   5e-125   
ref|XP_002277533.2|  PREDICTED: cation/H(+) antiporter 15-like is...    409   7e-125   
ref|XP_009627829.1|  PREDICTED: cation/H(+) antiporter 15-like is...    410   9e-125   
ref|XP_004156031.1|  PREDICTED: cation/H(+) antiporter 15-like          410   1e-124   
emb|CDX73532.1|  BnaC08g24710D                                          399   5e-124   
ref|XP_004978339.1|  PREDICTED: cation/H(+) antiporter 15-like          407   7e-124   
gb|EYU45688.1|  hypothetical protein MIMGU_mgv1a001564mg                406   8e-124   
ref|XP_002519710.1|  Na(+)/H(+) antiporter, putative                    407   2e-123   
ref|XP_002326092.2|  hypothetical protein POPTR_0019s14470g             405   3e-123   
ref|XP_006447579.1|  hypothetical protein CICLE_v10017901mg             406   4e-123   
gb|KDO43692.1|  hypothetical protein CISIN_1g036676mg                   392   4e-123   
ref|XP_002309885.2|  cation/hydrogen exchanger family protein           405   6e-123   
ref|XP_008442278.1|  PREDICTED: cation/H(+) antiporter 15-like          402   2e-122   
ref|XP_011023015.1|  PREDICTED: cation/H(+) antiporter 15-like          404   2e-122   
ref|XP_006855460.1|  hypothetical protein AMTR_s00057p00181590          402   3e-122   
gb|KDP37950.1|  hypothetical protein JCGZ_04593                         403   4e-122   
ref|XP_008792255.1|  PREDICTED: cation/H(+) antiporter 15               402   4e-122   
emb|CBI15866.3|  unnamed protein product                                409   2e-120   
ref|XP_011080835.1|  PREDICTED: cation/H(+) antiporter 15-like          397   2e-120   
ref|XP_007052425.1|  Cation proton exchanger                            398   2e-120   
ref|XP_011012847.1|  PREDICTED: cation/H(+) antiporter 15-like          397   9e-120   
ref|XP_002520098.1|  monovalent cation:proton antiporter, putative      397   1e-119   
ref|XP_008669922.1|  PREDICTED: cation/H(+) antiporter 15-like          396   2e-119   
ref|XP_002305995.2|  hypothetical protein POPTR_0004s13620g             392   7e-119   
gb|EPS59090.1|  hypothetical protein M569_15718                         392   9e-119   
ref|XP_003577121.1|  PREDICTED: cation/H(+) antiporter 15-like          393   3e-118   
ref|XP_006654535.1|  PREDICTED: cation/H(+) antiporter 15-like          392   3e-118   
ref|XP_010911264.1|  PREDICTED: cation/H(+) antiporter 20-like          376   2e-117   
ref|NP_001066026.1|  Os12g0121600                                       390   3e-117   
ref|XP_006654915.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    384   5e-117   
emb|CDY70299.1|  BnaA07g37760D                                          375   8e-117   
ref|XP_004231538.1|  PREDICTED: cation/H(+) antiporter 15-like is...    386   3e-116   
emb|CDP06345.1|  unnamed protein product                                387   4e-116   
emb|CDP09259.1|  unnamed protein product                                396   5e-116   
ref|XP_010650847.1|  PREDICTED: cation/H(+) antiporter 15-like is...    383   6e-116   
ref|XP_010099439.1|  Cation/H(+) antiporter 15                          385   6e-116   
gb|ABA91259.1|  Sodium/hydrogen exchanger family protein                385   1e-115   
ref|XP_002448912.1|  hypothetical protein SORBIDRAFT_05g001490          386   1e-115   



>ref|XP_009766374.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana sylvestris]
 ref|XP_009766375.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana sylvestris]
Length=802

 Score =  1195 bits (3091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/804 (80%), Positives = 717/804 (89%), Gaps = 6/804 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M S   + CP PMKATSNG FQGD+PLDYALPL IVQICLV++LTRVLAYLLRPLRQPRV
Sbjct  1     MASTSPMKCPPPMKATSNGVFQGDNPLDYALPLAIVQICLVLVLTRVLAYLLRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GGVLLGPSA GR+E YL+AIFP +SLTVLDTLA+ GLLFFLFLVGLELDP+SLRR
Sbjct  61    IAEIVGGVLLGPSALGRNEKYLHAIFPSRSLTVLDTLANFGLLFFLFLVGLELDPRSLRR  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIALAGIS+PF LGIGTSF+LR TIAKGVSQGPFLVFMGVALSITAFPVLARIL
Sbjct  121   TGKKALSIALAGISVPFALGIGTSFVLRGTIAKGVSQGPFLVFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSGTGHSPL+SLWVLLCGTGFVLLCI
Sbjct  181   AELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGTGHSPLVSLWVLLCGTGFVLLCI  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              + P IFKWMA RCS+GEPV+E+Y+CA LAAVL AGFVTDTIGIHALFGAFV+GVLVPK+
Sbjct  241   FIGPPIFKWMAKRCSQGEPVNELYICATLAAVLAAGFVTDTIGIHALFGAFVLGVLVPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP + ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKI+GT
Sbjct  301   GPFSGALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIVGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             I+VS LC++P QEA+TLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT
Sbjct  361   IVVSLLCKMPVQEAVTLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  420

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             TPIV+++YKPAKLA+TEYK RTI+RKD +KQLRILTCFHS +NIP++INLIEASRGTEK 
Sbjct  421   TPIVVSVYKPAKLAITEYKNRTIERKDTNKQLRILTCFHSSKNIPTMINLIEASRGTEKK  480

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
              G +VYAMHLMELSERSSAILM HKARKNGLPFW  +GE +DS +IVVAFETFE LSKVS
Sbjct  481   EGLRVYAMHLMELSERSSAILMVHKARKNGLPFWK-KGEVSDSNQIVVAFETFEQLSKVS  539

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             IRP+TAIS M+SMHEDIIASAE KR AMIILPFHKHQ+IDGH ETTR +LRHVNRRVL+ 
Sbjct  540   IRPTTAISPMNSMHEDIIASAERKRAAMIILPFHKHQRIDGHLETTRADLRHVNRRVLQH  599

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             APCSVGILVDRGLGG SHVSASNVD+ +T+L+FGG+DDREALAYG R+ EHPGI LVV R
Sbjct  600   APCSVGILVDRGLGGASHVSASNVDFKVTILFFGGYDDREALAYGTRIAEHPGINLVVVR  659

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAET  499
             F LDPE AG    + +    + SPE  S+DE+ L   K + S N S+KYEEK VK  A T
Sbjct  660   FVLDPEVAGK--SVKLDMDQTYSPEVHSKDEELLIDLKHKISKNGSIKYEEKTVKDVAGT  717

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             +E+IR Y+RCNL +VGRM EG++VAA+DKK +CPELGPLGNLL+C EFSTTASVLVVQQY
Sbjct  718   IESIRSYSRCNLFLVGRMSEGQVVAALDKKSDCPELGPLGNLLTCPEFSTTASVLVVQQY  777

Query  318   RTELSK---NGLKEDDSVDGDYES  256
             R+ELS+   N LK+ +  +GD +S
Sbjct  778   RSELSQDSINSLKDGELTEGDNDS  801



>ref|XP_009620181.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
 ref|XP_009620183.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
 ref|XP_009620184.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
 ref|XP_009620185.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
Length=802

 Score =  1189 bits (3075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 643/804 (80%), Positives = 714/804 (89%), Gaps = 6/804 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M S   + CP PMKATSNG FQGD+PLDYALPL IVQICLV++LTRVLAYLLRPLRQPRV
Sbjct  1     MASTLPMKCPPPMKATSNGVFQGDNPLDYALPLAIVQICLVLVLTRVLAYLLRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GGV+LGPSA GR+  YL+AIFP +SLTVLDTLA+ GLLFFLFLVGLELDP+SLRR
Sbjct  61    IAEIVGGVILGPSALGRNAKYLHAIFPSRSLTVLDTLANFGLLFFLFLVGLELDPRSLRR  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIALAGIS+PF LGIGTSF+LR TI KGVSQGPFLVFMGVALSITAFPVLARIL
Sbjct  121   TGKKALSIALAGISVPFALGIGTSFVLRGTIGKGVSQGPFLVFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSGTGHSPL+SLWVLLCGTGFVLLCI
Sbjct  181   AELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGTGHSPLVSLWVLLCGTGFVLLCI  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              + P IFKWMA RCS+GEPV+E+Y+CA LAAVL AGFVTDTIGIHALFGAFV+GVLVPK+
Sbjct  241   FICPPIFKWMAKRCSQGEPVNELYICATLAAVLAAGFVTDTIGIHALFGAFVLGVLVPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP + ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKI+GT
Sbjct  301   GPFSGALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIVGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             I+VS +C++P QEA+TLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT
Sbjct  361   IVVSLMCKMPVQEAVTLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  420

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             TPIV+++YKPAKLA+TEYK RTI+RKD SKQLRILTCFHS +NIP++INLIEASRGTEK 
Sbjct  421   TPIVVSVYKPAKLAITEYKNRTIERKDTSKQLRILTCFHSTKNIPTMINLIEASRGTEKK  480

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
              G  VYAMHLMELSERSSAILM HKARKNGLPFW  +GE +DS +IVVAFETFE LSKVS
Sbjct  481   EGLCVYAMHLMELSERSSAILMVHKARKNGLPFWK-KGEVSDSNQIVVAFETFEQLSKVS  539

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             IRP+TAIS M+SMHEDIIASAE KRVAMIILPFHKHQ+IDGH ETTR +LRHVNRRVL+ 
Sbjct  540   IRPTTAISPMNSMHEDIIASAERKRVAMIILPFHKHQRIDGHLETTRADLRHVNRRVLQH  599

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             APCSVGILVDRGLGG SHVSASNVD+ +TVL+FGG+DDREALAYG R+ EHPGI LVV R
Sbjct  600   APCSVGILVDRGLGGASHVSASNVDFKVTVLFFGGYDDREALAYGTRIAEHPGINLVVVR  659

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAET  499
             F LDPE  G    + +    + SPE  S+DE+ L   K + S N SVKYEEK VK  A T
Sbjct  660   FVLDPEVVGK--SVKLDMEQTYSPEANSKDEELLIDLKHKISKNGSVKYEEKTVKDVAGT  717

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             +E+IR Y+RCNL +VGRM EG++VAA+DKK +CPELGPLGNLL+C EFSTTASVLVVQQY
Sbjct  718   IESIRSYSRCNLFLVGRMSEGQVVAALDKKSDCPELGPLGNLLTCPEFSTTASVLVVQQY  777

Query  318   RTELSK---NGLKEDDSVDGDYES  256
             R+ELS+   N LK+ +  +GD +S
Sbjct  778   RSELSQDSINSLKDGELTEGDNDS  801



>ref|XP_004245552.1| PREDICTED: cation/H(+) antiporter 18-like isoform X1 [Solanum 
lycopersicum]
Length=802

 Score =  1183 bits (3060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 636/804 (79%), Positives = 720/804 (90%), Gaps = 6/804 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M SNG++ CP+PMKA SNG FQGD+PLDYALPL IVQICLV++LTR+LAY+LRPLRQPRV
Sbjct  1     MASNGSMKCPSPMKAASNGVFQGDNPLDYALPLAIVQICLVLVLTRLLAYILRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GGVLLGPSA GR++ YL+AIFP KSLTVLDTLA+ GLLFFLFLVGLELDPKSLRR
Sbjct  61    IAEIVGGVLLGPSALGRNQKYLHAIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRR  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIALAGIS+PF LGIGTSF+LRAT+++GV+QGPFL+FMGVALSITAFPVLARIL
Sbjct  121   TGKKALSIALAGISVPFALGIGTSFVLRATVSQGVNQGPFLIFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSG G SP+ISLWVLLCGTGFVLLCI
Sbjct  181   AELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGVGRSPVISLWVLLCGTGFVLLCI  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
             L+ PRIFKWMA RCSEGEPVDE YVCA LAAVL A FVTD IGIHALFGAFV+GVLVPK+
Sbjct  241   LIAPRIFKWMARRCSEGEPVDEKYVCATLAAVLAASFVTDMIGIHALFGAFVLGVLVPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP A ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVI TACFGKI+GT
Sbjct  301   GPFAGALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIVTACFGKIVGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             I+VS LC++P QEA+TLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT
Sbjct  361   IVVSLLCKLPTQEAVTLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  420

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             TPIVI++YKPAKLAVT+YK+RTIQRK+ SKQLRIL CFHS RNIP+++NLIE SRG EK 
Sbjct  421   TPIVISVYKPAKLAVTKYKHRTIQRKNTSKQLRILACFHSSRNIPAMLNLIEVSRGIEKR  480

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
              G +VYAMHLMELSERSSAILM HKA+KNGLPFWNT  +  DS +IVVAF+TF +LSKVS
Sbjct  481   EGLRVYAMHLMELSERSSAILMVHKAKKNGLPFWNTE-QVQDSNQIVVAFDTFSNLSKVS  539

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             IRP+TAIS M+SMHEDI+ASAE KRVAMIILPFHKH ++DGH ETTR ELRHVNRRVL+ 
Sbjct  540   IRPTTAISPMNSMHEDIVASAERKRVAMIILPFHKHPRLDGHLETTRGELRHVNRRVLQH  599

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             APCSVGILVDRGLGG SHVS+SNVD+++T L+FGGHDDREALAYG R+ EHPGI L+V R
Sbjct  600   APCSVGILVDRGLGGASHVSSSNVDFSVTALFFGGHDDREALAYGVRIAEHPGISLIVVR  659

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAET  499
             F +DPE +GT   + V  +  ++PE +S DE+FLA  KQ++ST+ S+K+EE++VK A  T
Sbjct  660   FIVDPEISGT--SVKVEMNDKTNPEAQSDDEEFLADVKQKSSTDGSIKFEERIVKDARGT  717

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             +EAIR YNRCNL +VGRMPEG++V A+DKK +CPELG LGNLL+  EFSTTASVLVVQQY
Sbjct  718   IEAIREYNRCNLYLVGRMPEGQVVVALDKKSDCPELGSLGNLLTSPEFSTTASVLVVQQY  777

Query  318   RTEL---SKNGLKEDDSVDGDYES  256
             R++L   S + LKE +S DGD +S
Sbjct  778   RSQLPEESLSSLKEGESSDGDCDS  801



>ref|XP_009586863.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
 ref|XP_009586864.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
Length=803

 Score =  1178 bits (3048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/805 (79%), Positives = 714/805 (89%), Gaps = 7/805 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M SN TV CP PMKATSNG FQGD+PLDYALPL IVQICLV++LTRVLAYLLRPLRQPRV
Sbjct  1     MASNVTVKCPTPMKATSNGVFQGDNPLDYALPLAIVQICLVLVLTRVLAYLLRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GGVLLGPSA GR+E YL AIFP KSLTVLDTLA+ GLLFFLFLVGLELDPKSLRR
Sbjct  61    IAEIVGGVLLGPSALGRNEKYLQAIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRR  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIALAGIS+PF LGIGTS +LRATI++GV+QGPFL+FMGVALSITAFPVLARIL
Sbjct  121   TGKKALSIALAGISVPFALGIGTSIVLRATISQGVNQGPFLIFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSG G SPLISLWVLLCGTGFVLLCI
Sbjct  181   AELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGVGRSPLISLWVLLCGTGFVLLCI  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
             L+ PRIFKWMA RCSEGEPVDE YVCA LAAVL AGFVTDTIGIHALFGAFV+GVLVPK+
Sbjct  241   LIAPRIFKWMARRCSEGEPVDEKYVCATLAAVLAAGFVTDTIGIHALFGAFVLGVLVPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP A ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVI TACFGKI+GT
Sbjct  301   GPFAGALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIVTACFGKIVGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             I+VS LC++P QEA+TLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT
Sbjct  361   IVVSLLCKLPVQEAVTLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  420

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             TPIVI++YKPAKLAVT YK+RTI+RK+ SKQLRILTCFHS RNIP+++NLIE SRG EK 
Sbjct  421   TPIVISVYKPAKLAVTAYKHRTIERKNTSKQLRILTCFHSTRNIPTMLNLIEVSRGIEKR  480

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
              G +VYAMHL ELSERSSAILM HKA+KNGLPFWNT  +  DS +IVVAFETF+HLSKVS
Sbjct  481   EGLRVYAMHLTELSERSSAILMVHKAKKNGLPFWNTE-QVQDSNQIVVAFETFQHLSKVS  539

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             IRP+TAIS M+SMHEDI+ SAE KRVAMIILPFHKH ++DGH ETTR +LRHVNRRVL+ 
Sbjct  540   IRPTTAISPMNSMHEDIVTSAERKRVAMIILPFHKHPRLDGHLETTRGDLRHVNRRVLQH  599

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             APCSVGILVDRGLGG SH+ +SNVD++ITVL+FGGHDDREALAYG R+ EHPGI LVV R
Sbjct  600   APCSVGILVDRGLGGASHIPSSNVDFSITVLFFGGHDDREALAYGVRIAEHPGISLVVVR  659

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAET  499
             FT+DPE  G+   + +  + +S+PE +S DE++LA  K ++S + S+K+EE+ VK A  T
Sbjct  660   FTVDPEVTGS--SVKIEMNDNSTPEARSEDEEYLADVKHKSSMDGSIKFEERTVKDARGT  717

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             +EAIR YN CNL +VGRMPEG++V A+DK+ +CPELG LGNLL+  EFSTTASVLVVQQY
Sbjct  718   IEAIREYNCCNLFLVGRMPEGQLVLALDKRSDCPELGSLGNLLTSPEFSTTASVLVVQQY  777

Query  318   RTELSKNGL----KEDDSVDGDYES  256
             R++L +  L    +E +S DGDY S
Sbjct  778   RSQLPRESLSSLKEEGESTDGDYNS  802



>ref|XP_009765985.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana sylvestris]
Length=803

 Score =  1176 bits (3042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/805 (79%), Positives = 715/805 (89%), Gaps = 7/805 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +N T+ CP PMKATSNG FQGD+PLDYALPL IVQICLV++LTRVLAYLLRPLRQPRV
Sbjct  1     MATNVTMKCPTPMKATSNGVFQGDNPLDYALPLAIVQICLVLVLTRVLAYLLRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GGVLLGPSA GR+E YL AIFP KSLTVLDTLA+ GLLFFLFLVGLELDPKSLRR
Sbjct  61    IAEIVGGVLLGPSALGRNEKYLQAIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRR  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIALAGIS+PF LGIGTSF+LRATI++GV+QGPFL+FMGVALSITAFPVLARIL
Sbjct  121   TGKKALSIALAGISVPFALGIGTSFVLRATISQGVNQGPFLIFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSG G SPLISLWVLLCGTGFVLLCI
Sbjct  181   AELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGVGRSPLISLWVLLCGTGFVLLCI  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
             L+ PRIFKWMA RCS+GEPVDE YVCA LAAVL AGFVTDTIGIHALFGAFV+GVLVPK+
Sbjct  241   LIAPRIFKWMARRCSDGEPVDEKYVCATLAAVLAAGFVTDTIGIHALFGAFVLGVLVPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP A ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVI TACFGKI+GT
Sbjct  301   GPFAGALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIVTACFGKIVGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             I+VS LC++P QEA+TLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT
Sbjct  361   IVVSLLCKLPVQEAVTLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  420

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             TPIVI++YKPAKLAVT YK+RTI+RK+ SKQLRILTCFHS RNIP+++NLIE SRG EK 
Sbjct  421   TPIVISVYKPAKLAVTAYKHRTIERKNTSKQLRILTCFHSTRNIPTMLNLIEVSRGIEKR  480

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
              G +VYAMHLMELSERSSAILM HKA+KNGLPFWNT  +  DS +IVVAFETF+HLSKVS
Sbjct  481   EGLRVYAMHLMELSERSSAILMVHKAKKNGLPFWNTE-QAQDSNQIVVAFETFQHLSKVS  539

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             IRP+TAIS M+SMHEDI+ SAE KRVAMIILPFHK+ ++DGH ETTR +LRHVNRRVL+ 
Sbjct  540   IRPTTAISPMNSMHEDIVTSAERKRVAMIILPFHKYPRLDGHLETTRGDLRHVNRRVLQH  599

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             APCSVGILVDRGLGG SH+ +SNVD++ITVL+FGGHDDREALAYG R+ EHPGI LVV R
Sbjct  600   APCSVGILVDRGLGGASHIPSSNVDFSITVLFFGGHDDREALAYGVRIAEHPGISLVVVR  659

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAET  499
             FT+DPE  G+   + +  + +S+PE +S DE++LA  K ++S + S+K+EE+ VK A  T
Sbjct  660   FTVDPEVTGS--SVKIEMNDNSTPEARSEDEEYLADVKHKSSMDGSIKFEERTVKDARGT  717

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             +E I  YNRCNL +VGRMPEG++V A+DK+ +CPELG +GNLL+  EFSTTASVLVVQQY
Sbjct  718   IEVISEYNRCNLFLVGRMPEGQLVLALDKRSDCPELGSVGNLLTSPEFSTTASVLVVQQY  777

Query  318   RTELSKNGL----KEDDSVDGDYES  256
             R++L +  L    +E +S DGDY S
Sbjct  778   RSQLPRESLSSLKEEGESTDGDYNS  802



>ref|XP_009802616.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana sylvestris]
Length=801

 Score =  1170 bits (3027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/773 (82%), Positives = 698/773 (90%), Gaps = 4/773 (1%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CP PMKATSNG FQGD PLDYALPL IVQICLV++LTRVLAYLLRPLRQPRV+AEIIGG+
Sbjct  10    CPPPMKATSNGVFQGDDPLDYALPLAIVQICLVLVLTRVLAYLLRPLRQPRVVAEIIGGI  69

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GR+E YL+ IFP KSLTVLDTLA+ GLLFFLFLVGLELDPKSLRRTGKKAL I
Sbjct  70    LLGPSALGRNEKYLHTIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRRTGKKALCI  129

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             A+AGISLPF LGIGTSF LRATI+KGV+QGPFLVFMGVALSITAFPVLARILAELKLLTT
Sbjct  130   AVAGISLPFVLGIGTSFALRATISKGVNQGPFLVFMGVALSITAFPVLARILAELKLLTT  189

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             DVG+MAMSAAAVNDVAAWILLALAIALSGT  SPLISLWVLLCG GFV+LCI + P IFK
Sbjct  190   DVGRMAMSAAAVNDVAAWILLALAIALSGTTSSPLISLWVLLCGAGFVILCIFIGPPIFK  249

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             WMA RCS+GE VDEIYVCA LAAVL AGFVTDTIGIHALFGAFV+GVLVPK+GP A ALV
Sbjct  250   WMARRCSDGEHVDEIYVCATLAAVLAAGFVTDTIGIHALFGAFVLGVLVPKEGPFAGALV  309

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFT+CFGKI+GTI+VS LC+
Sbjct  310   EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTSCFGKIVGTIVVSLLCK  369

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +P QEA+TLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI++Y
Sbjct  370   MPMQEALTLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVISIY  429

Query  1374  KPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAM  1195
             KPAKLAVTEYK+RTI+RKD SKQ+R+LTCF+S RNIP+LINLIE SRGTEK  G +VYAM
Sbjct  430   KPAKLAVTEYKHRTIERKDTSKQVRMLTCFYSTRNIPTLINLIEVSRGTEKREGLRVYAM  489

Query  1194  HLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAIS  1015
             HLMELSERSSAILM HK ++NGLPFWN +GE TDS ++VVAFETFEHLSKVSIRP+TAIS
Sbjct  490   HLMELSERSSAILMVHKVKRNGLPFWN-KGEVTDSNQVVVAFETFEHLSKVSIRPTTAIS  548

Query  1014  AMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGIL  835
              M+SMHEDII SAE KRVAMIILPFHKHQ++DGHFETTR +LRHVNRRVL+ APCSVGIL
Sbjct  549   PMNSMHEDIITSAERKRVAMIILPFHKHQRLDGHFETTRTDLRHVNRRVLQHAPCSVGIL  608

Query  834   VDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETA  655
             VDRGLGG SHVSASNVD+TIT+L+FGGHDDREALAYG RM EHPG+ L+V RF +DPE A
Sbjct  609   VDRGLGGASHVSASNVDFTITILFFGGHDDREALAYGVRMAEHPGVTLIVVRFVVDPEVA  668

Query  654   GTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGYN  475
             G SVK+D++ + S   +    DE  L+  KQR S + S+KYEE+ +K AAET EAI+ YN
Sbjct  669   GGSVKIDMNQNSSLEAQP---DEVLLSGLKQRISKDGSIKYEERTIKDAAETFEAIKTYN  725

Query  474   RCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYR  316
             RCNL +VGRMPEG++VAA++KK ECPELGP+GNLL   EFSTTASVLVVQQYR
Sbjct  726   RCNLFLVGRMPEGQVVAALNKKSECPELGPIGNLLISSEFSTTASVLVVQQYR  778



>ref|XP_006343907.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum tuberosum]
Length=790

 Score =  1162 bits (3007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 628/792 (79%), Positives = 706/792 (89%), Gaps = 6/792 (1%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             MKATSNG FQGD+PLDYALPL IVQICLV++LTR+LAY+LRPLRQPRVIAEI+GGVLLGP
Sbjct  1     MKATSNGVFQGDNPLDYALPLAIVQICLVLVLTRLLAYILRPLRQPRVIAEIVGGVLLGP  60

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SA GR++ YL+AIFP KSLTVLDTLA+ GLLFFLFLVGLELDPKSLRRTGKKALSIALAG
Sbjct  61    SALGRNQKYLHAIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRRTGKKALSIALAG  120

Query  2262  ISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQ  2083
             IS+PF LGIGTSF+LR T++KGV+QGPFL+FMGVALSITAFPVLARILAELKLLTTDVGQ
Sbjct  121   ISVPFALGIGTSFVLRETVSKGVNQGPFLIFMGVALSITAFPVLARILAELKLLTTDVGQ  180

Query  2082  mamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMAS  1903
             MAMSAAAVNDVAAWILLALAIALSG G SP+ISLWVLLCGTGFVLLCI + PRIFKWMA 
Sbjct  181   MAMSAAAVNDVAAWILLALAIALSGVGRSPVISLWVLLCGTGFVLLCIFIAPRIFKWMAR  240

Query  1902  RCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVE  1723
             RCSEGEPVDE YVCA LA VL A FVTD IGIHALFGAFV+GVLVPK+GP A ALVEKVE
Sbjct  241   RCSEGEPVDEKYVCATLAVVLAASFVTDMIGIHALFGAFVLGVLVPKEGPFAGALVEKVE  300

Query  1722  DLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQ  1543
             DLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVI TACFGKI+GTI+VS LC++P Q
Sbjct  301   DLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIVTACFGKIVGTIVVSLLCKLPIQ  360

Query  1542  EAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAK  1363
             EA+TLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI++YKPAK
Sbjct  361   EAVTLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVISVYKPAK  420

Query  1362  LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLME  1183
             LAVT YK+RTIQRK+ SKQLRIL CFHS RNIP+++NLIE SRG EK  G +VYAMHLME
Sbjct  421   LAVTAYKHRTIQRKNTSKQLRILACFHSTRNIPAMLNLIEVSRGIEKREGLRVYAMHLME  480

Query  1182  LSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMSS  1003
             LSERSSAILM HKA+KNGLPFWNT  +  DS +IVVAF+TF +LSKVSIRP+TAIS M+S
Sbjct  481   LSERSSAILMVHKAKKNGLPFWNTE-QVQDSNQIVVAFDTFSNLSKVSIRPTTAISPMNS  539

Query  1002  MHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDRG  823
             MHEDI+ASAE KRVAMIILPFHKH ++DGH ETTR ELRHVNRRVL+ APCSVGILVDRG
Sbjct  540   MHEDIVASAERKRVAMIILPFHKHPRLDGHLETTRGELRHVNRRVLQHAPCSVGILVDRG  599

Query  822   LGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGTsv  643
             LGG SHVS+SNVD+++T L+FGGHDDREALAYG R+ EHPGI L+V RF +DPE +GT  
Sbjct  600   LGGASHVSSSNVDFSVTALFFGGHDDREALAYGVRIAEHPGISLIVVRFIVDPEVSGT--  657

Query  642   kldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGYNRCNL  463
              + V  +  ++PE +S DE+FLA  KQ++S + S+K+EE++VK A  T+EAIR YNRCNL
Sbjct  658   SVKVEMNDKTNPEAQSDDEEFLADVKQKSSIDGSIKFEERLVKDARGTIEAIREYNRCNL  717

Query  462   LVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTEL---SKNGL  292
              +VGRMPEG++V A+DKK +CPELG LGNLL+  EFSTTASVLVVQQYR++L   S + L
Sbjct  718   FLVGRMPEGQVVVALDKKSDCPELGSLGNLLTSPEFSTTASVLVVQQYRSQLPEESLSSL  777

Query  291   KEDDSVDGDYES  256
             KE +S DGD +S
Sbjct  778   KEGESSDGDCDS  789



>ref|XP_009586862.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
Length=802

 Score =  1150 bits (2975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/773 (81%), Positives = 693/773 (90%), Gaps = 3/773 (0%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CP PMKATSNG FQGD PLDYALPL IVQICLV++LTRVLAYLLRPLRQPRV+AEIIGG+
Sbjct  10    CPPPMKATSNGVFQGDDPLDYALPLAIVQICLVLVLTRVLAYLLRPLRQPRVVAEIIGGI  69

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GR+E YL+ IFP KSLTVLDTLA+ GLLFFLFLVGLELDPKSLRRTGKKAL I
Sbjct  70    LLGPSALGRNEKYLHTIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRRTGKKALCI  129

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             A+AGISLPF LGIGTSF LRATI+KGV+QGPFLVFMGVALSITAFPVLARILAELKLLTT
Sbjct  130   AVAGISLPFVLGIGTSFALRATISKGVNQGPFLVFMGVALSITAFPVLARILAELKLLTT  189

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             DVG+MAMSAAAVNDVAAWILLALAIALSGT  SPLISLWVLLCG GFV+LCI + P IFK
Sbjct  190   DVGRMAMSAAAVNDVAAWILLALAIALSGTTSSPLISLWVLLCGAGFVILCIFIGPPIFK  249

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             WMA RCS+GE VDEIYVCA LAAVL AGFVTDTIGIHALFGAFV+GVLVPK+GP A ALV
Sbjct  250   WMARRCSDGEHVDEIYVCATLAAVLAAGFVTDTIGIHALFGAFVLGVLVPKEGPFAGALV  309

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFT+CFGKI+GTI+VS LC+
Sbjct  310   EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTSCFGKIVGTIVVSLLCK  369

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +P QEA+TLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI++Y
Sbjct  370   MPMQEALTLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVISIY  429

Query  1374  KPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAM  1195
             KPAKLAVTEYK+RTI+RKD SKQ+R+LTCF+S RNIP+LINLIE SRGTEK  G +VYAM
Sbjct  430   KPAKLAVTEYKHRTIERKDTSKQVRMLTCFYSTRNIPTLINLIEVSRGTEKREGLRVYAM  489

Query  1194  HLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAIS  1015
             HLMELSERSSAILM HK ++NGLPFWN +GE  DS ++VVAFETFEHLSKVSIRP+TAIS
Sbjct  490   HLMELSERSSAILMVHKVKRNGLPFWN-KGEVADSNQVVVAFETFEHLSKVSIRPTTAIS  548

Query  1014  AMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGIL  835
              M+SMHEDII SAE KRVAMIILPFHKHQ++DGHFETTR +LRHVNRRVL+ APCSVGIL
Sbjct  549   PMNSMHEDIITSAERKRVAMIILPFHKHQRLDGHFETTRTDLRHVNRRVLQHAPCSVGIL  608

Query  834   VDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETA  655
             VDRGLGG SHVSASNVD+TIT+L+FGGHDD EALAYG RM EHPG+ LVV RF +DPE A
Sbjct  609   VDRGLGGASHVSASNVDFTITILFFGGHDDHEALAYGVRMAEHPGVTLVVVRFVVDPEVA  668

Query  654   GTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGYN  475
             G    + +  + +SS E +  DE  L+  KQR S + S+KYEE+ +K  AET EAI+ YN
Sbjct  669   G--GSVKIDINQNSSLEAQPEDEVLLSGLKQRISKDGSIKYEERTIKDGAETFEAIKSYN  726

Query  474   RCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYR  316
             RCNL +VGRMPEG++VAA++KK ECPELGP+GNLL   EFSTTASVLVVQQYR
Sbjct  727   RCNLFLVGRMPEGQVVAALNKKSECPELGPIGNLLISSEFSTTASVLVVQQYR  779



>ref|XP_004245551.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum lycopersicum]
 ref|XP_010325373.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum lycopersicum]
 ref|XP_010325374.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum lycopersicum]
Length=802

 Score =  1147 bits (2968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 618/795 (78%), Positives = 702/795 (88%), Gaps = 6/795 (1%)
 Frame = -1

Query  2640  VVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIG  2461
             + CP PMKATSNG FQGD PLDYALPL IVQICLV++LTRVLAY+LRPLRQPRV+AEIIG
Sbjct  8     LTCPKPMKATSNGVFQGDDPLDYALPLAIVQICLVLVLTRVLAYILRPLRQPRVVAEIIG  67

Query  2460  GVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKAL  2281
             G+LLGPSA GRSE YL+ IFP KSLTVLDTLA+ GLLFFLFLVGLELDPKSLRRTGKKAL
Sbjct  68    GILLGPSALGRSEKYLHTIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRRTGKKAL  127

Query  2280  SIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLL  2101
              IA+AGIS+PF LGIGTSF LRATI++GV+QGPFLVFMGVALSITAFPVLARILAELKLL
Sbjct  128   CIAIAGISVPFVLGIGTSFALRATISQGVNQGPFLVFMGVALSITAFPVLARILAELKLL  187

Query  2100  TTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRI  1921
             TTDVG+MAMSAAAVNDVAAWILLALAIALSG G SP ISLWVLL G GFVLLCIL+ P I
Sbjct  188   TTDVGRMAMSAAAVNDVAAWILLALAIALSGNGSSPFISLWVLLSGAGFVLLCILIGPPI  247

Query  1920  FKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASA  1741
             F WMA RCS+GE VDEIYVC  LAAVL AGFVTD+IGIHALFGAFV+GVLVPK+GP A A
Sbjct  248   FTWMAKRCSDGEHVDEIYVCGTLAAVLAAGFVTDSIGIHALFGAFVLGVLVPKEGPFAGA  307

Query  1740  LVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTL  1561
             LVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLL LVIFT+CFGKI+GTI+VS L
Sbjct  308   LVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLALVIFTSCFGKIVGTIVVSLL  367

Query  1560  CRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIA  1381
             C++P QEA+TLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI+
Sbjct  368   CKMPVQEALTLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIS  427

Query  1380  LYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVY  1201
             +Y+PAKLAVT+YK+RTI+RKD SKQ+RIL+CF+S RNIP+LINLIE SRGT K  G +VY
Sbjct  428   IYRPAKLAVTKYKHRTIERKDTSKQVRILSCFYSTRNIPTLINLIEVSRGTAKKEGLRVY  487

Query  1200  AMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTA  1021
             AMHLMELSERSSAILM HK ++NGLPFWN +GE +DS ++VVAFETFEHLSKVSIRP+TA
Sbjct  488   AMHLMELSERSSAILMVHKVKRNGLPFWN-KGEVSDSNQVVVAFETFEHLSKVSIRPTTA  546

Query  1020  ISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVG  841
             IS M+SMHEDII SAE KRVAMIILPFHKHQ++DGHFETTR +LRHVNR+VL+ APCSVG
Sbjct  547   ISPMNSMHEDIITSAENKRVAMIILPFHKHQRLDGHFETTRTDLRHVNRKVLQQAPCSVG  606

Query  840   ILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPE  661
             ILVDRGLGG SHV ASNVD+TIT+L+FGGHDDREALAYG RM EHPGI L V RF +DP 
Sbjct  607   ILVDRGLGGASHVPASNVDFTITILFFGGHDDREALAYGMRMAEHPGITLAVVRFAVDPA  666

Query  660   TAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRG  481
              AG    + +  S +S+PE +  DE  ++  K+  ST+ S+KYEEK VK + E +EA + 
Sbjct  667   LAG--GSVKLKMSHNSNPEVQPEDEVVISKLKESISTDGSIKYEEKTVKDSTELIEATKS  724

Query  480   YNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTELSK  301
             YN+CNL +VGRMPEG++VA+++K  ECPELGP+GNLL+  EFSTTAS+LVVQQYR++LS+
Sbjct  725   YNKCNLFLVGRMPEGQVVASLNKNSECPELGPIGNLLTSSEFSTTASLLVVQQYRSQLSQ  784

Query  300   ---NGLKEDDSVDGD  265
                N L++ ++ DG+
Sbjct  785   DALNSLEDGETSDGN  799



>ref|XP_004244724.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum lycopersicum]
Length=801

 Score =  1144 bits (2959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 619/804 (77%), Positives = 699/804 (87%), Gaps = 7/804 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M S     CP+PMKATSNG FQGDSPLDYALPL IVQICLV++LTRVLAYLL PLRQPRV
Sbjct  1     MASTTITKCPSPMKATSNGVFQGDSPLDYALPLAIVQICLVLVLTRVLAYLLSPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEIIGG+LLGPSA GR++ YLNAIFP +SLTVLDTLA+ GLLFFLFLVG+ELDP  LRR
Sbjct  61    IAEIIGGILLGPSALGRNQKYLNAIFPPRSLTVLDTLANFGLLFFLFLVGIELDPGYLRR  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKAL IALAGISLPF LGIGTS +LR TIAKGVSQGPFL+FMG++LSITAFPVLARIL
Sbjct  121   TGKKALIIALAGISLPFTLGIGTSCVLRGTIAKGVSQGPFLIFMGISLSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVGQMAMSAAA+NDVAAWILLALAI+LSG  +SPLIS+WVLLCGTGFVLLC+
Sbjct  181   AELKLLTTDVGQMAMSAAAINDVAAWILLALAISLSGASNSPLISVWVLLCGTGFVLLCL  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
             ++ P IF WM  RC+EGEPVDE+YVCA L AVL AGF+TDTIGIHALFGAFV+GVLVPK+
Sbjct  241   VIGPPIFNWMDKRCAEGEPVDELYVCATLGAVLAAGFITDTIGIHALFGAFVLGVLVPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP + ALV KVEDLVSGLFLPLYFVSSGLKTN+ATIQGAQSWGLLVLVIFT+CFGKI+GT
Sbjct  301   GPFSGALVVKVEDLVSGLFLPLYFVSSGLKTNIATIQGAQSWGLLVLVIFTSCFGKIVGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
              LVS LC++P QEA+ LGFLMNTKGLVELIVLNIGKDRGVLNDQTFAI+VLMAL TTFIT
Sbjct  361   TLVSLLCKMPVQEAVMLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIIVLMALVTTFIT  420

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             TPIV+++YKPAKLA TEYK+RTI+RKD SKQLRILTCFHS R++P++INLIEASRGT K 
Sbjct  421   TPIVVSVYKPAKLATTEYKHRTIERKDTSKQLRILTCFHSTRSLPTMINLIEASRGTAKK  480

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
              G +VYAMHLMELSERSSAILM HKARKNGLPFW  R E +D+ +IVV FETFEHLSKVS
Sbjct  481   -GLRVYAMHLMELSERSSAILMVHKARKNGLPFWKKR-EVSDTNQIVVVFETFEHLSKVS  538

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             IRP+TAIS M+SMHEDIIA AEGKRVAMIILPFHK Q+IDGHF TTR++LRHVNRRVL+ 
Sbjct  539   IRPTTAISPMNSMHEDIIAGAEGKRVAMIILPFHKRQRIDGHFVTTRDDLRHVNRRVLQH  598

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             APCSVGILVDRGLGG SHVSASNVD+ +T+L+FGGHDDREALAYG RM EHPGI L+V R
Sbjct  599   APCSVGILVDRGLGGASHVSASNVDFQVTILFFGGHDDREALAYGMRMAEHPGINLLVVR  658

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAET  499
             F +DPE AG    + +    + SPE +S+DE+ L   K   S N S+KYEEK+VK  A T
Sbjct  659   FLVDPEVAG--RSVTLDIDQTYSPEAQSKDEELLTDLKHNMSKNDSIKYEEKLVKDGAGT  716

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
              E IR Y RCNL +VGRM EG++V A+D K +CPELGPLGNLL+C EFSTTASVLVVQQY
Sbjct  717   TELIRAYKRCNLFLVGRMSEGQVVLALDIKSDCPELGPLGNLLTCSEFSTTASVLVVQQY  776

Query  318   RTELSK---NGLKEDDSVDGDYES  256
             ++ELS+   N LK+ +  +G+ +S
Sbjct  777   QSELSQDSINSLKDGELTEGNSDS  800



>ref|XP_006343906.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum tuberosum]
Length=802

 Score =  1144 bits (2958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 618/795 (78%), Positives = 702/795 (88%), Gaps = 6/795 (1%)
 Frame = -1

Query  2640  VVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIG  2461
             + CP PMKATSNG FQGD PLDYALPL IVQICLV++LTRVLAYLLRPLRQPRV+AEIIG
Sbjct  8     LTCPKPMKATSNGVFQGDDPLDYALPLAIVQICLVLVLTRVLAYLLRPLRQPRVVAEIIG  67

Query  2460  GVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKAL  2281
             G+LLGPSA GRSE YL+ IFP KSLTVLDTLA+ GLLFFLFLVGLELDPKSLRRTGKKAL
Sbjct  68    GILLGPSALGRSEKYLHTIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRRTGKKAL  127

Query  2280  SIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLL  2101
              IA+AGIS+PF LGIGTSF LRATI++GV+QGPFLVFMGVALSITAFPVLARILAELKLL
Sbjct  128   CIAIAGISVPFVLGIGTSFALRATISQGVNQGPFLVFMGVALSITAFPVLARILAELKLL  187

Query  2100  TTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRI  1921
             TTDVG+MAMSAAAVNDVAAWILLALAIALSG G SP ISLWVLL G GFVLLCIL+ P I
Sbjct  188   TTDVGRMAMSAAAVNDVAAWILLALAIALSGNGSSPFISLWVLLSGAGFVLLCILIGPPI  247

Query  1920  FKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASA  1741
             F WMA RCS+GE VDEIYVC  LAAVL AGFVTD+IGIHALFGAFV+GVLVPK+GP A A
Sbjct  248   FTWMAKRCSDGEHVDEIYVCGTLAAVLAAGFVTDSIGIHALFGAFVLGVLVPKEGPFAGA  307

Query  1740  LVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTL  1561
             LVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLL LVIFT+CFGKI+GTI+VS L
Sbjct  308   LVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLALVIFTSCFGKIVGTIVVSLL  367

Query  1560  CRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIA  1381
             C++P QEA+TLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI+
Sbjct  368   CKMPVQEALTLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIS  427

Query  1380  LYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVY  1201
             +Y+PAKLAVT+YK+RTI+RKD SKQ+RIL+CF+S RNIP+LINLIE SRGT K  G +VY
Sbjct  428   IYRPAKLAVTKYKHRTIERKDTSKQVRILSCFYSTRNIPTLINLIEVSRGTAKKEGLRVY  487

Query  1200  AMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTA  1021
             AMHLMELSERSSAILM HK ++NGLPFWN +GE +DS ++VVAFETFEHLSKVSIRP+TA
Sbjct  488   AMHLMELSERSSAILMVHKVKRNGLPFWN-KGEVSDSNQVVVAFETFEHLSKVSIRPTTA  546

Query  1020  ISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVG  841
             IS M+SMHEDII SAE KRVAMIILPFHKHQ++DGHFETTR +LRHVNR+VL+ APCSVG
Sbjct  547   ISPMNSMHEDIITSAENKRVAMIILPFHKHQRLDGHFETTRTDLRHVNRKVLQQAPCSVG  606

Query  840   ILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPE  661
             ILVDRGLGG SHV ASNV++TIT+L+FGGHDDREALAYG RM EHPGI LVV RF +DP 
Sbjct  607   ILVDRGLGGASHVPASNVNFTITILFFGGHDDREALAYGIRMAEHPGITLVVVRFAVDPA  666

Query  660   TAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRG  481
              AG    + +  S +SSPE +  DE  ++  K+  ST+ S+KYEE+ VK A E +EA + 
Sbjct  667   LAG--GSVKLKMSQNSSPEVQPEDEVVISRLKESISTDGSIKYEERTVKDATELIEATKS  724

Query  480   YNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTELSK  301
             YN+CNL +VGRMPEG++VA+++K  ECPELGP+GNLL+  + STTAS+LVVQQYR++LS+
Sbjct  725   YNKCNLFLVGRMPEGQVVASLNKNSECPELGPIGNLLTSSDISTTASLLVVQQYRSQLSQ  784

Query  300   ---NGLKEDDSVDGD  265
                N L++ ++ DG+
Sbjct  785   DALNSLEDGETSDGN  799



>emb|CDP12106.1| unnamed protein product [Coffea canephora]
Length=799

 Score =  1124 bits (2907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 609/801 (76%), Positives = 691/801 (86%), Gaps = 3/801 (0%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M SN TV CPAPMKATSNG FQG++PLDYALPL+I+QICLV++LTR LAYLLRPLRQPRV
Sbjct  1     MASNATVKCPAPMKATSNGVFQGETPLDYALPLVILQICLVIVLTRTLAYLLRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             +AEIIGGVLLGPSA GR+  +L+ +FP +SLTVLDT+A+LGLLFFLFLVGLELDPKSLRR
Sbjct  61    VAEIIGGVLLGPSALGRNHKFLHTVFPPRSLTVLDTIANLGLLFFLFLVGLELDPKSLRR  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKAL+IALAGI+LPF LGIGTSF LRATI+KGVS+GPFLVFMGVALSITAFPVLARIL
Sbjct  121   TGKKALAIALAGITLPFALGIGTSFALRATISKGVSEGPFLVFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG+MAMSAAAVNDVAAWILLALA+ALSG G SPL+SLWVLLCG+GFVL CI
Sbjct  181   AELKLLTTDVGRMAMSAAAVNDVAAWILLALAVALSGVGRSPLVSLWVLLCGSGFVLCCI  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              V P IF+WMA RC EGEPVDE+YVCA LA VL AGFVTD+IGIHALFGAFVIG+LVPK+
Sbjct  241   FVAPPIFRWMARRCPEGEPVDEMYVCATLAVVLAAGFVTDSIGIHALFGAFVIGILVPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A ALVEKVEDLVSG+FLPLYFVSSGLKTNVATI GAQ+WGLL LVIFTACFGKI+GT
Sbjct  301   GAFAGALVEKVEDLVSGIFLPLYFVSSGLKTNVATIHGAQAWGLLALVIFTACFGKIVGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             I VS L ++P Q+A+ LGFLMNTKGLVELIVLNIGKDRGVLND+TFA+MVLMALFTTFIT
Sbjct  361   IFVSLLSKMPLQQAVALGFLMNTKGLVELIVLNIGKDRGVLNDETFAVMVLMALFTTFIT  420

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             TPIV+A+YKPAK+A +EYK+ TIQRK+ S QLR+LTCFHS RNIPSLINLIEASRGTEK 
Sbjct  421   TPIVMAVYKPAKMARSEYKHHTIQRKEASAQLRLLTCFHSSRNIPSLINLIEASRGTEKK  480

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
             GG +VYAMHLMELSERSSAILM HKARKNGLPFW ++ + +DS ++VVAFE F  LSKVS
Sbjct  481   GGLRVYAMHLMELSERSSAILMVHKARKNGLPFW-SKVQDSDSNQVVVAFEAFRQLSKVS  539

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             IRP+TAIS +++MHEDI+A AE K V+MIILPFHKHQ+IDGH ETTR E RHVNRRVL  
Sbjct  540   IRPTTAISPIATMHEDILAGAEKKGVSMIILPFHKHQRIDGHLETTRAEFRHVNRRVLRA  599

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             APCSVGI VDRGLGGTSHVSASNVDYTIT L+FGGHDDREA+AYGA M EHPGI LVV R
Sbjct  600   APCSVGIFVDRGLGGTSHVSASNVDYTITALFFGGHDDREAVAYGALMAEHPGISLVVVR  659

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAET  499
             F +DP+ AG SV LDV+ S          DE+FL+  K+      SV +EEK+V+  AET
Sbjct  660   FAVDPKVAGKSVNLDVNESSGPEARSD--DEEFLSELKENVKEVRSVTFEEKIVRDGAET  717

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             +EA+R Y+RCNL +VGRMPEG++VAA++   + PELGP+GN L   EFST ASVLVVQQY
Sbjct  718   VEAVRAYSRCNLFLVGRMPEGQLVAALNNTTDSPELGPVGNFLVAPEFSTRASVLVVQQY  777

Query  318   RTELSKNGLKEDDSVDGDYES  256
             R ELS++ L   ++     ES
Sbjct  778   RRELSEDSLASLEAEGSGEES  798



>gb|EYU23396.1| hypothetical protein MIMGU_mgv1a001514mg [Erythranthe guttata]
Length=804

 Score =  1121 bits (2900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/805 (76%), Positives = 708/805 (88%), Gaps = 6/805 (1%)
 Frame = -1

Query  2658  MGSNGTVV-CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPR  2482
             M SN T + CP PMKA SNG FQGD+PL ++LPLLI+QICLVV LTR LAYLLRPLRQPR
Sbjct  1     MASNVTALKCPPPMKAASNGVFQGDNPLHFSLPLLIIQICLVVALTRALAYLLRPLRQPR  60

Query  2481  VIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLR  2302
             VIAEIIGG+LLGPSA GR++ YL+A+FP +SLTVLDT+A+LGLLFFLFLVGLELDPK+LR
Sbjct  61    VIAEIIGGILLGPSALGRNQKYLHAVFPARSLTVLDTIANLGLLFFLFLVGLELDPKALR  120

Query  2301  RTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARI  2122
             RTGKKALSIALAGI+LPF LGIGTSF+LR+TI+K V+QGPFLVFMGVA+SITAFPVLARI
Sbjct  121   RTGKKALSIALAGITLPFALGIGTSFVLRSTISKDVAQGPFLVFMGVAVSITAFPVLARI  180

Query  2121  LAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLC  1942
             LAELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSGTG SPL+SLWV L G+GF+ LC
Sbjct  181   LAELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGTG-SPLVSLWVFLSGSGFITLC  239

Query  1941  ILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPK  1762
             I V P +FKWM  RC EGEPVDEIYVCA LAAVL AG VTDTIGIHALFGAFV+GVLVPK
Sbjct  240   IFVAPLLFKWMVKRCPEGEPVDEIYVCATLAAVLAAGLVTDTIGIHALFGAFVLGVLVPK  299

Query  1761  DGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILG  1582
             +GP A ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQG QSWGLLVLVIFTACFGKI+G
Sbjct  300   EGPFAGALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGGQSWGLLVLVIFTACFGKIVG  359

Query  1581  TILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFI  1402
             T++VS LC+IPF+EA+ LGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFI
Sbjct  360   TVVVSLLCKIPFREALVLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFI  419

Query  1401  TTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEK  1222
             TTPIV+ALYKPA++A ++YK+RTIQRKDP+ QLR+LTCFHS R+IP+LINL+E SRGT K
Sbjct  420   TTPIVVALYKPARMAASDYKHRTIQRKDPNTQLRLLTCFHSTRSIPTLINLMETSRGTGK  479

Query  1221  SGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKV  1042
              GG +V+AMHLMELSERSSAILM HKARKNG PFWN + E TD+ ++VVAFE FE LS+V
Sbjct  480   RGGLRVFAMHLMELSERSSAILMVHKARKNGAPFWN-KAESTDTNQVVVAFEAFEQLSQV  538

Query  1041  SIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLE  862
             SIRP+TAISAMSSMHEDI +SA+GK+ A+IILPFHKHQ+IDGH ETTR++LRHVNRRVLE
Sbjct  539   SIRPTTAISAMSSMHEDICSSAQGKKAAVIILPFHKHQRIDGHLETTRSDLRHVNRRVLE  598

Query  861   GAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVA  682
              APCSVGILVDRGLGG +H++ASNV+YTITVL+FGG DDREAL+YGA M EHPGI L V 
Sbjct  599   HAPCSVGILVDRGLGGAAHIAASNVNYTITVLFFGGPDDREALSYGAIMAEHPGINLNVV  658

Query  681   RFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAE  502
             RF +D + AG SV+LD+  +  + PE++S DE+F++ F++R S   S+K+EE VV  AAE
Sbjct  659   RFVVDSKVAGESVRLDIDGNDGNRPEDRSDDEEFISEFRERVSKAGSIKFEECVVGGAAE  718

Query  501   TMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQ  322
              M  IR +N  NL +VGR+PEG++VAA+DKKGECPELGP+G LL   E ST ASVLV+QQ
Sbjct  719   AMAVIRSHNVSNLFLVGRIPEGQLVAALDKKGECPELGPIGKLLVSPEMSTAASVLVMQQ  778

Query  321   YRTELSKNG---LKEDDSVDGDYES  256
             YR++L+ +    LKE+D+V G+ +S
Sbjct  779   YRSQLTGHALTSLKEEDTVGGESDS  803



>ref|XP_011080876.1| PREDICTED: cation/H(+) antiporter 18-like [Sesamum indicum]
 ref|XP_011080877.1| PREDICTED: cation/H(+) antiporter 18-like [Sesamum indicum]
Length=800

 Score =  1104 bits (2855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 601/804 (75%), Positives = 686/804 (85%), Gaps = 8/804 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M SN TV CP PMKATSNG FQGD PL +ALPLLI+QICLVV+LTRVLAYLLRPLRQPRV
Sbjct  1     MASNATVKCPPPMKATSNGVFQGDDPLHFALPLLILQICLVVVLTRVLAYLLRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEIIGG+LLGPSA GR+  YL+AIFP +SLTVLDT+A+LGLLFFLFLVGLELDP++LRR
Sbjct  61    IAEIIGGILLGPSALGRNPKYLHAIFPPQSLTVLDTIANLGLLFFLFLVGLELDPRALRR  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TG+KALSIALAGI+LPF LGIGTSF+LR TI+KGVS GPFLVFMGVALSITAFPVLARIL
Sbjct  121   TGRKALSIALAGITLPFALGIGTSFVLRETISKGVSHGPFLVFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG+MAMSAAAVNDVAAW+LLALAIALSGT  SPL+SLWV  CG+GFV+LCI
Sbjct  181   AELKLLTTDVGRMAMSAAAVNDVAAWVLLALAIALSGTDQSPLVSLWVFFCGSGFVVLCI  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              + P IFKWMA RCS+GEPVDEIY+CA LAAVL AG VTD IGIHALFGAFV+GVLVPK+
Sbjct  241   FLAPPIFKWMAQRCSQGEPVDEIYICATLAAVLAAGLVTDIIGIHALFGAFVLGVLVPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP A ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQG QSWGLLVLVIFTACFGKI+GT
Sbjct  301   GPFAGALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGVQSWGLLVLVIFTACFGKIVGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             ++VS  C+IPF+EA+TLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT
Sbjct  361   VVVSRFCKIPFKEALTLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  420

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             TPIV+ +YKPA++A +EYK+RTIQRK    QLR+LTCFHS RNIP+LINL+EASRGT   
Sbjct  421   TPIVLTIYKPARVARSEYKHRTIQRKKSYTQLRLLTCFHSTRNIPTLINLMEASRGTGIR  480

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
              G +VYAMHLMELSERSSAILM HKARKNG+PFWN RG  +D  +IVVAFE F+HLS+VS
Sbjct  481   EGLRVYAMHLMELSERSSAILMVHKARKNGMPFWN-RGHDSDPNQIVVAFEAFQHLSQVS  539

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             ++P+TAIS+MSSMHEDI  SA  K+VAMI+LPFHKHQ++DG  ETTR ELRHVNRRVLE 
Sbjct  540   VQPTTAISSMSSMHEDICNSAARKKVAMIVLPFHKHQRVDGRLETTRAELRHVNRRVLEH  599

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             APCSV ILVDRGLGGT HV+ASNVDYTIT  +FGG DD EAL+YGA M EHPGI L V  
Sbjct  600   APCSVAILVDRGLGGTCHVAASNVDYTITTFFFGGPDDHEALSYGALMAEHPGISLNVVH  659

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAET  499
             FT+DP+  G    + +       P+ +S DE FLA FKQ+ S + S++++E VV +AAE 
Sbjct  660   FTVDPKIVGD--TVQLDMDDLHIPDARSNDEVFLAEFKQKVSKDGSIRFKETVVSNAAEA  717

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             ++ I  YNR NL +VGR PEG++V A++   ECPELGP+GNLL   EFST  SVLVVQQY
Sbjct  718   VDVIHTYNRSNLFLVGRTPEGQLVGALNTTKECPELGPVGNLLISPEFST--SVLVVQQY  775

Query  318   RTEL---SKNGLKEDDSVDGDYES  256
             R++L   S N LK +D+ + + +S
Sbjct  776   RSQLTGDSLNSLKAEDTAEAESDS  799



>ref|XP_009608562.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
Length=801

 Score =  1104 bits (2855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/790 (77%), Positives = 683/790 (86%), Gaps = 8/790 (1%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             M ATS+G  QGD+PL YALPL IVQICLV++LTRVLAY+LRPLRQPRV+AEIIGG+LLGP
Sbjct  10    MHATSSGVLQGDNPLHYALPLAIVQICLVLVLTRVLAYILRPLRQPRVVAEIIGGILLGP  69

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SA GR++ YLNAIFPK SLTVLDTLA+LGLLFFLFLVG ELDP+SLRRTGKKALSIALAG
Sbjct  70    SALGRNQKYLNAIFPKSSLTVLDTLANLGLLFFLFLVGTELDPRSLRRTGKKALSIALAG  129

Query  2262  ISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQ  2083
             I+LPF LGIGTSF LRATIA+GV+QGPFLVFMGVALSITAFPVLARILAELKLLTTDVG+
Sbjct  130   ITLPFVLGIGTSFALRATIAEGVNQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGR  189

Query  2082  mamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMAS  1903
             MAMSAAAVNDVAAWILLALAIALSG+G SP+ISLWVLLCGTGFVL+CI   P IF WMA 
Sbjct  190   MAMSAAAVNDVAAWILLALAIALSGSG-SPIISLWVLLCGTGFVLICIFTAPLIFNWMAR  248

Query  1902  RCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVE  1723
             +CSEGEPV+E+YVCA LA VL AGFVTD IGIHALFGAFV+GVLVPK+GP A ALVEKVE
Sbjct  249   QCSEGEPVNELYVCATLAIVLAAGFVTDAIGIHALFGAFVVGVLVPKEGPFAGALVEKVE  308

Query  1722  DLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQ  1543
             DLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVI T+CFGKI+GT+ VS +C++P Q
Sbjct  309   DLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIATSCFGKIVGTVFVSLMCKLPLQ  368

Query  1542  EAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAK  1363
             E++TLGFLMNTKGLVELIVLNIGKD+GVLNDQ FAIMVLMALFTTF+TTPIVIA+YKPAK
Sbjct  369   ESLTLGFLMNTKGLVELIVLNIGKDKGVLNDQIFAIMVLMALFTTFMTTPIVIAIYKPAK  428

Query  1362  LAVTEYKYRTIQRKDPSK-QLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLM  1186
             +AVTEYK+RT+ RKD SK QLRILTCFH  RNIP+LINLIEASRGTEK  G +VYAMHL+
Sbjct  429   MAVTEYKHRTVMRKDTSKAQLRILTCFHGTRNIPTLINLIEASRGTEKKEGLRVYAMHLL  488

Query  1185  ELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMS  1006
             EL+ERSSAILM HKARKNGLPFWN +G+  +S +++VAFETF  LSKVSIRP+TAISAM+
Sbjct  489   ELTERSSAILMVHKARKNGLPFWN-KGQVGESNQVIVAFETFGQLSKVSIRPTTAISAMT  547

Query  1005  SMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDR  826
             SMHEDIIASAE KRV+MIILPFHKHQ+IDG FETTR +LR VNRRVL+ APCSV IL+DR
Sbjct  548   SMHEDIIASAERKRVSMIILPFHKHQRIDGQFETTRADLRLVNRRVLQHAPCSVSILIDR  607

Query  825   GLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGTs  646
             GLGG SHVSAS VDY++ VL+FGG DDREALAYG RM EHPGI L V RF  DPE  G +
Sbjct  608   GLGGASHVSASEVDYSVLVLFFGGQDDREALAYGMRMAEHPGITLTVVRFVTDPEVVGPT  667

Query  645   vkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGYNRCN  466
             V +D+        E    DE+FLA  KQ+++ + S+ +EE  VK A ET+EAIR Y +CN
Sbjct  668   VHVDIIDDSGPEGEST--DEEFLADMKQKSTGDGSIIFEESTVKDATETIEAIRAYKKCN  725

Query  465   LLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTEL---SKNG  295
             L +VGRM EG++V+A D K +CPELGPLGNLL   E STTASVLVVQ+YR+EL   S N 
Sbjct  726   LFLVGRMSEGQLVSAFDTKTDCPELGPLGNLLISPEISTTASVLVVQKYRSELPQDSLNT  785

Query  294   LKEDDSVDGD  265
             L E  S  GD
Sbjct  786   LNEGASAKGD  795



>ref|XP_009782586.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana sylvestris]
Length=801

 Score =  1102 bits (2850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 606/792 (77%), Positives = 682/792 (86%), Gaps = 8/792 (1%)
 Frame = -1

Query  2628  APMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLL  2449
             +PM ATS+G  QGD+PL YALPL IVQICLV++LTRVLAY+LRPLRQPRV+AEIIGG+LL
Sbjct  8     SPMHATSSGVLQGDNPLHYALPLAIVQICLVLVLTRVLAYILRPLRQPRVVAEIIGGILL  67

Query  2448  GPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIAL  2269
             GPSA GR+E YLNAIFPK SLTVLDTLA+LGLLFFLFLVG ELDP+SLRRTGKKALSIAL
Sbjct  68    GPSALGRNEKYLNAIFPKSSLTVLDTLANLGLLFFLFLVGTELDPRSLRRTGKKALSIAL  127

Query  2268  AGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDV  2089
             AGI+LPF LGIGTSF LRATIA+GV+QGPFLVFMGVALSITAFPVLARILAELKLLTTDV
Sbjct  128   AGITLPFVLGIGTSFALRATIAEGVNQGPFLVFMGVALSITAFPVLARILAELKLLTTDV  187

Query  2088  GQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWM  1909
             G+MAMSAAAVNDVAAWILLALAIALSG+G SP+ISLWVLLCGTGFVL+CI   P IF WM
Sbjct  188   GRMAMSAAAVNDVAAWILLALAIALSGSG-SPIISLWVLLCGTGFVLICIFTAPLIFNWM  246

Query  1908  ASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEK  1729
             A +CSEGEPV+E+YVCA LA VL AGFVTD IGIHALFGAFV+GVLVPKDGP A ALVEK
Sbjct  247   ARQCSEGEPVNELYVCATLAIVLAAGFVTDAIGIHALFGAFVVGVLVPKDGPFAGALVEK  306

Query  1728  VEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIP  1549
             VEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLL LVI T+CFGKI+GT+ VS +C++ 
Sbjct  307   VEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLALVITTSCFGKIVGTVFVSLMCKLS  366

Query  1548  FQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKP  1369
              QE++ LGFLMNTKGLVELIVLNIGKD+GVLNDQ FAIMVLMALFTTF+TTPIVIA+YKP
Sbjct  367   LQESLALGFLMNTKGLVELIVLNIGKDKGVLNDQIFAIMVLMALFTTFMTTPIVIAIYKP  426

Query  1368  AKLAVTEYKYRTIQRKDPSK-QLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMH  1192
             AK+AVTEYK+RTI RKD SK QLRILTCFH  RNIP+LINLIEASRGTEK  G +VYAMH
Sbjct  427   AKMAVTEYKHRTIMRKDTSKAQLRILTCFHGTRNIPTLINLIEASRGTEKKEGLRVYAMH  486

Query  1191  LMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISA  1012
             L+EL+ERSSAILM HKARKNGLPFWN +G+  +S +++VAFETF  LSKVSIRP+TAISA
Sbjct  487   LLELTERSSAILMVHKARKNGLPFWN-KGQVGESNQVIVAFETFGQLSKVSIRPTTAISA  545

Query  1011  MSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILV  832
             M+SMHEDIIASAE KRV+MIILPFHKHQ+IDGHFETTR +LR VNRRVL+ APCSV IL+
Sbjct  546   MTSMHEDIIASAERKRVSMIILPFHKHQRIDGHFETTRADLRLVNRRVLQHAPCSVSILI  605

Query  831   DRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAG  652
             DRGLGG  HVSAS VDY++ VL+FGG DDREALAYG RM EHPGI L   RF  DPE  G
Sbjct  606   DRGLGGACHVSASEVDYSVLVLFFGGQDDREALAYGMRMAEHPGITLTAVRFVTDPEVVG  665

Query  651   TsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGYNR  472
              +V +D+        E    DE+FLA  KQ++S + S+ +EE  VK A ET+EAIR Y +
Sbjct  666   LTVHVDIIDDSGPEAELT--DEEFLADLKQKSSGDGSIIFEEITVKDATETIEAIRAYKK  723

Query  471   CNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTELSKNG-  295
              NL +VGRM EG++V+  D + +CPELGPLGNLL   EFSTTASVLVVQ+YR+ELS++  
Sbjct  724   VNLFLVGRMSEGQLVSTFDTRTDCPELGPLGNLLISPEFSTTASVLVVQKYRSELSQDSL  783

Query  294   --LKEDDSVDGD  265
               LKE  S  GD
Sbjct  784   STLKEGASAKGD  795



>ref|XP_011073516.1| PREDICTED: cation/H(+) antiporter 18-like [Sesamum indicum]
Length=801

 Score =  1094 bits (2830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 604/804 (75%), Positives = 694/804 (86%), Gaps = 7/804 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M S+ T  C  PMKATSNG FQ D PL +ALPL+IVQICLVV+LTRVLAYLLRPLRQPRV
Sbjct  1     MASDATAKCQPPMKATSNGVFQEDDPLHFALPLVIVQICLVVVLTRVLAYLLRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEIIGGVLLGPSA GR++ YL+AIFP +SLTVLDTLA+LGLLFFLFLVGLELDPK LRR
Sbjct  61    IAEIIGGVLLGPSALGRNQKYLDAIFPPRSLTVLDTLANLGLLFFLFLVGLELDPKGLRR  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIAL GI LPF LG+GTSF+LRATI+KGV+QGPFLVFMGVALSITAFPVLARIL
Sbjct  121   TGKKALSIALGGIGLPFALGVGTSFLLRATISKGVNQGPFLVFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSGTG S ++SLWV LCG GF++LCI
Sbjct  181   AELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGTGGSAIVSLWVFLCGFGFIVLCI  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              V P IF+W+A RC  GEPVDEIY+CA L AVL AGFVTDTIGIHALFGAFV+GVLVPK+
Sbjct  241   FVCPPIFRWIARRCPRGEPVDEIYICATLVAVLAAGFVTDTIGIHALFGAFVLGVLVPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTAC GKI+GT
Sbjct  301   GAFAEALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACSGKIVGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             ILVS  C++PF+EA+TLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT
Sbjct  361   ILVSICCKVPFKEALTLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  420

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             TP+V+A+YKPA++A  EYK+RTI RK+   QLR+LTCFHS  +IP+LINL+EASRG  K 
Sbjct  421   TPVVMAIYKPAQMAKMEYKHRTIHRKEADTQLRMLTCFHSTTHIPTLINLMEASRGRGKR  480

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
             GG +VYAMHLMELSERSSAILM HKAR NGLPFW ++G+ +D+ +IVVAFE F+HLS+VS
Sbjct  481   GGLRVYAMHLMELSERSSAILMVHKARNNGLPFW-SKGQNSDANQIVVAFEAFQHLSQVS  539

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             IRP+TAIS +SSMHEDI  SA+ KRVAMIILP+HKHQ++DGH ETTR +LR+VNRRVLE 
Sbjct  540   IRPTTAISPISSMHEDICTSADRKRVAMIILPYHKHQRLDGHLETTRADLRYVNRRVLEH  599

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             +PCSVGILVDRGLGG SH+SASNVDYT+T L+FGGHDDREAL+YGA M EH GI L   R
Sbjct  600   SPCSVGILVDRGLGGKSHISASNVDYTVTALFFGGHDDREALSYGALMAEHTGINLNAVR  659

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAET  499
             F +D +  G SV+L++             DE+FLA FKQ+ S + S+KY+E VV +AAET
Sbjct  660   FVVDTKVVGESVQLEIKDQYGPEVTS---DEEFLAEFKQKVSQDGSIKYDEIVVSNAAET  716

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             ++ IR YNRCNL V+GRMPEG++VAA++KK ECPELGP+GNLL   EF TTASVLVVQQY
Sbjct  717   VDVIRKYNRCNLFVIGRMPEGQLVAALNKKTECPELGPVGNLLISLEFKTTASVLVVQQY  776

Query  318   RTELSKN---GLKEDDSVDGDYES  256
             R++L+ +    LK++ + + +Y+S
Sbjct  777   RSQLTGDSLASLKDECTTEEEYDS  800



>gb|EYU40046.1| hypothetical protein MIMGU_mgv1a001527mg [Erythranthe guttata]
Length=802

 Score =  1088 bits (2814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/792 (75%), Positives = 677/792 (85%), Gaps = 7/792 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M SNGT  CP PMKA SNG FQGD+PL +ALPLLIVQICLVV+LTRVLAY+LRPLRQPRV
Sbjct  1     MASNGTAKCPPPMKAASNGVFQGDNPLHFALPLLIVQICLVVVLTRVLAYILRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEIIGGVLLGPSA GR+  YL AIFP +SLTVLDTLA+LGLLFFLFLVGLELDPKSLR+
Sbjct  61    IAEIIGGVLLGPSALGRNHKYLQAIFPARSLTVLDTLANLGLLFFLFLVGLELDPKSLRQ  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIALAGISLPF LG+GTS +LRATI+KGV++GPFLVFMGVALSITAFPVLARIL
Sbjct  121   TGKKALSIALAGISLPFALGVGTSIVLRATISKGVNEGPFLVFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSG G SPL+SLWV LCG GF+  CI
Sbjct  181   AELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGVGRSPLVSLWVFLCGFGFITSCI  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              + P IFKW+A RC +GEPVDEIY+CA LAAVL AGFVTDTIGIHALFGAFV+GVLVPK+
Sbjct  241   FIAPPIFKWIARRCPQGEPVDEIYICATLAAVLAAGFVTDTIGIHALFGAFVMGVLVPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A ALVEKVEDLVSGLFLPLYFVSSGLKT+VATIQGA+SWGLL LVIFTACFGKI+GT
Sbjct  301   GAFAGALVEKVEDLVSGLFLPLYFVSSGLKTDVATIQGAESWGLLALVIFTACFGKIVGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             +LVS LC++PF+EA+TLGFLMNTKGLVELIVLNIG+DRGVLNDQTFAIMVLMALFTTF+T
Sbjct  361   VLVSLLCKVPFKEALTLGFLMNTKGLVELIVLNIGRDRGVLNDQTFAIMVLMALFTTFLT  420

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             TPIV+A+YKPA++A  EYKYRTIQRK+ + Q+R+L CFHS RNIP+L+NLIEASRGT K 
Sbjct  421   TPIVMAIYKPAQMAKFEYKYRTIQRKEANTQIRMLACFHSTRNIPTLMNLIEASRGTGKK  480

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
             GG +VYAMHLMELSERSSAILM HKARKNGLPFWN +   +DS +IVVAFE F HLS+VS
Sbjct  481   GGLRVYAMHLMELSERSSAILMVHKARKNGLPFWN-KSNTSDSNQIVVAFEAFHHLSQVS  539

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             IRP+TAIS MSSMHEDI  SA+ KR A+IILPFHKHQ+ DGH ETTR + RHVNR+VLE 
Sbjct  540   IRPTTAISPMSSMHEDICTSADSKRAAIIILPFHKHQRFDGHLETTRADFRHVNRKVLEH  599

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             +PCSVGILVDRGLGG SHVSASNV+YT+T  +FGGHDDREA +YGA M EH GI L   R
Sbjct  600   SPCSVGILVDRGLGGNSHVSASNVNYTVTAFFFGGHDDREAFSYGALMAEHNGIRLNAVR  659

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDED--FLAAFKQRNSTNSSVKYEEKVVKSAA  505
               LD +  G SV++D++            DED  FL  FK++ S + S++YEE VV   A
Sbjct  660   LILDRKVVGDSVRVDINDENVPEGLA---DEDFSFLEEFKEKVSEDGSIEYEEVVVSDVA  716

Query  504   ETMEAIRGY-NRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVV  328
             E +  ++G+ NRCNL +VGRMPEG++VAA+ +K ECPELGP+GNLL   E   TASVLVV
Sbjct  717   EAVGVVQGFNNRCNLFLVGRMPEGQLVAAIGRKSECPELGPVGNLLISPEMKITASVLVV  776

Query  327   QQYRTELSKNGL  292
             QQYR+ L+ + L
Sbjct  777   QQYRSSLTGDSL  788



>ref|XP_007040407.1| Cation/H+ exchanger 18 [Theobroma cacao]
 gb|EOY24908.1| Cation/H+ exchanger 18 [Theobroma cacao]
Length=806

 Score =  1081 bits (2796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/808 (73%), Positives = 680/808 (84%), Gaps = 8/808 (1%)
 Frame = -1

Query  2658  MGSNGTVV--CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M +N T    CP+PMKATSNG FQGD+PLDYALPL I+QICLVV LTR+LA+LLRPLRQP
Sbjct  1     MATNATTASHCPSPMKATSNGLFQGDNPLDYALPLAILQICLVVALTRILAFLLRPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEI+GG+LLGPSA GR+E YLNAIFP +SLTVLDTLA+LGLLFFLFLVGLELDPKSL
Sbjct  61    RVIAEIVGGILLGPSALGRNEKYLNAIFPSRSLTVLDTLANLGLLFFLFLVGLELDPKSL  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             RRTGKKAL IALAGIS+PF LGIGTSF L ATI+KGV + PFLVFMGVALSITAFPVLAR
Sbjct  121   RRTGKKALCIALAGISVPFALGIGTSFALHATISKGVDEAPFLVFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTTD+G+MAMSAAAVNDVAAWILLALAIALSGTGHSPL+SLWV LCG+GFVL 
Sbjct  181   ILAELKLLTTDIGRMAMSAAAVNDVAAWILLALAIALSGTGHSPLVSLWVFLCGSGFVLC  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
             CI +VP IFKWMA RC EGEPV+E+Y+CA LAAVL AGFVTD+IGIHALFGAFVIGVLVP
Sbjct  241   CIFIVPPIFKWMAQRCPEGEPVEELYICATLAAVLAAGFVTDSIGIHALFGAFVIGVLVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             K+GP A ALVEKVEDLVSGLFLPLYFVSSGLKTNVATI+GAQSWGLLVLVI TAC GKI+
Sbjct  301   KEGPFAGALVEKVEDLVSGLFLPLYFVSSGLKTNVATIRGAQSWGLLVLVIITACLGKIV  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GT+ VS +C++PFQEA  LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMA+FTTF
Sbjct  361   GTVSVSLMCKVPFQEAAALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMAIFTTF  420

Query  1404  ITTPIVIALYKPAK-LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             ITTP+V+A+YKPAK ++  ++KYRTI+RKD + QLRIL CFHS RNIPS+INLIEASRGT
Sbjct  421   ITTPLVMAVYKPAKRMSKRDHKYRTIERKDTNTQLRILACFHSTRNIPSMINLIEASRGT  480

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
             EK  G  VYAMHLMELSER SAILM HKARKNGLPFWN +G+ ++S ++VVAFETF  LS
Sbjct  481   EKKEGLCVYAMHLMELSERPSAILMVHKARKNGLPFWN-KGKQSNSDQVVVAFETFRQLS  539

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +VS+RP TAISAMS MHEDI  SAE KR A+IILPFH+HQ++DG  ETTR E   VN++V
Sbjct  540   RVSVRPMTAISAMSGMHEDICTSAERKRAAVIILPFHRHQRLDGSLETTRTEFHSVNKQV  599

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             L  APCSVGILVDRGLGGT+H+SASNV    TVL+FGGHDDREAL YGARM EHPGI L 
Sbjct  600   LAEAPCSVGILVDRGLGGTTHISASNVSSITTVLFFGGHDDREALTYGARMAEHPGISLT  659

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSA  508
             V RF   PE +G  +      + S++ E  + DE  L  FK++ S +S++ YEE+VV+++
Sbjct  660   VIRFLPGPEISGDEIVRTDINTISNASEGST-DERALIEFKKKISNDSTISYEERVVQNS  718

Query  507   AETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVV  328
              ET+E IR ++RCNL +VGRMPE ++ A ++ K +CPELGP+G LL+  EFST+ASVLVV
Sbjct  719   TETIEVIREFSRCNLFLVGRMPESQVAATLNAKSDCPELGPVGTLLTSPEFSTSASVLVV  778

Query  327   QQYRTEL---SKNGLKEDDSVDGDYESA  253
             QQ+       S    K  ++ D D ESA
Sbjct  779   QQFTKHSPPPSVTSTKVAETPDPDIESA  806



>ref|XP_004233089.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum lycopersicum]
Length=828

 Score =  1066 bits (2757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 583/781 (75%), Positives = 669/781 (86%), Gaps = 4/781 (1%)
 Frame = -1

Query  2628  APMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLL  2449
             +PM ATS+G  QGD+PL Y+LPL+IVQICLV++LTRVLAYLLRPLRQPRV+AEIIGG+LL
Sbjct  8     SPMHATSSGLLQGDNPLHYSLPLVIVQICLVLVLTRVLAYLLRPLRQPRVVAEIIGGILL  67

Query  2448  GPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIAL  2269
             GPSA GR++ YLNAIFP  SL VLDTLA+LGLLFFLFLVG ELDP+SLRRTGKKAL IAL
Sbjct  68    GPSALGRNKNYLNAIFPPSSLPVLDTLANLGLLFFLFLVGTELDPRSLRRTGKKALCIAL  127

Query  2268  AGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDV  2089
             AGI+LPF LGIGTSF LR+TIA+GV+Q PFLVFMGVALSITAFPVLARILAELKLLTTDV
Sbjct  128   AGITLPFVLGIGTSFALRSTIAQGVNQAPFLVFMGVALSITAFPVLARILAELKLLTTDV  187

Query  2088  GQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWM  1909
             G+MAMSAAAVNDVAAWILLALAIALSG+G SP++SLWVLL G+GF+LLCIL+ PRIFKWM
Sbjct  188   GRMAMSAAAVNDVAAWILLALAIALSGSG-SPIVSLWVLLSGSGFILLCILIAPRIFKWM  246

Query  1908  ASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEK  1729
             A +C EGEPV+E+YVCA LA VL AGF TD IGIHALFGAFV+GVLVPK+GP A ALVEK
Sbjct  247   AKQCPEGEPVNELYVCATLAIVLAAGFATDAIGIHALFGAFVVGVLVPKEGPFAGALVEK  306

Query  1728  VEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIP  1549
             VEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVI T+CFGKI GT+ VS +C++ 
Sbjct  307   VEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIATSCFGKIAGTVCVSLMCKLS  366

Query  1548  FQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKP  1369
              QE++ LGFLMNTKGLVELIVLNIGKD+GVLNDQ FAIMVLMALFTTF+TTP+VIA YKP
Sbjct  367   VQESLALGFLMNTKGLVELIVLNIGKDKGVLNDQIFAIMVLMALFTTFMTTPLVIATYKP  426

Query  1368  AKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHL  1189
             AK+AVTEYK RTI RKD SKQLRILTCFH  RNIP+LINLIEA+RGT+K  G +VYAMHL
Sbjct  427   AKMAVTEYKNRTIMRKDTSKQLRILTCFHGTRNIPTLINLIEATRGTDKKEGLRVYAMHL  486

Query  1188  MELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAM  1009
             +EL+ER SAILM HKARKNGLP WN + +  +S +++VAFETF  LSKVSIRP+TAIS M
Sbjct  487   LELTERPSAILMVHKARKNGLPLWN-KEKAGESNQVIVAFETFGQLSKVSIRPNTAISPM  545

Query  1008  SSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVD  829
             SSMHEDIIASAE KRV+MII+PFHKHQ++DGHFETTR +LR+VNRRVLE APCSVGI++D
Sbjct  546   SSMHEDIIASAERKRVSMIIVPFHKHQRLDGHFETTRADLRNVNRRVLEHAPCSVGIIID  605

Query  828   RGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGT  649
             RGLGG SHVSAS V+Y++ VL+FGGHDDREALAYG R+ EHPGI L V RF +DP   G 
Sbjct  606   RGLGGASHVSASEVNYSVLVLFFGGHDDREALAYGMRVAEHPGITLNVVRFIIDPAVIGA  665

Query  648   svkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGYNRC  469
                       SS   E   DE FL+  KQ++S +SS+ +++ +VK   ET E IRG+ +C
Sbjct  666   -SVHVDIVQNSSPVPESQEDEIFLSDMKQKSSGDSSIIFQDSIVKDIRETTEVIRGFKKC  724

Query  468   NLLVVGRMPEGEIVAAMDKKG-ECPELGPLGNLLSCKEFSTTASVLVVQQYRTELSKNGL  292
             NL +VGRM EG++V+A D K   CPELGPLGNLL   E ST+ASVLVVQQYR+EL +  L
Sbjct  725   NLFIVGRMSEGQLVSAFDSKSHHCPELGPLGNLLISGEISTSASVLVVQQYRSELPQESL  784

Query  291   K  289
             +
Sbjct  785   R  785



>ref|XP_010106576.1| Cation/H(+) antiporter 18 [Morus notabilis]
 gb|EXC10830.1| Cation/H(+) antiporter 18 [Morus notabilis]
Length=798

 Score =  1066 bits (2756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/792 (73%), Positives = 674/792 (85%), Gaps = 5/792 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             MG+NGT  CP+PMKATSNG FQGD PL +ALPL+I+QICLV+++TRVLA+L+RPLRQPRV
Sbjct  1     MGTNGTA-CPSPMKATSNGVFQGDDPLHFALPLVILQICLVLVVTRVLAFLMRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEIIGG+LLGPSA GR++ YL+AIFP +SLTVLDTLA+LGLLFFLFLVGLELDPKS+RR
Sbjct  60    IAEIIGGILLGPSALGRNQNYLHAIFPARSLTVLDTLANLGLLFFLFLVGLELDPKSIRR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKAL IA+ GISLPF LGIG+SFILRATI+KGVS   FLVFMGVALSITAFPVLARIL
Sbjct  120   TGKKALGIAIVGISLPFALGIGSSFILRATISKGVSSAAFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG+MAMSAAAVNDVAAW+LLALAIALSG+  SPL+SLWVLL G  FV+ CI
Sbjct  180   AELKLLTTDVGRMAMSAAAVNDVAAWVLLALAIALSGSNQSPLVSLWVLLSGCIFVISCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
             ++VP IFKWM+ RC EGEPVDE+Y+CA LAAVL AGF+TDTIGIHA+FGAFVIGVLVPKD
Sbjct  240   ILVPPIFKWMSQRCHEGEPVDEMYICATLAAVLAAGFITDTIGIHAMFGAFVIGVLVPKD  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GPLA ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQG QSWGLLVLVIFTACFGKI GT
Sbjct  300   GPLAGALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGLQSWGLLVLVIFTACFGKIFGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             ++VS  C++P +EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIM+LMA+FTTFIT
Sbjct  360   VMVSLYCKVPIREALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMILMAVFTTFIT  419

Query  1398  TPIVIALYKPAKLA-VTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEK  1222
             TP+V+A+YKPAK A + EYKYRTI+RK+P+ QLRIL CFHS+RN+PSL+NL+E+SRGTEK
Sbjct  420   TPLVVAVYKPAKRARMAEYKYRTIERKNPNSQLRILACFHSQRNVPSLLNLLESSRGTEK  479

Query  1221  SGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKV  1042
                  VYA+HLMELSERSSAILM HKAR+NGLPFWN +G  +DS  IVVAFE +  L +V
Sbjct  480   HQELCVYALHLMELSERSSAILMVHKARRNGLPFWN-KGHRSDSGNIVVAFEAYRQLGRV  538

Query  1041  SIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLE  862
             S+RP T+IS+MS MHEDI  +AEGKR A+IILPFHKHQ++DG  ETTR++ R VNRRVLE
Sbjct  539   SVRPMTSISSMSDMHEDICTTAEGKRAAIIILPFHKHQRLDGSLETTRSDFRWVNRRVLE  598

Query  861   GAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVA  682
              APCSVGI VDRGLGG+SHV+ASNV Y+ITVL+FGG DDREALAYG+RM EHPGI L V 
Sbjct  599   RAPCSVGIFVDRGLGGSSHVAASNVSYSITVLFFGGRDDREALAYGSRMAEHPGIRLTVI  658

Query  681   RFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAE  502
             RF ++ E AG   ++++    S+  +    DE  L  FK+  + N+SVKYEEK V S  +
Sbjct  659   RFLVEREAAGEITRVNMEEDSSTILDSV--DEVLLNEFKKTKADNNSVKYEEKAVTSPEQ  716

Query  501   TMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQ  322
              +  IR   RCNL +VGRMP GE+  A+ ++ ECPELGP+G LL+  +FSTTASVLV+QQ
Sbjct  717   AIAIIRETGRCNLYLVGRMPAGEVALALTRRSECPELGPVGTLLTSPDFSTTASVLVLQQ  776

Query  321   YRTELSKNGLKE  286
             Y  ++ +N   E
Sbjct  777   YNGQVPQNFTSE  788



>ref|XP_006355611.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum tuberosum]
Length=823

 Score =  1062 bits (2746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/781 (74%), Positives = 675/781 (86%), Gaps = 3/781 (0%)
 Frame = -1

Query  2628  APMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLL  2449
             +PM ATS+G  QGD+PL Y+LPL+IVQICLV++LTRVLAY+LRPLRQPRV+AEIIGG+LL
Sbjct  8     SPMHATSSGLLQGDNPLHYSLPLVIVQICLVLVLTRVLAYILRPLRQPRVVAEIIGGILL  67

Query  2448  GPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIAL  2269
             GPSA GR++ YLN IFP  SL VLDTLA+LGLLFFLFLVG ELDP+SLRRTGKKAL IA 
Sbjct  68    GPSALGRNKNYLNTIFPPNSLPVLDTLANLGLLFFLFLVGTELDPRSLRRTGKKALCIAF  127

Query  2268  AGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDV  2089
             AGI+LPF LGIGTSF LR+TIA+GV+Q PFLVFMGVALSITAFPVLARILAELKLLTTDV
Sbjct  128   AGITLPFVLGIGTSFALRSTIAQGVNQAPFLVFMGVALSITAFPVLARILAELKLLTTDV  187

Query  2088  GQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWM  1909
             G+MAMSAAAVNDVAAWILLALAIALSG+G SP++SLWVLL GTGF+LLCI++ PRIF WM
Sbjct  188   GRMAMSAAAVNDVAAWILLALAIALSGSG-SPIVSLWVLLSGTGFILLCIVIAPRIFNWM  246

Query  1908  ASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEK  1729
             A +C EGEPV+E+YVCA LA VL AGFVTD IGIHALFGAFV+GVLVPK+GP A ALVEK
Sbjct  247   ARQCPEGEPVNELYVCATLAIVLAAGFVTDAIGIHALFGAFVVGVLVPKEGPFAGALVEK  306

Query  1728  VEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIP  1549
             VEDLV+GLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVI T+CFGKI+GTI VS +C++ 
Sbjct  307   VEDLVTGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVITTSCFGKIVGTICVSLMCKLS  366

Query  1548  FQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKP  1369
              QE++ LGFLMNTKGLVELIVLNIGKD+GVLNDQ FAIMVLMALFTTF+TTP+VIA YKP
Sbjct  367   VQESLALGFLMNTKGLVELIVLNIGKDKGVLNDQIFAIMVLMALFTTFMTTPLVIATYKP  426

Query  1368  AKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHL  1189
             AK+AVTEYK+RTI RKD +KQLRILTCFH  RNIP+LINLIEA+RGTEK  G +VYAMHL
Sbjct  427   AKMAVTEYKHRTIMRKDTTKQLRILTCFHGTRNIPTLINLIEATRGTEKKEGLRVYAMHL  486

Query  1188  MELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAM  1009
             +EL+ER SAILM HKARKNGLP WN + +  +S +++VAFETF  LSKVSIRP+TAIS M
Sbjct  487   LELTERPSAILMVHKARKNGLPLWN-KEKAGESNQVIVAFETFGQLSKVSIRPTTAISPM  545

Query  1008  SSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVD  829
             SSMHEDIIASAE KRV+MII+PFHKHQ++DGHFETTR +LR+VNRRVLE APCSVGI++D
Sbjct  546   SSMHEDIIASAERKRVSMIIVPFHKHQRLDGHFETTRADLRNVNRRVLEHAPCSVGIIID  605

Query  828   RGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGT  649
             RGLGG SHVSAS V+YT+ VL+FGGHDDREALAYG R+ EH GI L V RF +DP   G 
Sbjct  606   RGLGGASHVSASEVNYTVLVLFFGGHDDREALAYGMRVAEHHGITLNVVRFIIDPAVIGA  665

Query  648   svkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGYNRC  469
             SV +D++ +    PE    D+ +L+  KQ++S +SS+ ++E +VK   ET+E IRG+ +C
Sbjct  666   SVHVDIAQNSGPVPESSQEDDIYLSDQKQKSSGDSSIVFQESIVKDVRETIEVIRGFKKC  725

Query  468   NLLVVGRMPEGEIVAAMDKKG-ECPELGPLGNLLSCKEFSTTASVLVVQQYRTELSKNGL  292
             NL +VGRM EG++V+A D K  +CPELG LGNLL   E ST+ASVLVVQQYR+EL +  L
Sbjct  726   NLFIVGRMSEGQLVSAFDSKSHDCPELGRLGNLLISGEISTSASVLVVQQYRSELPQESL  785

Query  291   K  289
             +
Sbjct  786   R  786



>ref|XP_004298855.1| PREDICTED: cation/H(+) antiporter 18-like [Fragaria vesca subsp. 
vesca]
Length=803

 Score =  1051 bits (2717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 575/805 (71%), Positives = 677/805 (84%), Gaps = 7/805 (1%)
 Frame = -1

Query  2658  MGSNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M +NG+   +CP+PMKATSNG FQGD+PL +ALPL I+QIC+VV LTR LAYLL+PLRQP
Sbjct  1     MATNGSAGHICPSPMKATSNGVFQGDNPLHFALPLAILQICIVVALTRGLAYLLKPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEIIGGVLLGPSA GR+++YL AIFP KS+TVLDTLA+LGLLFFLFL GLE+DPK+L
Sbjct  61    RVIAEIIGGVLLGPSALGRNKSYLQAIFPPKSITVLDTLANLGLLFFLFLAGLEIDPKAL  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             R+TGKKAL+IA+ GISLPF LGIG+SF+LRATI+KGV    FLVFMGVALSITAFPVLAR
Sbjct  121   RQTGKKALAIAVIGISLPFALGIGSSFVLRATISKGVDLTAFLVFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTT++G++AMSAAAVNDVAAW+LLALAIALSG+  SPL+SLWVLL G  FV+ 
Sbjct  181   ILAELKLLTTEIGRLAMSAAAVNDVAAWVLLALAIALSGSNQSPLVSLWVLLSGFVFVIC  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
              ILVVP IFKWMA RC EGEP+DEIYVCA L AVL AGF+TDTIGIHA+FGAFVIGVLVP
Sbjct  241   AILVVPSIFKWMAQRCHEGEPIDEIYVCATLTAVLAAGFITDTIGIHAMFGAFVIGVLVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             K+GP   +LVEKVEDLVSGLFLPLYFVSSGLKTNVATI+G QSWGLLVLVIFTACFGKI 
Sbjct  301   KEGPFVGSLVEKVEDLVSGLFLPLYFVSSGLKTNVATIEGVQSWGLLVLVIFTACFGKIF  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GT++VS LC++P +EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTF
Sbjct  361   GTVMVSLLCKVPVREALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTF  420

Query  1404  ITTPIVIALYKPAKLA-VTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             ITTP+V A+YKPAK A + +YKY+TI+RK+ + QLRIL+CFHS RNIPS+INL+EASRGT
Sbjct  421   ITTPLVTAVYKPAKRARMADYKYKTIERKNTNSQLRILSCFHSARNIPSIINLLEASRGT  480

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
             +K  G  VYAMHLMELSERSSAILM HKAR+NGLPFWN +G  +++  +VVAFE ++ LS
Sbjct  481   KKRDGLCVYAMHLMELSERSSAILMVHKARRNGLPFWN-KGLRSNTDNVVVAFEAYQQLS  539

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
              VSIRP T IS++S+MHEDI A+AE KR A+IILPFHKHQ++DG  ETTRN+ R VN+RV
Sbjct  540   HVSIRPMTEISSVSNMHEDICATAENKRAAIIILPFHKHQRLDGTLETTRNDFRGVNKRV  599

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             LE APCSVGILVDRGLGGT+H++ASNV Y ITVLYFGG DDREALAYGARM EHPGI LV
Sbjct  600   LEHAPCSVGILVDRGLGGTTHIAASNVSYFITVLYFGGRDDREALAYGARMAEHPGIRLV  659

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSA  508
             V RF ++PE  G    +D+  +  S       DE+FLA FK R   + S+ YEEKVV++ 
Sbjct  660   VIRFLVEPEIVGEISTVDIDHNSGSKVGSV--DEEFLAEFKHRIVQDDSITYEEKVVRNE  717

Query  507   AETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVV  328
             A+T+  IR   RC+L +VGR P GE+  A++K+ ECPELGP+G+LL   +FST ASVLV+
Sbjct  718   AQTIGVIREKGRCHLFLVGRCPGGEVALALNKRSECPELGPVGSLLISPDFSTQASVLVL  777

Query  327   QQYRTELSKNGLKE-DDSVDGDYES  256
             QQY  ++  N   E ++S+D D +S
Sbjct  778   QQYNGQVPLNLASEMEESLDKDTDS  802



>gb|KHG06330.1| hypothetical protein F383_32801 [Gossypium arboreum]
Length=818

 Score =  1048 bits (2711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/778 (74%), Positives = 657/778 (84%), Gaps = 15/778 (2%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CP+PMKATSNG FQGD+PLD+ALPL I+QICLVV LTR+LA+LLRPLRQPRVIAEI+GG+
Sbjct  27    CPSPMKATSNGVFQGDNPLDFALPLAILQICLVVALTRILAFLLRPLRQPRVIAEIVGGI  86

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPS  GR+E YLNAIFP KS TVLDTLA+LGLLFFLFLVGLELDPKS+RRTGKKALSI
Sbjct  87    LLGPSVLGRNEKYLNAIFPAKSHTVLDTLANLGLLFFLFLVGLELDPKSIRRTGKKALSI  146

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             A+AGISLPF LGIGTS+ LRATI+KGV + PFLVFMGVALSITAFPVLARILAELKLLTT
Sbjct  147   AVAGISLPFMLGIGTSYALRATISKGVDEAPFLVFMGVALSITAFPVLARILAELKLLTT  206

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             D+G+MAMSAAAVNDVAAWILLALAIALSGTG+SPL+SLWV LCGTGFV+ C  +VP IFK
Sbjct  207   DIGRMAMSAAAVNDVAAWILLALAIALSGTGNSPLVSLWVFLCGTGFVVGCTFIVPPIFK  266

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             WM  RC EGEPV+E+YVCA L AVL AGFVTD IGIHALFGAFVIGVLVPK+GP A ALV
Sbjct  267   WMVQRCPEGEPVNELYVCATLTAVLAAGFVTDLIGIHALFGAFVIGVLVPKEGPFAGALV  326

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVSGLFLPLYFVSSGLKTN+ATIQGAQSWGLLVLVI TACFGKI GT+ VS LC 
Sbjct  327   EKVEDLVSGLFLPLYFVSSGLKTNIATIQGAQSWGLLVLVIITACFGKIAGTVSVSLLCN  386

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +PF EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMA+FTTFITTP+V+A+Y
Sbjct  387   VPFSEALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTTFITTPLVMAVY  446

Query  1374  KPAK-LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYA  1198
             KPAK     +YK++TI+RK+ + QLRIL CFHS RNIP++INLIEASRGTEK  G  VYA
Sbjct  447   KPAKRQGKGDYKHKTIERKESNSQLRILACFHSYRNIPTMINLIEASRGTEKKEGLCVYA  506

Query  1197  MHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAI  1018
             +HLMELSER SA+LM HKARKNGLPFWN + + +   +IVVAFETF  LS+V +RP TAI
Sbjct  507   LHLMELSERPSAMLMVHKARKNGLPFWN-KVKQSGGDQIVVAFETFRQLSRVVVRPMTAI  565

Query  1017  SAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGI  838
             S++SS+HEDI  SAE KR AMIILPFHKHQ++DG FETTR + + VN+RVLE APCSVGI
Sbjct  566   SSISSLHEDICESAERKRAAMIILPFHKHQRVDGTFETTRTDYQLVNKRVLEQAPCSVGI  625

Query  837   LVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPET  658
             LVDRGLGGT+H+SASNVD  ITVL+FGGHDDREALAYG RM EHPGI L V RF   PE 
Sbjct  626   LVDRGLGGTTHISASNVDSIITVLFFGGHDDREALAYGTRMAEHPGISLTVVRFVPGPEV  685

Query  657   AGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGY  478
             +G  V  D++ S          D+  L  FK + S  +S+ YEE+VV+S+ ET+EAIR +
Sbjct  686   SGEIVTADINTS----------DDRVLMEFKNKASNENSISYEERVVRSSRETIEAIREF  735

Query  477   NRCNLLVVGRMPEGEIVAAMD---KKGECPELGPLGNLLSCKEFSTTASVLVVQQYRT  313
             +RCNL +VG+MPE  + A       K EC ELG +G+LL+  EFST+ASVLVVQQYRT
Sbjct  736   SRCNLFLVGQMPENHVTATAKLNAAKTECLELGVIGSLLTSAEFSTSASVLVVQQYRT  793



>ref|XP_009334467.1| PREDICTED: cation/H(+) antiporter 18 [Pyrus x bretschneideri]
 ref|XP_009334468.1| PREDICTED: cation/H(+) antiporter 18 [Pyrus x bretschneideri]
 ref|XP_009334469.1| PREDICTED: cation/H(+) antiporter 18 [Pyrus x bretschneideri]
 ref|XP_009334470.1| PREDICTED: cation/H(+) antiporter 18 [Pyrus x bretschneideri]
 ref|XP_009334471.1| PREDICTED: cation/H(+) antiporter 18 [Pyrus x bretschneideri]
 ref|XP_009334472.1| PREDICTED: cation/H(+) antiporter 18 [Pyrus x bretschneideri]
Length=807

 Score =  1048 bits (2711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/784 (73%), Positives = 669/784 (85%), Gaps = 6/784 (1%)
 Frame = -1

Query  2658  MGSNGTVV--CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M +N TV   CPAPM+ATSNG FQGD+PLD+ALPL I+QICLVV LTR+LAYLLRPLRQP
Sbjct  1     MATNTTVANACPAPMQATSNGVFQGDNPLDFALPLAILQICLVVALTRILAYLLRPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEI+GG+LLGPSA GR++ YL AIFP +SLTVLDTLA+LGLLFFLFLVGLELDPKSL
Sbjct  61    RVIAEIVGGILLGPSALGRNKDYLEAIFPNRSLTVLDTLANLGLLFFLFLVGLELDPKSL  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             RRTGKKAL IALAGI+LPF LGIGTSF L+ TI+KGV   PFLVFMGVALSITAFPVLAR
Sbjct  121   RRTGKKALCIALAGITLPFVLGIGTSFALKGTISKGVDGPPFLVFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTTD+G+MAMSAAAVNDVAAWILLALAI+LS TG SPL+SLWVLLCG  FVL 
Sbjct  181   ILAELKLLTTDIGRMAMSAAAVNDVAAWILLALAISLSSTGRSPLVSLWVLLCGCAFVLS  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
             C+  +  IFKWMA RC EGEPVDE+YVCA L AVL AGFVTDTIGIHALFGAFV+G++VP
Sbjct  241   CVFFIRPIFKWMAQRCPEGEPVDELYVCATLVAVLAAGFVTDTIGIHALFGAFVLGIIVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             K+GP A ALVEKVEDLVSGLFLPLYFVSSGLKT++ATI+GAQSWGLLVLVI TACFGKI+
Sbjct  301   KEGPFAGALVEKVEDLVSGLFLPLYFVSSGLKTDIATIRGAQSWGLLVLVISTACFGKII  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GT+ VS LCR+PFQEA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMA+FTTF
Sbjct  361   GTVAVSLLCRVPFQEALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMAIFTTF  420

Query  1404  ITTPIVIALYKPAKL-AVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             +TTP+V+A+YKPAK  ++++YKYRTI+RKDP+ +LR+L CFH  RN+P++INLIEASRGT
Sbjct  421   VTTPVVMAVYKPAKRKSISDYKYRTIERKDPNTELRVLICFHGTRNLPTMINLIEASRGT  480

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
             EK     VYAMHLMEL+ERSSAILM HKAR+NGLPFWN + + +D+ ++VVAFETFE LS
Sbjct  481   EKKERLCVYAMHLMELNERSSAILMVHKARRNGLPFWN-KVKDSDNNQVVVAFETFEQLS  539

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +V+IRP TAIS++SSMHEDI A AE K  ++IILPFHKHQ++DG  ETTR E R VNRRV
Sbjct  540   RVAIRPMTAISSVSSMHEDICAMAERKGASIIILPFHKHQRLDGVLETTRTEYRGVNRRV  599

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             LE APCSVGI+VDRGLGG++HVSASNV  +I VL+FGG DDREALAYG RM EHPG  L 
Sbjct  600   LEHAPCSVGIMVDRGLGGSTHVSASNVSSSIVVLFFGGSDDREALAYGMRMAEHPGNSLT  659

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSA  508
             V  F   PE  G  V++D++   +++    +  E FLA  KQ+ S N S+KYEE+ V++A
Sbjct  660   VVHFLASPELQGEIVQVDINEGSNTTAGSAT--EMFLAELKQKISNNRSIKYEERAVRNA  717

Query  507   AETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVV  328
             AET + IR +NRCNL +VGR P G++ AA++ KG+CPELGP+G LL+  +F+TTASVLV+
Sbjct  718   AETTDLIREFNRCNLFLVGRRPHGQVAAALNLKGDCPELGPVGILLTSPDFTTTASVLVM  777

Query  327   QQYR  316
             QQY 
Sbjct  778   QQYH  781



>gb|KHG06329.1| hypothetical protein F383_32801 [Gossypium arboreum]
Length=802

 Score =  1047 bits (2707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/778 (74%), Positives = 657/778 (84%), Gaps = 15/778 (2%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CP+PMKATSNG FQGD+PLD+ALPL I+QICLVV LTR+LA+LLRPLRQPRVIAEI+GG+
Sbjct  11    CPSPMKATSNGVFQGDNPLDFALPLAILQICLVVALTRILAFLLRPLRQPRVIAEIVGGI  70

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPS  GR+E YLNAIFP KS TVLDTLA+LGLLFFLFLVGLELDPKS+RRTGKKALSI
Sbjct  71    LLGPSVLGRNEKYLNAIFPAKSHTVLDTLANLGLLFFLFLVGLELDPKSIRRTGKKALSI  130

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             A+AGISLPF LGIGTS+ LRATI+KGV + PFLVFMGVALSITAFPVLARILAELKLLTT
Sbjct  131   AVAGISLPFMLGIGTSYALRATISKGVDEAPFLVFMGVALSITAFPVLARILAELKLLTT  190

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             D+G+MAMSAAAVNDVAAWILLALAIALSGTG+SPL+SLWV LCGTGFV+ C  +VP IFK
Sbjct  191   DIGRMAMSAAAVNDVAAWILLALAIALSGTGNSPLVSLWVFLCGTGFVVGCTFIVPPIFK  250

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             WM  RC EGEPV+E+YVCA L AVL AGFVTD IGIHALFGAFVIGVLVPK+GP A ALV
Sbjct  251   WMVQRCPEGEPVNELYVCATLTAVLAAGFVTDLIGIHALFGAFVIGVLVPKEGPFAGALV  310

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVSGLFLPLYFVSSGLKTN+ATIQGAQSWGLLVLVI TACFGKI GT+ VS LC 
Sbjct  311   EKVEDLVSGLFLPLYFVSSGLKTNIATIQGAQSWGLLVLVIITACFGKIAGTVSVSLLCN  370

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +PF EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMA+FTTFITTP+V+A+Y
Sbjct  371   VPFSEALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTTFITTPLVMAVY  430

Query  1374  KPAK-LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYA  1198
             KPAK     +YK++TI+RK+ + QLRIL CFHS RNIP++INLIEASRGTEK  G  VYA
Sbjct  431   KPAKRQGKGDYKHKTIERKESNSQLRILACFHSYRNIPTMINLIEASRGTEKKEGLCVYA  490

Query  1197  MHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAI  1018
             +HLMELSER SA+LM HKARKNGLPFWN + + +   +IVVAFETF  LS+V +RP TAI
Sbjct  491   LHLMELSERPSAMLMVHKARKNGLPFWN-KVKQSGGDQIVVAFETFRQLSRVVVRPMTAI  549

Query  1017  SAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGI  838
             S++SS+HEDI  SAE KR AMIILPFHKHQ++DG FETTR + + VN+RVLE APCSVGI
Sbjct  550   SSISSLHEDICESAERKRAAMIILPFHKHQRVDGTFETTRTDYQLVNKRVLEQAPCSVGI  609

Query  837   LVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPET  658
             LVDRGLGGT+H+SASNVD  ITVL+FGGHDDREALAYG RM EHPGI L V RF   PE 
Sbjct  610   LVDRGLGGTTHISASNVDSIITVLFFGGHDDREALAYGTRMAEHPGISLTVVRFVPGPEV  669

Query  657   AGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGY  478
             +G  V  D++ S          D+  L  FK + S  +S+ YEE+VV+S+ ET+EAIR +
Sbjct  670   SGEIVTADINTS----------DDRVLMEFKNKASNENSISYEERVVRSSRETIEAIREF  719

Query  477   NRCNLLVVGRMPEGEIVAAMD---KKGECPELGPLGNLLSCKEFSTTASVLVVQQYRT  313
             +RCNL +VG+MPE  + A       K EC ELG +G+LL+  EFST+ASVLVVQQYRT
Sbjct  720   SRCNLFLVGQMPENHVTATAKLNAAKTECLELGVIGSLLTSAEFSTSASVLVVQQYRT  777



>ref|XP_008238994.1| PREDICTED: cation/H(+) antiporter 18-like [Prunus mume]
 ref|XP_008238995.1| PREDICTED: cation/H(+) antiporter 18-like [Prunus mume]
Length=808

 Score =  1046 bits (2704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/787 (74%), Positives = 667/787 (85%), Gaps = 12/787 (2%)
 Frame = -1

Query  2658  MGSNGTVV--CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M +N TV   CPAPMKATSNG FQGD+PLD+ALPL I+QICLVV LTR+LAYLLRPLRQP
Sbjct  1     MVTNATVASACPAPMKATSNGVFQGDNPLDFALPLAILQICLVVALTRILAYLLRPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEI+GG+LLGPSA G S+ YL+ IFPK+SLTVLDTLA+LGLLFFLFLVGLELDPKS+
Sbjct  61    RVIAEIVGGILLGPSALGHSKNYLDTIFPKRSLTVLDTLANLGLLFFLFLVGLELDPKSI  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             RRTGKKAL IA AGI+LPF LGIGTSF LRATI+KGV   PFLVFMGVALSITAFPVLAR
Sbjct  121   RRTGKKALCIAAAGITLPFVLGIGTSFALRATISKGVDGPPFLVFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTTDVG+MAMSAAAVNDVAAW+LLALAI+LSGTG SPL+SLWV LCG GFVL 
Sbjct  181   ILAELKLLTTDVGRMAMSAAAVNDVAAWVLLALAISLSGTGRSPLVSLWVFLCGCGFVLG  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
             C+  V  IFKWMA RC EGEPV+E+YVCA L AVL AGFVTDTIGIHALFGAFV+G+LVP
Sbjct  241   CVFFVRPIFKWMAQRCPEGEPVEELYVCATLVAVLAAGFVTDTIGIHALFGAFVLGILVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             K+GP A ALVEKVEDLVSGLFLPLYFVSSGLKT+VATI+GAQSWGLLVLVI TACFGKI+
Sbjct  301   KEGPFAGALVEKVEDLVSGLFLPLYFVSSGLKTDVATIRGAQSWGLLVLVISTACFGKII  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GTI VS LCR+PFQEA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMA+FTTF
Sbjct  361   GTIGVSLLCRMPFQEALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMAIFTTF  420

Query  1404  ITTPIVIALYKPAKL-AVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             ITTPIV+A+YKPAK  + + YKYRTI+RKDPS QLRILTCF+S RN+P++INLIEASRGT
Sbjct  421   ITTPIVMAVYKPAKRKSNSNYKYRTIERKDPSTQLRILTCFYSTRNLPTMINLIEASRGT  480

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
             EK     VYAMHLMEL ERSSAI+M HKAR+NGLPFWN   + +D+ ++VVAFETFE LS
Sbjct  481   EKRERLCVYAMHLMELDERSSAIVMVHKARRNGLPFWN---KGSDNNQVVVAFETFEQLS  537

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +V+IRP TAIS++ SMHEDI ASAE +R AMII+PFHKHQ++DG  ETTR E R VNRRV
Sbjct  538   RVAIRPMTAISSIPSMHEDICASAERERAAMIIIPFHKHQRLDGALETTRTEYRGVNRRV  597

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             LE APCSVGI+VDRGLGGT+H+SASNV  TI VL+FGG DDREALAYG RM EHPG  L 
Sbjct  598   LENAPCSVGIMVDRGLGGTTHISASNVSSTIVVLFFGGSDDREALAYGMRMAEHPGNNLT  657

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSA  508
             +  F   PE     V++D++   ++S      +E  ++  KQ+ S + S+KYEE+ V++A
Sbjct  658   IVHFLASPELEKEIVRVDINDGSNASAGPG--NEKLISELKQKISNDGSIKYEERTVRNA  715

Query  507   AETMEAIRGYNRCNLLVVGRMPEGEIVAAMD----KKGECPELGPLGNLLSCKEFSTTAS  340
             AET + IR +NRCNL +VGR PEG++ AA++     K +CPELGP+G+LL+  +F+T AS
Sbjct  716   AETTDLIREFNRCNLFLVGRRPEGQVAAALNVNLKVKSDCPELGPVGSLLTSPDFTTAAS  775

Query  339   VLVVQQY  319
             VLVVQQY
Sbjct  776   VLVVQQY  782



>ref|XP_007210366.1| hypothetical protein PRUPE_ppa001527mg [Prunus persica]
 gb|EMJ11565.1| hypothetical protein PRUPE_ppa001527mg [Prunus persica]
Length=808

 Score =  1046 bits (2704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/787 (74%), Positives = 666/787 (85%), Gaps = 12/787 (2%)
 Frame = -1

Query  2658  MGSNGTVV--CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M +N TV   CPAPMKATSNG FQGD+PLD+ALPL I+QICLVV LTR+LAYLLRPLRQP
Sbjct  1     MATNATVASACPAPMKATSNGVFQGDNPLDFALPLAILQICLVVALTRILAYLLRPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEI+GG+LLGPSA G S+ YL+ IFPK+SLTVLDTLA+LGLLFFLFLVGLELDPKS+
Sbjct  61    RVIAEIVGGILLGPSALGHSKNYLDTIFPKRSLTVLDTLANLGLLFFLFLVGLELDPKSI  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             RRTGKKAL IA AGI+LPF LGIGTSF LRATI+KGV   PFLVFMGVALSITAFPVLAR
Sbjct  121   RRTGKKALCIAAAGITLPFVLGIGTSFALRATISKGVDGPPFLVFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTTDVG+MAMSAAAVNDVAAW+LLALAI+LSGTG SPL+SLWV LCG GFVL 
Sbjct  181   ILAELKLLTTDVGRMAMSAAAVNDVAAWVLLALAISLSGTGRSPLVSLWVFLCGCGFVLG  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
             C+  V  IFKWMA RC EGEPV+E+YVCA L AVL AGFVTDTIGIHALFGAFV+G+LVP
Sbjct  241   CVFFVRPIFKWMAQRCPEGEPVEELYVCATLVAVLAAGFVTDTIGIHALFGAFVLGILVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             K+GP A ALVEKVEDLVSGLFLPLYFVSSGLKT+VATI+GAQSWGLLVLVI TACFGKI+
Sbjct  301   KEGPFAGALVEKVEDLVSGLFLPLYFVSSGLKTDVATIRGAQSWGLLVLVISTACFGKII  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GTI VS LCR+PFQEA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMA+FTTF
Sbjct  361   GTIGVSLLCRMPFQEAMALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMAIFTTF  420

Query  1404  ITTPIVIALYKPAKL-AVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             ITTPIV+A+YKPAK  + + YKYRTI+RKDPS QLRILTCFH  RN+P++INLIEASRGT
Sbjct  421   ITTPIVMAVYKPAKRKSNSNYKYRTIERKDPSTQLRILTCFHGTRNLPTMINLIEASRGT  480

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
             EK     VYAMHLMEL+ERSSAI+M HKAR+NGLPFWN   + +D+ ++VVAFETFE LS
Sbjct  481   EKRERLCVYAMHLMELNERSSAIVMVHKARRNGLPFWN---KGSDNNKVVVAFETFEQLS  537

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +V+IRP TAIS++SSMHEDI ASAE +R AMII+PFHKHQ++DG  ETTR E R VNRRV
Sbjct  538   RVAIRPMTAISSISSMHEDICASAERERAAMIIIPFHKHQRLDGALETTRTEYRGVNRRV  597

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             LE APCSVGI+VDRGLGGT+H+SASNV  T+ VL+FGG DDREALAYG RM EHPG  L 
Sbjct  598   LENAPCSVGIMVDRGLGGTTHISASNVSSTVVVLFFGGSDDREALAYGMRMAEHPGNNLT  657

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSA  508
             V  F   PE     V++D++    +S      +E  +   +Q+ S + S+KYEE+ V++ 
Sbjct  658   VVHFLASPELEKEIVRVDINDGSDASAGPG--NEKLIVELQQKISNDGSIKYEERTVRNV  715

Query  507   AETMEAIRGYNRCNLLVVGRMPEGEIVAAMD----KKGECPELGPLGNLLSCKEFSTTAS  340
             AET ++IR +NRCNL +VGR PEG++ AA++     K +CPELGP+G+LL+  +F+T AS
Sbjct  716   AETTDSIREFNRCNLFLVGRRPEGQVAAALNVNLKVKSDCPELGPVGSLLTSPDFTTAAS  775

Query  339   VLVVQQY  319
             VLVVQQY
Sbjct  776   VLVVQQY  782



>ref|XP_008385052.1| PREDICTED: cation/H(+) antiporter 18 [Malus domestica]
 ref|XP_008385695.1| PREDICTED: cation/H(+) antiporter 18 [Malus domestica]
 ref|XP_008386303.1| PREDICTED: cation/H(+) antiporter 18 [Malus domestica]
 ref|XP_008386957.1| PREDICTED: cation/H(+) antiporter 18 [Malus domestica]
Length=807

 Score =  1045 bits (2702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/784 (73%), Positives = 669/784 (85%), Gaps = 6/784 (1%)
 Frame = -1

Query  2658  MGSNGTVV--CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M +N TV   CP PM ATSNG FQGD+PLD+ALPL I+QICLVV LTR+LAYLLRPLRQP
Sbjct  1     MATNTTVASACPTPMTATSNGVFQGDNPLDFALPLAILQICLVVALTRILAYLLRPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEI+GG+LLGPSA GR++ YL AIFP +SLTVLDTLA+LGLLFFLFLVGLELDPKSL
Sbjct  61    RVIAEIVGGILLGPSALGRNKDYLEAIFPNRSLTVLDTLANLGLLFFLFLVGLELDPKSL  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             RRTGKKAL IALAGI+LPF LGIGTSF L+ TI+KGV   PFLVFMGVALSITAFPVLAR
Sbjct  121   RRTGKKALCIALAGITLPFVLGIGTSFALKGTISKGVDGPPFLVFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTTD+G+MAMSAAAVNDVAAWILLALAI+LS TG SPL+SLWVLLCG  FVL 
Sbjct  181   ILAELKLLTTDIGRMAMSAAAVNDVAAWILLALAISLSSTGRSPLVSLWVLLCGCAFVLS  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
             C+  +  IFKWMA RC EGEPV+E+YVCA L AVL AGFVTDTIGIHALFGAFV+G++VP
Sbjct  241   CVFFIRPIFKWMAQRCPEGEPVEELYVCATLVAVLAAGFVTDTIGIHALFGAFVLGIIVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             K+GP A ALVEKVEDL+SGLFLPLYFVSSGLKT++ATI+GAQSWGLLVLVI TACFGKI+
Sbjct  301   KEGPFAGALVEKVEDLISGLFLPLYFVSSGLKTDIATIRGAQSWGLLVLVISTACFGKII  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GT+ VS LCR+PFQEA+ LGFLMNTKGLVELIVLNIG+DR VLNDQTFAIMVLMA+FTTF
Sbjct  361   GTVAVSLLCRVPFQEALALGFLMNTKGLVELIVLNIGRDRKVLNDQTFAIMVLMAIFTTF  420

Query  1404  ITTPIVIALYKPAKL-AVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             +TTP+V+A+YKPAK  ++++YKYRTI+RKDP+ +LR+LTCFH  RN+P++INLIEASRGT
Sbjct  421   LTTPVVMAVYKPAKRKSISDYKYRTIERKDPNTELRVLTCFHGTRNLPTMINLIEASRGT  480

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
             EK     VYAMHLMEL+ERSSAILM HKAR+NGLPFWN + + +D+ ++VVAFETFE LS
Sbjct  481   EKKERLCVYAMHLMELNERSSAILMVHKARRNGLPFWN-KVKDSDNHQVVVAFETFEQLS  539

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +V+IRP  AIS++SSMHEDI A AE K  A+IILPFHKHQ++DG  ETTR E R VNRRV
Sbjct  540   RVAIRPMIAISSVSSMHEDICAMAERKGAAIIILPFHKHQRLDGVLETTRTEYRGVNRRV  599

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             LE APCSVGI+VDRGLGG++HVSASNV  +I VL+FGG DDREALAYG RM EHPG  L 
Sbjct  600   LEHAPCSVGIMVDRGLGGSTHVSASNVSSSIVVLFFGGSDDREALAYGMRMAEHPGNSLT  659

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSA  508
             V  F   PE  G  V++D++   ++S    +  E FLA  KQ+ S NSS+KYEE+ V++A
Sbjct  660   VVHFLASPELQGEIVQVDINEGSNTSAGSAT--EMFLAELKQKISNNSSIKYEERAVRNA  717

Query  507   AETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVV  328
             AET + IR +NRCNL +VGR P+G++ AA++ KG+CPELGP+G LL+  +F+TTASVLV+
Sbjct  718   AETTDLIREFNRCNLFLVGRRPDGQVAAALNLKGDCPELGPVGILLTSPDFTTTASVLVM  777

Query  327   QQYR  316
             QQY 
Sbjct  778   QQYH  781



>ref|XP_002509895.1| Na(+)/H(+) antiporter, putative [Ricinus communis]
 gb|EEF51282.1| Na(+)/H(+) antiporter, putative [Ricinus communis]
Length=805

 Score =  1044 bits (2700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/784 (75%), Positives = 665/784 (85%), Gaps = 6/784 (1%)
 Frame = -1

Query  2658  MGSNGTVV-CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPR  2482
             M SNGTV  C  PMKATS+G FQGD+PLDYALPL IVQI LVV+LTRVLA+LLRPLRQPR
Sbjct  1     MASNGTVASCLKPMKATSDGVFQGDNPLDYALPLAIVQIVLVVVLTRVLAFLLRPLRQPR  60

Query  2481  VIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLR  2302
             VIAEIIGG+LLGPSA GR+  YL+ IFP +SLTVLDTLA+LGLLFFLFLVGLELD KSLR
Sbjct  61    VIAEIIGGILLGPSALGRNTDYLHRIFPPRSLTVLDTLANLGLLFFLFLVGLELDLKSLR  120

Query  2301  RTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARI  2122
             RTGKKALSIALAGISLPF +GIG SF+LR TI+ GV + P LVFMGVALSITAFPVLARI
Sbjct  121   RTGKKALSIALAGISLPFVMGIGVSFVLRNTISPGVKEAPLLVFMGVALSITAFPVLARI  180

Query  2121  LAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLC  1942
             LAELKLLTTDVG+MAMSAAAVND+AAWILLALAIALSGTG SPL SLWVLL G GF++ C
Sbjct  181   LAELKLLTTDVGRMAMSAAAVNDIAAWILLALAIALSGTGRSPLTSLWVLLTGCGFIICC  240

Query  1941  ILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPK  1762
             IL+VP +FKWMA RC EGEPV+E+YVCA LA VL AGF TD+IGIHALFGAFVIGVL+PK
Sbjct  241   ILIVPPVFKWMAHRCPEGEPVNEMYVCATLATVLAAGFCTDSIGIHALFGAFVIGVLIPK  300

Query  1761  DGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILG  1582
             DGP A ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVL+I TACFGKI+G
Sbjct  301   DGPFAGALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLIIATACFGKIIG  360

Query  1581  TILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFI  1402
             T+ VS LCRIPFQEA+TLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAI VLMA+FTTFI
Sbjct  361   TVGVSLLCRIPFQEALTLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAICVLMAIFTTFI  420

Query  1401  TTPIVIALYKPAKLAVT-EYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TTPIV+++YKPAK A+  +YK++TI+RKDP  QLRIL CFHS  NIP++IN IEASRGTE
Sbjct  421   TTPIVVSIYKPAKRAINADYKHKTIERKDPDSQLRILACFHSTLNIPTMINFIEASRGTE  480

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             K  G  VYA+HLMELSERSSAILM HKARKNGLPFWN + + +D+ ++VVAFE F  LS+
Sbjct  481   KRQGLCVYALHLMELSERSSAILMVHKARKNGLPFWN-KLQKSDTNQVVVAFEAFRQLSR  539

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             V IRP TAISA+ +MHEDI ASAE KR AM+ILPFHKHQ++DG  ETTRNE R VN+RVL
Sbjct  540   VFIRPMTAISALHNMHEDICASAERKRAAMVILPFHKHQRLDGTLETTRNEFRWVNKRVL  599

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             E APCSVGILVDRGLGG +HVSASN+  TITVL+FGG DDREALAYGARM EHPGI L V
Sbjct  600   EHAPCSVGILVDRGLGGGTHVSASNLSSTITVLFFGGRDDREALAYGARMAEHPGISLTV  659

Query  684   ARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAA  505
               F    E  G  VK+D++   S + E    D+  L   K+ +  N S+K+EE+VV SA 
Sbjct  660   IHFIASTEIVGQMVKVDITDEASITSESA--DKMVLVGIKKVSDDN-SIKFEERVVNSAR  716

Query  504   ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQ  325
             E +EA++ ++RCNL VVGRMPEG + AA++ K ECPELGP GNLL+  +F+T+ASVLVVQ
Sbjct  717   EVVEAVKEFSRCNLFVVGRMPEGPVAAALNGKAECPELGPAGNLLTSHDFTTSASVLVVQ  776

Query  324   QYRT  313
             QY +
Sbjct  777   QYNS  780



>ref|XP_007040405.1| Cation/H+ exchanger 18 isoform 1 [Theobroma cacao]
 ref|XP_007040406.1| Cation/H+ exchanger 18 isoform 1 [Theobroma cacao]
 gb|EOY24906.1| Cation/H+ exchanger 18 isoform 1 [Theobroma cacao]
 gb|EOY24907.1| Cation/H+ exchanger 18 isoform 1 [Theobroma cacao]
Length=803

 Score =  1039 bits (2687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/806 (71%), Positives = 669/806 (83%), Gaps = 7/806 (1%)
 Frame = -1

Query  2658  MGSNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M SN TV   CP+PMKATSNG FQGD+PLDYALPL I+QICLVV+LTR LA+LLRP+RQP
Sbjct  1     MVSNATVGQKCPSPMKATSNGLFQGDNPLDYALPLAILQICLVVVLTRGLAFLLRPIRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEIIGG+LLGPS  GRS++YL AIFP KSLTVLDTLA++GL+FFLFL GLE+D K+L
Sbjct  61    RVIAEIIGGILLGPSVLGRSKSYLQAIFPPKSLTVLDTLANIGLIFFLFLAGLEIDLKAL  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             RRTGK AL IA+AGI LPF LGIG+SF+L+ATI+KGV+   FLVFMGVALSITAFPVLAR
Sbjct  121   RRTGKTALGIAVAGIGLPFALGIGSSFLLKATISKGVNASAFLVFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTTDVG++AMSAAAVNDVAAWILLALA+ALSG+  SP  SLWV L G  FV+ 
Sbjct  181   ILAELKLLTTDVGRIAMSAAAVNDVAAWILLALAVALSGSNSSPAASLWVFLSGCVFVIC  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
                +VP IFKWMA RC EGEPV+E+Y+CA LAAVL AGFVTD IGIHA+FGAFV+GV+ P
Sbjct  241   LSFIVPPIFKWMAYRCHEGEPVEEMYICATLAAVLAAGFVTDAIGIHAMFGAFVVGVVFP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             K+GP A ALVEKVEDLVSGLFLPLYFVSSGLKTN+ATIQG QSWGLL LVIFTACFGKI+
Sbjct  301   KEGPFAGALVEKVEDLVSGLFLPLYFVSSGLKTNIATIQGLQSWGLLALVIFTACFGKIV  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GT++VS  C++P +EA  LGFLMNTKGLVELIVLNIG+DR VLNDQTFAIMVLMALFTTF
Sbjct  361   GTVVVSLSCKVPAREAFALGFLMNTKGLVELIVLNIGRDRKVLNDQTFAIMVLMALFTTF  420

Query  1404  ITTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             ITTP+V+A+YKPA+    +YK+RTI+RK+P  QLRILTCFHS RNIPS+INL+EASRG  
Sbjct  421   ITTPVVMAVYKPARSRKVDYKHRTIERKNPDTQLRILTCFHSSRNIPSMINLLEASRGVG  480

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             K  GF VYA+HLMELSERSSAILM HKARKNGLPFWN +G  +DS  IVVAFE F+ LS+
Sbjct  481   KREGFSVYALHLMELSERSSAILMVHKARKNGLPFWN-KGRHSDSDHIVVAFEAFQQLSQ  539

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             V++R  T+IS+M+ MHEDI  +AE KR A+IILPFHKHQ++DG FETTR + R VN+RVL
Sbjct  540   VTVRSMTSISSMADMHEDICTTAERKRAAIIILPFHKHQRMDGSFETTRTDFRWVNQRVL  599

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             E APCS+GILVDRGLGGT+HVSASNV  ++TVL+FGG DDREALAYGARM EHPGI L V
Sbjct  600   EHAPCSIGILVDRGLGGTTHVSASNVSLSMTVLFFGGCDDREALAYGARMAEHPGISLNV  659

Query  684   ARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAA  505
              RF ++PET G   ++D+  +          DE+FL+ FKQ+ S + SV+YEEK V++A 
Sbjct  660   IRFVVEPETIGEIARIDMQENSGLKSMSL--DEEFLSKFKQKISNDDSVRYEEKAVRNAT  717

Query  504   ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQ  325
             ET  AIR  +RCNL++VGRMP+GE+  A+ ++ ECPELGP+G LL   +FS TASVLVVQ
Sbjct  718   ETFAAIREASRCNLVLVGRMPDGELALALMRRSECPELGPVGCLLISPDFSATASVLVVQ  777

Query  324   QYRTELSKN--GLKEDDSVDGDYESA  253
             QY   +S N     E++S D D ES+
Sbjct  778   QYHGRVSLNLASDMEEESPDKDSESS  803



>ref|XP_007210361.1| hypothetical protein PRUPE_ppa001551mg [Prunus persica]
 gb|EMJ11560.1| hypothetical protein PRUPE_ppa001551mg [Prunus persica]
Length=804

 Score =  1039 bits (2686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/806 (71%), Positives = 670/806 (83%), Gaps = 8/806 (1%)
 Frame = -1

Query  2658  MGSNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M SN T    CP PMKATSNG FQGD PL +ALPL I+QIC+VV++TR LAY+LRPLRQP
Sbjct  1     MASNATAGHACPPPMKATSNGIFQGDDPLHFALPLAILQICVVVIVTRGLAYVLRPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEI+GG+LLGPSA GR+++YL AIFP KS+TVLDTLA+LGLLFFLFL GLE+DPKS+
Sbjct  61    RVIAEIVGGILLGPSALGRNKSYLQAIFPPKSITVLDTLANLGLLFFLFLAGLEIDPKSI  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             R+TGKKAL+IA+ GISLPF LGIG+SF+LR TIAKGV    FLVFMGVALSITAFPVLAR
Sbjct  121   RQTGKKALAIAIVGISLPFALGIGSSFVLRETIAKGVDATAFLVFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTTD+G+MAMSAAAVNDVAAWILLALA+ALSG+  SPL+SLWV L G  FV+ 
Sbjct  181   ILAELKLLTTDIGRMAMSAAAVNDVAAWILLALAVALSGSNQSPLVSLWVFLSGCVFVIC  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
              IL+VP IFKWMA RC EGEPVDEIYVCA L AVL AG +TDTIGIHA+FGAFV+GVLVP
Sbjct  241   AILIVPPIFKWMAQRCHEGEPVDEIYVCATLTAVLAAGLITDTIGIHAMFGAFVVGVLVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             K+GP A ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQG QSWGLLVLVIFTACFGKI 
Sbjct  301   KEGPFAGALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGLQSWGLLVLVIFTACFGKIF  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GTI+VS  C++P +EA+ LGFLMN+KGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTF
Sbjct  361   GTIMVSLFCKLPVREALALGFLMNSKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTF  420

Query  1404  ITTPIVIALYKPAKLA-VTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             ITTP+VIA+YKPAK A +  YK++TI+RK+ + QLRIL CFHS RNIPS+INL+E SRGT
Sbjct  421   ITTPLVIAVYKPAKKAGMAVYKHKTIERKNMNTQLRILACFHSARNIPSIINLLEVSRGT  480

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
             +K  G  VYAMHL ELSERSSAILM HKAR+NGLPFWN   +P +S  +VVAFE ++ LS
Sbjct  481   KKREGLCVYAMHLKELSERSSAILMVHKARRNGLPFWNKSQQP-NSDNVVVAFEAYQQLS  539

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +VSIRP T IS++S MHEDI A+AE KR A++ILPFHKHQ++DG  ETTRN+ R VN+RV
Sbjct  540   RVSIRPMTEISSISDMHEDICATAESKRAAVVILPFHKHQRLDGTLETTRNDFRLVNQRV  599

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             L+ APCSVGILVDRGLGG +HV+ASNV Y ITVL+FGG DD EALAYGARM EHPG+ L+
Sbjct  600   LQHAPCSVGILVDRGLGGATHVAASNVSYNITVLFFGGRDDSEALAYGARMAEHPGVSLM  659

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSA  508
             V RF ++PE  G   ++++  +GS+       DE+ LA FKQ+ S ++S+ YEEK V++ 
Sbjct  660   VIRFLVEPEVVGEISRINIDENGSTKVGSV--DEEVLAEFKQKISKDNSITYEEKTVRNN  717

Query  507   AETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVV  328
             A+T+  IR   RCNL +VGR P GE+  A++++ ECPELGPLG+LL   +FST+ASVLVV
Sbjct  718   AQTIAVIREVGRCNLFLVGRTPGGEVALAINRRSECPELGPLGSLLISPDFSTSASVLVV  777

Query  327   QQYRTELSKNGLK--EDDSVDGDYES  256
             QQY  ++S N     E++S + D ES
Sbjct  778   QQYNGQVSLNLASEIEEESPERDRES  803



>ref|XP_008238996.1| PREDICTED: cation/H(+) antiporter 18-like [Prunus mume]
Length=800

 Score =  1038 bits (2685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/790 (71%), Positives = 663/790 (84%), Gaps = 6/790 (1%)
 Frame = -1

Query  2658  MGSNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M SN T    CP PMKATSNG FQGD PL +ALPL I+QIC+VV++TR LAY+LRPLRQP
Sbjct  1     MASNATAGHACPPPMKATSNGIFQGDDPLHFALPLAILQICIVVIVTRGLAYVLRPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEI+GG+LLGPSA GR+++YL AIFP KS+TVLDTLA+LGLLFFLFL GLE+DPKS+
Sbjct  61    RVIAEIVGGILLGPSALGRNKSYLQAIFPPKSITVLDTLANLGLLFFLFLAGLEIDPKSI  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             R+TGKKAL+IA+ GISLPF LGIG+SF+LR TIAKGV    FLVFMGVALSITAFPVLAR
Sbjct  121   RQTGKKALAIAIVGISLPFALGIGSSFVLRETIAKGVDATAFLVFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTTD+G+MAMSAAAVNDVAAWILLALA+ALSG+  SPL+SLWV L G  FV+ 
Sbjct  181   ILAELKLLTTDIGRMAMSAAAVNDVAAWILLALAVALSGSNQSPLVSLWVFLSGCVFVIC  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
              IL+VP +FKWMA RC EGEPVDEIYVCA L AVL AG +TDTIGIHA+FGAFV+GVLVP
Sbjct  241   AILIVPPVFKWMAQRCHEGEPVDEIYVCATLTAVLAAGLITDTIGIHAMFGAFVVGVLVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             K+GP A ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQG QSWGLLVLVIFTACFGKI 
Sbjct  301   KEGPFAGALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGLQSWGLLVLVIFTACFGKIF  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GTI+VS  C++P +EA+ LGFLMN+KGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTF
Sbjct  361   GTIMVSLFCKLPVREALALGFLMNSKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTF  420

Query  1404  ITTPIVIALYKPAKLA-VTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             ITTP+VIA+YKPAK A +  YK++TI+RK+ + QLRIL CFHS RNIPS+INL+E SRGT
Sbjct  421   ITTPLVIAVYKPAKKAGMAVYKHKTIERKNMNTQLRILACFHSARNIPSIINLLEVSRGT  480

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
             +K  G  VYAMHL ELSERSSAILM HKAR+NGLPFWN   +P +S  +VVAFE ++ LS
Sbjct  481   KKREGLCVYAMHLKELSERSSAILMVHKARRNGLPFWNKSQQP-NSDNVVVAFEAYQQLS  539

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +VSIRP T IS++S MHEDI A+AE KR A++ILPFHKHQ++DG  ETTRN+ R VN+RV
Sbjct  540   RVSIRPMTEISSISDMHEDICATAESKRAAIVILPFHKHQRLDGTLETTRNDFRLVNQRV  599

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             L+ APCSVGILVDRGLGG +HV+ASNV Y ITVL+FGG DDREALAYGARM EHPG+ L+
Sbjct  600   LQHAPCSVGILVDRGLGGATHVAASNVSYNITVLFFGGRDDREALAYGARMAEHPGVSLM  659

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSA  508
             V RF ++PE  G   +++++ + S+       DE+ LA FKQ+ S ++S+ YEEK V++ 
Sbjct  660   VIRFLVEPEVVGEISRININDNASTKVGSV--DEEVLAEFKQKISKDNSIMYEEKAVRNN  717

Query  507   AETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVV  328
             A+T+  IR   RCNL +VGR P GE+  A++++ ECPELGPLG+LL   +FST+ASVLVV
Sbjct  718   AQTIAVIREVGRCNLFLVGRTPGGEVALALNRRSECPELGPLGSLLISPDFSTSASVLVV  777

Query  327   QQYRTELSKN  298
             QQY  ++S N
Sbjct  778   QQYNGQVSLN  787



>gb|KHG13786.1| Cation/H(+) antiporter 18 -like protein [Gossypium arboreum]
Length=800

 Score =  1036 bits (2680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/783 (72%), Positives = 661/783 (84%), Gaps = 13/783 (2%)
 Frame = -1

Query  2658  MGSNGTVVCPA-PMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPR  2482
             M +N T      PMKATSNG FQGD+PLD+ALPL I+QIC+VV LTR+LA+LL+PLRQPR
Sbjct  1     MATNATTSSQCHPMKATSNGVFQGDNPLDFALPLAILQICIVVALTRILAFLLKPLRQPR  60

Query  2481  VIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLR  2302
             VIAEI+GG+LLGPSA GR++ YLN IFP KSLTVLDT+A+LGLLFFLFLVGLELD KS+R
Sbjct  61    VIAEIVGGILLGPSALGRNKNYLNTIFPTKSLTVLDTIANLGLLFFLFLVGLELDMKSVR  120

Query  2301  RTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARI  2122
             RTGKKALSIA+AGISLPF LGIGTS+ LRATI+KGV + PFLVFMGVALSITAFPVLARI
Sbjct  121   RTGKKALSIAVAGISLPFILGIGTSYALRATISKGVDEAPFLVFMGVALSITAFPVLARI  180

Query  2121  LAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLC  1942
             LAELKLLTTD+G+MAMSAAAVNDVAAWILLALAIALS T  SPL+SLWV L GTGF++ C
Sbjct  181   LAELKLLTTDLGRMAMSAAAVNDVAAWILLALAIALSATDKSPLVSLWVFLSGTGFIVGC  240

Query  1941  ILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPK  1762
             I +VP IFKWM  RC EGEPV E+Y+CA L AVL AGF+TD IGIHALFGAFVIGVLVPK
Sbjct  241   IFIVPPIFKWMIQRCPEGEPVSELYICATLTAVLAAGFITDLIGIHALFGAFVIGVLVPK  300

Query  1761  DGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILG  1582
             +GP A ALVEKVEDLVSGLFLPLYFVSSGLKTN+ATIQGAQSWGLLVLVI TACFGKI+G
Sbjct  301   EGPFAGALVEKVEDLVSGLFLPLYFVSSGLKTNIATIQGAQSWGLLVLVIITACFGKIVG  360

Query  1581  TILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFI  1402
             T+ VS LC++PF EA+ LGFLMNTKGLVELIVLNIGKDR VLND+TFAIMVLMA+FTTF+
Sbjct  361   TVSVSLLCKLPFSEALALGFLMNTKGLVELIVLNIGKDRKVLNDETFAIMVLMAVFTTFL  420

Query  1401  TTPIVIALYKPAK-LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TTP+V+A+YKPAK     EYK++TI+RK+ + QLRIL CFHS RNIP++INLIEASRGT 
Sbjct  421   TTPLVMAVYKPAKRQGKGEYKHKTIERKESNSQLRILACFHSYRNIPTMINLIEASRGTV  480

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             K  G  VYA+HLMELSER SAILM H+ARKNGLPFWN +G  +D  +IVV FETF  LS+
Sbjct  481   KKEGLCVYALHLMELSERPSAILMVHRARKNGLPFWN-KGTHSDGDQIVVVFETFRQLSR  539

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             VS+RP TAIS++SS+HEDI  SAE KR AMIILPFHKHQ++DG FETTR + + +N+RVL
Sbjct  540   VSVRPMTAISSLSSLHEDICESAERKRAAMIILPFHKHQRVDGTFETTRTDYQLINKRVL  599

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             E APCSVGILVDRGLGG++H+SASNVD  ITVL+FGG+DDREALAYGARM EHPGI L +
Sbjct  600   ENAPCSVGILVDRGLGGSTHISASNVDSIITVLFFGGNDDREALAYGARMAEHPGISLTI  659

Query  684   ARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAA  505
              RF   PE +G  V  D++ S          DE +L  FK + S + S+ +EE+VV+++ 
Sbjct  660   VRFLPGPEVSGEIVTTDINTS----------DEQYLMEFKNKISNDKSINFEERVVRNSR  709

Query  504   ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQ  325
             ET+EAI  +NRCNL VVG+MPE  ++A ++ K ECP+LGP+G+LL+  EFSTTASVLVVQ
Sbjct  710   ETIEAIGEFNRCNLFVVGQMPETHVIAKLNAKSECPDLGPIGSLLTSPEFSTTASVLVVQ  769

Query  324   QYR  316
             QY+
Sbjct  770   QYK  772



>ref|XP_011022576.1| PREDICTED: cation/H(+) antiporter 18-like [Populus euphratica]
Length=804

 Score =  1036 bits (2679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/792 (72%), Positives = 667/792 (84%), Gaps = 4/792 (1%)
 Frame = -1

Query  2667  AEIMGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQ  2488
             A +  +  T+ CP PMKATSNG FQGD+PLDYALPL IVQICLVVLLTR+LA+LLRPLRQ
Sbjct  2     AALNATGTTLSCPEPMKATSNGVFQGDNPLDYALPLAIVQICLVVLLTRILAFLLRPLRQ  61

Query  2487  PRVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKS  2308
             PRVIAEI+GG+LLGPSA GR++ YL+ +FP KSL VLDTLA+LGLLFFLFLVGLELD KS
Sbjct  62    PRVIAEIVGGILLGPSALGRNKHYLDKVFPAKSLPVLDTLANLGLLFFLFLVGLELDLKS  121

Query  2307  LRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLA  2128
             LRRTGKKAL IA AGISLPF LGIGTSF LR TI+KGV + PFLVFMGVALSITAFPVLA
Sbjct  122   LRRTGKKALCIAAAGISLPFLLGIGTSFALRGTISKGVDKAPFLVFMGVALSITAFPVLA  181

Query  2127  RILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVL  1948
             RILAELKLLTTDVG+MAMSAAAVNDVAAWILLALA+ALSGTGHSPL+SLWV LCG GFVL
Sbjct  182   RILAELKLLTTDVGRMAMSAAAVNDVAAWILLALAVALSGTGHSPLVSLWVFLCGLGFVL  241

Query  1947  LCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLV  1768
              C+ ++P IFKWMA+RC EGEPVDEIYVCA L AVL AGF+TD+IGIHALFGAFV+GVL+
Sbjct  242   CCVFIIPPIFKWMANRCPEGEPVDEIYVCATLTAVLAAGFITDSIGIHALFGAFVVGVLI  301

Query  1767  PKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKI  1588
             PK+G  A ALVEKVED+VSGLFLPLYFVSSGLKTNVATIQG QSWGLLVLVI TACFGKI
Sbjct  302   PKEGAFAGALVEKVEDIVSGLFLPLYFVSSGLKTNVATIQGLQSWGLLVLVITTACFGKI  361

Query  1587  LGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTT  1408
             +GT+ VS LCR+PFQEA+ +GFLMNTKGLVELIVLNIGKDR VLND+TF+IMVLMA+FTT
Sbjct  362   VGTVGVSLLCRMPFQEAVAVGFLMNTKGLVELIVLNIGKDRKVLNDETFSIMVLMAIFTT  421

Query  1407  FITTPIVIALYKPAKLA-VTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRG  1231
             FITTP+V+A+YKPAK A   +YK R I+R DPS QLRIL CFHS R++P++INLIEASRG
Sbjct  422   FITTPLVMAVYKPAKRARRADYKIRKIERNDPSTQLRILACFHSTRDVPTMINLIEASRG  481

Query  1230  TEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHL  1051
             T++  G  VYAMHLMEL+ERSSAILM HK RKNGLPFWN + + + + ++VVAFE F  L
Sbjct  482   TDRREGLCVYAMHLMELTERSSAILMVHKVRKNGLPFWN-KLQQSGNNQVVVAFEAFRQL  540

Query  1050  SKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRR  871
             S VSI P+TAIS M  MHEDI  SAE KR A IILPFHKHQ++DG FETTR E R VN R
Sbjct  541   SHVSIHPTTAISQMYDMHEDICESAERKRAAAIILPFHKHQRLDGTFETTRTEFRWVNMR  600

Query  870   VLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICL  691
             VLE A CSVGILVDRG GG +HV ASNV Y++TVL+FGG DDREALAYGARM EHPGI L
Sbjct  601   VLENARCSVGILVDRGFGGGTHVPASNVSYSVTVLFFGGRDDREALAYGARMAEHPGISL  660

Query  690   VVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKS  511
              V RFT   E  G  V++D++   + S E    D++F+A FK++ S +SSVKYEE++V +
Sbjct  661   SVIRFTTSHEIVGEIVRVDINDDHNVSTEST--DDEFIAEFKKKISNDSSVKYEERIVNN  718

Query  510   AAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLV  331
             A ET+EA + ++ CNL +VGR+P+G +VA+++ K ECPELGP+G+LL   +F+T+ASVLV
Sbjct  719   AEETVEAAKDFSHCNLFLVGRVPQGPVVASLNVKVECPELGPVGHLLISPDFTTSASVLV  778

Query  330   VQQYRTELSKNG  295
             +QQ+ +  S+ G
Sbjct  779   MQQHASPGSRGG  790



>ref|XP_002304537.2| hypothetical protein POPTR_0003s13470g [Populus trichocarpa]
 gb|EEE79516.2| hypothetical protein POPTR_0003s13470g [Populus trichocarpa]
Length=803

 Score =  1036 bits (2678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/781 (73%), Positives = 666/781 (85%), Gaps = 4/781 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             + + GT+ CP PMKATSNG FQGD+PLDYALPL I+QICLVVLLTR+LA+LLRPLRQPRV
Sbjct  4     LNATGTLSCPKPMKATSNGVFQGDNPLDYALPLAILQICLVVLLTRILAFLLRPLRQPRV  63

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA GR++ YL+ +FP KSL VLDTLA+LGLLFFLFL+GLELD KSLRR
Sbjct  64    IAEIVGGILLGPSALGRNKHYLDKVFPAKSLPVLDTLANLGLLFFLFLIGLELDLKSLRR  123

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKAL IA AGI LPF LGIGTSF LR TI+KG  + PFLVFMGVALSITAFPVLARIL
Sbjct  124   TGKKALGIAAAGIGLPFLLGIGTSFALRGTISKGADKAPFLVFMGVALSITAFPVLARIL  183

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSGTGHS L+SLWV LCG+GFVL C+
Sbjct  184   AELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGTGHSALVSLWVFLCGSGFVLCCV  243

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              ++P IFKWMA+RC EGEPVDEIYVCA L AVL AGFVTD+IGIHALFGAFV+GVL+PK+
Sbjct  244   FIIPPIFKWMANRCPEGEPVDEIYVCATLTAVLAAGFVTDSIGIHALFGAFVVGVLIPKE  303

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A ALVEKVED+VSGLFLPLYFVSSGLKTNVATIQG QSWGLLVLVI TACFGKI+GT
Sbjct  304   GAFAGALVEKVEDIVSGLFLPLYFVSSGLKTNVATIQGLQSWGLLVLVITTACFGKIVGT  363

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             + VS LCR+PFQEA+ +GFLMNTKGLVELIVLNIGKDR VLND+TF+IMVLMA+FTTFIT
Sbjct  364   VGVSLLCRMPFQEAVAMGFLMNTKGLVELIVLNIGKDRKVLNDETFSIMVLMAIFTTFIT  423

Query  1398  TPIVIALYKPAKLAV-TEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEK  1222
             TP+V+A+YKPAK A   +YK R I+R DP+ QLRIL CFHS R++P++INLIEASRGT++
Sbjct  424   TPLVMAVYKPAKRASRADYKIRKIERNDPNTQLRILACFHSTRDVPTMINLIEASRGTDR  483

Query  1221  SGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKV  1042
                  VYAMHLMEL+ERSSAILM HK RKNGLPFWN + + + + ++VVAFE F  LS+V
Sbjct  484   RERLCVYAMHLMELTERSSAILMVHKVRKNGLPFWN-KLQQSGNNQVVVAFEAFRQLSRV  542

Query  1041  SIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLE  862
             SI+P+TAIS M  MHEDI  SAE KRVA IILPFHKHQ++DG FETTR + R VN RVLE
Sbjct  543   SIKPTTAISQMYDMHEDICESAERKRVAAIILPFHKHQRLDGTFETTRTDFRWVNMRVLE  602

Query  861   GAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVA  682
              A CSVGILVDRGLGG +HV ASNV Y++TVL+FGG DDREALAYGARM EHPGI L V 
Sbjct  603   NARCSVGILVDRGLGGGTHVPASNVSYSVTVLFFGGRDDREALAYGARMAEHPGISLSVI  662

Query  681   RFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAE  502
             RFT   E  G  V++D++ + + S E    D++F+A FK++ S +SSVKYEE++V +AAE
Sbjct  663   RFTASHEIVGEIVRVDINDNHNVSTEST--DDEFIAEFKKKISNDSSVKYEERIVNNAAE  720

Query  501   TMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQ  322
             T+EA + ++RCNL +VGR+P+G +VA+++ K ECPELGP+G+LL   +F+T ASVLV+QQ
Sbjct  721   TVEAAKDFSRCNLFLVGRVPQGPVVASLNVKVECPELGPVGHLLISPDFTTLASVLVMQQ  780

Query  321   Y  319
             +
Sbjct  781   H  781



>ref|XP_004298856.1| PREDICTED: cation/H(+) antiporter 17-like [Fragaria vesca subsp. 
vesca]
Length=804

 Score =  1036 bits (2678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/797 (71%), Positives = 671/797 (84%), Gaps = 9/797 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +N TV CP+PMKATSNG FQGD+PL YALPL+I+QIC+VV LTR+LAY LRPLRQPRV
Sbjct  1     MANNTTVTCPSPMKATSNGVFQGDNPLHYALPLVILQICIVVTLTRILAYFLRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEIIGG+LLGPSA G ++ Y+NAIFP KSLTVLDT+A+LGLLFFLFLVGLELDPKSLRR
Sbjct  61    IAEIIGGILLGPSALGHNKDYINAIFPAKSLTVLDTIANLGLLFFLFLVGLELDPKSLRR  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIALAGI+LPF LGIGTSF+L+ TI+KGV   PFLVFMGVALSITAFPVLARIL
Sbjct  121   TGKKALSIALAGITLPFVLGIGTSFVLKETISKGVDGAPFLVFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG+MAMSAAAVNDVAAWILLALAI+LSG+G SPL+SLWV LCG  FVL+CI
Sbjct  181   AELKLLTTDVGRMAMSAAAVNDVAAWILLALAISLSGSGRSPLVSLWVFLCGCAFVLVCI  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
               V  +FKWM  RC EGEPVDE+YVC  L AVL AGFVTDTIGIHALFGAFV+G++VPK+
Sbjct  241   FAVRPLFKWMVQRCPEGEPVDELYVCGTLVAVLAAGFVTDTIGIHALFGAFVLGIIVPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP A ALVEKVEDLVSGLFLPLYFVSSGLKT+V TI+GAQSWGLLVLVI TACFGK++GT
Sbjct  301   GPFAGALVEKVEDLVSGLFLPLYFVSSGLKTDVTTIRGAQSWGLLVLVISTACFGKVIGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             I+VS  C++P QEA+ LGFLMNTKGLVELIVLNIG+DRGVLNDQTFAIMVLMA+FTTFIT
Sbjct  361   IVVSLFCKVPLQEALALGFLMNTKGLVELIVLNIGRDRGVLNDQTFAIMVLMAVFTTFIT  420

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             TP+V+A+YKPAK    +YKYRTI+RKD + QLR+LTCFH  RN+P++INLIEASRGTEK 
Sbjct  421   TPVVMAVYKPAKRLSKDYKYRTIERKDLNSQLRLLTCFHGTRNLPTMINLIEASRGTEKR  480

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
                 VYAMHL+EL+ER SAILM HKAR NG+PFWN +G+ +   ++VVAFETFE LS+V+
Sbjct  481   ERLCVYAMHLLELNERPSAILMVHKARNNGIPFWN-KGQHSGDNQVVVAFETFEQLSRVA  539

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             IRP TAISA+++MHEDI  SA+ +R AMIILPFHKHQ++DG FET R+E R +N++VLE 
Sbjct  540   IRPMTAISAVTTMHEDICTSADSERAAMIILPFHKHQRLDGTFETARSEYRLINQQVLEN  599

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             APCSVGI+VDRGLGG++HVSASN+D  +TVL+FGG DDREALAYG RMVEHPGI L +  
Sbjct  600   APCSVGIIVDRGLGGSTHVSASNLDSVVTVLFFGGSDDREALAYGIRMVEHPGITLNIIH  659

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAET  499
             F    E  G  V++DV+   ++S      ++ F+A  K +  + SS+KYEE+VV +AAET
Sbjct  660   FLPSAELQGEIVRVDVNDDSNTSAGPT--EDTFIAELKLKILSYSSIKYEERVVGNAAET  717

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
                IR +++CNL +VGR P+G I A+++ KG+CPELGP+G+LL   +FSTTASVLVVQQY
Sbjct  718   TALIREFSQCNLFLVGRRPQGPIAASLNVKGDCPELGPVGSLLIYPDFSTTASVLVVQQY  777

Query  318   RTELSKNGLKEDDSVDG  268
                   +GLK  +S  G
Sbjct  778   ------HGLKLPNSSVG  788



>ref|XP_010676379.1| PREDICTED: cation/H(+) antiporter 18-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010676380.1| PREDICTED: cation/H(+) antiporter 18-like [Beta vulgaris subsp. 
vulgaris]
Length=800

 Score =  1035 bits (2676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/799 (71%), Positives = 657/799 (82%), Gaps = 5/799 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M  N T  CP PM ATS G FQG++PLD+ALPL+IVQI LV++LTR LA+LLRPLRQPRV
Sbjct  1     MAQNVTA-CPKPMAATSTGVFQGENPLDFALPLVIVQIILVIVLTRTLAFLLRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEIIGGVLLGPSAFGRSEA+L+ IFP KSL VLDTLA+LGL+FFLFLVGLELDPK+LRR
Sbjct  60    IAEIIGGVLLGPSAFGRSEAFLHTIFPAKSLPVLDTLANLGLIFFLFLVGLELDPKALRR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIALAGISLPF +GIGTSF+LRATI+KGV+Q PF+VFMGVALSITAFPVLARIL
Sbjct  120   TGKKALSIALAGISLPFAMGIGTSFVLRATISKGVNQAPFIVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSGTG SPLISLWV LCG  FV LCI
Sbjct  180   AELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGTGQSPLISLWVFLCGAAFVGLCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
             L+VPRIFKWM   C +GEPV+EIY+C  LAAVL AGFVTDTIGIHALFGAFV+G+L PKD
Sbjct  240   LIVPRIFKWMTRHCPDGEPVEEIYICGTLAAVLAAGFVTDTIGIHALFGAFVLGILAPKD  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GPLA ALVEKVEDLVSGL LPLYF SSGLKTNVATIQGAQSWGLL+LVI TACFGK++GT
Sbjct  300   GPLAGALVEKVEDLVSGLLLPLYFASSGLKTNVATIQGAQSWGLLLLVILTACFGKVVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             ++VS LC+IP  E++ LG LMN+KGLVELIVLNIGKDR VLNDQTFAIMVLMAL TTF+T
Sbjct  360   VVVSRLCKIPLSESVALGVLMNSKGLVELIVLNIGKDRKVLNDQTFAIMVLMALVTTFMT  419

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             TPIV+A+YKPAK     YK RT+QRKDPS QLR++ CFHS R+IP++INLIEASRGTEK 
Sbjct  420   TPIVMAVYKPAKRG-RAYKLRTVQRKDPSAQLRVMACFHSGRSIPTMINLIEASRGTEKK  478

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
              G  VYAMHLMELSERSSAI M HKAR NGLPFWN +G  +DS ++VVAFE +  LS+V 
Sbjct  479   QGLAVYAMHLMELSERSSAIRMVHKARNNGLPFWN-KGMQSDSDQVVVAFEAYGQLSQVQ  537

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             IRP TAIS  S MHEDI ASAE KR A+IILPFHKHQK DG  ETTR+E R +N++VL+ 
Sbjct  538   IRPMTAISHFSDMHEDICASAESKRAALIILPFHKHQKFDGSLETTRHEYRVINKKVLQH  597

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
              PCSVGILVDRGLGG+S VSASNVD TIT+L+FGG DDREALA+G RM EHPGI LVV  
Sbjct  598   TPCSVGILVDRGLGGSSQVSASNVDSTITILFFGGPDDREALAFGERMSEHPGITLVVVH  657

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAET  499
             F  DP   G  +        S+  + K+ DE+ +   KQ+ S + S+KYEE+VVK +++T
Sbjct  658   FKADPNMEGGEMVAIDVSDSSTGKDSKAADEEVIDVIKQKVSKDGSIKYEERVVKGSSDT  717

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVA--AMDKKGECPELGPLGNLLSCKEFSTTASVLVVQ  325
                I+ ++RCNL++VGR PEG +     ++ K E PELGP+G LL  +E ST ASVLV+ 
Sbjct  718   SNVIKEFSRCNLVLVGRSPEGMVATNFGLNVKTEYPELGPIGGLLVSQEVSTNASVLVIH  777

Query  324   QYRTELSKNGLKEDDSVDG  268
             Q+        L+E+++ DG
Sbjct  778   QFSGGSRPMSLEEEEATDG  796



>gb|KDP25351.1| hypothetical protein JCGZ_20507 [Jatropha curcas]
Length=806

 Score =  1032 bits (2668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/782 (72%), Positives = 653/782 (84%), Gaps = 4/782 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +NGTV CP PMKATS+G FQGD+PLDYALPL I+QI LV++LTR++A LL+P+RQPRV
Sbjct  1     MATNGTVTCPKPMKATSDGIFQGDNPLDYALPLAIIQIVLVIVLTRLIAVLLKPMRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA GR+  YL+ IFP +SLTVLDTLA+LGLLFFLFLVGLELD KSL R
Sbjct  61    IAEIVGGILLGPSALGRNTNYLHRIFPPRSLTVLDTLANLGLLFFLFLVGLELDLKSLGR  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKA SIALAGI+LPF LGIG SF+LRATI+ GV + P LVFMGVALSITAFPVLARIL
Sbjct  121   TGKKAFSIALAGITLPFVLGIGVSFVLRATISPGVKEAPLLVFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG+MAM+AAAVND+AAWILLALAIALSG GHSPLISLWVLL G+GF++LC 
Sbjct  181   AELKLLTTDVGRMAMAAAAVNDIAAWILLALAIALSGNGHSPLISLWVLLSGSGFIILCA  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
             +++P +F+WM  RC  GEPV+E+YVCA LA VL AGF TD IGIHALFGAFVIGVL+PK+
Sbjct  241   VIIPPVFRWMVHRCPRGEPVNEMYVCATLAIVLAAGFCTDAIGIHALFGAFVIGVLIPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A ALVEKVEDLVSGLFLPLYFVSSGLKT+VATI+GAQSWGLLVLVI TACFGKI+GT
Sbjct  301   GHFAGALVEKVEDLVSGLFLPLYFVSSGLKTDVATIRGAQSWGLLVLVITTACFGKIVGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             +LVS LCRIP QEAITLGFLMNTKGLVELIVLNIGKDR VLNDQTFAI VLMA+FTTFIT
Sbjct  361   VLVSLLCRIPTQEAITLGFLMNTKGLVELIVLNIGKDRKVLNDQTFAICVLMAIFTTFIT  420

Query  1398  TPIVIALYKPAKLA-VTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEK  1222
             TPIV+A+YKPAK A V++YK RTI+RKDP  QLR+L CFHS  NIP+LINLIEASRGTEK
Sbjct  421   TPIVVAVYKPAKRAVVSDYKQRTIERKDPDSQLRVLACFHSTWNIPTLINLIEASRGTEK  480

Query  1221  SGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKV  1042
               G  VYA+HLMELSER+SAILM HKARKNGLPFWN + + +D+ ++VVAFE F  L++V
Sbjct  481   RQGLCVYALHLMELSERTSAILMVHKARKNGLPFWN-KLQQSDTNQVVVAFEAFRQLNRV  539

Query  1041  SIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLE  862
             SIRP TAIS +  +HEDI  SAE KR AMIILPFHKHQ++DG  +TTRNE R VN+RVLE
Sbjct  540   SIRPMTAISHLHDIHEDICTSAERKRAAMIILPFHKHQRLDGTLDTTRNEFRFVNKRVLE  599

Query  861   GAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVA  682
              APCSVGILVDRGLGG +HV+ASNV  +ITVL+FGG DDREALAYG RM EHPGI L + 
Sbjct  600   HAPCSVGILVDRGLGGGTHVAASNVSSSITVLFFGGRDDREALAYGERMAEHPGISLTIV  659

Query  681   RFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAE  502
              F    ET G           S        D ++LA FK  N  +SS+K EE++V S+ E
Sbjct  660   HFIPSDETLG-HTVKVEITEESPISTPTISDAEYLAKFKN-NKGDSSIKLEERIVNSSGE  717

Query  501   TMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQ  322
              +E I+ +NRCN+ VVGR P+G + AA++ K ECPE+GP+GN+L+  +F+T+ASVLVVQQ
Sbjct  718   VVEMIKDFNRCNMFVVGRNPDGPVAAALNDKFECPEIGPMGNILTSNDFTTSASVLVVQQ  777

Query  321   YR  316
             YR
Sbjct  778   YR  779



>gb|EYU23392.1| hypothetical protein MIMGU_mgv1a024127mg, partial [Erythranthe 
guttata]
Length=773

 Score =  1030 bits (2662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/779 (74%), Positives = 667/779 (86%), Gaps = 9/779 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M SNGTV C  PMKA SNG FQGD+PL +ALPLLI+QICLVV+LTRVLAY LRPLRQPRV
Sbjct  1     MASNGTVKCQPPMKAASNGVFQGDNPLHFALPLLIIQICLVVVLTRVLAYCLRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             +AEIIGG+LLGPSA GR++ YL+A+FP +SLTVLDT+A+LGLLFFLFLVGLELDPK+LR+
Sbjct  61    VAEIIGGILLGPSALGRNQKYLHAVFPPQSLTVLDTIANLGLLFFLFLVGLELDPKALRQ  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIALAGI+LPF LGIGTSF+LRATI++GVSQGPFLVFMGVALSITAFPVLARIL
Sbjct  121   TGKKALSIALAGITLPFALGIGTSFVLRATISEGVSQGPFLVFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG+MAMSAAAVND+AAWILLALAIALSGTG SPL+S+WV LCG+GFV+LCI
Sbjct  181   AELKLLTTDVGRMAMSAAAVNDIAAWILLALAIALSGTGRSPLVSIWVFLCGSGFVILCI  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              +VP +FK +A RC +GEPVDEIY+CA LAAVL AGFVTD IGIHALFGAF++GVLVPK+
Sbjct  241   FLVPPVFKQLAKRCPQGEPVDEIYICATLAAVLAAGFVTDAIGIHALFGAFILGVLVPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP + ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLL LVIFTACFGKI+GT
Sbjct  301   GPFSGALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLALVIFTACFGKIVGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             ++VS LC+IP +EA+TLGFLMNTKGLVELIVLNIGKDRGVLNDQ FAIMVLMALFTTFIT
Sbjct  361   VVVSLLCKIPLKEALTLGFLMNTKGLVELIVLNIGKDRGVLNDQAFAIMVLMALFTTFIT  420

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT-EK  1222
             TPIV+ +YKPA++A ++YK+RTIQRK+   QLR+LTCF+S R+IPSLINLIEASRGT ++
Sbjct  421   TPIVVTIYKPARMARSDYKHRTIQRKESQTQLRLLTCFNSTRDIPSLINLIEASRGTGKR  480

Query  1221  SGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKV  1042
              G  +VYAMHLMELSERSSAI M HKARKNG+PFWN R + +D T+IVVAFE F+HLS+V
Sbjct  481   EGVLRVYAMHLMELSERSSAIRMAHKARKNGMPFWN-RVKDSDPTQIVVAFEAFQHLSQV  539

Query  1041  SIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLE  862
             S+RP+TAIS+MSSMH DI  SA  K+VAMIILPFHKHQ++DG FET+R  LRHVN+RVLE
Sbjct  540   SVRPTTAISSMSSMHIDICNSATKKKVAMIILPFHKHQRVDGSFETSRVGLRHVNKRVLE  599

Query  861   GAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVA  682
              APCSVGI VDRGLGGT  V+ASNVDY ITV +FGG DDREA +YG  M EHPGI L + 
Sbjct  600   HAPCSVGIFVDRGLGGTCQVAASNVDYNITVFFFGGRDDREAASYGRVMAEHPGIRLDIV  659

Query  681   RFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNST-NSSVKYEEKVVKSAA  505
             RF + P   G SV++D+   G  S      DE F+A F+ + S  N S+++EE  V  A+
Sbjct  660   RFVVGPGVGGDSVRVDIGGGGDESRSA---DEVFIAEFESKVSKDNGSIRFEEFEVSGAS  716

Query  504   ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLL-SCKEFSTTASVLV  331
             E +E +R YNR NL+VVGR+ EGE+V A+  + ECPELG + NLL    EF  TASVLV
Sbjct  717   EAVEVMRRYNRSNLIVVGRVAEGELVEALKGRSECPELGAVANLLIGSPEF--TASVLV  773



>gb|EPS69500.1| hypothetical protein M569_05263 [Genlisea aurea]
Length=798

 Score =  1026 bits (2653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/804 (72%), Positives = 663/804 (82%), Gaps = 10/804 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +N T  C  PMKATSNG FQGD PL +ALPL+I+QICLV +LTR LAYLLRPLRQPRV
Sbjct  1     MAANTTAKCLPPMKATSNGVFQGDDPLQFALPLVIIQICLVFVLTRGLAYLLRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAE+IGG+LLGPSA GR+E Y++ IFPK SLTVLDTLA+LGL+FFLFLVGLELDPKSLRR
Sbjct  61    IAEVIGGILLGPSALGRNENYIHTIFPKNSLTVLDTLANLGLIFFLFLVGLELDPKSLRR  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGK+ALSIAL GI++PF +GIGTSF LRATIAK  + GPFLVFMGVALSITAFPVLARIL
Sbjct  121   TGKRALSIALGGITIPFAMGIGTSFALRATIAKEAAHGPFLVFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSGTG SPL+SLWV LCG  F+LLC+
Sbjct  181   AELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGTGRSPLVSLWVFLCGAAFILLCV  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
             LV   +FKWMA RCSEG+ VDEIYVC +L AVL AGFVTDTIGIHALFGAFV+GV+VPK+
Sbjct  241   LVGLPVFKWMARRCSEGDTVDEIYVCGVLVAVLAAGFVTDTIGIHALFGAFVLGVIVPKE  300

Query  1758  -GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILG  1582
              GP A ALVEKVEDLVSGLFLPLYFVSSGLKT+VATI+G QSWGLLVLVIFT+CFGKI G
Sbjct  301   EGPFARALVEKVEDLVSGLFLPLYFVSSGLKTDVATIRGGQSWGLLVLVIFTSCFGKIFG  360

Query  1581  TILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFI  1402
             T++VS +CR+P  EA+TLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFI
Sbjct  361   TVVVSLMCRVPHNEAVTLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFI  420

Query  1401  TTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEK  1222
             TTPIVIA+YKPA++A +EYK+RTIQRKD + QLR+LTCFH+ R IP+LINL+E SRGT +
Sbjct  421   TTPIVIAIYKPARMAKSEYKHRTIQRKDANTQLRLLTCFHTTRTIPTLINLMEISRGTGR  480

Query  1221  SGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKV  1042
              GG +VYAMHL ELSER SAILM +KARKNGLPFWN +    DS +IVV+FE F+HLS V
Sbjct  481   RGGLRVYAMHLRELSERPSAILMVNKARKNGLPFWN-KSPSQDSDQIVVSFEAFQHLSYV  539

Query  1041  SIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLE  862
             SIRP+ AIS +SSMHED+ A AE KR AMI+LPFHKH +IDGH ETTR++LR VNRRVLE
Sbjct  540   SIRPTVAISPLSSMHEDVCAGAERKRAAMIVLPFHKHLRIDGHMETTRSDLRSVNRRVLE  599

Query  861   GAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVA  682
              APCSV ILVDRGLGG +HV+ASNVDYTI   +FGG DD EAL Y A M EHPG+ L   
Sbjct  600   HAPCSVAILVDRGLGGAAHVAASNVDYTIAAFFFGGRDDCEALCYAAIMAEHPGVHLTAV  659

Query  681   RFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAE  502
             RF +D +  G SVK+D++    +       DE+F++ F++     SS+ Y E VV    E
Sbjct  660   RFVVDSKVVGKSVKVDIASGEGAEAS----DEEFISKFREERE-GSSISYVESVVSDENE  714

Query  501   TMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQ  322
               E +R Y R NLLVVGRMPEG++ AA  K+ ECPELG   NLL   EFS+ ASVLVVQQ
Sbjct  715   AAEVMRKYGRSNLLVVGRMPEGQLAAAFKKRRECPELGAAANLLISSEFSSAASVLVVQQ  774

Query  321   YR---TELSKNGLKEDDSVDGDYE  259
             +R   T  S   L+E+D+ DG++E
Sbjct  775   FRGPLTGYSLASLREEDTTDGEFE  798



>ref|XP_002276249.1| PREDICTED: cation/H(+) antiporter 18 [Vitis vinifera]
 ref|XP_010658648.1| PREDICTED: cation/H(+) antiporter 18 [Vitis vinifera]
Length=787

 Score =  1019 bits (2634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/776 (73%), Positives = 649/776 (84%), Gaps = 7/776 (1%)
 Frame = -1

Query  2640  VVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIG  2461
             V CP P KATSNG FQGD+P+ +ALPL IVQICLVV++TR LA+LL+PLRQPRVIAEI+G
Sbjct  5     VTCPPPTKATSNGVFQGDNPVHFALPLAIVQICLVVVVTRCLAFLLKPLRQPRVIAEIVG  64

Query  2460  GVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKAL  2281
             G+LLGPSA GR++ YL++IFP KSLTVLDTLA+LGLLFFLF+VGLELD KSL R GKKAL
Sbjct  65    GILLGPSALGRNKHYLHSIFPPKSLTVLDTLANLGLLFFLFIVGLELDLKSLHRAGKKAL  124

Query  2280  SIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLL  2101
             SIA+AGISLPF LG+GTSF+LRATI+KGV  GPF+VFMGVALSITAFPVLARILAELKLL
Sbjct  125   SIAVAGISLPFALGVGTSFVLRATISKGVDAGPFVVFMGVALSITAFPVLARILAELKLL  184

Query  2100  TTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRI  1921
             TTDVGQMAMSAAAVNDVAAWILLALAIALSGTG SP+ISLWV LCG GFVL C L+ PRI
Sbjct  185   TTDVGQMAMSAAAVNDVAAWILLALAIALSGTGRSPIISLWVFLCGFGFVLCCSLIAPRI  244

Query  1920  FKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASA  1741
             F+WMA RC EGEPVDE+Y+CA LAAVL AGFVTD IGIHALFG+FV+G+LVPK+GP ASA
Sbjct  245   FRWMAQRCPEGEPVDEMYICATLAAVLAAGFVTDAIGIHALFGSFVMGILVPKEGPFASA  304

Query  1740  LVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTL  1561
             LVEKVEDLVSGL LPLYFVSSGLKT+V+TI+G QSW LLVLVIFTAC GKI GTI VS  
Sbjct  305   LVEKVEDLVSGLLLPLYFVSSGLKTDVSTIRGLQSWSLLVLVIFTACLGKIAGTIAVSVC  364

Query  1560  CRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIA  1381
             CR+P +EA+ LGFLMN+KGLVELIVLNIGK+R VLNDQTFAIMVLMALFTTFITTP+VI+
Sbjct  365   CRMPVREALALGFLMNSKGLVELIVLNIGKERKVLNDQTFAIMVLMALFTTFITTPLVIS  424

Query  1380  LYKPAKL-AVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKV  1204
             +YKPAK  +  +YK+RTI RK+P+ +LRIL CF S  NIP++INLIE SRGT K  G  V
Sbjct  425   VYKPAKRPSKADYKHRTIDRKNPNGELRILVCFRSTNNIPTMINLIETSRGTGKREGLCV  484

Query  1203  YAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPST  1024
             YAMHLMELSERSS I M HKARKNGLPFWN +G P+ S +++VAFE F  LS VSIRP  
Sbjct  485   YAMHLMELSERSSVISMVHKARKNGLPFWN-KGLPSGSNQVIVAFEAFGQLSSVSIRPMI  543

Query  1023  AISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSV  844
             AISAMS++HEDI  SAE KRVA+IILPFHKHQ++DG  ETTR+E   VNR+VLE APCSV
Sbjct  544   AISAMSNIHEDICTSAERKRVAIIILPFHKHQRLDGTLETTRSEFSLVNRKVLEHAPCSV  603

Query  843   GILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDP  664
             GILVDRGLGGT+ VSASNV   ITV +FGG DDREAL+YGARM EHPGI LV  RF + P
Sbjct  604   GILVDRGLGGTAQVSASNVSSIITVPFFGGCDDREALSYGARMAEHPGISLVAVRFLIHP  663

Query  663   ETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIR  484
             +  G +   D   + +        DE+FLA FK  +S NS+VK+EE+VVK+AAE ME IR
Sbjct  664   DVQGEAPTPDSHDNPNFLL-----DENFLAEFKHNSSLNSAVKFEERVVKNAAEAMEIIR  718

Query  483   GYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYR  316
              Y+RC + VVGRMPEG +VA +  K E PELGP+G+LL+   F T ASVLVVQQY+
Sbjct  719   EYHRCTMFVVGRMPEGHVVAGLSPKTEFPELGPVGSLLTSPGFPTVASVLVVQQYQ  774



>ref|XP_002509894.1| Na(+)/H(+) antiporter, putative [Ricinus communis]
 gb|EEF51281.1| Na(+)/H(+) antiporter, putative [Ricinus communis]
Length=805

 Score =  1014 bits (2623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/807 (70%), Positives = 662/807 (82%), Gaps = 9/807 (1%)
 Frame = -1

Query  2658  MGSNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAY-LLRPLRQ  2488
             M SN +V   CP+PMK  SNG FQGDSPLD++LPL+I+QICLV++LTR LA+ L R LRQ
Sbjct  1     MASNASVGHTCPSPMKPASNGVFQGDSPLDFSLPLVILQICLVLVLTRALAFPLRRLLRQ  60

Query  2487  PRVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKS  2308
             PRVIAEIIGG+LLGPSA GRSE YL+A+FP KSL VLDTLA++GLL+FLFLVGLELD KS
Sbjct  61    PRVIAEIIGGILLGPSALGRSEKYLHAVFPPKSLPVLDTLANIGLLYFLFLVGLELDLKS  120

Query  2307  LRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLA  2128
             LR+TGKKAL+IA+AGISLPFG+GIG+SFILRATI+KGV+   FL+FMGVALSITAFPVLA
Sbjct  121   LRKTGKKALAIAIAGISLPFGMGIGSSFILRATISKGVNSTSFLLFMGVALSITAFPVLA  180

Query  2127  RILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVL  1948
             RILAELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSG+ HSP+ SLWVLLCG  FV+
Sbjct  181   RILAELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGSNHSPITSLWVLLCGFVFVI  240

Query  1947  LCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLV  1768
                LV+P IFK +  RC EGEPV+E YVCA LAAVL AGF+TD IGIHA+FGAFVIGVLV
Sbjct  241   CSTLVLPPIFKLITRRCHEGEPVEETYVCATLAAVLVAGFITDAIGIHAMFGAFVIGVLV  300

Query  1767  PKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKI  1588
             PK+GP A ALVEK+EDLVSGLFLPLYFVSSGLKT++ATI G QSWGLL LV FTACFGKI
Sbjct  301   PKEGPFARALVEKIEDLVSGLFLPLYFVSSGLKTDIATISGLQSWGLLALVTFTACFGKI  360

Query  1587  LGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTT  1408
             +GT LVS  C++P +EA+ +GFLMNTKGLVELIVLNIGKD+ VLNDQTFAIMVLMALFTT
Sbjct  361   VGTFLVSLACKVPLREALAMGFLMNTKGLVELIVLNIGKDKKVLNDQTFAIMVLMALFTT  420

Query  1407  FITTPIVIALYKPAKLA-VTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRG  1231
             FITTP+V+A+YKPA+ + V +YK+RTI+RK+ S QLRIL CFHS RNIPS INL+EASRG
Sbjct  421   FITTPLVMAVYKPARKSRVADYKHRTIERKNSSMQLRILACFHSARNIPSTINLLEASRG  480

Query  1230  TEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHL  1051
              +K+ G  VYAMHLMELSERSSAILM HKARKNGLP WN +G   DS  ++VAFE F  L
Sbjct  481   VQKAEGLCVYAMHLMELSERSSAILMVHKARKNGLPTWN-KGSKPDSNNVIVAFEAFRQL  539

Query  1050  SKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRR  871
             S+V +R  TAIS+MS +HEDI  +AE KR A+IILPFHKHQ++DG  ETTR + R VNRR
Sbjct  540   SQVMVRSMTAISSMSDIHEDICTTAERKRAAIIILPFHKHQRLDGSLETTRIDFRWVNRR  599

Query  870   VLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICL  691
             VLE APCSVGILVDRGLGGTSHV AS+V Y ITVL+FGG DDREALAYGARM EHPGI L
Sbjct  600   VLEHAPCSVGILVDRGLGGTSHVPASDVSYLITVLFFGGRDDREALAYGARMAEHPGISL  659

Query  690   VVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKS  511
              V RF + P+  G   ++++  S ++       DE FL  FKQ+   +SSVKYEEK +++
Sbjct  660   KVIRFLVAPDAQGEITQVNMESSINTKLGSW--DEQFLLEFKQKTCKDSSVKYEEKAIRN  717

Query  510   AAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLV  331
              A  M+ I   N CNL +VGRMPEGEI  A+++  ECPELGP+G+LL+   FSTTASVLV
Sbjct  718   TAGAMDVIHEVNHCNLFLVGRMPEGEIAIALNRWNECPELGPVGSLLATSNFSTTASVLV  777

Query  330   VQQYRTELSKNGLKE--DDSVDGDYES  256
             +QQY +++S +      DD V  D ES
Sbjct  778   IQQYDSQVSLDLASHAGDDQVGRDSES  804



>emb|CAN81240.1| hypothetical protein VITISV_031075 [Vitis vinifera]
Length=787

 Score =  1013 bits (2618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/776 (73%), Positives = 647/776 (83%), Gaps = 7/776 (1%)
 Frame = -1

Query  2640  VVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIG  2461
             V CP   KATSNG FQGD+P+ +ALPL IVQICLVV++TR LA+L++PLRQPRVIAEI+G
Sbjct  5     VTCPPXTKATSNGVFQGDNPVHFALPLAIVQICLVVVVTRCLAFLMKPLRQPRVIAEIVG  64

Query  2460  GVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKAL  2281
             G+LLGPSA GR++ YL++IFP KSLTVLDTLA+LGLLFFLF+VGLELD KSL R GKKAL
Sbjct  65    GILLGPSALGRNKXYLHSIFPPKSLTVLDTLANLGLLFFLFIVGLELDLKSLHRAGKKAL  124

Query  2280  SIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLL  2101
             SIA+AGISLPF LG+GTSF+LRATI+KGV  GPF+VFMGVALSITAFPVLARILAELKLL
Sbjct  125   SIAVAGISLPFALGVGTSFVLRATISKGVDAGPFVVFMGVALSITAFPVLARILAELKLL  184

Query  2100  TTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRI  1921
             TTDVGQMAMSAAAVNDVAAWILLALAIALSGTG SP+ISLWV LCG GFVL C L+ PRI
Sbjct  185   TTDVGQMAMSAAAVNDVAAWILLALAIALSGTGRSPIISLWVFLCGFGFVLCCSLIAPRI  244

Query  1920  FKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASA  1741
             F+WMA RC EGEPVDE+Y+CA LAAVL AGFVTD IGIHALFG+FV+G+LVPK+GP ASA
Sbjct  245   FRWMAQRCPEGEPVDEMYICATLAAVLAAGFVTDAIGIHALFGSFVMGILVPKEGPFASA  304

Query  1740  LVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTL  1561
             LVEKVEDLVSGL LPLYFVSSGLKT+V+TI+G QSW LLVLVIFTAC GKI GTI VS  
Sbjct  305   LVEKVEDLVSGLLLPLYFVSSGLKTDVSTIRGLQSWSLLVLVIFTACLGKIAGTIAVSVC  364

Query  1560  CRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIA  1381
             CR+P +EA+ LGFLMN+KGLVELIVLNIGK+R VLNDQTFAIMVLMALFTTFITTP+VI+
Sbjct  365   CRMPVREALALGFLMNSKGLVELIVLNIGKERKVLNDQTFAIMVLMALFTTFITTPLVIS  424

Query  1380  LYKPAKL-AVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKV  1204
             +YKPAK  +  +YK+RTI RK+P+ +LRIL CF S  NIP++INLIE SRGT K  G  V
Sbjct  425   VYKPAKRPSKADYKHRTIDRKNPNGELRILVCFRSTNNIPTMINLIEXSRGTGKREGLCV  484

Query  1203  YAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPST  1024
             YAMHLMELSERSS I M HK RKNGLPFWN +G P+ S +++VAFE F  LS VSIRP  
Sbjct  485   YAMHLMELSERSSVISMVHKTRKNGLPFWN-KGLPSGSNQVIVAFEAFGQLSSVSIRPMI  543

Query  1023  AISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSV  844
             AISAMS++HEDI  SAE KRVA+IILPFHKHQ++DG  ETTR+E   VNR+VLE APCSV
Sbjct  544   AISAMSNIHEDICTSAERKRVAIIILPFHKHQRLDGTLETTRSEFSLVNRKVLERAPCSV  603

Query  843   GILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDP  664
             GILVDRGLGGT+ VSASNV   ITV +FGG DDREA++YGARM EHPGI LV  RF + P
Sbjct  604   GILVDRGLGGTAQVSASNVSSIITVPFFGGCDDREAISYGARMAEHPGISLVAVRFLIHP  663

Query  663   ETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIR  484
             +  G +   D   + +        DE+FLA FK  +S NS+VK+EE+VVK+AAE ME IR
Sbjct  664   DVQGEAPTPDSHDNPNFLL-----DENFLAEFKHNSSLNSAVKFEERVVKNAAEAMEIIR  718

Query  483   GYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYR  316
              Y+RC + VVGRMPEG +VA +  K E PELGP+G+LL+   F T ASVLVVQQY+
Sbjct  719   EYHRCTMFVVGRMPEGHVVAGLSPKTEFPELGPVGSLLTSPGFPTVASVLVVQQYQ  774



>ref|XP_010055811.1| PREDICTED: cation/H(+) antiporter 18 [Eucalyptus grandis]
 ref|XP_010055812.1| PREDICTED: cation/H(+) antiporter 18 [Eucalyptus grandis]
 gb|KCW72362.1| hypothetical protein EUGRSUZ_E00818 [Eucalyptus grandis]
Length=804

 Score =  1011 bits (2615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/785 (73%), Positives = 648/785 (83%), Gaps = 7/785 (1%)
 Frame = -1

Query  2655  GSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVI  2476
             G+N T  CPA MKATSNG FQGD+PLD+ALPL I+QICLVVL+TR LA+LLRPLRQPRVI
Sbjct  6     GTNATS-CPAAMKATSNGVFQGDNPLDFALPLAILQICLVVLVTRFLAFLLRPLRQPRVI  64

Query  2475  AEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRT  2296
             AEI+GG+LLGPSA GR+  YL  IFP +SLTVLDTLA+LGLLFFLFLVGLELDP SLRRT
Sbjct  65    AEIVGGILLGPSALGRNHHYLQRIFPARSLTVLDTLANLGLLFFLFLVGLELDPSSLRRT  124

Query  2295  GKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILA  2116
             GKKALSIA AGISLPF +GIGTSF+LR TI+K V   PFLVFMGVALSITAFPVLARILA
Sbjct  125   GKKALSIAAAGISLPFAMGIGTSFVLRGTISKSVDGPPFLVFMGVALSITAFPVLARILA  184

Query  2115  ELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCIL  1936
             ELKLLTTDVG+MAMSAAAVNDVAAW+LLALAI+LSGTG SPL+SLWV LCG  FV+ CI 
Sbjct  185   ELKLLTTDVGRMAMSAAAVNDVAAWVLLALAISLSGTGRSPLVSLWVFLCGIAFVVGCIF  244

Query  1935  VVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDG  1756
             +VP IF+WMA RC EGEPVDE+YVCA LA VL AGF TD IGIHALFGAFVIGVLVPK+G
Sbjct  245   LVPPIFRWMAKRCPEGEPVDEMYVCATLAGVLAAGFATDAIGIHALFGAFVIGVLVPKEG  304

Query  1755  PLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTI  1576
             P A ALVEKVEDL+SGLFLPLYFVSSGLKT++A I+GAQSWGLLVLVI TACFGKI+GT+
Sbjct  305   PFAVALVEKVEDLISGLFLPLYFVSSGLKTDIAAIRGAQSWGLLVLVICTACFGKIVGTL  364

Query  1575  LVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITT  1396
               +   ++PF+EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMA+FTTFITT
Sbjct  365   AATLAFKVPFKEALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTTFITT  424

Query  1395  PIVIALYKPAKL-AVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             P+V+A+YKPA++ +   YK+R  +RK+P  QLRIL CFHS +NIP+ INLIEASRGTEK 
Sbjct  425   PLVVAVYKPAQMKSKGTYKHRKTERKNPESQLRILACFHSIKNIPTFINLIEASRGTEKR  484

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
              G  VYAMHLMELSERSSAILM HKARKNGLPFWN   +P +  +IVVAFE F  LS V 
Sbjct  485   EGLCVYAMHLMELSERSSAILMVHKARKNGLPFWNKGQDPDN--QIVVAFEAFRQLSHVL  542

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             IRP TAIS MS++HEDI ASAE KR A+IILPFHKHQ++DG  ETTR E R VN++VLE 
Sbjct  543   IRPMTAISPMSTIHEDICASAERKRAAIIILPFHKHQRLDGVMETTRTEFRFVNKKVLEH  602

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             APCSVGILVDRGLGG SHV AS+V  TITVL+FGG DD EALAYG RM EHPGI L V  
Sbjct  603   APCSVGILVDRGLGGGSHVPASDVSSTITVLFFGGQDDCEALAYGKRMAEHPGISLSVVS  662

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAET  499
             F ++PE AG  V + ++   SS  +  S D+ FL  FK  N    S+KYEE+ VK+  E 
Sbjct  663   FVVNPEIAGEIVGVGINDEASSHTKSMSGDQLFLTEFK--NPDADSIKYEERQVKTPGEA  720

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             ++ I+ ++RCNL +VGR PEG+I AAMD K E PELGP+G+LLS  EF TTASVLVVQQY
Sbjct  721   IDVIKEFSRCNLFLVGRRPEGQIAAAMDTKSETPELGPVGSLLSSSEF-TTASVLVVQQY  779

Query  318   RTELS  304
                +S
Sbjct  780   AEGIS  784



>ref|XP_010261446.1| PREDICTED: cation/H(+) antiporter 18 isoform X1 [Nelumbo nucifera]
Length=810

 Score =  1011 bits (2614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/810 (70%), Positives = 660/810 (81%), Gaps = 16/810 (2%)
 Frame = -1

Query  2670  SAEIMGSNGTVV---CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLR  2500
             S E M SN T V   CP+PMK TSNG+FQGD+PLD+ALPL+I+QICLV+++TR LA+LLR
Sbjct  12    STEAMASNNTTVAHLCPSPMKPTSNGAFQGDNPLDFALPLVILQICLVLVVTRTLAFLLR  71

Query  2499  PLRQPRVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleL  2320
             PLRQPRVIAEIIGG+LLGPSA GR+++YLNA+FP KSLTVLDTLA+LGLLFFLFLVG+EL
Sbjct  72    PLRQPRVIAEIIGGILLGPSALGRNKSYLNAVFPAKSLTVLDTLANLGLLFFLFLVGVEL  131

Query  2319  DPKSLRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAF  2140
             DPKSLRRTGKKAL IA+AGIS+PF LG+G+SFILR TI+K V+  PFLVFMGVA SITAF
Sbjct  132   DPKSLRRTGKKALGIAVAGISVPFVLGVGSSFILRHTISKSVNGPPFLVFMGVAFSITAF  191

Query  2139  PVLARILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGT  1960
             PVLARILAELKLLTTDVG+MAMSAAAVNDV AWILLALAIALS +GHSP+I+LWVLL G 
Sbjct  192   PVLARILAELKLLTTDVGRMAMSAAAVNDVVAWILLALAIALSSSGHSPVITLWVLLSGC  251

Query  1959  GFVLLCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVI  1780
              FV+  ILV P IFKWMA R       DE+ +C  LAAVL AGFVTD+IGIHALFGAFV+
Sbjct  252   AFVIASILVFPPIFKWMAQRSQ-----DEVNICGTLAAVLAAGFVTDSIGIHALFGAFVL  306

Query  1779  GVLVPKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTAC  1600
             GVLVPKDG  A ALVEKVEDLVSGLFLPLYFVSSGLKTN+ATIQGAQSWGLLVLVI TAC
Sbjct  307   GVLVPKDGTFADALVEKVEDLVSGLFLPLYFVSSGLKTNIATIQGAQSWGLLVLVIITAC  366

Query  1599  FGKILGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMA  1420
             FGKI+GTI+VS  C +PF+EAITLGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMA
Sbjct  367   FGKIVGTIVVSLACELPFREAITLGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMA  426

Query  1419  LFTTFITTPIVIALYKPA-KLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIE  1243
             LFTTF+TTP+V+A+YKPA K+   +YK+RTI+RKD S QLRIL CFH  RNIP+LINLIE
Sbjct  427   LFTTFLTTPLVMAIYKPARKVGRADYKHRTIERKDSSTQLRILACFHCTRNIPTLINLIE  486

Query  1242  ASRGTEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFET  1063
             ASRGTE+  G  VYAMHLMELSERSSAILM HKARKNG+PFWN +G+ + S  +VVAFET
Sbjct  487   ASRGTERREGLCVYAMHLMELSERSSAILMVHKARKNGMPFWN-KGQQSGSDHVVVAFET  545

Query  1062  FEHLSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRH  883
             F+ LS VS+RP TAISA+S++HEDI  SAE KRVAM+ILPFHKHQ++DG  ETTR + R 
Sbjct  546   FQRLSHVSVRPMTAISALSNIHEDICTSAERKRVAMVILPFHKHQRLDGAMETTRTDFRW  605

Query  882   VNRRVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHP  703
             VN+RVL+ APCSVGILVDRG GGT+HVSASNV Y+ITVL+ GG DDREALAYG+RM EHP
Sbjct  606   VNQRVLDQAPCSVGILVDRGFGGTTHVSASNVSYSITVLFCGGRDDREALAYGSRMAEHP  665

Query  702   GICLVVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEK  523
             GI L V R  L        +++D++       +    D++ LA F+Q+   + S+KYEE+
Sbjct  666   GISLTVIRLLLRLNPVEEVIEIDMNARSDDKEKAI--DDECLAVFRQKVQKDGSIKYEER  723

Query  522   VVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTA  343
              +   AE + A+R ++RCNL +VGR  E  + A +D+  ECPELGP+G+LL C +   TA
Sbjct  724   TIGDTAEIIAAVREFSRCNLFLVGRRIEDSVAAVLDRISECPELGPMGSLLKCSDTLATA  783

Query  342   SVLVVQQYRTELSKNGLKEDDSVDGDYESA  253
             SVL+VQQ+        L+E     G Y S+
Sbjct  784   SVLIVQQFTPHSVSVALEE----PGKYSSS  809



>gb|KHG26273.1| Cation/H(+) antiporter 18 -like protein [Gossypium arboreum]
Length=801

 Score =  1009 bits (2609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 559/806 (69%), Positives = 660/806 (82%), Gaps = 9/806 (1%)
 Frame = -1

Query  2658  MGSNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M SN +V   CP+PMKATSNG FQGD+PLDYALPL I+QICLVV+LTR LA LLRP+RQP
Sbjct  1     MASNTSVGQKCPSPMKATSNGFFQGDNPLDYALPLAILQICLVVVLTRGLAVLLRPIRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RV+AEIIGG+LLGPS  GRS++YL AIFP KSLTVLDTLA+LGL+FFLFL GLE+DPK+L
Sbjct  61    RVVAEIIGGILLGPSVLGRSKSYLEAIFPPKSLTVLDTLANLGLIFFLFLAGLEIDPKAL  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             R+TGK AL+IALAGI LPF LGIG+SF+LR TI+KGV+   FL+FMGVALSITAFPVLAR
Sbjct  121   RQTGKTALAIALAGIGLPFALGIGSSFLLRETISKGVNASAFLIFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTTDVG+MAMSAAAVNDVAAWILLALA+ALSG+  SP++SLWV L G  FV+ 
Sbjct  181   ILAELKLLTTDVGRMAMSAAAVNDVAAWILLALAVALSGSNTSPVVSLWVFLSGCVFVIC  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
               L+VP IFKWMA RC EGEPV+EIY+CA LA VL AGFVTD IGIHA+FGAFV+GVL P
Sbjct  241   LALIVPPIFKWMARRCHEGEPVEEIYICATLAVVLAAGFVTDAIGIHAMFGAFVVGVLFP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             K+GP A ALVEKVEDLVSGLFLPLYFVSSGLKTN+ATIQG QSWGLL LVIFTACFGKI+
Sbjct  301   KEGPFAHALVEKVEDLVSGLFLPLYFVSSGLKTNIATIQGLQSWGLLALVIFTACFGKII  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GT++VS  C++P + A+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTF
Sbjct  361   GTVVVSLCCKVPLRGALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTF  420

Query  1404  ITTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             ITTP+V+A+YKPA+   T+YKYRTI+RK+   QLRIL CFHS RNIPS+INL EASRG  
Sbjct  421   ITTPVVMAVYKPARRK-TDYKYRTIERKNSDAQLRILACFHSARNIPSMINLFEASRGVA  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             K  G  VYA+HLMELSERSSAILM HKARKNGLPFW ++G  +DS  +VVAFE F+ LS+
Sbjct  480   KREGLSVYALHLMELSERSSAILMVHKARKNGLPFW-SKGWRSDSDHVVVAFEAFQQLSQ  538

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             V++R  T+IS+++ MHEDI ++AE KR A+IILPFHKHQ++DG FETTR + R VNRRVL
Sbjct  539   VTVRSMTSISSIADMHEDICSTAESKRAAIIILPFHKHQRVDGSFETTRTDFRWVNRRVL  598

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             E APCSVGILVDRGLGGT+HVSASNV Y ITVL+FGG DD EALAYGARM EHPGI L +
Sbjct  599   EHAPCSVGILVDRGLGGTTHVSASNVSYLITVLFFGGPDDCEALAYGARMAEHPGISLNI  658

Query  684   ARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAA  505
               F ++PET G    +++  +     +  +  E+FL+ F+     + SV+YEEK V++  
Sbjct  659   ICFVVEPETIGKISTINMQENAGIETKSSA--EEFLSRFRNLQK-DDSVRYEEKAVRNVT  715

Query  504   ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQ  325
             E + AIRG +R NL +VGRMPEG++  A+ ++ ECPELG +G+LL   +FS TASVLV+Q
Sbjct  716   EIIAAIRGADRSNLFLVGRMPEGKLALALRRRSECPELGAVGSLLIAPDFSVTASVLVIQ  775

Query  324   QYRTELSKN--GLKEDDSVDGDYESA  253
             QY      N     E++S D D ES+
Sbjct  776   QYNGYTCPNLDPYMEEESPDKDSESS  801



>ref|XP_006439425.1| hypothetical protein CICLE_v10018903mg [Citrus clementina]
 gb|ESR52665.1| hypothetical protein CICLE_v10018903mg [Citrus clementina]
Length=801

 Score =  1009 bits (2609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/799 (70%), Positives = 650/799 (81%), Gaps = 11/799 (1%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CPAPMKATSNG FQGD+PLDYALPL I+QICLVVLLTR+LA++LRPLRQPRVIAEI+GG+
Sbjct  7     CPAPMKATSNGVFQGDNPLDYALPLAILQICLVVLLTRLLAFVLRPLRQPRVIAEIVGGI  66

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GR++ +L A+FP +SLTVLDTLA+LGLLFFLFLVGLE+DPKS+RR GKKALSI
Sbjct  67    LLGPSALGRNKDFLKAVFPSRSLTVLDTLANLGLLFFLFLVGLEMDPKSIRRAGKKALSI  126

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             AL GISLPF LGIGTSF LRAT++KGV Q PFL+FMGVA SITAFPVLARILAELKLLTT
Sbjct  127   ALGGISLPFALGIGTSFALRATVSKGVDQAPFLIFMGVAFSITAFPVLARILAELKLLTT  186

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             DVG+MAMSAAAVNDVAAWILLALA+ALSG+G SPL+SLWVLLCG GFV+ C+++V  IFK
Sbjct  187   DVGRMAMSAAAVNDVAAWILLALAVALSGSGRSPLVSLWVLLCGCGFVIGCVVIVTPIFK  246

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             WM  RC +GEPV E+YVC  L+ VL +GFVTD+IGIHALFGAF+ GVLVPK+GP A ALV
Sbjct  247   WMEKRCPDGEPVKELYVCVTLSIVLLSGFVTDSIGIHALFGAFITGVLVPKEGPFAGALV  306

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVSGLFLPLYFVSSGLKTN+ TIQG QSWG LVLVI TACFGKI+GT+ +S  CR
Sbjct  307   EKVEDLVSGLFLPLYFVSSGLKTNITTIQGLQSWGFLVLVIVTACFGKIVGTVAMSLACR  366

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             IPF+EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMA+FTTFITTP+V+A+Y
Sbjct  367   IPFKEALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTTFITTPLVMAVY  426

Query  1374  KP-AKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYA  1198
             KP  K +   YK+RTI+RKDP+ +LRI  CFH+  N+P++INLIEASRGTEK  G  VYA
Sbjct  427   KPNQKTSKVAYKHRTIKRKDPNSELRIFACFHTASNVPTMINLIEASRGTEKKEGLCVYA  486

Query  1197  MHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAI  1018
             MHLMELSERSSAILM HKARKNG+PFWN +G+ +D  ++VVAFE F  LS+V IRP TAI
Sbjct  487   MHLMELSERSSAILMVHKARKNGVPFWN-KGKRSDCDQVVVAFEAFRQLSRVFIRPMTAI  545

Query  1017  SAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGI  838
             SAM  MHEDI +SAE KR AMIILPFHKHQ+ DG  ETTR+E R VN+RVLE A CSVGI
Sbjct  546   SAMHGMHEDICSSAERKRAAMIILPFHKHQRFDGVLETTRSEFRWVNKRVLEHASCSVGI  605

Query  837   LVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPET  658
             LVDRGLGG++HV+ASNV   ITVL+FGG+DD+EALAYGARM EHPGI L V RF    E 
Sbjct  606   LVDRGLGGSTHVAASNVSSVITVLFFGGNDDQEALAYGARMAEHPGISLNVVRFLPSSEI  665

Query  657   AGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGY  478
             +G           +        DE FLA  KQ+     + KYEE+ +K+ +ET++ +  +
Sbjct  666   SGEIEADTNDAESTGESA----DEIFLAEVKQKFKNLEAFKYEERWIKNTSETVDVLGEF  721

Query  477   NRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTELSKN  298
             N+C+L +VGRMP     A +  K +CPELGP+G+LL   +FST+ASVLVVQQY  +   +
Sbjct  722   NKCHLFLVGRMPVSRAAAMLKVKSDCPELGPVGSLLISPDFSTSASVLVVQQYVGQTPSS  781

Query  297   GLKED-----DSVDGDYES  256
              L  D     +S + D ES
Sbjct  782   PLLPDKVAVIESPEHDTES  800



>ref|XP_010261447.1| PREDICTED: cation/H(+) antiporter 18 isoform X2 [Nelumbo nucifera]
Length=795

 Score =  1009 bits (2608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/806 (70%), Positives = 658/806 (82%), Gaps = 16/806 (2%)
 Frame = -1

Query  2658  MGSNGTVV---CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQ  2488
             M SN T V   CP+PMK TSNG+FQGD+PLD+ALPL+I+QICLV+++TR LA+LLRPLRQ
Sbjct  1     MASNNTTVAHLCPSPMKPTSNGAFQGDNPLDFALPLVILQICLVLVVTRTLAFLLRPLRQ  60

Query  2487  PRVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKS  2308
             PRVIAEIIGG+LLGPSA GR+++YLNA+FP KSLTVLDTLA+LGLLFFLFLVG+ELDPKS
Sbjct  61    PRVIAEIIGGILLGPSALGRNKSYLNAVFPAKSLTVLDTLANLGLLFFLFLVGVELDPKS  120

Query  2307  LRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLA  2128
             LRRTGKKAL IA+AGIS+PF LG+G+SFILR TI+K V+  PFLVFMGVA SITAFPVLA
Sbjct  121   LRRTGKKALGIAVAGISVPFVLGVGSSFILRHTISKSVNGPPFLVFMGVAFSITAFPVLA  180

Query  2127  RILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVL  1948
             RILAELKLLTTDVG+MAMSAAAVNDV AWILLALAIALS +GHSP+I+LWVLL G  FV+
Sbjct  181   RILAELKLLTTDVGRMAMSAAAVNDVVAWILLALAIALSSSGHSPVITLWVLLSGCAFVI  240

Query  1947  LCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLV  1768
               ILV P IFKWMA R       DE+ +C  LAAVL AGFVTD+IGIHALFGAFV+GVLV
Sbjct  241   ASILVFPPIFKWMAQRSQ-----DEVNICGTLAAVLAAGFVTDSIGIHALFGAFVLGVLV  295

Query  1767  PKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKI  1588
             PKDG  A ALVEKVEDLVSGLFLPLYFVSSGLKTN+ATIQGAQSWGLLVLVI TACFGKI
Sbjct  296   PKDGTFADALVEKVEDLVSGLFLPLYFVSSGLKTNIATIQGAQSWGLLVLVIITACFGKI  355

Query  1587  LGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTT  1408
             +GTI+VS  C +PF+EAITLGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMALFTT
Sbjct  356   VGTIVVSLACELPFREAITLGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTT  415

Query  1407  FITTPIVIALYKPA-KLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRG  1231
             F+TTP+V+A+YKPA K+   +YK+RTI+RKD S QLRIL CFH  RNIP+LINLIEASRG
Sbjct  416   FLTTPLVMAIYKPARKVGRADYKHRTIERKDSSTQLRILACFHCTRNIPTLINLIEASRG  475

Query  1230  TEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHL  1051
             TE+  G  VYAMHLMELSERSSAILM HKARKNG+PFWN +G+ + S  +VVAFETF+ L
Sbjct  476   TERREGLCVYAMHLMELSERSSAILMVHKARKNGMPFWN-KGQQSGSDHVVVAFETFQRL  534

Query  1050  SKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRR  871
             S VS+RP TAISA+S++HEDI  SAE KRVAM+ILPFHKHQ++DG  ETTR + R VN+R
Sbjct  535   SHVSVRPMTAISALSNIHEDICTSAERKRVAMVILPFHKHQRLDGAMETTRTDFRWVNQR  594

Query  870   VLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICL  691
             VL+ APCSVGILVDRG GGT+HVSASNV Y+ITVL+ GG DDREALAYG+RM EHPGI L
Sbjct  595   VLDQAPCSVGILVDRGFGGTTHVSASNVSYSITVLFCGGRDDREALAYGSRMAEHPGISL  654

Query  690   VVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKS  511
              V R  L        +++D++       +    D++ LA F+Q+   + S+KYEE+ +  
Sbjct  655   TVIRLLLRLNPVEEVIEIDMNARSDDKEKAI--DDECLAVFRQKVQKDGSIKYEERTIGD  712

Query  510   AAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLV  331
              AE + A+R ++RCNL +VGR  E  + A +D+  ECPELGP+G+LL C +   TASVL+
Sbjct  713   TAEIIAAVREFSRCNLFLVGRRIEDSVAAVLDRISECPELGPMGSLLKCSDTLATASVLI  772

Query  330   VQQYRTELSKNGLKEDDSVDGDYESA  253
             VQQ+        L+E     G Y S+
Sbjct  773   VQQFTPHSVSVALEE----PGKYSSS  794



>ref|XP_002272080.1| PREDICTED: cation/H(+) antiporter 18 [Vitis vinifera]
 ref|XP_010658622.1| PREDICTED: cation/H(+) antiporter 18 [Vitis vinifera]
 ref|XP_010658629.1| PREDICTED: cation/H(+) antiporter 18 [Vitis vinifera]
 ref|XP_010658636.1| PREDICTED: cation/H(+) antiporter 18 [Vitis vinifera]
Length=796

 Score =  1008 bits (2607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/791 (70%), Positives = 651/791 (82%), Gaps = 14/791 (2%)
 Frame = -1

Query  2658  MGSNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M +N +    CP+PMK+ SNG FQGD+PL +ALPL I+QICLV+++TR LAYL RPLRQP
Sbjct  1     MATNSSAGHACPSPMKSVSNGIFQGDNPLHFALPLAILQICLVLVVTRGLAYLFRPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEI+GG+LLGPSA GRSE+YL+A+FP +SLTVLDTLA+LGLLFFLFL GLELDPKSL
Sbjct  61    RVIAEIVGGILLGPSALGRSESYLHAVFPSQSLTVLDTLANLGLLFFLFLAGLELDPKSL  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             RRTGKKAL IA+AGISLPF LGIGTSF+LR TIAKGV+   FLVFMGVALSITAFPVLAR
Sbjct  121   RRTGKKALGIAIAGISLPFALGIGTSFVLRETIAKGVNGTSFLVFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTTDVG+MAMSAAAVNDVAAWILLALAI+LSG+  SP++  WVLLCG GFV+ 
Sbjct  181   ILAELKLLTTDVGRMAMSAAAVNDVAAWILLALAISLSGSKQSPIVPFWVLLCGCGFVIC  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
               L++P IFKWMA RC EGEPVDE+Y+C+ LA VL AG VTD IGIHA+FGAFV+G+LVP
Sbjct  241   ASLILPPIFKWMARRCHEGEPVDEMYICSTLAVVLAAGVVTDAIGIHAMFGAFVVGILVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             K+GP ASAL+EKVEDLVSGLFLPLYFVSSGLKTNVATIQG QSW LLVLVIFTAC GKI+
Sbjct  301   KEGPFASALLEKVEDLVSGLFLPLYFVSSGLKTNVATIQGLQSWALLVLVIFTACIGKIV  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GT++VS   ++P +EA+ LGFLMN+KGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTF
Sbjct  361   GTVVVSLSFKMPLREALALGFLMNSKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTF  420

Query  1404  ITTPIVIALYKPAKLAV-TEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             ITTP+V+A+YKPAK    T++K RT++RK+ + +LRI+ CFH  RNIPS+INL EASRGT
Sbjct  421   ITTPLVVAVYKPAKRERNTDHKQRTVERKNTNTELRIMACFHGARNIPSMINLFEASRGT  480

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
              K  G  +YAMHLME SERSSAI+M HK RKNGLPFWN +G  ++S +IVVAFE F+ LS
Sbjct  481   NKHEGLCIYAMHLMEFSERSSAIMMVHKVRKNGLPFWN-KGVRSESNQIVVAFEAFQQLS  539

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +VS+RP T+IS++S MHEDI  +A+ KRVA+IILPFHKHQ++DG  ETTR + R VNRRV
Sbjct  540   QVSVRPMTSISSISDMHEDICTTADRKRVAIIILPFHKHQRVDGSLETTRTDFRWVNRRV  599

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             LE A CSVGILVDRGLGGT+HVSASNV Y ITVL+FGGHDDREALAYG RM EHPGI L+
Sbjct  600   LEHAACSVGILVDRGLGGTTHVSASNVSYFITVLFFGGHDDREALAYGIRMAEHPGINLM  659

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSA  508
             V RF ++ ETA                     DE+ LA  KQ+ S + S+KYEEK V+SA
Sbjct  660   VIRFLVEHETA---------EGIELVDGNSKPDEECLAELKQKISKDGSIKYEEKEVRSA  710

Query  507   AETMEAIRGYNRCNLLVVGRMPE-GEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLV  331
             AET+ AIR  + CNL +VGR P+   I   +D++ ECPELGPLG+LL+  +FST ASVLV
Sbjct  711   AETIAAIREASFCNLFLVGRAPDKAAIPLPLDRRSECPELGPLGSLLASTDFSTAASVLV  770

Query  330   VQQYRTELSKN  298
             +QQY   +S N
Sbjct  771   IQQYHGSVSPN  781



>gb|KDO76404.1| hypothetical protein CISIN_1g003702mg [Citrus sinensis]
Length=801

 Score =  1006 bits (2602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/799 (69%), Positives = 648/799 (81%), Gaps = 11/799 (1%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CPAPMKATSNG FQGD+PLDYALPL I+QICLVVLLTR+LA++LRPLRQPRVIAEI+GG+
Sbjct  7     CPAPMKATSNGVFQGDNPLDYALPLAILQICLVVLLTRLLAFVLRPLRQPRVIAEIVGGI  66

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GR++ +L A+FP +SLTVLDTLA+LGLLFFLFLVGLE+DPKS+RR GKKALSI
Sbjct  67    LLGPSALGRNKDFLKAVFPSRSLTVLDTLANLGLLFFLFLVGLEMDPKSIRRAGKKALSI  126

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             AL GISLPF LGIGTSF LRAT++KGV Q PFL+FMGVA SITAFPVLARILAELKLLTT
Sbjct  127   ALGGISLPFALGIGTSFALRATVSKGVDQAPFLIFMGVAFSITAFPVLARILAELKLLTT  186

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             DVG+MAMSAAAVNDVAAWILLALA+ALSG+G SPL+SLWVLLCG GFV+ C+ +V  IFK
Sbjct  187   DVGRMAMSAAAVNDVAAWILLALAVALSGSGRSPLVSLWVLLCGCGFVIGCVFIVTPIFK  246

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             WM  RC +GEPV E+YVC  L+ VL +GFVTD+IGIHALFGAF+ GVLVPK+GP A ALV
Sbjct  247   WMEKRCPDGEPVKELYVCVTLSIVLLSGFVTDSIGIHALFGAFITGVLVPKEGPFAGALV  306

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVSGL LPLYFVSSGLKTN+ TIQG QSWG LVLVI TACFGKI+GT+ +S  CR
Sbjct  307   EKVEDLVSGLLLPLYFVSSGLKTNITTIQGLQSWGFLVLVIVTACFGKIVGTVAMSLACR  366

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             IPF+EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMA+FTTFITTP+V+A+Y
Sbjct  367   IPFKEALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTTFITTPLVMAVY  426

Query  1374  KP-AKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYA  1198
             KP  K +   YK+RTI+RKDP+ +LRI  CFH+  N+P++INLIEASRGTEK  G  VYA
Sbjct  427   KPNQKTSKVAYKHRTIKRKDPNSELRIFACFHTASNVPTMINLIEASRGTEKKEGLCVYA  486

Query  1197  MHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAI  1018
             MHLMELSERSSAILM HKARKNG+PFWN +G+ +D  ++VVAFE F  LS+V IRP TAI
Sbjct  487   MHLMELSERSSAILMVHKARKNGVPFWN-KGKRSDCDQVVVAFEAFRQLSRVFIRPMTAI  545

Query  1017  SAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGI  838
             SAM  MHEDI +SAE KR AMIILPFHKHQ+ DG  ETTR+E R VN+RVLE A CSVGI
Sbjct  546   SAMHGMHEDICSSAERKRAAMIILPFHKHQRFDGVLETTRSEFRWVNKRVLEHASCSVGI  605

Query  837   LVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPET  658
             LVDRGLGG++HV+ASNV   ITVL+FGG+DD+EALAYGARM EHPGI L V RF    E 
Sbjct  606   LVDRGLGGSTHVAASNVSSVITVLFFGGNDDQEALAYGARMAEHPGISLNVVRFLPSSEI  665

Query  657   AGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGY  478
             +G           +        DE FLA  KQ+     + KYEE+ +K+ +ET++ +  +
Sbjct  666   SGEIEADTNDAESTGESA----DEIFLAEVKQKFKNLEAFKYEERWIKNTSETVDVLGEF  721

Query  477   NRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTELSKN  298
             N+C+L +VGRMP     A +  K +CPELGP+G+LL   +FST+ASVLVVQQY  +   +
Sbjct  722   NKCHLFLVGRMPVSRAAAMLKVKSDCPELGPVGSLLISPDFSTSASVLVVQQYVGQTPSS  781

Query  297   GLKED-----DSVDGDYES  256
              L  D     +S + D ES
Sbjct  782   PLLPDKVAVIESPEHDTES  800



>ref|XP_008341283.1| PREDICTED: cation/H(+) antiporter 18-like [Malus domestica]
 ref|XP_008341284.1| PREDICTED: cation/H(+) antiporter 18-like [Malus domestica]
Length=806

 Score =  1005 bits (2599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/785 (72%), Positives = 665/785 (85%), Gaps = 11/785 (1%)
 Frame = -1

Query  2658  MGSNGTVV--CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M +N TV   CPAPMKATSNG FQGD+PLDYALPL I+QICLVV LTR+LAYLLRPLRQP
Sbjct  1     MATNTTVATACPAPMKATSNGVFQGDNPLDYALPLAILQICLVVTLTRILAYLLRPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEI+GG+LLGPSA G ++ Y+ AIFPK+SLTVLDTLA+LGLLFFLF+VGLELDPKS+
Sbjct  61    RVIAEIVGGILLGPSALGHNKDYIEAIFPKRSLTVLDTLANLGLLFFLFIVGLELDPKSI  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             RRTGKKAL IALAGI LPF LGIGTSF L+ TI+KGV   PFLVFMGVALSITAFPVLAR
Sbjct  121   RRTGKKALCIALAGIILPFVLGIGTSFALKETISKGVDGPPFLVFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTTD+G+MAMSAAA+NDVAAWILLALAI+LSGTG SPL+SLWVLLCG  FVL 
Sbjct  181   ILAELKLLTTDIGRMAMSAAAINDVAAWILLALAISLSGTGRSPLVSLWVLLCGCAFVLG  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
             C+  V  IFKWMA RC EGEPV+E+YVCA L AVL AGFVTDTIGIHALFGAFV+G++VP
Sbjct  241   CVFFVRPIFKWMAQRCPEGEPVEELYVCATLVAVLAAGFVTDTIGIHALFGAFVLGIIVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             K+GP A ALVEKVEDLVSGLFLPLYFVSSGLKT++ATI GAQSWGLLVLVI TACFGK+ 
Sbjct  301   KEGPFAGALVEKVEDLVSGLFLPLYFVSSGLKTDIATIHGAQSWGLLVLVISTACFGKVF  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GT+ VS LCR+PFQEA+ LGFLMNTKGLVELIVLNIG++R VLNDQTFAIMVLMA+FTTF
Sbjct  361   GTVAVSLLCRLPFQEALALGFLMNTKGLVELIVLNIGRERKVLNDQTFAIMVLMAIFTTF  420

Query  1404  ITTPIVIALYKPAKL-AVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             ITTP+V+A+YKPAK  + ++YKYRTI+RKDP+ +L+ILTCFH  RN+P++INLIEASRGT
Sbjct  421   ITTPVVMAVYKPAKRKSTSDYKYRTIERKDPNTELQILTCFHGTRNLPTMINLIEASRGT  480

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDS--TEIVVAFETFEH  1054
              K     VYAMHLMEL+ERSSAILM HKAR+NGLPFWN   + TDS   ++VVAFETFE 
Sbjct  481   GKKERLCVYAMHLMELNERSSAILMVHKARRNGLPFWN---KVTDSGNNQLVVAFETFEQ  537

Query  1053  LSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNR  874
             LS+V+IRP TAIS++SSMHEDI A AE KR A+II+PFHKHQ++DG   TTR E R VN+
Sbjct  538   LSRVAIRPMTAISSVSSMHEDICAMAERKRAAIIIVPFHKHQRLDGVLVTTRTEYRGVNQ  597

Query  873   RVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGIC  694
             RVLE APCSVGI+VDRGLGG++HVSASNV  +I V++FGG DD EALAYG RM EHPG  
Sbjct  598   RVLEHAPCSVGIMVDRGLGGSTHVSASNVSSSIVVVFFGGSDDHEALAYGMRMAEHPGNN  657

Query  693   LVVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVK  514
             L V  F   PE     V++D++   ++S      +E F+A  K +   +SS+KYEE+VV+
Sbjct  658   LTVVHFLASPELQREIVQVDINEGFNTSAGSV--NEKFIAELK-KVPNDSSIKYEERVVR  714

Query  513   SAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVL  334
             +AAET + IR +NRCNL +VGR PEG++ AA++ KG+CPELGP+G+LL+  +F+TTASVL
Sbjct  715   NAAETTDLIREFNRCNLFLVGRRPEGQVAAALNIKGDCPELGPVGSLLTSPDFTTTASVL  774

Query  333   VVQQY  319
             VVQQY
Sbjct  775   VVQQY  779



>ref|XP_006476453.1| PREDICTED: cation/H(+) antiporter 18-like isoform X1 [Citrus 
sinensis]
 ref|XP_006476454.1| PREDICTED: cation/H(+) antiporter 18-like isoform X2 [Citrus 
sinensis]
 ref|XP_006476455.1| PREDICTED: cation/H(+) antiporter 18-like isoform X3 [Citrus 
sinensis]
Length=801

 Score =  1004 bits (2596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/773 (71%), Positives = 638/773 (83%), Gaps = 6/773 (1%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CPAPMKATSNG FQGD+PLDYALPL I+QICLVVLLTR+LA++LRPLRQPRVIAEI+GG+
Sbjct  7     CPAPMKATSNGVFQGDNPLDYALPLAILQICLVVLLTRLLAFVLRPLRQPRVIAEIVGGI  66

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GR++ +L A+FP +SLTVLDTLA+LGLLFFLFLVGLE+DPKS+RR GKKALSI
Sbjct  67    LLGPSALGRNKDFLKAVFPSRSLTVLDTLANLGLLFFLFLVGLEMDPKSIRRAGKKALSI  126

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             AL GISLPF LGIGTSF LRAT++KGV Q PFL+FMGVA SITAFPVLARILAELKLLTT
Sbjct  127   ALGGISLPFALGIGTSFALRATVSKGVDQAPFLIFMGVAFSITAFPVLARILAELKLLTT  186

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             DVG+MAMSAAAVNDVAAWILLALA+ALSG+G SPL+SLWVLLCG GFV+ C+ +V  IFK
Sbjct  187   DVGRMAMSAAAVNDVAAWILLALAVALSGSGRSPLVSLWVLLCGCGFVIGCVFIVTPIFK  246

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             WM  RC +GEPV E+YVC  L+ VL +GFVTD+IGIHALFGAF+ GVLVPK+GP A ALV
Sbjct  247   WMEKRCPDGEPVKELYVCVTLSIVLLSGFVTDSIGIHALFGAFITGVLVPKEGPFAGALV  306

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVSGL LPLYFVSSGLKTN+ TIQG QSWG LVLVI TACFGKI+GT+ +S  CR
Sbjct  307   EKVEDLVSGLLLPLYFVSSGLKTNITTIQGLQSWGFLVLVIVTACFGKIVGTVAMSLACR  366

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             IPF+EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMA+FTTFITTP+V+A+Y
Sbjct  367   IPFKEALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTTFITTPLVMAVY  426

Query  1374  KP-AKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYA  1198
             KP  K +   YK+RTI+RKDP+ +LRI  CFH+  N+P++INLIEASRGTEK  G  VYA
Sbjct  427   KPNQKTSKVAYKHRTIKRKDPNSELRIFACFHTASNVPTMINLIEASRGTEKKEGLCVYA  486

Query  1197  MHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAI  1018
             MHLMELSERSSAILM HKARKNG+PFWN +G+ +D  ++VVAFE F  LS+V IRP TAI
Sbjct  487   MHLMELSERSSAILMVHKARKNGVPFWN-KGKRSDCDQVVVAFEAFRQLSRVFIRPMTAI  545

Query  1017  SAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGI  838
             SAM  MHEDI +SAE KR AMIILPFHKHQ+ DG  ETTR+E R VN+RVLE A CSVGI
Sbjct  546   SAMHGMHEDICSSAERKRAAMIILPFHKHQRFDGVLETTRSEFRWVNKRVLEHASCSVGI  605

Query  837   LVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPET  658
             LVDRGLGG++HV+ASNV   ITVL+FGG+DD+EALAYGARM EHPGI L V RF    E 
Sbjct  606   LVDRGLGGSTHVAASNVSSVITVLFFGGNDDQEALAYGARMAEHPGISLNVVRFLPSSEI  665

Query  657   AGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGY  478
             +G           +        DE FLA  KQ+     + KYEE+ +K+ +ET++ +  +
Sbjct  666   SGEIEADTNDAESTGESA----DEIFLAEVKQKFKNLEAFKYEERWIKNTSETVDVLGEF  721

Query  477   NRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             N+C+L +VGRMP     A +  K +CPELGP+G+LL   +FST+ASVLVVQQY
Sbjct  722   NKCHLFLVGRMPVSRAAAMLKVKSDCPELGPVGSLLISPDFSTSASVLVVQQY  774



>ref|XP_002276346.1| PREDICTED: cation/H(+) antiporter 18 [Vitis vinifera]
 ref|XP_010658644.1| PREDICTED: cation/H(+) antiporter 18 [Vitis vinifera]
Length=786

 Score =  1000 bits (2586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/777 (73%), Positives = 647/777 (83%), Gaps = 5/777 (1%)
 Frame = -1

Query  2643  TVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEII  2464
              V CP P KATSNG FQGD+P+ +ALPLLIVQICLV+++TR LA+LL+PLRQPRVIAEI+
Sbjct  4     NVTCPPPTKATSNGVFQGDNPIHFALPLLIVQICLVLVVTRCLAFLLKPLRQPRVIAEIV  63

Query  2463  GGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKA  2284
             GG+LLGPSA GR++ YL++IFP KSLTVLDTLA+LGLLFFLFLVGLELD  SLRRTGKKA
Sbjct  64    GGILLGPSALGRNKQYLHSIFPPKSLTVLDTLANLGLLFFLFLVGLELDLNSLRRTGKKA  123

Query  2283  LSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKL  2104
             LSIA+AGISLPF LG+GTS +LRATI+KGV  GPFLVFMGVALSITAFPVLARILAELKL
Sbjct  124   LSIAVAGISLPFALGVGTSVVLRATISKGVDAGPFLVFMGVALSITAFPVLARILAELKL  183

Query  2103  LTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPR  1924
             LTTDVG+MAMSAAAVNDVAAWILLALAIALSGTG SP+++LWV LCG GFVL C L+ PR
Sbjct  184   LTTDVGRMAMSAAAVNDVAAWILLALAIALSGTGRSPIVALWVFLCGFGFVLCCSLIAPR  243

Query  1923  IFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLAS  1744
             IFKWMA RC EGEPVDE+YVCA LAAVL AGFVTD IGIHALFGAFV+G+LVPK+GP A 
Sbjct  244   IFKWMAQRCPEGEPVDEMYVCATLAAVLAAGFVTDAIGIHALFGAFVMGILVPKEGPFAG  303

Query  1743  ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVST  1564
             ALVEKVEDLVSGL LPLYFVSSGLKT+VATI+G QSWGLLVLVIFTAC GKI GT+ VS 
Sbjct  304   ALVEKVEDLVSGLLLPLYFVSSGLKTDVATIRGLQSWGLLVLVIFTACLGKIAGTVAVSL  363

Query  1563  LCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI  1384
               R+P  EA+ LGFLMN+KGLVELIVLNIGK+R VLNDQTFAIMVLMALFTTFITTP+VI
Sbjct  364   SWRMPVPEALALGFLMNSKGLVELIVLNIGKERKVLNDQTFAIMVLMALFTTFITTPLVI  423

Query  1383  ALYKPAK-LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFK  1207
             A+YKPAK  +  +Y +RTI RK+P+ +LRIL CF S  +IP++INL+EASRGT K  G  
Sbjct  424   AVYKPAKRTSKADYNHRTIDRKNPNAELRILVCFQSSNSIPTIINLVEASRGTAKREGLC  483

Query  1206  VYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPS  1027
             VYAMHLMELSERSSAILM HKARKNGLPFWN +   + S +++VAFE F  LS+VSIRP 
Sbjct  484   VYAMHLMELSERSSAILMVHKARKNGLPFWN-KAVRSGSNQLIVAFEAFGQLSRVSIRPM  542

Query  1026  TAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCS  847
             TAISAMS+MHEDI  SAE KR A+IILPFHKHQ+ DG  ET+R+E   VNR+VLE A CS
Sbjct  543   TAISAMSNMHEDICTSAERKRAAIIILPFHKHQRFDGTLETSRSEFGVVNRKVLEHARCS  602

Query  846   VGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLD  667
             VGILVDR LGGT+ VSASNV   ITV +FGG DDREAL+YGARM EHPGI LV  RF   
Sbjct  603   VGILVDRDLGGTAQVSASNVSSIITVPFFGGCDDREALSYGARMAEHPGISLVAIRFLFH  662

Query  666   PETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAI  487
             P+T   ++  D  P+ +S+      DE+FLA FK + S NSSVK EE+VVK+AAE +E I
Sbjct  663   PDTLDEAITPDPHPNPNSNSSL---DENFLAEFKNKTSHNSSVKLEERVVKNAAEAIEII  719

Query  486   RGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYR  316
             R Y+RC + VVGR PEG++VA +    E PELGP+G+LL+C    T ASVLVVQQY+
Sbjct  720   REYHRCTMFVVGRTPEGQLVAGLSPLIEFPELGPVGSLLTCGGIPTAASVLVVQQYQ  776



>emb|CAN81239.1| hypothetical protein VITISV_031074 [Vitis vinifera]
Length=786

 Score =   994 bits (2569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/777 (72%), Positives = 644/777 (83%), Gaps = 5/777 (1%)
 Frame = -1

Query  2643  TVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEII  2464
              V CP P KATSNG FQGD+P+ +ALPLLIVQICLV+++TR LA+LL+PLRQPRVIAEI+
Sbjct  4     NVTCPPPTKATSNGVFQGDNPIHFALPLLIVQICLVLVVTRCLAFLLKPLRQPRVIAEIV  63

Query  2463  GGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKA  2284
             GG+LLGPSA GR++ YL++IFP KSLTVLDTLA+LGLLFFLFLVGLELD  SLRRTGKKA
Sbjct  64    GGILLGPSALGRNKXYLHSIFPPKSLTVLDTLANLGLLFFLFLVGLELDLNSLRRTGKKA  123

Query  2283  LSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKL  2104
             LSIA+AGISLPF LG+GTS +LRATI+KGV  GPFLVFMGVALSITAFPVLARILAELKL
Sbjct  124   LSIAVAGISLPFALGVGTSVVLRATISKGVDAGPFLVFMGVALSITAFPVLARILAELKL  183

Query  2103  LTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPR  1924
             LTTDVG+MAMSAAAVNDVAAWILLALAIALSGTG SP+++LWV LCG GFVL C L+ PR
Sbjct  184   LTTDVGRMAMSAAAVNDVAAWILLALAIALSGTGRSPIVALWVFLCGFGFVLCCSLIAPR  243

Query  1923  IFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLAS  1744
             IFKWMA RC EGEPVDE+YVCA LAAVL AGFVTD IGIHALFGAFV+G+LVPK+GP A 
Sbjct  244   IFKWMAQRCPEGEPVDEMYVCATLAAVLAAGFVTDAIGIHALFGAFVMGILVPKEGPFAG  303

Query  1743  ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVST  1564
             ALVEKVEDLVSGL LPLYFVSSGLKT+VATI+G QSWGLLVLVIFTAC GKI GT+ VS 
Sbjct  304   ALVEKVEDLVSGLLLPLYFVSSGLKTDVATIRGLQSWGLLVLVIFTACLGKIAGTVAVSL  363

Query  1563  LCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI  1384
               R+P  EA+ LGFLMN+KGLVELIVLNIGK+R VLNDQTFAIMVLMALFTTFITTP+VI
Sbjct  364   SWRMPVPEALALGFLMNSKGLVELIVLNIGKERKVLNDQTFAIMVLMALFTTFITTPLVI  423

Query  1383  ALYKPAK-LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFK  1207
              +YKPAK  +  +Y +RTI RK+P+ +LRIL CF S  +IP++INL+EASRGT K  G  
Sbjct  424   XIYKPAKRTSKADYNHRTIDRKNPNAELRILVCFQSSNSIPTIINLVEASRGTAKREGLC  483

Query  1206  VYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPS  1027
             VYAMHLMELSERSSAILM HKARKNGLPFWN +   + S +++VAFE F  LS+VSIRP 
Sbjct  484   VYAMHLMELSERSSAILMVHKARKNGLPFWN-KAVRSGSNQLIVAFEAFGQLSRVSIRPM  542

Query  1026  TAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCS  847
             TAISAMS+MHEDI  SAE KR A+IILPFHKHQ+ DG  ET+R+E   VNR+VLE A CS
Sbjct  543   TAISAMSNMHEDICTSAERKRAAIIILPFHKHQRFDGTLETSRSEFGVVNRKVLEHARCS  602

Query  846   VGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLD  667
             VGILVDR LGGT+ VSASNV   ITV +FGG DDREAL+YGARM EHPGI LV  RF   
Sbjct  603   VGILVDRDLGGTAQVSASNVSSIITVPFFGGCDDREALSYGARMAEHPGISLVAIRFLFH  662

Query  666   PETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAI  487
             P+T   ++  D  P+ +S+      DE+FLA FK + S N SVK EE+VVK+AAE +E I
Sbjct  663   PDTLDEAITPDPHPNXNSNSSL---DENFLAEFKNKTSHNXSVKLEERVVKNAAEAIEII  719

Query  486   RGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYR  316
             R Y+RC + VVGR PEG++VA +    E  ELGP+G+LL+C    T ASVLVVQQY+
Sbjct  720   REYHRCTMFVVGRTPEGQLVAGLSPLIEFXELGPVGSLLTCGGIPTAASVLVVQQYQ  776



>ref|XP_006573800.1| PREDICTED: cation/H(+) antiporter 18-like isoform X1 [Glycine 
max]
 ref|XP_006573801.1| PREDICTED: cation/H(+) antiporter 18-like isoform X2 [Glycine 
max]
 ref|XP_006573802.1| PREDICTED: cation/H(+) antiporter 18-like isoform X3 [Glycine 
max]
Length=806

 Score =   991 bits (2561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/810 (68%), Positives = 648/810 (80%), Gaps = 12/810 (1%)
 Frame = -1

Query  2658  MGSNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M SN T    CP PMKATSNG+FQGD PLD+ALPL I+QICLV++++R LAYLL+PLRQP
Sbjct  1     MASNATSKNACPPPMKATSNGAFQGDDPLDFALPLAILQICLVLVVSRGLAYLLKPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEIIGG++LGPSA GR+++Y+  +FP +SLTVLDTLA++GL+FFLFL GLELD KSL
Sbjct  61    RVIAEIIGGIILGPSALGRNKSYMQNVFPPRSLTVLDTLANIGLIFFLFLAGLELDLKSL  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             R++G + L+IA+AGISLPF +GIG+SF+L+ TIAKG     FLVFMGVALSITAFPVLAR
Sbjct  121   RQSGNRVLAIAMAGISLPFVIGIGSSFVLKQTIAKGADSAAFLVFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTT+VG+ AMSAAA+ND+AAWILLALA+ALSG   SPL+SLWV L G GFV+ 
Sbjct  181   ILAELKLLTTNVGRTAMSAAAINDIAAWILLALAVALSGHDRSPLVSLWVFLAGCGFVIC  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
              IL+VP IFKWM+ RC EGEPV+E+Y+CA LAAVL AGFVTD IGIHA+FGAFV+G+LVP
Sbjct  241   AILIVPPIFKWMSQRCHEGEPVEEVYICATLAAVLAAGFVTDAIGIHAMFGAFVVGILVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
              DGP ASALVEKVEDLVSGLFLPLYFVSSGLKTNVATI+GAQSWGLLV VIFTA FGKIL
Sbjct  301   SDGPFASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIKGAQSWGLLVFVIFTASFGKIL  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GT++VS  C++PF EA+ LGFLMN KGLVELIVLNIGKDR VLNDQTFAIMVLMA+FTTF
Sbjct  361   GTLVVSLFCKVPFNEALVLGFLMNCKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTTF  420

Query  1404  ITTPIVIALYKPA-KLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             ITTP+V A+YKPA K  + +YKYRTI RK+ + QLRILTCFH  RNIPS+INLIEASRG 
Sbjct  421   ITTPLVTAVYKPARKGKIVDYKYRTIGRKNANSQLRILTCFHGARNIPSMINLIEASRGI  480

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
              K     VYAMHL E SERSS ILM HKAR+NGLPFWN +G   DS  ++VAFE +  LS
Sbjct  481   RKGDALCVYAMHLKEFSERSSTILMVHKARRNGLPFWN-KGHHADSNHVIVAFEAYRQLS  539

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +VSIRP  AIS+M+++HEDI A+AE K  A+IILPFHKHQ++DG    TRN+ R VN+RV
Sbjct  540   QVSIRPMIAISSMNNIHEDICATAERKGAAVIILPFHKHQRLDGSLNITRNDFRWVNKRV  599

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             LE APCSVGI VDRGLGGTSHVSASNV Y +TVL+FGG DDREALAYGARM EHPGI L+
Sbjct  600   LEHAPCSVGIFVDRGLGGTSHVSASNVSYRVTVLFFGGGDDREALAYGARMAEHPGIRLL  659

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSA  508
             V RF  +P   G    + V    S+  +  S+DE+FL  FK + + + S+ YEEKVVK  
Sbjct  660   VIRFVGEPMNEGE--IVRVDVGDSTGTKLISQDEEFLDEFKAKIANDDSIIYEEKVVKDG  717

Query  507   AETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVV  328
             AET+  I   N CNL +VG  P  E+ +AM K+ ECPELGP+G LL+ +++ TTASVLV+
Sbjct  718   AETVAIICELNSCNLFLVGSRPASEVASAM-KRSECPELGPVGGLLASQDYPTTASVLVM  776

Query  327   QQYRTELSKNGLKEDDSV-----DGDYESA  253
             QQY+     N    D  +     D D ESA
Sbjct  777   QQYQNGAPINFTISDSEMEEHVPDRDSESA  806



>ref|XP_010101602.1| Cation/H(+) antiporter 18 [Morus notabilis]
 gb|EXB88792.1| Cation/H(+) antiporter 18 [Morus notabilis]
Length=813

 Score =   989 bits (2558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/791 (70%), Positives = 642/791 (81%), Gaps = 17/791 (2%)
 Frame = -1

Query  2658  MGSNGTVV--CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M  N +V   CP+PM ATSNG FQGD+PLDYALPL I+QI LVV LTR LA+LLRPLRQP
Sbjct  1     MAPNASVASSCPSPMHATSNGVFQGDNPLDYALPLAILQILLVVALTRTLAFLLRPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEI+GG+LLGPSAFGR++AYL+A+FP KSLTVLDTLA+LGLLFFLFLVGLELD K+L
Sbjct  61    RVIAEIVGGILLGPSAFGRNKAYLDAVFPDKSLTVLDTLANLGLLFFLFLVGLELDLKAL  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGP-FLVFMGVALSITAFPVLA  2128
             RRTGKKA SIA+ GISLPF +GIGTSF LRATI+KGV QGP FLVF+GVALSITAFPVLA
Sbjct  121   RRTGKKAFSIAIVGISLPFIIGIGTSFALRATISKGV-QGPAFLVFIGVALSITAFPVLA  179

Query  2127  RILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVL  1948
              IL ELKLLTTD+G+MAMSAAAVND+ AWILLALAIALSG   SPL+SLWV LC + FVL
Sbjct  180   CILVELKLLTTDLGRMAMSAAAVNDIVAWILLALAIALSGDDSSPLVSLWVFLCSSAFVL  239

Query  1947  LCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLV  1768
              C   VP IFKWMA RC EGEPV E+YVCA LAAVL AGFVTDTIGIHALFGAFVIGVLV
Sbjct  240   CCAFGVPPIFKWMAQRCPEGEPVKELYVCATLAAVLAAGFVTDTIGIHALFGAFVIGVLV  299

Query  1767  PKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKI  1588
             PK+GP A A+VEKVEDLVSGLFLPLYFVSSGLKTN+ TI GAQSWGLLVLVI TACFGKI
Sbjct  300   PKEGPFAGAMVEKVEDLVSGLFLPLYFVSSGLKTNITTISGAQSWGLLVLVIITACFGKI  359

Query  1587  LGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTT  1408
             +GT++VS  C++P QE++ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMA+FTT
Sbjct  360   VGTVVVSLFCKVPLQESLALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTT  419

Query  1407  FITTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             FITTP+VIA+YKPAK     YK R I +K+ + +LRIL CF+S RNIP++INLIEASRGT
Sbjct  420   FITTPLVIAVYKPAKRKNNYYKDRCIGKKETNTELRILACFYSIRNIPTMINLIEASRGT  479

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
             EK     VYAMHLMEL+ER S+ILM HKARKNGLPFWN +G  ++S +IVVAFE F+ LS
Sbjct  480   EKKERLCVYAMHLMELTERPSSILMVHKARKNGLPFWN-KGSQSNSDQIVVAFEAFQQLS  538

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +VSIRP TAISAMS MHEDI ASAE KR AMIILPFHKHQ+ DG  ETTR E R +N++V
Sbjct  539   RVSIRPMTAISAMSDMHEDICASAERKRTAMIILPFHKHQRWDGALETTRAEFRVINKKV  598

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             LE APCSVGILVDRG GGT+H+SAS+V   + VL+FGGHDD EALA+G RM +HPGI L 
Sbjct  599   LEQAPCSVGILVDRGFGGTTHISASHVSSNVKVLFFGGHDDCEALAFGMRMAKHPGISLN  658

Query  687   VARFTLDP-------ETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYE  529
             V      P       ET G            S+     +DE+ LA  KQ+   +SS+KYE
Sbjct  659   VIHLLPGPAMMEEAKETVGV-----DIQEDDSNISFGPQDENALAELKQKILIDSSIKYE  713

Query  528   EKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFST  349
              + V++++ET+ AI+ ++ CNL +VGR P+G +   +  K ECPELGP+GNLL+  +FST
Sbjct  714   VRQVENSSETIAAIKEFSGCNLFLVGRNPQGVVANGLSVKSECPELGPVGNLLTSADFST  773

Query  348   TASVLVVQQYR  316
             TASVLVVQ++R
Sbjct  774   TASVLVVQRHR  784



>ref|XP_006360740.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum tuberosum]
Length=793

 Score =   989 bits (2558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/786 (69%), Positives = 653/786 (83%), Gaps = 5/786 (1%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CP+PMKATSNG FQGD+PLD+ALPL I+QICLV+++TR LA+LLRPLRQPRVIAE+IGG+
Sbjct  5     CPSPMKATSNGIFQGDNPLDFALPLAILQICLVLVVTRGLAFLLRPLRQPRVIAEVIGGI  64

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GR++ YLNA+FP KS+TVLDTLA++GLLFFLFL GLELD KSLR++GKK L+I
Sbjct  65    LLGPSALGRNKGYLNAVFPPKSITVLDTLANIGLLFFLFLAGLELDVKSLRQSGKKVLAI  124

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             A+ GI+LPF LGIGTSFILR TI KGV+   FLVFMGVALSITAFPVLARILAELKLLTT
Sbjct  125   AVTGITLPFALGIGTSFILRGTINKGVNATAFLVFMGVALSITAFPVLARILAELKLLTT  184

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             DVG+MAMSAAA+NDVAAWILLALAIALSG   SP++ LWV LCG GFV+   L+VP IFK
Sbjct  185   DVGRMAMSAAAINDVAAWILLALAIALSGDNLSPVVPLWVFLCGCGFVIGAYLIVPPIFK  244

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             W++ RC EGEPVDE+Y+CA LAAVL AG VTD IGIHA+FGAFVIGVL+PK+GP A  LV
Sbjct  245   WISRRCHEGEPVDELYICATLAAVLAAGLVTDVIGIHAMFGAFVIGVLLPKEGPFAGELV  304

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVSGLFLPLYFVSSGLKTNVATIQG QSWGLLVLVIFTACFGKI+GT +VS L +
Sbjct  305   EKVEDLVSGLFLPLYFVSSGLKTNVATIQGIQSWGLLVLVIFTACFGKIVGTFIVSLLWK  364

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             IP  EA+ LGFLMN+KGLVELIVLNIGKDR VLNDQTFAIMV+MALFTTFITTP+V+A+Y
Sbjct  365   IPKNEALALGFLMNSKGLVELIVLNIGKDRKVLNDQTFAIMVMMALFTTFITTPLVLAVY  424

Query  1374  KPAK-LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYA  1198
             KPAK L+  +YK+R I+RK+P+ +LRILTCF S RNIPS+INL+EASRGTE+     VYA
Sbjct  425   KPAKMLSKGDYKHRRIERKNPNTELRILTCFRSSRNIPSVINLLEASRGTERGERLSVYA  484

Query  1197  MHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAI  1018
             MHLME SER SAILM HKAR NGLPFWN +G+ + +  +VVAFE F+ LS+VS+RP T+I
Sbjct  485   MHLMEFSERPSAILMVHKARHNGLPFWN-KGQRS-ANHVVVAFEAFQQLSQVSVRPMTSI  542

Query  1017  SAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGI  838
             S++S MHEDI  +AE K +AMIILP+HK+ ++DG FE+TR +   VNRRVLE A CSVGI
Sbjct  543   SSLSDMHEDICITAEKKNIAMIILPYHKNLRLDGSFESTRPDFHLVNRRVLEHASCSVGI  602

Query  837   LVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPET  658
              VDRGLGGT+ +SASNV ++I VLYFGGHDDREALAYG RM EHPG+ L V RF +  E+
Sbjct  603   FVDRGLGGTAQISASNVSFSIIVLYFGGHDDREALAYGTRMAEHPGVELTVIRFLV--ES  660

Query  657   AGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGY  478
               +   + +   G+S+    S DE FLAAF+   S +SS+KYEEK V++ +ET+  +R Y
Sbjct  661   DSSEEIVTIHTEGTSAATLVSADEGFLAAFRTSISDDSSIKYEEKTVRNVSETITILRDY  720

Query  477   NRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTELSKN  298
             +RC+L +VGR P+G +  A+ ++ +CPELGP+G+LL+  E++TTASVLVVQQY   L  N
Sbjct  721   SRCSLFLVGRRPDGVLPLALSQRIDCPELGPVGSLLTSPEYTTTASVLVVQQYYDNLYAN  780

Query  297   GLKEDD  280
               ++ D
Sbjct  781   SSQQRD  786



>ref|XP_006476457.1| PREDICTED: cation/H(+) antiporter 18-like isoform X2 [Citrus 
sinensis]
Length=797

 Score =   989 bits (2557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/792 (70%), Positives = 651/792 (82%), Gaps = 13/792 (2%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CPAPMK TSNG FQGDSPLD+ALPL I+QICLV+LLTR LA++LRPLRQPRVIAEI GG+
Sbjct  8     CPAPMKPTSNGVFQGDSPLDFALPLAILQICLVILLTRGLAFILRPLRQPRVIAEITGGI  67

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GRSE +L A+FP KS TVLDTLA+LGL+FF+FLVGLELDPKSLR+TGKKAL I
Sbjct  68    LLGPSALGRSERFLQAVFPPKSQTVLDTLANLGLIFFMFLVGLELDPKSLRQTGKKALGI  127

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             A+AGISLPF LGIG+SF+LR TI+KGV    FLVFMGVALSITAFPVLARILAELKLLT 
Sbjct  128   AIAGISLPFALGIGSSFLLRETISKGVDSRSFLVFMGVALSITAFPVLARILAELKLLTA  187

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             DVG+MAMSAAAVNDVAAWILLALA+ALSG+G S L+ +WV L G  FV+   L+VP  FK
Sbjct  188   DVGRMAMSAAAVNDVAAWILLALAVALSGSGQSSLVPVWVFLSGCVFVICLTLLVPPTFK  247

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             WMA +C EGEPV+E YVCA LAAVL AGF+TD IGIHA+FGAFV+GVLVPK+GP ASALV
Sbjct  248   WMARQCHEGEPVEETYVCATLAAVLAAGFITDAIGIHAMFGAFVVGVLVPKEGPFASALV  307

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVSG+FLPLYFVSSGLKTN+ATIQG QSWGLL LVI TAC GKI+GT +VS   +
Sbjct  308   EKVEDLVSGIFLPLYFVSSGLKTNIATIQGLQSWGLLALVILTACLGKIVGTFVVSLSFK  367

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +P +EA+ LG LMNTKGLVELIVLNIGKDR VLNDQ FAIMVLMA+ TTF+TTP+V+A+Y
Sbjct  368   VPLREALALGILMNTKGLVELIVLNIGKDRKVLNDQVFAIMVLMAVVTTFMTTPLVMAVY  427

Query  1374  KPAKLA-VTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYA  1198
             KPA+ A V +YK+RT++RK+   Q RIL CFHS RNIPS INL+EA RG +KS G  VYA
Sbjct  428   KPARRARVADYKHRTVERKNSKAQFRILACFHSARNIPSTINLLEALRGIQKSEGLCVYA  487

Query  1197  MHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAI  1018
             +HLMELSERSSAILM HKAR+NGLPFWN RG  ++   IVVAFE F+ LS+VS+RP TAI
Sbjct  488   LHLMELSERSSAILMVHKARRNGLPFWN-RGRQSNPNHIVVAFEAFQQLSRVSVRPMTAI  546

Query  1017  SAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGI  838
             S+MS MHEDI  +AE KR A+IILPFHKHQ++DG  ETTR++ R VN+RVL+ APCSVGI
Sbjct  547   SSMSDMHEDICTTAESKRAAIIILPFHKHQRLDGSLETTRSDFRWVNQRVLKHAPCSVGI  606

Query  837   LVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPET  658
             L+DRGLGGT+ VSASNV YTITVL+FGG DDREALA GARM EHPGI  +V RF L  +T
Sbjct  607   LIDRGLGGTTQVSASNVSYTITVLFFGGRDDREALACGARMAEHPGISFIVIRFLLAADT  666

Query  657   AGTsvkldvspsgssspeekSRDEDFLAAFKQRNS-TNSSVKYEEKVVKSAAETMEAIRG  481
              G +V +D++ + S        DE+ L+ FK + S  + SV+YEE++V++  ET+  IR 
Sbjct  667   IGNTVSVDMAGNASM-------DEEVLSEFKLKTSHRDGSVRYEERLVRNTTETIAVIRE  719

Query  480   YNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTELSK  301
              +RCNLL+VGRMP+GE+  A+  + +CPELGP+G+LL+  EFS TASVLV+QQY   +S 
Sbjct  720   VSRCNLLLVGRMPDGELALALSTRSDCPELGPVGSLLTSLEFS-TASVLVIQQYSDRVSM  778

Query  300   NGLK--EDDSVD  271
             N     E+DS D
Sbjct  779   NLASELEEDSPD  790



>gb|KHN25663.1| Cation/H(+) antiporter 18 [Glycine soja]
Length=806

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/810 (68%), Positives = 647/810 (80%), Gaps = 12/810 (1%)
 Frame = -1

Query  2658  MGSNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M SN T    CP PMKATSNG+FQGD PLD+ALPL I+QICLV++++R LAYLL+PLRQP
Sbjct  1     MASNATSKNACPPPMKATSNGAFQGDDPLDFALPLAILQICLVLVVSRGLAYLLKPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEIIGG++LGPSA GR+++Y+  +FP +SLTVLDTLA++GL+FFLFL GLELD KSL
Sbjct  61    RVIAEIIGGIILGPSALGRNKSYMQNVFPPRSLTVLDTLANIGLIFFLFLAGLELDLKSL  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             R++G + L+IA+AGISLPF +GIG+SF+L+ TIAKG     FLVFMGVALSITAFPVLAR
Sbjct  121   RQSGNRVLAIAMAGISLPFVIGIGSSFVLKQTIAKGADSAAFLVFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTT+VG+ AMSAAA+ND+AAWILLALA+ALSG   SPL+SLWV L G GFV+ 
Sbjct  181   ILAELKLLTTNVGRTAMSAAAINDIAAWILLALAVALSGHDRSPLVSLWVFLAGCGFVIC  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
              IL+VP IFKWM+ RC EGEPV+E+Y+CA LAAVL AGFVTD IGIHA+FGAFV+G+LVP
Sbjct  241   AILIVPPIFKWMSQRCHEGEPVEEVYICATLAAVLAAGFVTDAIGIHAMFGAFVVGILVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
              DGP ASALVEKVEDLVSGLFLPLYFVSSGLKTNVATI+GAQSWGLLV VIFTA FGKIL
Sbjct  301   SDGPFASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIKGAQSWGLLVFVIFTASFGKIL  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GT++VS  C++PF EA+ LGFLMN KGLVELIVLNIGKDR VLNDQTFAIMVLMA+FTTF
Sbjct  361   GTLVVSLFCKVPFNEALVLGFLMNCKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTTF  420

Query  1404  ITTPIVIALYKPA-KLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             ITTP+V A+YKPA K  + +YKYRTI RK+ + QLRILTCFH  RNIPS+INLIEASRG 
Sbjct  421   ITTPLVTAVYKPARKGKIVDYKYRTIGRKNANSQLRILTCFHGARNIPSMINLIEASRGI  480

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
              K     VYAMHL E SERSS ILM HKAR+NGLPFWN +G   DS  ++VAFE +  LS
Sbjct  481   RKGDALCVYAMHLKEFSERSSTILMVHKARRNGLPFWN-KGHHADSNHVIVAFEAYRQLS  539

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +VSIRP  AIS+M+++HEDI A+AE K  A+IILPFHKHQ++DG    TRN+ R VN+RV
Sbjct  540   QVSIRPMIAISSMNNIHEDICATAERKGAAVIILPFHKHQRLDGSLNITRNDFRWVNKRV  599

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             LE APCSVGI VDRGLGGTSHVSASNV Y +TVL+FGG DDREALAYG RM EHPGI L+
Sbjct  600   LEHAPCSVGIFVDRGLGGTSHVSASNVSYRVTVLFFGGGDDREALAYGTRMAEHPGIRLL  659

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSA  508
             V RF  +P   G    + V    S+  +  S+DE+FL  FK + + + S+ YEEKVVK  
Sbjct  660   VIRFVGEPMNEGE--IVRVDVGDSTGTKLISQDEEFLDEFKAKIANDDSIIYEEKVVKDG  717

Query  507   AETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVV  328
             AET+  I   N CNL +VG  P  E+ +AM K+ ECPELGP+G LL+ +++ TTASVLV+
Sbjct  718   AETVAIICELNSCNLFLVGSRPASEVASAM-KRSECPELGPVGGLLASQDYPTTASVLVM  776

Query  327   QQYRTELSKNGLKEDDSV-----DGDYESA  253
             QQY+     N    D  +     D D ESA
Sbjct  777   QQYQNGAPINFTISDSEMEEHVPDRDSESA  806



>ref|XP_006476456.1| PREDICTED: cation/H(+) antiporter 18-like isoform X1 [Citrus 
sinensis]
Length=809

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/801 (69%), Positives = 655/801 (82%), Gaps = 14/801 (2%)
 Frame = -1

Query  2661  IMGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPR  2482
             +M S G   CPAPMK TSNG FQGDSPLD+ALPL I+QICLV+LLTR LA++LRPLRQPR
Sbjct  12    LMASVGHA-CPAPMKPTSNGVFQGDSPLDFALPLAILQICLVILLTRGLAFILRPLRQPR  70

Query  2481  VIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLR  2302
             VIAEI GG+LLGPSA GRSE +L A+FP KS TVLDTLA+LGL+FF+FLVGLELDPKSLR
Sbjct  71    VIAEITGGILLGPSALGRSERFLQAVFPPKSQTVLDTLANLGLIFFMFLVGLELDPKSLR  130

Query  2301  RTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARI  2122
             +TGKKAL IA+AGISLPF LGIG+SF+LR TI+KGV    FLVFMGVALSITAFPVLARI
Sbjct  131   QTGKKALGIAIAGISLPFALGIGSSFLLRETISKGVDSRSFLVFMGVALSITAFPVLARI  190

Query  2121  LAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLC  1942
             LAELKLLT DVG+MAMSAAAVNDVAAWILLALA+ALSG+G S L+ +WV L G  FV+  
Sbjct  191   LAELKLLTADVGRMAMSAAAVNDVAAWILLALAVALSGSGQSSLVPVWVFLSGCVFVICL  250

Query  1941  ILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPK  1762
              L+VP  FKWMA +C EGEPV+E YVCA LAAVL AGF+TD IGIHA+FGAFV+GVLVPK
Sbjct  251   TLLVPPTFKWMARQCHEGEPVEETYVCATLAAVLAAGFITDAIGIHAMFGAFVVGVLVPK  310

Query  1761  DGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILG  1582
             +GP ASALVEKVEDLVSG+FLPLYFVSSGLKTN+ATIQG QSWGLL LVI TAC GKI+G
Sbjct  311   EGPFASALVEKVEDLVSGIFLPLYFVSSGLKTNIATIQGLQSWGLLALVILTACLGKIVG  370

Query  1581  TILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFI  1402
             T +VS   ++P +EA+ LG LMNTKGLVELIVLNIGKDR VLNDQ FAIMVLMA+ TTF+
Sbjct  371   TFVVSLSFKVPLREALALGILMNTKGLVELIVLNIGKDRKVLNDQVFAIMVLMAVVTTFM  430

Query  1401  TTPIVIALYKPAKLA-VTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TTP+V+A+YKPA+ A V +YK+RT++RK+   Q RIL CFHS RNIPS INL+EA RG +
Sbjct  431   TTPLVMAVYKPARRARVADYKHRTVERKNSKAQFRILACFHSARNIPSTINLLEALRGIQ  490

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             KS G  VYA+HLMELSERSSAILM HKAR+NGLPFWN RG  ++   IVVAFE F+ LS+
Sbjct  491   KSEGLCVYALHLMELSERSSAILMVHKARRNGLPFWN-RGRQSNPNHIVVAFEAFQQLSR  549

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             VS+RP TAIS+MS MHEDI  +AE KR A+IILPFHKHQ++DG  ETTR++ R VN+RVL
Sbjct  550   VSVRPMTAISSMSDMHEDICTTAESKRAAIIILPFHKHQRLDGSLETTRSDFRWVNQRVL  609

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             + APCSVGIL+DRGLGGT+ VSASNV YTITVL+FGG DDREALA GARM EHPGI  +V
Sbjct  610   KHAPCSVGILIDRGLGGTTQVSASNVSYTITVLFFGGRDDREALACGARMAEHPGISFIV  669

Query  684   ARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNS-TNSSVKYEEKVVKSA  508
              RF L  +T G +V +D++ + S        DE+ L+ FK + S  + SV+YEE++V++ 
Sbjct  670   IRFLLAADTIGNTVSVDMAGNASM-------DEEVLSEFKLKTSHRDGSVRYEERLVRNT  722

Query  507   AETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVV  328
              ET+  IR  +RCNLL+VGRMP+GE+  A+  + +CPELGP+G+LL+  EFS TASVLV+
Sbjct  723   TETIAVIREVSRCNLLLVGRMPDGELALALSTRSDCPELGPVGSLLTSLEFS-TASVLVI  781

Query  327   QQYRTELSKNGLK--EDDSVD  271
             QQY   +S N     E+DS D
Sbjct  782   QQYSDRVSMNLASELEEDSPD  802



>ref|XP_006439427.1| hypothetical protein CICLE_v10018864mg [Citrus clementina]
 gb|ESR52667.1| hypothetical protein CICLE_v10018864mg [Citrus clementina]
Length=796

 Score =   986 bits (2548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/791 (69%), Positives = 648/791 (82%), Gaps = 12/791 (2%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CPAPMK TSNG FQGDSPLD+ALPL I+QICLV+LLTR LA++LRPLRQPRVIAEI GG+
Sbjct  8     CPAPMKPTSNGVFQGDSPLDFALPLAILQICLVILLTRGLAFILRPLRQPRVIAEITGGI  67

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GRSE +L A+FP KS TVLDTLA+LGL+FF+FLVGLELDPKSLR+TGKKAL I
Sbjct  68    LLGPSALGRSERFLQAVFPPKSQTVLDTLANLGLIFFMFLVGLELDPKSLRQTGKKALGI  127

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             A+AGISLPF LGIG+SF+LR TI+KGV    FLVFMGVALSITAFPVLARILAELKLLT 
Sbjct  128   AIAGISLPFALGIGSSFLLRETISKGVDSTSFLVFMGVALSITAFPVLARILAELKLLTA  187

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             DVG+MAMSAAAVNDVAAWILLALA+ALSG+G S L+ +WV L G  FV+   L VP  FK
Sbjct  188   DVGRMAMSAAAVNDVAAWILLALAVALSGSGQSSLVPVWVFLSGCVFVICLTLFVPPTFK  247

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             WMA +C EGEPV+E YVCA LAAVL AGF+TD IGIHA+FGAFV+GVLVPK+GP A+ALV
Sbjct  248   WMARQCHEGEPVEETYVCATLAAVLAAGFITDAIGIHAMFGAFVVGVLVPKEGPFANALV  307

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVSG+FLPLYFVSSGLKTN+ATIQG QSWGLL LVI TAC GKI+GT +VS   +
Sbjct  308   EKVEDLVSGIFLPLYFVSSGLKTNIATIQGLQSWGLLALVILTACLGKIVGTFVVSLSFK  367

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +P +EA+ LG LMNTKGLVELIVLNIGKDR VLNDQ FAIM+LMA+ TTF+TTP+V+A+Y
Sbjct  368   VPLREALALGILMNTKGLVELIVLNIGKDRKVLNDQVFAIMILMAVVTTFMTTPLVMAVY  427

Query  1374  KPAKLA-VTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYA  1198
             KPA+ A V +YK+RT++RK+   Q RIL CFHS RNIPS INL+EA RG +KS G  VYA
Sbjct  428   KPARRARVADYKHRTVERKNSKAQFRILACFHSARNIPSTINLLEALRGIQKSEGLCVYA  487

Query  1197  MHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAI  1018
             +HLMELSERSSAILM HKAR+NGLPFWN RG  ++   IVVAFE F+ LS+VS+RP TAI
Sbjct  488   LHLMELSERSSAILMVHKARRNGLPFWN-RGRQSNPNHIVVAFEAFQQLSRVSVRPMTAI  546

Query  1017  SAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGI  838
             S+MS MHEDI  +AE KR A+IILPFHKHQ++DG  ETTR++ R VN+RVL+ APCSVGI
Sbjct  547   SSMSDMHEDICTTAESKRAAIIILPFHKHQRLDGSLETTRSDFRWVNQRVLKHAPCSVGI  606

Query  837   LVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPET  658
             L+DRGLGGT+ VSASNV YTITVL+FGG DDREALA GARM EHPGI  +V RF L  + 
Sbjct  607   LIDRGLGGTTQVSASNVSYTITVLFFGGRDDREALACGARMAEHPGISFIVIRFLLAADA  666

Query  657   AGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGY  478
              G +V +D++ + S        DE+ L+ FK + S N SV+YEE++V++ AET+  IR  
Sbjct  667   IGNTVSVDMAGNASM-------DEEVLSEFKLKTSRNGSVRYEERLVRNTAETIAVIREV  719

Query  477   NRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTELSKN  298
             +RCNLL+VGRMP+GE+  A+  + +C ELGP+G+LL+  EFS TASVL++QQY   +  N
Sbjct  720   SRCNLLLVGRMPDGELALALSTRSDCLELGPVGSLLTSLEFS-TASVLIIQQYSDRVFMN  778

Query  297   GLK--EDDSVD  271
                  E+DS D
Sbjct  779   LASELEEDSPD  789



>ref|XP_006439426.1| hypothetical protein CICLE_v10018864mg [Citrus clementina]
 gb|ESR52666.1| hypothetical protein CICLE_v10018864mg [Citrus clementina]
Length=832

 Score =   986 bits (2548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/800 (69%), Positives = 652/800 (82%), Gaps = 13/800 (2%)
 Frame = -1

Query  2661  IMGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPR  2482
             +M S G   CPAPMK TSNG FQGDSPLD+ALPL I+QICLV+LLTR LA++LRPLRQPR
Sbjct  36    LMASVGHA-CPAPMKPTSNGVFQGDSPLDFALPLAILQICLVILLTRGLAFILRPLRQPR  94

Query  2481  VIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLR  2302
             VIAEI GG+LLGPSA GRSE +L A+FP KS TVLDTLA+LGL+FF+FLVGLELDPKSLR
Sbjct  95    VIAEITGGILLGPSALGRSERFLQAVFPPKSQTVLDTLANLGLIFFMFLVGLELDPKSLR  154

Query  2301  RTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARI  2122
             +TGKKAL IA+AGISLPF LGIG+SF+LR TI+KGV    FLVFMGVALSITAFPVLARI
Sbjct  155   QTGKKALGIAIAGISLPFALGIGSSFLLRETISKGVDSTSFLVFMGVALSITAFPVLARI  214

Query  2121  LAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLC  1942
             LAELKLLT DVG+MAMSAAAVNDVAAWILLALA+ALSG+G S L+ +WV L G  FV+  
Sbjct  215   LAELKLLTADVGRMAMSAAAVNDVAAWILLALAVALSGSGQSSLVPVWVFLSGCVFVICL  274

Query  1941  ILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPK  1762
              L VP  FKWMA +C EGEPV+E YVCA LAAVL AGF+TD IGIHA+FGAFV+GVLVPK
Sbjct  275   TLFVPPTFKWMARQCHEGEPVEETYVCATLAAVLAAGFITDAIGIHAMFGAFVVGVLVPK  334

Query  1761  DGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILG  1582
             +GP A+ALVEKVEDLVSG+FLPLYFVSSGLKTN+ATIQG QSWGLL LVI TAC GKI+G
Sbjct  335   EGPFANALVEKVEDLVSGIFLPLYFVSSGLKTNIATIQGLQSWGLLALVILTACLGKIVG  394

Query  1581  TILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFI  1402
             T +VS   ++P +EA+ LG LMNTKGLVELIVLNIGKDR VLNDQ FAIM+LMA+ TTF+
Sbjct  395   TFVVSLSFKVPLREALALGILMNTKGLVELIVLNIGKDRKVLNDQVFAIMILMAVVTTFM  454

Query  1401  TTPIVIALYKPAKLA-VTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TTP+V+A+YKPA+ A V +YK+RT++RK+   Q RIL CFHS RNIPS INL+EA RG +
Sbjct  455   TTPLVMAVYKPARRARVADYKHRTVERKNSKAQFRILACFHSARNIPSTINLLEALRGIQ  514

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             KS G  VYA+HLMELSERSSAILM HKAR+NGLPFWN RG  ++   IVVAFE F+ LS+
Sbjct  515   KSEGLCVYALHLMELSERSSAILMVHKARRNGLPFWN-RGRQSNPNHIVVAFEAFQQLSR  573

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             VS+RP TAIS+MS MHEDI  +AE KR A+IILPFHKHQ++DG  ETTR++ R VN+RVL
Sbjct  574   VSVRPMTAISSMSDMHEDICTTAESKRAAIIILPFHKHQRLDGSLETTRSDFRWVNQRVL  633

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             + APCSVGIL+DRGLGGT+ VSASNV YTITVL+FGG DDREALA GARM EHPGI  +V
Sbjct  634   KHAPCSVGILIDRGLGGTTQVSASNVSYTITVLFFGGRDDREALACGARMAEHPGISFIV  693

Query  684   ARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAA  505
              RF L  +  G +V +D++ + S        DE+ L+ FK + S N SV+YEE++V++ A
Sbjct  694   IRFLLAADAIGNTVSVDMAGNASM-------DEEVLSEFKLKTSRNGSVRYEERLVRNTA  746

Query  504   ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQ  325
             ET+  IR  +RCNLL+VGRMP+GE+  A+  + +C ELGP+G+LL+  EFS TASVL++Q
Sbjct  747   ETIAVIREVSRCNLLLVGRMPDGELALALSTRSDCLELGPVGSLLTSLEFS-TASVLIIQ  805

Query  324   QYRTELSKNGLK--EDDSVD  271
             QY   +  N     E+DS D
Sbjct  806   QYSDRVFMNLASELEEDSPD  825



>ref|XP_004164366.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis sativus]
Length=799

 Score =   983 bits (2542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/805 (68%), Positives = 651/805 (81%), Gaps = 9/805 (1%)
 Frame = -1

Query  2658  MGSNGTVV--CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M SN T V  CP PMKATSNG FQGD+PLD+ALPL+I+QICLVV LTR LA+LLRPL+QP
Sbjct  1     MASNATAVTLCPTPMKATSNGIFQGDNPLDFALPLIILQICLVVALTRGLAFLLRPLKQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVI EIIGG+LLGPSA GR++ +L+ IFP  S+T+LDT+A++GLLFFLFLVGLELD KS+
Sbjct  61    RVIGEIIGGILLGPSALGRNKNFLHTIFPSNSITLLDTVANIGLLFFLFLVGLELDLKSI  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             RRTGKKAL IA+ GI +PF LGIG+SF+LR TI+KGV+   FL+FMGVALSITAFPVLAR
Sbjct  121   RRTGKKALGIAITGICVPFALGIGSSFVLRETISKGVNASAFLIFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSG+  SPL ++WV L G GFV+ 
Sbjct  181   ILAELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGSDKSPLTAVWVFLSGCGFVVA  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
              I+++  +FKWM  +C +GEPV EIY+CA LA VL AGF TD IGIHA+FGAFV+GVLVP
Sbjct  241   AIVILSPVFKWMTKQCFQGEPVREIYICATLAIVLAAGFATDFIGIHAMFGAFVVGVLVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             KDGPL  ALVEK+EDLVS LFLPLYFVSSGLKTNVATIQGAQSWGLLVLVI TAC GKIL
Sbjct  301   KDGPLVGALVEKIEDLVSSLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIVTACSGKIL  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GT LVS LC++P +EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIM+LMALFTTF
Sbjct  361   GTFLVSLLCKVPVREALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMILMALFTTF  420

Query  1404  ITTPIVIALYKPAKLA-VTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             ITTP+VIA+YKPA+ A + +YK+R I+RK+ + QLR+LTCFHS  N+PS+INL+EASRGT
Sbjct  421   ITTPLVIAVYKPARSAKIADYKHRKIERKNKNTQLRMLTCFHSAGNVPSIINLLEASRGT  480

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
             EK     VYAMHLMELSERSSAILM HKARKNGLPFWN +G+ +DS  ++VAFE ++ LS
Sbjct  481   EKGEELCVYAMHLMELSERSSAILMVHKARKNGLPFWN-KGQRSDSNHVIVAFEAYQQLS  539

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +V IRP TAIS+MS +HEDI A+AE KR A+IILPFHKHQ++DG  ETTR+ +R VN+ V
Sbjct  540   RVFIRPMTAISSMSDIHEDICATAERKRTAIIILPFHKHQRVDGSLETTRSSIRVVNQNV  599

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             LE A CSVGI VDRGLGGT+HVS+SNV   ITVL+FGG DDREAL++G RM EHPGI L+
Sbjct  600   LEHARCSVGIFVDRGLGGTTHVSSSNVSLFITVLFFGGGDDREALSFGVRMAEHPGIRLM  659

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSA  508
             V  F ++PE  G          G+S  +   +D++FL+ F+   S N S+ Y E+ +K+A
Sbjct  660   VIHFFVEPEPIGE--ITSADTVGNSLAKTVPQDDEFLSEFRHNASKNDSITYVERTIKTA  717

Query  507   AETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVV  328
             AE M  I+    CNL +VGR P      A+++  +CPELGP+GNLL+   F  TASVLVV
Sbjct  718   AEAMSTIQELKHCNLYLVGRTPSLNSSFALNRN-DCPELGPVGNLLTSLNFPITASVLVV  776

Query  327   QQYRTELSKNGLKEDDSVDGDYESA  253
             QQYR++L  N     DS DG+ ESA
Sbjct  777   QQYRSQLPVN--SASDSADGESESA  799



>ref|XP_002297994.1| cation/hydrogen exchanger family protein [Populus trichocarpa]
 gb|EEE82799.1| cation/hydrogen exchanger family protein [Populus trichocarpa]
Length=804

 Score =   982 bits (2539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/798 (69%), Positives = 646/798 (81%), Gaps = 14/798 (2%)
 Frame = -1

Query  2661  IMGSNGT--VVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQ  2488
             ++ SN T    CP+ +K TSNG FQGD+PLD+ALPL I+QICLVV++TR LA+LLRPLRQ
Sbjct  1     MVSSNATSGYACPS-IKPTSNGVFQGDNPLDFALPLAILQICLVVVVTRGLAFLLRPLRQ  59

Query  2487  PRVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKS  2308
             PRVIAEIIGG+LLGPSA GRS+ YL A+FP +SLTVLDTLA++GL+FFLFL GLELDPKS
Sbjct  60    PRVIAEIIGGILLGPSALGRSKGYLQAVFPTRSLTVLDTLANIGLIFFLFLAGLELDPKS  119

Query  2307  LRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLA  2128
             L RTGKKAL+IA+AGISLPF +GIGTSFILR TI+K V+   FLVFMGVALSITAFPVLA
Sbjct  120   LGRTGKKALAIAMAGISLPFAMGIGTSFILRLTISKDVNSTAFLVFMGVALSITAFPVLA  179

Query  2127  RILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVL  1948
             RILAELKLLTTD+G+MAMSAAAVNDVAAWILLALAI+LSG+  SP+IS WV L G  FV+
Sbjct  180   RILAELKLLTTDIGRMAMSAAAVNDVAAWILLALAISLSGSNTSPIISFWVFLSGCIFVI  239

Query  1947  LCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLV  1768
               IL+VP IFKWM   C EGEPV+E+YVCA LAAVL AGFVTD IGIHA+FGAFVIG+LV
Sbjct  240   CSILIVPPIFKWMTKWCQEGEPVEEMYVCATLAAVLAAGFVTDAIGIHAMFGAFVIGILV  299

Query  1767  PKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKI  1588
             PK+GP A ALVEKVED+VSGLFLPLYFVSSGLKTNVATIQG QSWGLLVLVIFTACFGKI
Sbjct  300   PKEGPFAGALVEKVEDIVSGLFLPLYFVSSGLKTNVATIQGLQSWGLLVLVIFTACFGKI  359

Query  1587  LGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTT  1408
             +GT +VS LC++P +E++ + FLMNTKGLVELIVLNIGKDR VLND+TF+IMVLMALFTT
Sbjct  360   VGTFVVSILCKVPLRESLAMAFLMNTKGLVELIVLNIGKDRKVLNDETFSIMVLMALFTT  419

Query  1407  FITTPIVIALYKPAK-LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRG  1231
             FITTP+V A+YKPA+ + + +YKYRT++R+  + +LRIL CFH  RNI S+INL+E SRG
Sbjct  420   FITTPLVTAVYKPARRVKMADYKYRTVERRSSNTELRILACFHGSRNISSIINLLEVSRG  479

Query  1230  TEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHL  1051
              EK+ G  VYAMHLMELSER+SAILM HKARKNGLPFWN RG+ + S  +VVAF+ F+ L
Sbjct  480   VEKAEGLCVYAMHLMELSERTSAILMVHKARKNGLPFWN-RGQRSGSNLVVVAFDAFQQL  538

Query  1050  SKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRR  871
             S+VS+RP TAIS+M+ MHEDI  +AE KR AMIILPFHK Q++DG  ETTR + + VNRR
Sbjct  539   SRVSVRPMTAISSMADMHEDICTTAERKRAAMIILPFHKLQRLDGSLETTRTDFQLVNRR  598

Query  870   VLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICL  691
             VL  APCSVGILVDRG GGT+ VSASNV Y ITVL+FGG DDREALAYGARM EHPG+ L
Sbjct  599   VLGDAPCSVGILVDRGFGGTTQVSASNVSYVITVLFFGGRDDREALAYGARMAEHPGVSL  658

Query  690   VVARFTLDPETAGTsv---------kldvspsgssspeekSRDEDFLAAFKQRNSTNSSV  538
              V RF + PE  G               V   GSSS    S DEDF++  KQ+ S + SV
Sbjct  659   KVFRFLVKPEAGGEISRVKPEAGGEISRVDMDGSSSTRLGSLDEDFISELKQKMSKDDSV  718

Query  537   KYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKE  358
             K EEK V +AAET++AI      NL +VGR+P+GEI   +    + PELGP+G LL+  +
Sbjct  719   KLEEKFVGNAAETIDAIHEARHSNLFLVGRLPDGEIALDLRSSSDSPELGPVGGLLASSD  778

Query  357   FSTTASVLVVQQYRTELS  304
              STTASVLVV+QY + +S
Sbjct  779   ISTTASVLVVKQYSSRVS  796



>ref|XP_004252574.1| PREDICTED: cation/H(+) antiporter 18 [Solanum lycopersicum]
 ref|XP_010314495.1| PREDICTED: cation/H(+) antiporter 18 [Solanum lycopersicum]
Length=790

 Score =   982 bits (2539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/786 (68%), Positives = 646/786 (82%), Gaps = 8/786 (1%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CP+PMKATSNG FQGD+PLD+ALPL I+QICLV+++TR LA+LLRPLRQPRVIAE+IGG+
Sbjct  5     CPSPMKATSNGIFQGDNPLDFALPLAILQICLVLVVTRGLAFLLRPLRQPRVIAEVIGGI  64

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GR++ YLNA+FP KS+TVLDTLA++GLLFFLFL GLELD KSLR++GKK L+I
Sbjct  65    LLGPSALGRNKGYLNAVFPPKSITVLDTLANVGLLFFLFLAGLELDVKSLRQSGKKVLAI  124

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             A+ GI+LPF LG+GTSFILR TI +GV+   FLVFMGVALSITAFPVLARILAELKLLTT
Sbjct  125   AITGITLPFVLGVGTSFILRGTINQGVNATAFLVFMGVALSITAFPVLARILAELKLLTT  184

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             DVG+MAMSAAAVNDVAAWILLALAIALSG   S ++ LWV LCG GFV+   L+VP IFK
Sbjct  185   DVGRMAMSAAAVNDVAAWILLALAIALSGDNLSAVVPLWVFLCGCGFVIGASLIVPPIFK  244

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             W++ RC EGEPVDE+Y+CA LAAVL AG VTD IGIHA+FGAFVIGVL+PK+GP A  LV
Sbjct  245   WISQRCHEGEPVDEMYICATLAAVLAAGLVTDVIGIHAMFGAFVIGVLLPKEGPFAGVLV  304

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVSGLFLPLYFVSSGLKTNVATIQG QSWGLLVLVIFTACFGKI+GT +VS L +
Sbjct  305   EKVEDLVSGLFLPLYFVSSGLKTNVATIQGVQSWGLLVLVIFTACFGKIIGTFIVSLLWK  364

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             IP  EA+ LGFLMN+KGLVELIVLNIGKDR VLNDQTFAIMV+MALFTTFITTP+V+A+Y
Sbjct  365   IPKNEALALGFLMNSKGLVELIVLNIGKDRKVLNDQTFAIMVMMALFTTFITTPLVMAVY  424

Query  1374  KPAKL-AVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYA  1198
             KPAK+ +  +YK+R I+RK+P+ +LR+LTCF S RNIPS INL+EASRGTE+     VYA
Sbjct  425   KPAKMPSKGDYKHRRIERKNPNTELRLLTCFRSSRNIPSAINLLEASRGTERGERLSVYA  484

Query  1197  MHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAI  1018
             MHLME SER SAILM HKAR NGLPFWN       +  +VVAFE F+ LS+VS+RP T+I
Sbjct  485   MHLMEFSERPSAILMVHKARHNGLPFWNKSQR--SANHVVVAFEAFQQLSQVSVRPMTSI  542

Query  1017  SAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGI  838
             S++S MHEDI  +AE K +AMIILP+HK+ ++DG FE+TR +   VN+RVLE A CSVGI
Sbjct  543   SSLSDMHEDICITAEKKNIAMIILPYHKNLRLDGSFESTRPDFHLVNKRVLEHASCSVGI  602

Query  837   LVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPET  658
              VDRGLGGT+ +SASNV ++ITVLYFGGHDDREALAYG RM EHPG+ L V RF ++ ++
Sbjct  603   FVDRGLGGTAQISASNVSFSITVLYFGGHDDREALAYGTRMAEHPGVELTVIRFLVESDS  662

Query  657   AGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGY  478
             +   V +    +   S      DE+FLAAF+   S +SS+KYEEK +++ +ET+  +R Y
Sbjct  663   SEEIVTIHTDAATLVSA-----DEEFLAAFRTSISDDSSIKYEEKTIRNVSETITILRDY  717

Query  477   NRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTELSKN  298
             +RC+L +VGR P G +  A+ ++ +CPELGP+G+LL+ +E++TTASVLVVQQY  +L   
Sbjct  718   SRCSLFLVGRRPNGVVPLALSQRTDCPELGPVGSLLTSQEYATTASVLVVQQYYDKLYAT  777

Query  297   GLKEDD  280
                + D
Sbjct  778   NPHQRD  783



>ref|XP_004511538.1| PREDICTED: LOW QUALITY PROTEIN: cation/H(+) antiporter 18-like 
[Cicer arietinum]
Length=801

 Score =   982 bits (2538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/806 (67%), Positives = 655/806 (81%), Gaps = 9/806 (1%)
 Frame = -1

Query  2658  MGSNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M SN T   VCP PMK TSNG+FQGD+PLDYALPL I+QICLV+++TR LAYL RPLRQP
Sbjct  1     MTSNTTSGNVCPPPMKPTSNGAFQGDNPLDYALPLAILQICLVLVVTRGLAYLFRPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEI+GG+LLGPSA GR+++YLNA+FP KSLTVLDTLA+LGL+FFLFL G+ELDPKSL
Sbjct  61    RVIAEIVGGILLGPSALGRNKSYLNAVFPPKSLTVLDTLANLGLIFFLFLAGVELDPKSL  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             R+TG + L+IA AGISLPF LGIG+SF+L+ATIAK V+   F+V+MGVALSITAFPVLAR
Sbjct  121   RKTGGRVLAIATAGISLPFALGIGSSFVLKATIAKDVNTSAFVVYMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTT VG+MAMSAAAVNDVAAWILLALA+ALSG   SPL+SLWV L G GFV+ 
Sbjct  181   ILAELKLLTTSVGRMAMSAAAVNDVAAWILLALAVALSGNSQSPLVSLWVFLGGCGFVVC  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
              IL+V  IFKWMA +C EGEPV+E+Y+CA LAAVL AGFVTD IGIHA+FGAFV G+LVP
Sbjct  241   SILIVLPIFKWMAQKCHEGEPVEELYICATLAAVLAAGFVTDAIGIHAMFGAFVFGILVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             KDGP A ALVEK+EDLVSGL LPLYFVSSGLKTN+ATIQG QSWGL++ V FTACFGKI+
Sbjct  301   KDGPFAGALVEKIEDLVSGLLLPLYFVSSGLKTNIATIQGLQSWGLVIFVTFTACFGKIV  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GTI+   LC++ F E++ LGFLMN+KGLVELIVLNIGK+R VLNDQTFAIMVLMALFTTF
Sbjct  361   GTIVACLLCKVSFNESLVLGFLMNSKGLVELIVLNIGKERKVLNDQTFAIMVLMALFTTF  420

Query  1404  ITTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             +TTP+V+A+YK  K  +++YKYRTI+RK+ + QLRIL CFH  RNIPS+INLIE SRG +
Sbjct  421   MTTPLVMAVYK-RKARISDYKYRTIERKNANSQLRILVCFHGARNIPSVINLIEISRGIQ  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             K     VYAMHL E SERSS++LM  K RKNGLPFWN +G   DS  ++VAFE ++ LS+
Sbjct  480   KRDALCVYAMHLKEFSERSSSMLMVQKVRKNGLPFWN-KGPRADSDHVIVAFEAYQQLSQ  538

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             VS+RP  AIS+M+++HEDI ++AE K  A+IILPFHK Q++DG  + TR++ R VN+RVL
Sbjct  539   VSVRPMIAISSMANIHEDICSTAERKSAAVIILPFHKQQRLDGSLDITRSDFRLVNKRVL  598

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             + APCSVGILVDRGLGGT HVSASNV Y+I VL+FGG DDREALAYGARM EHPGI LVV
Sbjct  599   DNAPCSVGILVDRGLGGTCHVSASNVSYSIVVLFFGGGDDREALAYGARMAEHPGIRLVV  658

Query  684   ARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAA  505
              RF ++P   G      V    SSS +  S D++FLA F+ + + + SV Y EK+VK AA
Sbjct  659   VRFLVEPNIVGE--ITRVDIGDSSSSKPISEDDEFLAEFRLKTTNDDSVIYGEKIVKDAA  716

Query  504   ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQ  325
             ET+  IR +N CNL VVG  P GE+  A+++  +  ELGP+G LL+ +++STTASVLV+Q
Sbjct  717   ETVATIREFNCCNLFVVGLRPTGELTCALERN-DSSELGPVGGLLASQDYSTTASVLVMQ  775

Query  324   QYRTELSKNGLKEDD--SVDGDYESA  253
             QYR ++  N ++E +  + DGD ESA
Sbjct  776   QYRNDMPINLVQEMEXHTTDGDAESA  801



>ref|XP_004146576.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis sativus]
 gb|KGN53371.1| hypothetical protein Csa_4G050260 [Cucumis sativus]
Length=799

 Score =   980 bits (2534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/805 (68%), Positives = 650/805 (81%), Gaps = 9/805 (1%)
 Frame = -1

Query  2658  MGSNGTVV--CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M SN T V  CP PMKATSNG FQGD+PLD+ALPL+I+QICLVV LTR LA+LLRPL+QP
Sbjct  1     MASNATAVTLCPTPMKATSNGIFQGDNPLDFALPLIILQICLVVALTRGLAFLLRPLKQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVI EIIGG+LLGPSA GR++ +L+ IFP  S+T+LDT+A++GLLFFLFLVGLELD KS+
Sbjct  61    RVIGEIIGGILLGPSALGRNKNFLHTIFPSNSITLLDTIANIGLLFFLFLVGLELDLKSI  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             RRTGKKA  IA+ GI +PF LGIG+SF+LR TI+KGV+   FL+FMGVALSITAFPVLAR
Sbjct  121   RRTGKKAFGIAITGICVPFALGIGSSFVLRETISKGVNASAFLIFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSG+  SPL ++WV L G GFV+ 
Sbjct  181   ILAELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGSDKSPLTAVWVFLSGCGFVVA  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
              I+++  +FKWM  +C +GEPV EIY+CA LA VL AGF TD IGIHA+FGAFV+GVLVP
Sbjct  241   AIVILSPVFKWMTKQCFQGEPVREIYICATLAIVLAAGFATDFIGIHAMFGAFVVGVLVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             KDGPL  ALVEK+EDLVS LFLPLYFVSSGLKTNVATIQGAQSWGLLVLVI TAC GKIL
Sbjct  301   KDGPLVGALVEKIEDLVSSLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIVTACSGKIL  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GT LVS LC++P +EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIM+LMALFTTF
Sbjct  361   GTFLVSLLCKVPVREALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMILMALFTTF  420

Query  1404  ITTPIVIALYKPAKLA-VTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             ITTP+VIA+YKPA+ A + +YK+R I+RK+ + QLR+LTCFHS  N+PS+INL+EASRGT
Sbjct  421   ITTPLVIAVYKPARSAKIADYKHRKIERKNKNTQLRMLTCFHSAGNVPSIINLLEASRGT  480

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
             EK     VYAMHLMELSERSSAILM HKARKNGLPFWN +G+ +DS  ++VAFE ++ LS
Sbjct  481   EKGEELCVYAMHLMELSERSSAILMVHKARKNGLPFWN-KGQRSDSNHVIVAFEAYQQLS  539

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +V IRP TAIS+MS +HEDI A+AE KR A+IILPFHKHQ++DG  ETTR+ +R VN+ V
Sbjct  540   RVFIRPMTAISSMSDIHEDICATAERKRTAIIILPFHKHQRVDGSLETTRSSIRVVNQNV  599

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             LE A CSVGI VDRGLGGT+HVS+SNV   ITVL+FGG DDREAL++G RM EHPGI L+
Sbjct  600   LEHARCSVGIFVDRGLGGTTHVSSSNVSLFITVLFFGGGDDREALSFGVRMAEHPGIRLM  659

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSA  508
             V  F ++PE  G          G+S  +   +D++FL+ F+   S N S+ Y E+ +K+A
Sbjct  660   VIHFFVEPEPIGE--ITSADTVGNSLAKTVPQDDEFLSEFRHNASKNDSITYVERTIKTA  717

Query  507   AETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVV  328
             AE M  ++    CNL +VGR P      A+++  +CPELGP+GNLL+   F  TASVLVV
Sbjct  718   AEAMSTVQELKHCNLYLVGRTPGLNSSFALNRN-DCPELGPVGNLLTSLNFPITASVLVV  776

Query  327   QQYRTELSKNGLKEDDSVDGDYESA  253
             QQYR++L  N     DS DG+ ESA
Sbjct  777   QQYRSQLPVN--SASDSADGESESA  799



>ref|XP_003538685.1| PREDICTED: cation/H(+) antiporter 18-like isoform X1 [Glycine 
max]
 ref|XP_006590501.1| PREDICTED: cation/H(+) antiporter 18-like isoform X2 [Glycine 
max]
 ref|XP_006590502.1| PREDICTED: cation/H(+) antiporter 18-like isoform X3 [Glycine 
max]
Length=805

 Score =   980 bits (2534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/810 (67%), Positives = 644/810 (80%), Gaps = 13/810 (2%)
 Frame = -1

Query  2658  MGSNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M SN T    CP PMKATSNG+FQGD+PLD+ALPL I+QICLV++++R LAYLL+PLRQP
Sbjct  1     MASNATSGNACPQPMKATSNGAFQGDNPLDFALPLAILQICLVLVVSRGLAYLLKPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEIIGG++LGPS  GR+++Y+  +FP +SL VLDTLA++GL+FFLFL GLELD KSL
Sbjct  61    RVIAEIIGGIILGPSVLGRNKSYMQKVFPPRSLPVLDTLANIGLIFFLFLAGLELDLKSL  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             R++G + L+IA+AGISLPF +GIGTSF+L+ TIAKG     FLVFMGVALSITAFPVLAR
Sbjct  121   RQSGNRVLAIAMAGISLPFVIGIGTSFVLKQTIAKGSDNAAFLVFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTT+VG+ AMSAAA+ND+AAWILLALA+ALSG   SPL+SLWV L G GFV+ 
Sbjct  181   ILAELKLLTTNVGKTAMSAAAINDIAAWILLALAVALSGHDRSPLVSLWVFLAGCGFVIC  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
              IL+VP IFKWM+ RC EGEPV+E+Y+CA LAAVL AGFVTD IGIHA+FGAFV+G+LVP
Sbjct  241   AILIVPPIFKWMSQRCHEGEPVEEVYICATLAAVLAAGFVTDAIGIHAMFGAFVVGILVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
              DGP ASALVEKVEDLVSGLFLPLYFVSSGLKTNVATI+GAQSWGLL  VIFTA FGKIL
Sbjct  301   NDGPFASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIKGAQSWGLLAFVIFTASFGKIL  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GT+ VS  C++PF EA+ LGFLMN KGLVELIVLNIGKDR VLNDQTFAIMVLMA+FTTF
Sbjct  361   GTLFVSLFCKVPFNEALVLGFLMNCKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTTF  420

Query  1404  ITTPIVIALYKPA-KLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             ITTP+V A+YKPA K  +T YKYRTI RK+ + QLRIL CFH  RNIPS+INLIEASRG 
Sbjct  421   ITTPLVTAVYKPARKGKITNYKYRTIGRKNANSQLRILACFHGARNIPSMINLIEASRGI  480

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
             +K     VYAMHL E SERSS++LM HKAR+NGLPFWN +G   DS  ++VAFE +  LS
Sbjct  481   QKRDALCVYAMHLKEFSERSSSMLMVHKARRNGLPFWN-KGHHADSNHVIVAFEAYRQLS  539

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +VSIRP  AIS+M+++HEDI A+AE K  A+IILPFHKHQ++DG    TRN+ R VN+RV
Sbjct  540   QVSIRPMIAISSMNNIHEDICATAERKGAAVIILPFHKHQRLDGSLNITRNDFRWVNKRV  599

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             LE APCSVGI VDRGLGGTSHVSASNV Y +TVL+FGG DD EALAYGARM EHPGI L+
Sbjct  600   LEHAPCSVGIFVDRGLGGTSHVSASNVSYRVTVLFFGGGDDHEALAYGARMAEHPGIRLL  659

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSA  508
             V RF  +P        + V    S+S +  S+DE+FL   K + + + S+ YEEKVVK  
Sbjct  660   VIRFVGEPMNG---EIVRVDVGDSTSTKLISQDEEFLDEIKTKIANDDSIIYEEKVVKDG  716

Query  507   AETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVV  328
             AET+  IR    CNL +VG  P  E+ +AM K+ ECPELGP+G LL+ +++ TTASVLV+
Sbjct  717   AETVAIIRELKSCNLFLVGSRPASEVASAM-KRSECPELGPVGGLLASQDYPTTASVLVM  775

Query  327   QQYRTELSKNGLKEDDSV-----DGDYESA  253
             QQ++     N    D  +     D D ESA
Sbjct  776   QQFQNGAPINFTISDSEMEEHVPDRDSESA  805



>ref|XP_008451983.1| PREDICTED: LOW QUALITY PROTEIN: cation/H(+) antiporter 18-like 
[Cucumis melo]
Length=799

 Score =   979 bits (2531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/805 (68%), Positives = 653/805 (81%), Gaps = 9/805 (1%)
 Frame = -1

Query  2658  MGSNGTVV--CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M SN T V  CP PMKATSNG FQGD+PLD+ALPL+I+QICLVV LTR LA+LLRPL+QP
Sbjct  1     MASNSTAVTSCPTPMKATSNGIFQGDNPLDFALPLIILQICLVVALTRGLAFLLRPLKQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVI EIIGG+LLGPSA GR++ +L+ IFP  S+T+LDT+A++GLLFFLFLVGLELD KS+
Sbjct  61    RVIGEIIGGILLGPSALGRNKNFLHTIFPSNSITLLDTVANIGLLFFLFLVGLELDLKSI  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             RRTGKKAL IA+ GI +PF LGIG+SF+LR TI+KGV+   FL+FMGVALSITAFPVLAR
Sbjct  121   RRTGKKALGIAITGICVPFALGIGSSFVLRETISKGVNASAFLIFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSG+  SPL ++WVLL G GFV+ 
Sbjct  181   ILAELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGSDKSPLTAVWVLLSGCGFVVA  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
              I+++  +FKWM  +C +GEPV EIY+CA LA VL AGF TD IGIHA+FGAFV+GVLVP
Sbjct  241   AIVILSPVFKWMTKQCFQGEPVREIYICATLAIVLAAGFATDFIGIHAMFGAFVVGVLVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             KDGPL  ALVEK+EDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVI TAC GKIL
Sbjct  301   KDGPLIGALVEKIEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIVTACSGKIL  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GT LVS LC++P +EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIM+LMALFTTF
Sbjct  361   GTFLVSLLCKVPVREALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMILMALFTTF  420

Query  1404  ITTPIVIALYKPAKLA-VTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             ITTP+VIA+YKPA+ A + +YK+R I+ K+ + QLR+LTCFHS  N+PS+INL+EASRGT
Sbjct  421   ITTPLVIAVYKPARSAKIADYKHRKIEXKNKNTQLRMLTCFHSAGNVPSIINLLEASRGT  480

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
              K     VYAMHLMELSERSSAILM HKARKNGLPFWN +G+ +DS  ++VAFE ++ LS
Sbjct  481   GKGEELCVYAMHLMELSERSSAILMVHKARKNGLPFWN-KGQRSDSNHVIVAFEAYQQLS  539

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +V IRP TAIS+MS +HEDI A+AE KR A+IILPFHKHQ++DG  ETTR+ +R VN+ V
Sbjct  540   RVFIRPMTAISSMSDIHEDICATAERKRTAIIILPFHKHQRVDGSLETTRSSIRVVNQNV  599

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             LE A CSVGI  DRGLGGT+HVS+SNV   ITVL+FGG DDREAL++G RM EHPGI L+
Sbjct  600   LEHAQCSVGIFADRGLGGTAHVSSSNVSLFITVLFFGGGDDREALSFGVRMAEHPGIRLM  659

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSA  508
             V  F ++PE  G    +     G+S  +  S+D++FL+ F+   S N S+ Y EK +K+A
Sbjct  660   VIHFFVEPEPVGE--IISADTVGNSLAKPVSQDDEFLSEFRYNASKNDSITYVEKTIKTA  717

Query  507   AETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVV  328
             AE M  ++    CNL +VGR P      A+++  +CPELGP+GNLL+   F  TASVLVV
Sbjct  718   AEVMGIVQELKHCNLYLVGRTPGLNSSFALNRN-DCPELGPIGNLLTSPNFPITASVLVV  776

Query  327   QQYRTELSKNGLKEDDSVDGDYESA  253
             QQYR++L  N     DSVDG+ ESA
Sbjct  777   QQYRSQLPVN--SASDSVDGESESA  799



>ref|XP_008451984.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis melo]
Length=796

 Score =   979 bits (2530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/793 (69%), Positives = 653/793 (82%), Gaps = 20/793 (3%)
 Frame = -1

Query  2667  AEIMGSNGTV---VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRP  2497
             A +  +N T    VCP  MKATS+G FQGD+PL+YALPL I+QICLVVLLTRVL++LLRP
Sbjct  2     ATVATNNATAASGVCPPAMKATSDGIFQGDNPLNYALPLAILQICLVVLLTRVLSFLLRP  61

Query  2496  LRQPRVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLD  2317
             +RQPRVIAEI+GG+LLGPSA GR+ +YL+ +FP +SLTVLDTLA+LGLLFFLFLVGLELD
Sbjct  62    IRQPRVIAEIVGGILLGPSALGRNLSYLHTVFPPRSLTVLDTLANLGLLFFLFLVGLELD  121

Query  2316  PKSLRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFP  2137
              KSLRRTGK+A+ IA AGI+LPF LGIGTSF+LR+TI+KGV++   LVFMGVALSITAFP
Sbjct  122   LKSLRRTGKRAMCIAFAGITLPFVLGIGTSFVLRSTISKGVNEAALLVFMGVALSITAFP  181

Query  2136  VLARILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTG  1957
             VLARILAELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSG+G+SP +SLWV L G G
Sbjct  182   VLARILAELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGSGNSPFVSLWVFLSGAG  241

Query  1956  FVLLCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIG  1777
             F++ C   +P +F+WM+ RCSEGEPV E+Y+CA L+ VL AGF+TD IGIHALFGAFV+G
Sbjct  242   FIVFCTFAIPPVFRWMSERCSEGEPVKELYICATLSIVLAAGFMTDLIGIHALFGAFVVG  301

Query  1776  VLVPKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACF  1597
             VL+PK+GP A ALVEKVEDLVSGLFLPLYFVSSGLKTNVATI+GA+SWGLL+LVIF ACF
Sbjct  302   VLIPKEGPFAGALVEKVEDLVSGLFLPLYFVSSGLKTNVATIKGAKSWGLLILVIFNACF  361

Query  1596  GKILGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMAL  1417
             GKI+GT+ VS LC++PF E++ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMA+
Sbjct  362   GKIVGTVSVSLLCKMPFTESLALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMAI  421

Query  1416  FTTFITTPIVIALYKPA-KLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEA  1240
             FTTFITTPIVIA+YKPA K A + YK+RTI+RK+P+ +LRIL CFHS  NIP+ INLIEA
Sbjct  422   FTTFITTPIVIAVYKPAKKQARSNYKHRTIERKNPNSELRILACFHSYGNIPATINLIEA  481

Query  1239  SRGTEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETF  1060
             SRG EK  G  VYA+HL EL+ERSSAILM HKARKNG+PFWN +G   DS +IVVAFE F
Sbjct  482   SRGIEKKDGLCVYALHLTELTERSSAILMVHKARKNGVPFWN-KGR-VDSNQIVVAFEAF  539

Query  1059  EHLSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHV  880
               LS+VSIRP TAISA+S+MHEDI +SAE KR A+IILPFHKHQ++DG FETTR + R V
Sbjct  540   RQLSRVSIRPMTAISALSNMHEDICSSAETKRAAIIILPFHKHQRLDGSFETTRTDYRSV  599

Query  879   NRRVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPG  700
             NR+VLE APCSV IL+DRGLGG SHV+ASNV  T+TV++FGG DDREALA+G RM EHPG
Sbjct  600   NRKVLEQAPCSVAILIDRGLGGGSHVNASNVSSTVTVIFFGGPDDREALAFGKRMAEHPG  659

Query  699   ICLVVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKV  520
             I L V RFT   + A   ++        ++  +   D++ LA          S+KYEE+ 
Sbjct  660   ISLHVVRFTPSTDFA---MESVAVDVNKNNSPDSDCDDNALA----------SIKYEERN  706

Query  519   VKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLLSCKEFSTTA  343
             V   +  +EA++ +N+ NL++VGR PEGE+V +++   G+  ELGP+G +L+  EFSTTA
Sbjct  707   VSKGSHAVEAMKEFNKSNLILVGRCPEGEVVRSLNTNSGDSSELGPVGGVLASPEFSTTA  766

Query  342   SVLVVQQYRTELS  304
             SVLVVQQ+R E S
Sbjct  767   SVLVVQQFRGEQS  779



>ref|XP_009614856.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
 ref|XP_009614857.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
 ref|XP_009614858.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
Length=787

 Score =   975 bits (2521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/784 (69%), Positives = 646/784 (82%), Gaps = 8/784 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M S    +CPAPMKATSNG FQGD+PLD+ALPL I+QICLV+++TR LA+LLRPLRQPRV
Sbjct  1     MASGMEHLCPAPMKATSNGIFQGDNPLDFALPLAILQICLVLVVTRGLAFLLRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEIIGG+LLGPSA GR++AYLNA+FP KS+TVLDTLA++GLLFFLFLVGLELD KSLR+
Sbjct  61    IAEIIGGILLGPSALGRNKAYLNAVFPPKSITVLDTLANIGLLFFLFLVGLELDLKSLRQ  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             +GKK L IA+AGISLPF LGIG+SFILR TIAKGV+   FLVFMGVALSITAFPVLARIL
Sbjct  121   SGKKVLGIAVAGISLPFALGIGSSFILRETIAKGVNAPSFLVFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTT+VG+MAMSAAAVNDVAAWILLALAIALSG   SP + LWV L G GFV+   
Sbjct  181   AELKLLTTNVGRMAMSAAAVNDVAAWILLALAIALSGDNLSPAVPLWVFLSGCGFVIGAS  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
             L+VP IFKWM+ RC EGEPVDE+Y+C  LAAVL AGFVTD IGIHA+FGAFVIGVLVPK+
Sbjct  241   LIVPPIFKWMSRRCHEGEPVDEMYICGTLAAVLAAGFVTDIIGIHAMFGAFVIGVLVPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP A  LVEKVEDLVSGLFLPLYFVSSGLKTNVATIQG QSWGLL LVIFTAC GKI+GT
Sbjct  301   GPFAGVLVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGIQSWGLLALVIFTACLGKIVGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
              +VS L RIP +EA+ LGFLMN+KGLVELIVLNIGKDR VLNDQ FAIMVLMALFTTFIT
Sbjct  361   FIVSLLWRIPKREALALGFLMNSKGLVELIVLNIGKDRKVLNDQIFAIMVLMALFTTFIT  420

Query  1398  TPIVIALYKPAKLA-VTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEK  1222
             TP+V+A+YKPA+ A  ++YK+R ++RK+P+ QLRIL CFHS  NIPS+INL+EASRGTE+
Sbjct  421   TPLVLAVYKPAEKARKSDYKHRRVERKNPNTQLRILACFHSSWNIPSIINLLEASRGTER  480

Query  1221  SGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKV  1042
                  VYAMHLME SER SAILM HKAR NGLPFWN +G+ + +  +VVAFE F+ LS+V
Sbjct  481   GERLSVYAMHLMEFSERPSAILMVHKARHNGLPFWN-KGQRS-ANHVVVAFEAFQQLSQV  538

Query  1041  SIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLE  862
             S+RP T+IS+ + MHEDI  +AE K +A+IILP+HK+ ++DG FE+TR +   VN+RVLE
Sbjct  539   SVRPMTSISSFTDMHEDICITAERKDIAIIILPYHKNLRLDGSFESTRPDFHLVNKRVLE  598

Query  861   GAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVA  682
              A CSVGI VDRGLGG++ +SASNV ++ITVL+FGG DDREALAYGARM EHPG+ L V 
Sbjct  599   HASCSVGIFVDRGLGGSAQISASNVSFSITVLFFGGRDDREALAYGARMAEHPGVELTVI  658

Query  681   RFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAE  502
             RF L+ +++   V++D       S      DE+FLA F+   S +SS+KYEEK V++ +E
Sbjct  659   RFLLESDSSEEIVRIDTVSPTLVSA-----DEEFLADFRTSISKDSSIKYEEKNVRNVSE  713

Query  501   TMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQ  322
             T+  I  Y+RC+L VVGRMP G +   + ++ +CPELGP+G+ L+  +FSTTASVLVVQQ
Sbjct  714   TITIIHDYSRCSLFVVGRMPNGVVAVVLSQRIDCPELGPIGSFLTSPKFSTTASVLVVQQ  773

Query  321   YRTE  310
             Y  +
Sbjct  774   YYDQ  777



>ref|XP_011026948.1| PREDICTED: cation/H(+) antiporter 18-like [Populus euphratica]
 ref|XP_011026949.1| PREDICTED: cation/H(+) antiporter 18-like [Populus euphratica]
Length=792

 Score =   975 bits (2520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/789 (69%), Positives = 648/789 (82%), Gaps = 8/789 (1%)
 Frame = -1

Query  2661  IMGSNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQ  2488
             ++ SN T    CP+ +K TSNG FQG++PLD+ALPL I+QICLV+++TR LA+LLRPLRQ
Sbjct  1     MVSSNATSGHACPS-IKTTSNGVFQGNNPLDFALPLAILQICLVIVVTRGLAFLLRPLRQ  59

Query  2487  PRVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKS  2308
             PRVIAEIIGG+LLGPSA GRS+ +L A+FP +SLTVLDTLA++GL+FFLFL GLELD KS
Sbjct  60    PRVIAEIIGGILLGPSALGRSKGFLLAVFPTRSLTVLDTLANIGLIFFLFLAGLELDLKS  119

Query  2307  LRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLA  2128
             L RTGKKAL+IA+AGISLPF +GIGTSFILR TI+K V+   FLVF+GVALSITAFPVLA
Sbjct  120   LGRTGKKALAIAMAGISLPFAMGIGTSFILRLTISKDVNSTAFLVFIGVALSITAFPVLA  179

Query  2127  RILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVL  1948
             RILAELKLLTTD+G+MAMSAAAVNDVAAWILLALAI+LSG+  SP+IS WV L G  F +
Sbjct  180   RILAELKLLTTDIGRMAMSAAAVNDVAAWILLALAISLSGSNTSPIISFWVFLSGCIFFI  239

Query  1947  LCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLV  1768
               IL+VP IFKWM   C EGEPV+E+YVCA LAAVL AGFVTD IGIHA+FGAF+IG+LV
Sbjct  240   CSILIVPPIFKWMTKWCQEGEPVEEMYVCATLAAVLAAGFVTDAIGIHAMFGAFIIGILV  299

Query  1767  PKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKI  1588
             PK+GP A ALVEKVED+VSGLFLPLYFVSSGLKTNVATIQG QSWGLLVLVIFTACFGKI
Sbjct  300   PKEGPFAGALVEKVEDIVSGLFLPLYFVSSGLKTNVATIQGLQSWGLLVLVIFTACFGKI  359

Query  1587  LGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTT  1408
             +GT +VS LC++P +E++ +  LMNTKGLVELIVLNIGKDR VLND+TF+IMVLMALFTT
Sbjct  360   VGTFVVSLLCKVPLRESLAIAILMNTKGLVELIVLNIGKDRKVLNDETFSIMVLMALFTT  419

Query  1407  FITTPIVIALYKPA-KLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRG  1231
             FITTP+V A+YKPA ++ + +YKYRT++R+  + +LR+L CFH  RNI S+INL+E SRG
Sbjct  420   FITTPLVTAVYKPARRVKMADYKYRTVERRSSNTELRVLVCFHGSRNISSIINLLEVSRG  479

Query  1230  TEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHL  1051
              EK+ G  VYAMHLME SER+SAILM HKARKNGLPFWN RG+ + S  +VVAF+ F+ L
Sbjct  480   VEKAEGLCVYAMHLMEHSERTSAILMVHKARKNGLPFWN-RGQRSGSNLVVVAFDAFQQL  538

Query  1050  SKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRR  871
             S+VS++P TAIS+M+ MHEDI  +AE KRVAMIILPFHKHQ++DG  ETTR + + VNRR
Sbjct  539   SRVSVQPMTAISSMADMHEDICTTAERKRVAMIILPFHKHQRMDGSLETTRTDFQLVNRR  598

Query  870   VLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICL  691
             VL  APCSVGILVDRG GGT+ VSASNV Y ITVL+FGG DDREALAYGARM EHPG+ L
Sbjct  599   VLGDAPCSVGILVDRGFGGTTQVSASNVSYVITVLFFGGRDDREALAYGARMAEHPGVSL  658

Query  690   VVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKS  511
              V RF + PE AG   ++D+  S S+       DEDF++  KQ+ S + SVK EEK V +
Sbjct  659   KVIRFLVKPE-AGEISRVDMDGSSSTRLGSL--DEDFISELKQKMSKDDSVKLEEKFVGN  715

Query  510   AAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLV  331
             AAET++AI      NL +VGR+P+GEI  A+    + PELGP+G LL+  + STTASVLV
Sbjct  716   AAETIDAIHEARHSNLFLVGRLPDGEIALALRSSSDSPELGPVGGLLASSDISTTASVLV  775

Query  330   VQQYRTELS  304
             VQQY +++S
Sbjct  776   VQQYSSQVS  784



>ref|XP_010325375.1| PREDICTED: cation/H(+) antiporter 18-like isoform X2 [Solanum 
lycopersicum]
Length=639

 Score =   974 bits (2517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/641 (78%), Positives = 567/641 (88%), Gaps = 6/641 (1%)
 Frame = -1

Query  2169  MGVALSITAFPVLARILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPL  1990
             MGVALSITAFPVLARILAELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSG G SP+
Sbjct  1     MGVALSITAFPVLARILAELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGVGRSPV  60

Query  1989  ISLWVLLCGTGFVLLCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIG  1810
             ISLWVLLCGTGFVLLCIL+ PRIFKWMA RCSEGEPVDE YVCA LAAVL A FVTD IG
Sbjct  61    ISLWVLLCGTGFVLLCILIAPRIFKWMARRCSEGEPVDEKYVCATLAAVLAASFVTDMIG  120

Query  1809  IHALFGAFVIGVLVPKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWG  1630
             IHALFGAFV+GVLVPK+GP A ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWG
Sbjct  121   IHALFGAFVLGVLVPKEGPFAGALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWG  180

Query  1629  LLVLVIFTACFGKILGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLND  1450
             LLVLVI TACFGKI+GTI+VS LC++P QEA+TLGFLMNTKGLVELIVLNIGKDRGVLND
Sbjct  181   LLVLVIVTACFGKIVGTIVVSLLCKLPTQEAVTLGFLMNTKGLVELIVLNIGKDRGVLND  240

Query  1449  QTFAIMVLMALFTTFITTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRN  1270
             QTFAIMVLMALFTTFITTPIVI++YKPAKLAVT+YK+RTIQRK+ SKQLRIL CFHS RN
Sbjct  241   QTFAIMVLMALFTTFITTPIVISVYKPAKLAVTKYKHRTIQRKNTSKQLRILACFHSSRN  300

Query  1269  IPSLINLIEASRGTEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDS  1090
             IP+++NLIE SRG EK  G +VYAMHLMELSERSSAILM HKA+KNGLPFWNT  +  DS
Sbjct  301   IPAMLNLIEVSRGIEKREGLRVYAMHLMELSERSSAILMVHKAKKNGLPFWNTE-QVQDS  359

Query  1089  TEIVVAFETFEHLSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHF  910
              +IVVAF+TF +LSKVSIRP+TAIS M+SMHEDI+ASAE KRVAMIILPFHKH ++DGH 
Sbjct  360   NQIVVAFDTFSNLSKVSIRPTTAISPMNSMHEDIVASAERKRVAMIILPFHKHPRLDGHL  419

Query  909   ETTRNELRHVNRRVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALA  730
             ETTR ELRHVNRRVL+ APCSVGILVDRGLGG SHVS+SNVD+++T L+FGGHDDREALA
Sbjct  420   ETTRGELRHVNRRVLQHAPCSVGILVDRGLGGASHVSSSNVDFSVTALFFGGHDDREALA  479

Query  729   YGARMVEHPGICLVVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNST  550
             YG R+ EHPGI L+V RF +DPE +GTSVK++++   +   +    DE+FLA  KQ++ST
Sbjct  480   YGVRIAEHPGISLIVVRFIVDPEISGTSVKVEMNDKTNPEAQSD--DEEFLADVKQKSST  537

Query  549   NSSVKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLL  370
             + S+K+EE++VK A  T+EAIR YNRCNL +VGRMPEG++V A+DKK +CPELG LGNLL
Sbjct  538   DGSIKFEERIVKDARGTIEAIREYNRCNLYLVGRMPEGQVVVALDKKSDCPELGSLGNLL  597

Query  369   SCKEFSTTASVLVVQQYRTEL---SKNGLKEDDSVDGDYES  256
             +  EFSTTASVLVVQQYR++L   S + LKE +S DGD +S
Sbjct  598   TSPEFSTTASVLVVQQYRSQLPEESLSSLKEGESSDGDCDS  638



>ref|XP_006285823.1| hypothetical protein CARUB_v10007299mg [Capsella rubella]
 gb|EOA18721.1| hypothetical protein CARUB_v10007299mg [Capsella rubella]
Length=811

 Score =   974 bits (2517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/786 (68%), Positives = 640/786 (81%), Gaps = 6/786 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +N T  CPAPMKATSNG FQGD+P+D+ALPL I+QI +V++LTRVLAYLLRPLRQPRV
Sbjct  1     MATNSTKACPAPMKATSNGVFQGDNPIDFALPLAILQIVIVIVLTRVLAYLLRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAE+IGG++LGPS  GRS+ +L+A+FPKKSLTVL+TLA+LGLLFFLFL GLE+D K+LR 
Sbjct  61    IAEVIGGIMLGPSLLGRSKEFLDAVFPKKSLTVLETLANLGLLFFLFLAGLEIDTKALRH  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKAL IALAGISLPF LGIG+SF+L+ATI KGV    FL+FMGVALSITAFPVLARIL
Sbjct  121   TGKKALGIALAGISLPFALGIGSSFVLKATINKGVDSTAFLIFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTT++G++AMSAAAVNDVAAWILLALAIALSG+  SPL+SLWV L G  FV+   
Sbjct  181   AELKLLTTEIGRLAMSAAAVNDVAAWILLALAIALSGSNTSPLVSLWVFLSGCAFVIGAA  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              ++P IF+W+A RC EGEP++E Y+CA LA VL  GF+TD IGIH++FGAFV+GVL+PK+
Sbjct  241   FIIPPIFRWIARRCHEGEPIEETYICATLAVVLVCGFITDAIGIHSMFGAFVVGVLIPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP A ALVEKVEDLVSGLFLPLYFV+SGLKTNVATIQGAQSWGLLVLV FTACFGKI+GT
Sbjct  301   GPFAGALVEKVEDLVSGLFLPLYFVASGLKTNVATIQGAQSWGLLVLVTFTACFGKIVGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             + VS   +IP +EAITLGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTFIT
Sbjct  361   LGVSLGFKIPMREAITLGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFIT  420

Query  1398  TPIVIALYKPAKLAVT--EYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TPIV+A+YKPA+ A    EYK RT++R++ + QLRILTCFH   +IPS+INL+EASRG E
Sbjct  421   TPIVMAVYKPARRAKKEGEYKNRTVERENTNTQLRILTCFHGAGSIPSIINLLEASRGIE  480

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             K  G  VYA+HL ELSERSSAILM HK RKNG+PFWN RG   D+ ++VVAF+ F+ LS+
Sbjct  481   KGEGLCVYALHLRELSERSSAILMVHKVRKNGMPFWNRRGVNADADQVVVAFQAFQQLSR  540

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             V++RP TAIS+MS +HEDI  +A  KR A++ILPFHKHQ++DG  ETTR + R VNRRVL
Sbjct  541   VNVRPMTAISSMSDIHEDICTTAARKRAAIVILPFHKHQQLDGSLETTRGDYRWVNRRVL  600

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
               APCSVGI VDRGLGG+S VSA +V Y++ VL+FGG DDREALAYG RM EHPGI L V
Sbjct  601   LEAPCSVGIFVDRGLGGSSQVSAQDVSYSVVVLFFGGRDDREALAYGLRMAEHPGIVLTV  660

Query  684   ARFTLDPETAGTsvkldvspsgssspeekSR---DEDFLAAFKQRNSTNSSVKYEEKVVK  514
              RF + PE AG  V ++V  S +   +       DE+ ++  ++++S + S+K+ EK ++
Sbjct  661   FRFVVSPERAGEIVNVEVRDSNNEKNQSSKNPKLDEEIMSEIRKKSSVDESIKFVEKRIE  720

Query  513   SAA-ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASV  337
             +AA +   AI    R NL +VGRMP GEI  A+ +  ECPELGP+G+LL   E ST ASV
Sbjct  721   NAAVDVRSAIEEARRSNLFLVGRMPGGEIALAIRENSECPELGPVGSLLISPESSTRASV  780

Query  336   LVVQQY  319
             LV+QQY
Sbjct  781   LVIQQY  786



>ref|XP_010096456.1| Cation/H(+) antiporter 18 [Morus notabilis]
 ref|XP_010101601.1| Cation/H(+) antiporter 18 [Morus notabilis]
 gb|EXB64344.1| Cation/H(+) antiporter 18 [Morus notabilis]
 gb|EXB88791.1| Cation/H(+) antiporter 18 [Morus notabilis]
Length=792

 Score =   972 bits (2512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/788 (70%), Positives = 640/788 (81%), Gaps = 7/788 (1%)
 Frame = -1

Query  2658  MGSNGTVV--CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M  N +V   CPAPM ATSNG FQGD+PLDYALPL I+QI LVV++TRVLA+LLRPLRQP
Sbjct  1     MAPNASVASSCPAPMHATSNGVFQGDNPLDYALPLAILQILLVVVVTRVLAFLLRPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEI+GG+LLGPSA GR  +Y NAIFP KSLTVLDTLA+LGLLFF+FLVGLELD K+L
Sbjct  61    RVIAEIVGGILLGPSALGRIASYRNAIFPAKSLTVLDTLANLGLLFFMFLVGLELDLKAL  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGP-FLVFMGVALSITAFPVLA  2128
              RTGKKA SIALAGISLPF LGIGTSF LRATI+KGV QGP FLVFMGVALSITAFPVLA
Sbjct  121   HRTGKKAFSIALAGISLPFILGIGTSFALRATISKGV-QGPAFLVFMGVALSITAFPVLA  179

Query  2127  RILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVL  1948
             RILAELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSG   SPL+SLWV LCG+ FVL
Sbjct  180   RILAELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGDKSSPLVSLWVFLCGSAFVL  239

Query  1947  LCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLV  1768
              C   VP IFKWMA RC + EPV E+YVCA LA VL AGFVTD IGIHALFGAFVIGVLV
Sbjct  240   CCAFGVPPIFKWMAQRCPKDEPVKELYVCATLATVLAAGFVTDAIGIHALFGAFVIGVLV  299

Query  1767  PKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKI  1588
             PK+G  A A+VEKVEDLVSGLFLPLYFVSSGLKT++ATI GAQSWGLLVLVI TACFGK+
Sbjct  300   PKEGAFAGAMVEKVEDLVSGLFLPLYFVSSGLKTDIATISGAQSWGLLVLVIITACFGKV  359

Query  1587  LGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTT  1408
             +GT+ VS   ++P QE++ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMA+FTT
Sbjct  360   VGTVAVSLFSKVPLQESLALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTT  419

Query  1407  FITTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             FITTP+V+A+YKP K +   YK R+I +K  + +LRIL CF+S RNIP++INLIEASRGT
Sbjct  420   FITTPLVMAVYKPTKRSKNYYKDRSIGKKGTNTELRILACFYSIRNIPTMINLIEASRGT  479

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
             EK     VYAMHLMEL+ERSSAI M  KARKNGLPFWN   + ++S +IVVAFE F+ LS
Sbjct  480   EKKERLCVYAMHLMELTERSSAIQMVQKARKNGLPFWNKESQ-SNSDQIVVAFEAFQQLS  538

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +VSIRP TAISAMS MHEDI  SAE KR AMIIL FHKHQ++DG  ETTR E R VN++V
Sbjct  539   QVSIRPMTAISAMSEMHEDICMSAERKRAAMIILVFHKHQRLDGALETTRAEFRGVNKKV  598

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             LE APCSVGILVDRGLGGT+H+SAS+V   IT+L+FGGHDD EALA+G RM EHPGI L 
Sbjct  599   LEQAPCSVGILVDRGLGGTTHISASHVSSNITILFFGGHDDCEALAFGMRMAEHPGISLN  658

Query  687   VARFTLDP--ETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVK  514
             V      P   T   ++    +    S+   + +DE+ LA  KQ+ S N S+KY+ K V+
Sbjct  659   VIHLLPCPTMTTKAKAIVTVDNQDSDSNISFEPQDENALAELKQKLSANGSIKYQVKRVE  718

Query  513   SAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVL  334
             + ++++ AI+ ++ CNL +VGR PEG +  A   K ECPELGP+GNLL+  +F+TTASVL
Sbjct  719   NYSQSVAAIKEFSGCNLFLVGRNPEGVVAKAFSVKSECPELGPVGNLLTSADFTTTASVL  778

Query  333   VVQQYRTE  310
             VVQQ++ +
Sbjct  779   VVQQHQGQ  786



>gb|AAX49546.1| cation/H+ exchanger [Arabidopsis thaliana]
Length=808

 Score =   970 bits (2508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/785 (68%), Positives = 643/785 (82%), Gaps = 5/785 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +N T  CPAPMKATSNG FQGD+P+D+ALPL I+QI +V++LTRVLAYLLRPLRQPRV
Sbjct  1     MATNSTKACPAPMKATSNGVFQGDNPIDFALPLAILQIVIVIVLTRVLAYLLRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAE+IGG++LGPS  GRS+A+L+A+FPKKSLTVL+TLA+LGLLFFLFL GLE+D K+LRR
Sbjct  61    IAEVIGGIMLGPSLLGRSKAFLDAVFPKKSLTVLETLANLGLLFFLFLAGLEIDTKALRR  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKAL IALAGI+LPF LGIG+SF+L+ATI+KGV+   FLVFMGVALSITAFPVLARIL
Sbjct  121   TGKKALGIALAGITLPFALGIGSSFVLKATISKGVNSTAFLVFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTT++G++AMSAAAVNDVAAWILLALAIALSG+  SPL+SLWV L G  FV+   
Sbjct  181   AELKLLTTEIGRLAMSAAAVNDVAAWILLALAIALSGSNTSPLVSLWVFLSGCAFVIGAS  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              ++P IF+W++ RC EGEP++E Y+CA LA VL  GF+TD IGIH++FGAFV+GVL+PK+
Sbjct  241   FIIPPIFRWISRRCHEGEPIEETYICATLAVVLVCGFITDAIGIHSMFGAFVVGVLIPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP A ALVEKVEDLVSGLFLPLYFV+SGLKTNVATIQGAQSWGLLVLV  TACFGKILGT
Sbjct  301   GPFAGALVEKVEDLVSGLFLPLYFVASGLKTNVATIQGAQSWGLLVLVTATACFGKILGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             + VS   +IP +EAITLGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTFIT
Sbjct  361   LGVSLAFKIPMREAITLGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFIT  420

Query  1398  TPIVIALYKPAKLAVT--EYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKPA+ A    EYK+R ++R++ + QLRILTCFH   +IPS+INL+EASRG E
Sbjct  421   TPVVMAVYKPARRAKKEGEYKHRAVERENTNTQLRILTCFHGAGSIPSMINLLEASRGIE  480

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             K  G  VYA+HL ELSERSSAILM HK RKNG+PFWN RG   D+ ++VVAF+ F+ LS+
Sbjct  481   KGEGLCVYALHLRELSERSSAILMVHKVRKNGMPFWNRRGVNADADQVVVAFQAFQQLSR  540

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             V++RP TAIS+MS +HEDI  +A  K+ A++ILPFHKHQ++DG  ETTR + R VNRRVL
Sbjct  541   VNVRPMTAISSMSDIHEDICTTAVRKKAAIVILPFHKHQQLDGSLETTRGDYRWVNRRVL  600

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
               APCSVGI VDRGLGG+S VSA +V Y++ VL+FGG DDREALAYG RM EHPGI L V
Sbjct  601   LQAPCSVGIFVDRGLGGSSQVSAQDVSYSVVVLFFGGPDDREALAYGLRMAEHPGIVLTV  660

Query  684   ARFTLDPETAG--TsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKS  511
              RF + PE  G   +V++  + + + S +    DE+ ++  ++ +S + SVK+ EK +++
Sbjct  661   FRFVVSPERVGEIVNVEVSNNNNENQSVKNLKSDEEIMSEIRKISSVDESVKFVEKQIEN  720

Query  510   AA-ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVL  334
             AA +   AI    R NL +VGRMP GEI  A+ +  ECPELGP+G+LL   E ST ASVL
Sbjct  721   AAVDVRSAIEEVRRSNLFLVGRMPGGEIALAIRENSECPELGPVGSLLISPESSTKASVL  780

Query  333   VVQQY  319
             V+QQY
Sbjct  781   VIQQY  785



>ref|NP_198976.3| cation/H(+) antiporter 18 [Arabidopsis thaliana]
 sp|Q9FFR9.1|CHX18_ARATH RecName: Full=Cation/H(+) antiporter 18; AltName: Full=Protein 
CATION/H+ EXCHANGER 18; Short=AtCHX18 [Arabidopsis thaliana]
 dbj|BAB11467.1| Na+/H+ antiporter-like protein [Arabidopsis thaliana]
 gb|AED94698.1| cation/H(+) antiporter 18 [Arabidopsis thaliana]
Length=810

 Score =   970 bits (2507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/785 (68%), Positives = 643/785 (82%), Gaps = 5/785 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +N T  CPAPMKATSNG FQGD+P+D+ALPL I+QI +V++LTRVLAYLLRPLRQPRV
Sbjct  1     MATNSTKACPAPMKATSNGVFQGDNPIDFALPLAILQIVIVIVLTRVLAYLLRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAE+IGG++LGPS  GRS+A+L+A+FPKKSLTVL+TLA+LGLLFFLFL GLE+D K+LRR
Sbjct  61    IAEVIGGIMLGPSLLGRSKAFLDAVFPKKSLTVLETLANLGLLFFLFLAGLEIDTKALRR  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKAL IALAGI+LPF LGIG+SF+L+ATI+KGV+   FLVFMGVALSITAFPVLARIL
Sbjct  121   TGKKALGIALAGITLPFALGIGSSFVLKATISKGVNSTAFLVFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTT++G++AMSAAAVNDVAAWILLALAIALSG+  SPL+SLWV L G  FV+   
Sbjct  181   AELKLLTTEIGRLAMSAAAVNDVAAWILLALAIALSGSNTSPLVSLWVFLSGCAFVIGAS  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              ++P IF+W++ RC EGEP++E Y+CA LA VL  GF+TD IGIH++FGAFV+GVL+PK+
Sbjct  241   FIIPPIFRWISRRCHEGEPIEETYICATLAVVLVCGFITDAIGIHSMFGAFVVGVLIPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP A ALVEKVEDLVSGLFLPLYFV+SGLKTNVATIQGAQSWGLLVLV  TACFGKILGT
Sbjct  301   GPFAGALVEKVEDLVSGLFLPLYFVASGLKTNVATIQGAQSWGLLVLVTATACFGKILGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             + VS   +IP +EAITLGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTFIT
Sbjct  361   LGVSLAFKIPMREAITLGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFIT  420

Query  1398  TPIVIALYKPAKLAVT--EYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKPA+ A    EYK+R ++R++ + QLRILTCFH   +IPS+INL+EASRG E
Sbjct  421   TPVVMAVYKPARRAKKEGEYKHRAVERENTNTQLRILTCFHGAGSIPSMINLLEASRGIE  480

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             K  G  VYA+HL ELSERSSAILM HK RKNG+PFWN RG   D+ ++VVAF+ F+ LS+
Sbjct  481   KGEGLCVYALHLRELSERSSAILMVHKVRKNGMPFWNRRGVNADADQVVVAFQAFQQLSR  540

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             V++RP TAIS+MS +HEDI  +A  K+ A++ILPFHKHQ++DG  ETTR + R VNRRVL
Sbjct  541   VNVRPMTAISSMSDIHEDICTTAVRKKAAIVILPFHKHQQLDGSLETTRGDYRWVNRRVL  600

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
               APCSVGI VDRGLGG+S VSA +V Y++ VL+FGG DDREALAYG RM EHPGI L V
Sbjct  601   LQAPCSVGIFVDRGLGGSSQVSAQDVSYSVVVLFFGGPDDREALAYGLRMAEHPGIVLTV  660

Query  684   ARFTLDPETAG--TsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKS  511
              RF + PE  G   +V++  + + + S +    DE+ ++  ++ +S + SVK+ EK +++
Sbjct  661   FRFVVSPERVGEIVNVEVSNNNNENQSVKNLKSDEEIMSEIRKISSVDESVKFVEKQIEN  720

Query  510   AA-ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVL  334
             AA +   AI    R NL +VGRMP GEI  A+ +  ECPELGP+G+LL   E ST ASVL
Sbjct  721   AAVDVRSAIEEVRRSNLFLVGRMPGGEIALAIRENSECPELGPVGSLLISPESSTKASVL  780

Query  333   VVQQY  319
             V+QQY
Sbjct  781   VIQQY  785



>ref|XP_002868583.1| ATCHX18 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44842.1| ATCHX18 [Arabidopsis lyrata subsp. lyrata]
Length=810

 Score =   970 bits (2507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/810 (66%), Positives = 648/810 (80%), Gaps = 10/810 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +N T  CPAPMKATSNG FQGD+P+D+ALPL I+QI +V++LTRVLAY+LRPLRQPRV
Sbjct  1     MATNSTKACPAPMKATSNGVFQGDNPIDFALPLAILQIVIVIVLTRVLAYILRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAE+IGG++LGPS  GRS+ +L+A+FPKKSLTVL+TLA+LGLLFFLFL GLE+D K+LR 
Sbjct  61    IAEVIGGIMLGPSLLGRSKVFLDAVFPKKSLTVLETLANLGLLFFLFLAGLEIDTKALRH  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKAL IALAGI+LPF LGIGTSF+L+ATI+KGV    FLVFMGVALSITAFPVLARIL
Sbjct  121   TGKKALGIALAGITLPFALGIGTSFVLKATISKGVDSTAFLVFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTT++G++AMSAAAVNDVAAWILLALAIALSG+  SPL+SLWV L G  FV+   
Sbjct  181   AELKLLTTEIGRLAMSAAAVNDVAAWILLALAIALSGSNTSPLVSLWVFLSGCAFVIGAA  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              ++P IF+W+A RC EGEP++E Y+CA LA VL  GF+TD IGIH++FGAFV+GVL+PK+
Sbjct  241   FIIPPIFRWIARRCHEGEPIEETYICATLAVVLVCGFITDAIGIHSMFGAFVVGVLIPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP A ALVEKVEDLVSGLFLPLYFV+SGLKTNVATIQGAQSWGLLVLV  TACFGKILGT
Sbjct  301   GPFAGALVEKVEDLVSGLFLPLYFVASGLKTNVATIQGAQSWGLLVLVTATACFGKILGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             + VS   +IP +EAITLGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTFIT
Sbjct  361   LGVSLAFKIPMREAITLGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFIT  420

Query  1398  TPIVIALYKPAKLAVT--EYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKPA+ A    EYK+RT++R++ + QLRILTCFH   +IPS+INL+EASRG E
Sbjct  421   TPVVMAVYKPARRAKKEGEYKHRTVERENTNTQLRILTCFHGAGSIPSMINLLEASRGIE  480

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             K  G  VYA+HL ELSERSSAILM HK RKNG+PFWN RG    + ++VVAF+ F+ LS+
Sbjct  481   KGEGLCVYALHLRELSERSSAILMVHKVRKNGMPFWNRRGVNAHADQVVVAFQAFQQLSR  540

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             V++RP TAIS+MS +HEDI  +A  K+ A++ILPFHKHQ++DG  ETTR + R VNRRVL
Sbjct  541   VNVRPMTAISSMSDIHEDICTTAARKKAAIVILPFHKHQQLDGSLETTRGDYRWVNRRVL  600

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
               APCSVGI VDRGLGG+S VSA +V Y++ VL+FGG DDREALAYG RM EHPGI L V
Sbjct  601   LEAPCSVGIFVDRGLGGSSQVSAQDVSYSVVVLFFGGRDDREALAYGLRMAEHPGIALTV  660

Query  684   ARFTLDPETAG--TsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKS  511
              RF + PE  G   +V++  + + S S +    DE+ ++  ++ +S   SVK+ EK +++
Sbjct  661   FRFVVSPERVGEIVNVEVSNTNNESQSVKNLKSDEEIISEIRKISSVEESVKFVEKRIEN  720

Query  510   AA-ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVL  334
             AA +   AI    R NL +VGRMP GEI  A+ +  ECPELGP+G+LL   E ST ASVL
Sbjct  721   AAVDVRSAIEEVRRSNLFLVGRMPGGEIALAIRENSECPELGPVGSLLISPESSTKASVL  780

Query  333   VVQQYR-----TELSKNGLKEDDSVDGDYE  259
             V+QQY       +L+  G +   S D D +
Sbjct  781   VIQQYNGTGTAPDLASAGTEVLTSTDKDSD  810



>ref|XP_010910508.1| PREDICTED: cation/H(+) antiporter 18-like [Elaeis guineensis]
Length=821

 Score =   968 bits (2502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/787 (71%), Positives = 632/787 (80%), Gaps = 4/787 (1%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CP P  A SNG FQGD+PL  ALPL I+QICLVV++TR LA+LL+PLRQPRVIAEIIGG+
Sbjct  22    CPKPAAAASNGVFQGDNPLHSALPLAILQICLVVVITRSLAFLLKPLRQPRVIAEIIGGI  81

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GRS+A+L+A+FP  SLTVLDTLA+LGLLFFLFLVGLELDPKSLRRTGK+A  I
Sbjct  82    LLGPSALGRSKAFLHAVFPPSSLTVLDTLANLGLLFFLFLVGLELDPKSLRRTGKRAFGI  141

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             A+AGISLPF LGIGTS +LR TI+KGV   PFLVF+GVALSITAFPVLARILAELKLLTT
Sbjct  142   AVAGISLPFFLGIGTSVVLRHTISKGVQGAPFLVFVGVALSITAFPVLARILAELKLLTT  201

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             DVG+MAMSAAAVNDVAAWILLALAIALS +  SPL+SLWVLLCG  FVL C  +V  I  
Sbjct  202   DVGRMAMSAAAVNDVAAWILLALAIALSDSSQSPLVSLWVLLCGVAFVLFCTFLVQPILG  261

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             W+A R  EGEPV EIYVCA LAAVL AGFVTDTIGIHALFG F+IGVLVPKDGP A ALV
Sbjct  262   WIARRTPEGEPVGEIYVCATLAAVLAAGFVTDTIGIHALFGGFIIGVLVPKDGPFAGALV  321

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVI TAC GKI GT+ VS  CR
Sbjct  322   EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVILTACLGKIAGTVGVSIACR  381

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +P +EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFA+ VLMALFTTFITTP+V A Y
Sbjct  382   MPSREALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAVFVLMALFTTFITTPLVTAFY  441

Query  1374  KPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAM  1195
             KPA+ + T YK+RTI+RKD   QLR L CFHS RNIP++INLIEASRGT +  G  VYAM
Sbjct  442   KPARKSCTIYKHRTIERKDSGTQLRFLACFHSTRNIPTIINLIEASRGTNRREGLCVYAM  501

Query  1194  HLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAIS  1015
             HLMELSER SAILM HKARKNGLPFWN +   +   ++VVAFE FE LS VSIRP TAIS
Sbjct  502   HLMELSERPSAILMVHKARKNGLPFWN-KTLRSGYDQVVVAFEAFERLSNVSIRPMTAIS  560

Query  1014  AMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGIL  835
             A+S +HEDI ASAE K  A+IILPFHKHQ++DG  E TR+E R VNR+VLE APCSVGIL
Sbjct  561   ALSDIHEDICASAERKEAAIIILPFHKHQRLDGALEMTRHEFRSVNRKVLEHAPCSVGIL  620

Query  834   VDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETA  655
             VDRGLGGT+HVSAS+V  +ITVL+FGG DDREAL Y  R+ EHPGI L V RF ++    
Sbjct  621   VDRGLGGTTHVSASDVSSSITVLFFGGQDDREALTYATRIAEHPGIQLTVLRF-IESRNG  679

Query  654   GTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGYN  475
                  + +  +GSS+ E    DE  L  F+ +   + ++KYEE+ V S+ ET+ AI+  +
Sbjct  680   SDGESVAIDMNGSSTAEGMLADEKVLNEFRNKTQNDPAIKYEEREVASSDETVAAIQTVS  739

Query  474   RCNLLVVGRMPEGEIVAA-MDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTELSKN  298
             R +L++VGR PEG   AA M ++ ECPELGP+G+LL+     TTASVLVVQQY T  S+ 
Sbjct  740   RSDLILVGRRPEGAAAAALMTERNECPELGPVGDLLTSPSSLTTASVLVVQQY-TWQSRM  798

Query  297   GLKEDDS  277
              L   DS
Sbjct  799   KLPPADS  805



>gb|KHN35057.1| Cation/H(+) antiporter 18 [Glycine soja]
Length=791

 Score =   967 bits (2499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/796 (67%), Positives = 636/796 (80%), Gaps = 11/796 (1%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             MKATSNG+FQGD+PLD+ALPL I+QICLV++++R LAYLL+P RQPRVIAEIIGG++LGP
Sbjct  1     MKATSNGAFQGDNPLDFALPLAILQICLVLVVSRGLAYLLKPFRQPRVIAEIIGGIILGP  60

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             S  GR+++Y+  +FP +SL VLDTLA++GL+FFLFL GLELD KSLR++G + L+IA+AG
Sbjct  61    SVLGRNKSYMQKVFPPRSLPVLDTLANIGLIFFLFLAGLELDLKSLRQSGNRVLAIAMAG  120

Query  2262  ISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQ  2083
             ISLPF +GIGTSF+L+ TIAKG     FLVFMGVALSITAFPVLARILAELKLLTT+VG+
Sbjct  121   ISLPFVIGIGTSFVLKQTIAKGSDNAAFLVFMGVALSITAFPVLARILAELKLLTTNVGK  180

Query  2082  mamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMAS  1903
              AMSAAA+ND+AAWILLALA+ALSG   SPL+SLWV L G GFV+  IL+VP IFKWM+ 
Sbjct  181   TAMSAAAINDIAAWILLALAVALSGHDRSPLVSLWVFLAGCGFVICAILIVPPIFKWMSQ  240

Query  1902  RCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVE  1723
             RC EGEPV+E+Y+CA LAAVL AGFVTD IGIHA+FGAFV+G+LVP DGP ASALVEKVE
Sbjct  241   RCHEGEPVEEVYICATLAAVLAAGFVTDAIGIHAMFGAFVVGILVPNDGPFASALVEKVE  300

Query  1722  DLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQ  1543
             DLVSGLFLPLYFVSSGLKTNVATI+GAQSWGLL  VIFTA FGKILGT++VS  C++PF 
Sbjct  301   DLVSGLFLPLYFVSSGLKTNVATIKGAQSWGLLAFVIFTASFGKILGTLVVSLFCKVPFN  360

Query  1542  EAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPA-  1366
             EA+ LGFLMN KGLVELIVLNIGKDR VLNDQTFAIMVLMA+FTTFITTP+V A+YKPA 
Sbjct  361   EALVLGFLMNCKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTTFITTPLVTAVYKPAR  420

Query  1365  KLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLM  1186
             K  +T YKYRTI RK+ + QLRIL CFH  RNIPS+INLIEASRG +K     VYAMHL 
Sbjct  421   KGKITNYKYRTIGRKNANSQLRILACFHGARNIPSMINLIEASRGIQKRDALCVYAMHLK  480

Query  1185  ELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMS  1006
             E SERSS++LM HKAR+NGLPFWN +G   DS  ++VAFE +  LS+VSIRP  AIS+M+
Sbjct  481   EFSERSSSMLMVHKARRNGLPFWN-KGHHADSNHVIVAFEAYRQLSQVSIRPMIAISSMN  539

Query  1005  SMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDR  826
             ++HEDI A+AE K  A+IILPFHKHQ++DG    TRN+ R VN+RVLE APCSVGI VDR
Sbjct  540   NIHEDICATAERKGAAVIILPFHKHQRLDGSLNITRNDFRWVNKRVLEHAPCSVGIFVDR  599

Query  825   GLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGTs  646
             GLGGTSHVSASNV Y +TVL+FGG DD EALAYGARM EHPGI L+V RF  +P      
Sbjct  600   GLGGTSHVSASNVSYRVTVLFFGGGDDHEALAYGARMAEHPGIRLLVIRFVGEPMNG---  656

Query  645   vkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGYNRCN  466
               + V    S+S +  S+DE+FL   K + + + S+ YEEKVVK  AET+  IR    CN
Sbjct  657   EIVRVDVGDSTSTKLISQDEEFLDEIKTKIANDDSIIYEEKVVKDGAETVAIIRELKSCN  716

Query  465   LLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTELSKNGLKE  286
             L +VG  P  E+ +AM K+ ECPELGP+G LL+ +++ TTASVLV+QQ+      N    
Sbjct  717   LFLVGSRPASEVASAM-KRSECPELGPVGGLLASQDYPTTASVLVMQQFENGAPINFTIS  775

Query  285   DDSV-----DGDYESA  253
             D  +     D D ESA
Sbjct  776   DSEMEEHVPDRDSESA  791



>ref|XP_003611041.1| Na+/H+ antiporter-like protein [Medicago truncatula]
 gb|AES93999.1| cation/H+ exchanger 3 [Medicago truncatula]
Length=800

 Score =   966 bits (2497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/802 (67%), Positives = 642/802 (80%), Gaps = 7/802 (1%)
 Frame = -1

Query  2658  MGSNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M SN T   VCP PMK+TSNG FQGD PLDYALPL I+QICLV+++TR LAYLL+PLRQP
Sbjct  1     MTSNTTAGNVCPPPMKSTSNGVFQGDHPLDYALPLAILQICLVLVVTRGLAYLLKPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEI+GG+LLGPSAFGR+++YL+A+FP KSL VLDTLA+LGL+FFLFL G+ELDPKSL
Sbjct  61    RVIAEIVGGILLGPSAFGRNKSYLHAVFPPKSLPVLDTLANLGLIFFLFLAGIELDPKSL  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
              +TG + L+IA+ GISLPF LGIG+SF+L+ TIAK V+   FLV+MGVALSITAFPVLAR
Sbjct  121   GKTGGRVLAIAMVGISLPFALGIGSSFVLKETIAKDVNTSAFLVYMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTT VG+MAMSAAAVNDVAAWILLALA+ALSG   SPL+SLWV L G GFV+ 
Sbjct  181   ILAELKLLTTSVGRMAMSAAAVNDVAAWILLALAVALSGNSQSPLVSLWVFLAGCGFVVC  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
              IL+V  IFKWMA +C EGEPVDE+Y+CA LA+VL AGFVTD IGIHA+FGAFV G+LVP
Sbjct  241   SILIVLPIFKWMAQQCHEGEPVDELYICATLASVLAAGFVTDAIGIHAMFGAFVFGILVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             KDGP + ALVEK+EDLVSGL LPLYFVSSGLKTN+ATIQG QSWGLLV V FTACFGKI+
Sbjct  301   KDGPFSGALVEKIEDLVSGLLLPLYFVSSGLKTNIATIQGLQSWGLLVFVTFTACFGKIV  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GTI+VS LC++ F E++ LGFLMN+KGLVELIVLNIGKDR VLND+TFAIMVLMAL TTF
Sbjct  361   GTIVVSLLCKVSFNESLVLGFLMNSKGLVELIVLNIGKDRKVLNDETFAIMVLMALVTTF  420

Query  1404  ITTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             +TTP+V+A YK  K  +++YKY+T++RK+   +LRIL CFH  RNIPS+INLIEASRG +
Sbjct  421   MTTPLVMAAYK-RKAKISDYKYKTVERKNADSELRILACFHGARNIPSVINLIEASRGIK  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             K     VYAMHL E SERSS+ILM  K RKNGLPFWN +G   DS  ++VAFE ++ LS+
Sbjct  480   KRDALCVYAMHLKEFSERSSSILMVQKVRKNGLPFWN-KGHRADSDHVIVAFEAYQKLSQ  538

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             V +RP  AIS+M+++HEDI A+AE KR A+IILPFH  Q++DG  + TRN+ R VN+RVL
Sbjct  539   VCVRPMVAISSMANIHEDICATAERKRAAVIILPFHMQQRLDGSLDVTRNDFRFVNKRVL  598

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             E APCSVGI VDRGLGGT HVSASNV Y + VL+FGG DDREALAYGAR  EHPGI LV+
Sbjct  599   EHAPCSVGIFVDRGLGGTCHVSASNVSYCVAVLFFGGGDDREALAYGARTAEHPGIRLVI  658

Query  684   ARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAA  505
              RF ++    G      V    SS  +  S DE+FLA FK + +++ SV YEEK+VK AA
Sbjct  659   IRFLVESTILGE--ISSVDVGDSSIGKSISEDEEFLAEFKLKTASDDSVIYEEKIVKDAA  716

Query  504   ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQ  325
             ET+ +IR +N CNL +VG  P GE+  A++++ ECPELGP+G LL  ++  TTASVLV+Q
Sbjct  717   ETVASIRKFNSCNLFLVGLRPTGELACALERR-ECPELGPVGGLLISQDCPTTASVLVMQ  775

Query  324   QYRTELSKNGLKEDDSVDGDYE  259
             QY   +  N + E +     +E
Sbjct  776   QYHNGVPMNFVPEMEEHSHSHE  797



>ref|XP_010441325.1| PREDICTED: cation/H(+) antiporter 18 [Camelina sativa]
 ref|XP_010441326.1| PREDICTED: cation/H(+) antiporter 18 [Camelina sativa]
 ref|XP_010441327.1| PREDICTED: cation/H(+) antiporter 18 [Camelina sativa]
Length=803

 Score =   965 bits (2494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/781 (68%), Positives = 638/781 (82%), Gaps = 7/781 (1%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
             +N T  CPAPMKATSNG FQGD+P+D+ALPL I+QI +V++LTR+LAYLLRPLRQPRVIA
Sbjct  4     TNSTKACPAPMKATSNGVFQGDNPIDFALPLAILQIVIVIVLTRLLAYLLRPLRQPRVIA  63

Query  2472  EIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTG  2293
             E+IGG++LGPS  GRS+ +L+A+FPKKSLTVL+TLA+LGLLFFLFL GLE+D K+LR TG
Sbjct  64    EVIGGIMLGPSLLGRSKVFLDAVFPKKSLTVLETLANLGLLFFLFLAGLEIDTKALRHTG  123

Query  2292  KKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAE  2113
             KKAL IA+AGISLPF LGIG+SF+L+ATI+KGV    FLVFMGVALSITAFPVLARILAE
Sbjct  124   KKALGIAMAGISLPFALGIGSSFVLKATISKGVDSTAFLVFMGVALSITAFPVLARILAE  183

Query  2112  LKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILV  1933
             LKLLTT++G++AMSAAAVNDVAAWILLALAIALSG+  SPL+SLWV L G  FV+    +
Sbjct  184   LKLLTTEIGRLAMSAAAVNDVAAWILLALAIALSGSNTSPLVSLWVFLSGCAFVIGAAFI  243

Query  1932  VPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
             +P IFKW+A RC EGEP++E Y+CA LA VL  GF+TD IGIH++FGAFV+GVL+PK+GP
Sbjct  244   IPPIFKWIARRCHEGEPIEETYICATLAVVLVCGFITDAIGIHSMFGAFVVGVLIPKEGP  303

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
              A ALVEKVEDLVSGLFLPLYFV+SGLKTNVATIQGAQSWGLLVLV FTACFGKI+GT+ 
Sbjct  304   FAGALVEKVEDLVSGLFLPLYFVASGLKTNVATIQGAQSWGLLVLVTFTACFGKIVGTLG  363

Query  1572  VSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTP  1393
             VS   +IP +EAITLGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTFITTP
Sbjct  364   VSLAFKIPMREAITLGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFITTP  423

Query  1392  IVIALYKPAKLAVT--EYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             +V+A+YKPA+ A    EYK RT++R++ + QLRILTCFH   +IPS+INL+EASRG EK 
Sbjct  424   VVMAVYKPARRAKKEGEYKNRTVERENTNTQLRILTCFHGAGSIPSIINLLEASRGIEKG  483

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
              G  VYA+HL ELSERSSAILM HK RKNG+PFWN RG   D+ ++VVAF+ F+ LS+V+
Sbjct  484   EGLCVYALHLRELSERSSAILMVHKVRKNGMPFWNRRGVNADADQVVVAFQAFQQLSRVN  543

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             +RP TAIS+MS +HEDI  +A  KR A++ILPFHKHQ++DG  +TTR + R VNRRVL  
Sbjct  544   VRPMTAISSMSDIHEDICTTAARKRTAIVILPFHKHQQLDGSLQTTRGDYRWVNRRVLLE  603

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             APCSVGI VDRGLGG+S VSA +V Y++ VL+FGG DDREALAYG RM EHPGI L V R
Sbjct  604   APCSVGIFVDRGLGGSSQVSAQDVSYSVVVLFFGGRDDREALAYGLRMAEHPGIVLTVFR  663

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAA-E  502
             F + PE  G  V ++V  +  +       DE+ ++  ++++S + S+K+ EK V++AA +
Sbjct  664   FVVAPERVGEVVNVEVGDNEHNLKW----DEEIMSEIRKKSSVDESIKFVEKRVENAAVD  719

Query  501   TMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQ  322
                AI    R NL +VGR+P GEI  A+ +  ECPELGP+G+LL   E ST ASVLV+QQ
Sbjct  720   VRSAIEEVRRSNLFLVGRVPGGEIALAIRENSECPELGPVGSLLISPESSTRASVLVIQQ  779

Query  321   Y  319
             Y
Sbjct  780   Y  780



>ref|XP_010447730.1| PREDICTED: cation/H(+) antiporter 18-like [Camelina sativa]
 ref|XP_010447738.1| PREDICTED: cation/H(+) antiporter 18-like [Camelina sativa]
 ref|XP_010447745.1| PREDICTED: cation/H(+) antiporter 18-like [Camelina sativa]
Length=806

 Score =   965 bits (2494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/781 (67%), Positives = 636/781 (81%), Gaps = 4/781 (1%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
             +N T  CPAPMKATSNG FQGD+P+D+ALPL I+QI +V++LTR+LAYLLRPLRQPRVIA
Sbjct  4     TNSTKACPAPMKATSNGVFQGDNPIDFALPLAILQIVIVIVLTRLLAYLLRPLRQPRVIA  63

Query  2472  EIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTG  2293
             E+IGG++LGPS  GRS+ +L+A+FPKKSLTVL+TLA+LGLLFFLFL GLE+D K+LR TG
Sbjct  64    EVIGGIMLGPSLLGRSKVFLDAVFPKKSLTVLETLANLGLLFFLFLAGLEIDTKALRHTG  123

Query  2292  KKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAE  2113
             KKAL IA+AGISLPF LGIG+SF+L+ATI+KGV    FLVFMGVALSITAFPVLARILAE
Sbjct  124   KKALGIAMAGISLPFALGIGSSFVLKATISKGVDSTAFLVFMGVALSITAFPVLARILAE  183

Query  2112  LKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILV  1933
             LKLLTT++G++AMSAAAVNDVAAWILLALAIALSG+  SPL+SLWV L G  FV+    +
Sbjct  184   LKLLTTEIGRLAMSAAAVNDVAAWILLALAIALSGSNTSPLVSLWVFLAGCAFVVGAAFI  243

Query  1932  VPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
             +P IF+W+A RC EGEP++E Y+CA LA VL  GF+TD IGIH++FGAFV+GVL+PK+GP
Sbjct  244   IPPIFRWIARRCHEGEPIEETYICATLAVVLVCGFITDAIGIHSMFGAFVVGVLIPKEGP  303

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
              A ALVEKVEDLVSGLFLPLYFV+SGLKTNVATIQGAQSWGLLVLV FTACFGKI+GT+ 
Sbjct  304   FAGALVEKVEDLVSGLFLPLYFVASGLKTNVATIQGAQSWGLLVLVTFTACFGKIVGTLG  363

Query  1572  VSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTP  1393
             VS   +IP +EAITLGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTFITTP
Sbjct  364   VSLAFKIPMREAITLGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFITTP  423

Query  1392  IVIALYKPAKLAVT--EYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             +V+A+YKPA+ A    EYK RT++R++ + QLRILTCFH   +IPS+INL+EASRG EK 
Sbjct  424   VVMAVYKPARRAKKEGEYKNRTVERENTNTQLRILTCFHGAGSIPSIINLLEASRGIEKG  483

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
              G  VYA+HL ELSERSSAILM HK RKNG+PFWN RG   D+ ++VVAF+ F+ LS+V+
Sbjct  484   KGLCVYALHLRELSERSSAILMVHKVRKNGMPFWNRRGVNADADQVVVAFQAFQQLSRVN  543

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             +RP TAIS+MS +HEDI  +A  KR A++ILPFHKHQ++DG  ETTR + R VNRRVL  
Sbjct  544   VRPMTAISSMSDIHEDICTTAARKRAAIVILPFHKHQQLDGSLETTRGDYRWVNRRVLLE  603

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             APCSVGI VDRGLGG+S VSA +V Y++ VL+FGG DDREALAYG RM EHPGI L V R
Sbjct  604   APCSVGIFVDRGLGGSSQVSAQDVSYSVVVLFFGGRDDREALAYGLRMAEHPGIVLTVFR  663

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAA-E  502
             F + PE+    V         ++ +    DE+ ++  ++++S + S+K+ E+ V++AA +
Sbjct  664   FVVAPESV-GEVVNVEVGDNGNNEKNLKWDEEIMSEIRKKSSVDESIKFVERRVENAAVD  722

Query  501   TMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQ  322
                AI    R NL +VGR+P GEI  A+ +  ECPELGP+G+LL   E ST ASVLV+QQ
Sbjct  723   VRSAIEEVRRSNLFLVGRVPGGEIALAIRENSECPELGPVGSLLISPESSTRASVLVIQQ  782

Query  321   Y  319
             Y
Sbjct  783   Y  783



>ref|XP_007158549.1| hypothetical protein PHAVU_002G161600g [Phaseolus vulgaris]
 gb|ESW30543.1| hypothetical protein PHAVU_002G161600g [Phaseolus vulgaris]
Length=802

 Score =   964 bits (2493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/802 (66%), Positives = 639/802 (80%), Gaps = 8/802 (1%)
 Frame = -1

Query  2658  MGSNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M SN T    CPAPMKA SNG FQGD+PLD+ALPL I+QICLV++++R LAYLL+PLRQP
Sbjct  1     MASNATSGNACPAPMKAISNGVFQGDNPLDFALPLAILQICLVLVVSRGLAYLLKPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEIIGG+LLGPSA GRS++Y+ A+FP +SLTVLDTLA++GL+FFLFL GLELD KSL
Sbjct  61    RVIAEIIGGILLGPSALGRSKSYMQAVFPSRSLTVLDTLANIGLIFFLFLAGLELDLKSL  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             R++G + L+IA+AGISLPF +GIG+SF+L+ +IAKG     FLVFMGVALSITAFPVLAR
Sbjct  121   RQSGHRVLAIAMAGISLPFVMGIGSSFVLKQSIAKGSDSAAFLVFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTT+VG+ AMSAAA+ND+AAWILLALA+ALSG   SPL+SLWV L G GFV+ 
Sbjct  181   ILAELKLLTTNVGRTAMSAAAINDIAAWILLALAVALSGHERSPLVSLWVFLAGCGFVIC  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
               ++VP IFKW++ RC EGEPV+EIY+CA LAAVL AGFVTD IGIHA+FGAFV+G+L+P
Sbjct  241   ASIIVPPIFKWVSQRCHEGEPVEEIYICATLAAVLAAGFVTDAIGIHAMFGAFVVGILIP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
              DGP ASALVEKVEDLVSGLFLPLYFVSSGLKTN+ATI+G QSWGLLV VIFTA FGKIL
Sbjct  301   NDGPFASALVEKVEDLVSGLFLPLYFVSSGLKTNIATIKGLQSWGLLVFVIFTASFGKIL  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GT +VS LC++   +A+ LGFLMN KGLVELIVLNIGKDR VLNDQTFAIMVLMA+FTTF
Sbjct  361   GTTVVSLLCKVSLNDALVLGFLMNCKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTTF  420

Query  1404  ITTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             +TTP+V A+YKPA+   ++YKYRTI RK+ + QLRIL CFH  RNIPS+INLIEASRG +
Sbjct  421   VTTPLVTAIYKPAR-KRSDYKYRTIWRKNANSQLRILACFHCARNIPSMINLIEASRGIQ  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             K  G  +YAMHL E SERSS+ILM HKAR+NGLPFWN +G  + S +++VAFE +  L +
Sbjct  480   KRDGLCMYAMHLKEFSERSSSILMVHKARRNGLPFWN-KGCHSHSDQVIVAFEAYRQLGQ  538

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             VSIRP TAIS+M+++HEDI  +AE K  A+IILPFHKHQ +DG   TTRN+ R VN+RVL
Sbjct  539   VSIRPMTAISSMANIHEDICETAERKEAAVIILPFHKHQSLDGSLNTTRNDFRGVNKRVL  598

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             E APCSVGI VDRGLGGTSHVSASNV Y +TVL+FGG DD+EALAYG RM EHPGI LVV
Sbjct  599   EHAPCSVGIFVDRGLGGTSHVSASNVSYRVTVLFFGGGDDQEALAYGGRMAEHPGIKLVV  658

Query  684   ARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAA  505
              RF ++P   G  +        SS     S+DE FL  FK + + + S+ YEE+ VK+ A
Sbjct  659   IRFVVEPPNEGE-ILRVDVDDSSSGTTSISQDEKFLDEFKVKTANDDSIIYEERRVKNTA  717

Query  504   ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQ  325
             ET+  I  +N  +L +VG  P  E+ +A+ K  ECPELGP+G LL+  ++ TTASVLV+Q
Sbjct  718   ETIAIIHEFNSSSLFLVGSRPVSEVASAL-KSSECPELGPVGGLLASHDYPTTASVLVIQ  776

Query  324   QYRTELSKN--GLKEDDSVDGD  265
             QY      N     E+   DGD
Sbjct  777   QYNNGAPINFTSEMEEHLPDGD  798



>ref|XP_009796404.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana sylvestris]
 ref|XP_009796405.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana sylvestris]
 ref|XP_009796406.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana sylvestris]
Length=790

 Score =   964 bits (2492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/784 (68%), Positives = 646/784 (82%), Gaps = 5/784 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M S+   +CP+PMKATSNG FQGD+PLD+ALPL I+QICLV+++TR LA+LLRPLRQPRV
Sbjct  1     MASSMEHLCPSPMKATSNGIFQGDNPLDFALPLAILQICLVLVVTRGLAFLLRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEIIGG+LLGPSA GR++AYLNA+FP KS+TVLDTLA++GLLFFLFLVGLELD KSL +
Sbjct  61    IAEIIGGILLGPSALGRNKAYLNAVFPPKSITVLDTLANIGLLFFLFLVGLELDLKSLHQ  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             +GKK L IA+AGIS PF LGIG+SFILR TIAKGV+   FLVFMGVALSITAFPVLARIL
Sbjct  121   SGKKVLGIAVAGISFPFALGIGSSFILRETIAKGVNATSFLVFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTT+VG+MAMSAAAVNDVAAWILL+LAIALSG   SP +SLWV L G GFV+   
Sbjct  181   AELKLLTTNVGRMAMSAAAVNDVAAWILLSLAIALSGDNLSPTVSLWVFLSGCGFVIGAS  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
             L+VP IFK M+ RC EGEPVDE+Y+C  LAAVL AGFVTD IGIHA+FGAFVIGVLVPK+
Sbjct  241   LIVPPIFKRMSQRCHEGEPVDEMYICGTLAAVLAAGFVTDIIGIHAMFGAFVIGVLVPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP A  LVEKVEDLVSGLFLPLYFVSSGLKTNVATIQG QSWGLLVLVIFTAC GKILGT
Sbjct  301   GPFAGVLVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGIQSWGLLVLVIFTACLGKILGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
              +VS L +IP +EA+ LGFLMN+KGLVELIVLNIGKDR VLNDQ FAIM+LMALFTTF+T
Sbjct  361   FIVSLLWKIPKREALALGFLMNSKGLVELIVLNIGKDRKVLNDQIFAIMILMALFTTFMT  420

Query  1398  TPIVIALYKPAKLA-VTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEK  1222
             TP+V+A+YKPA+ A  ++YK+R ++RK+ + QLRIL CFHS RNIPS+INL+EASRGTE+
Sbjct  421   TPLVLAVYKPAEKARKSDYKHRRVERKNANTQLRILACFHSSRNIPSIINLLEASRGTER  480

Query  1221  SGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKV  1042
                  VYAMHL+E SER SAILM HKAR NGLPFWN +G+ + +  +VVAFE F+ LS+V
Sbjct  481   GERLSVYAMHLIEFSERPSAILMVHKARHNGLPFWN-KGQRS-ANHVVVAFEAFQQLSQV  538

Query  1041  SIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLE  862
             S++P T+IS+ + MH+DI  +AE K +A+IILP+HK+ ++DG FE+TR +   VN+RVLE
Sbjct  539   SVQPMTSISSFTDMHDDICITAERKDIAIIILPYHKNLRLDGSFESTRPDFHLVNKRVLE  598

Query  861   GAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVA  682
              A CSVGI VDRGLGG++ +SASNV ++ITVL+FGG DDREALAYGARM EHPG+ L V 
Sbjct  599   HASCSVGIFVDRGLGGSAQISASNVSFSITVLFFGGGDDREALAYGARMAEHPGVELTVI  658

Query  681   RFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAE  502
             RF L+ ++  +   + +   G+ +    S DE  LA F+   S +SS+KYEEK V++ +E
Sbjct  659   RFLLELDS--SEEIVRIDTEGTLAAALVSADEKILADFRTSISEDSSIKYEEKNVRNVSE  716

Query  501   TMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQ  322
             T+  IR Y+RC+L VVGRMP   +  A+ ++ +CPELGP+G+ L+  EFSTTASVLVVQQ
Sbjct  717   TITIIRDYSRCSLFVVGRMPNAAVALALSQRIDCPELGPIGSFLTSPEFSTTASVLVVQQ  776

Query  321   YRTE  310
             Y  +
Sbjct  777   YYDQ  780



>ref|XP_003611042.1| Cation proton exchanger [Medicago truncatula]
 gb|AES94000.1| cation/H+ exchanger 3 [Medicago truncatula]
Length=803

 Score =   964 bits (2492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/806 (67%), Positives = 642/806 (80%), Gaps = 7/806 (1%)
 Frame = -1

Query  2658  MGSNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M SN T   VCP PM+  SNG FQGD PLDYALPL I+QICLV+++TR LAYLL PLRQP
Sbjct  1     MTSNTTSGNVCPPPMQPASNGVFQGDHPLDYALPLAILQICLVLVVTRGLAYLLNPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEI+GG+LLGPSA GR++ YL+A+FP KSL VLDTLA+LGL+FFLFL G+ELDPKSL
Sbjct  61    RVIAEIVGGILLGPSALGRNKGYLHAVFPPKSLPVLDTLANLGLIFFLFLAGIELDPKSL  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             R+TG + L+IA+AGISLPF LGIG+SF+L+ TIAKGV+   FLV+MGVALSITAFPVLAR
Sbjct  121   RKTGGRVLAIAIAGISLPFALGIGSSFVLQRTIAKGVNTSAFLVYMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTT VG+MAMSAAAVNDVAAWILLALA+ALSG   SP +SLWV L G GFV+ 
Sbjct  181   ILAELKLLTTSVGRMAMSAAAVNDVAAWILLALAVALSGNSQSPFVSLWVFLSGCGFVVC  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
              IL+V  IFKWMA +C EGEPVDE+Y+CA LAAVL AGFVTD IGIHA+FGAFV G+LVP
Sbjct  241   SILIVLPIFKWMAQQCHEGEPVDELYICATLAAVLAAGFVTDAIGIHAMFGAFVFGILVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             KDG  A ALVEK+EDLVSGL LPLYFVSSGLKT++ATIQG QSWGLLV V FTACFGKI+
Sbjct  301   KDGAFAGALVEKIEDLVSGLLLPLYFVSSGLKTDIATIQGLQSWGLLVFVTFTACFGKIV  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GTI+VS +C++PF E++ LGFLMN+KGLVELIVLNIGKDR VLNDQTFAIMVLMAL TTF
Sbjct  361   GTIVVSLICKVPFNESLVLGFLMNSKGLVELIVLNIGKDRKVLNDQTFAIMVLMALITTF  420

Query  1404  ITTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             +TTP V+A YK  K   + YKYRTI+RK+   QLRIL CFH  RNIPSLINLIEASRG +
Sbjct  421   MTTPFVLAAYK-RKERKSNYKYRTIERKNADGQLRILACFHGSRNIPSLINLIEASRGIK  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             K     VYAMHL E  ERSS+ILM  K R+NGLPFW+ +G   DS  ++VAFE ++ LS+
Sbjct  480   KHDALCVYAMHLKEFCERSSSILMAQKVRQNGLPFWD-KGRHGDSLHVIVAFEAYQKLSQ  538

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             V +RP  AIS+M+++HEDI  +A+ KR A+IILPFHK Q++DG  +  RN+ R VN+RVL
Sbjct  539   VFVRPMIAISSMANIHEDICTTADRKRAAVIILPFHKQQRVDGSLDIIRNDFRLVNKRVL  598

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             E APCSVGI VDRGLGG+ HVSASNV Y I VL+FGG DDREALAYGARM EHPGI LVV
Sbjct  599   EHAPCSVGIFVDRGLGGSCHVSASNVSYCIAVLFFGGGDDREALAYGARMAEHPGIQLVV  658

Query  684   ARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAA  505
               F ++P  AG   K+DV  S S++    S D +FLA FK + + + S+ YEE++VK A 
Sbjct  659   IHFLVEPNIAGKITKVDVGDSSSNNSISDSEDGEFLAEFKLKTANDDSIIYEERIVKDAE  718

Query  504   ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQ  325
             ET+  IR  N CNL +VGR P GE+  A+++  ECPELGP+G LL+ ++F TTASVLV+Q
Sbjct  719   ETVATIREINFCNLFLVGRRPAGELGFALERS-ECPELGPVGGLLASQDFRTTASVLVMQ  777

Query  324   QYRTELSKNGLK--EDDSVDGDYESA  253
             QY   +  N +   E+ S DGD ES+
Sbjct  778   QYHNGVPINFVPEMEEHSRDGDTESS  803



>ref|XP_010533613.1| PREDICTED: cation/H(+) antiporter 18-like [Tarenaya hassleriana]
Length=808

 Score =   962 bits (2488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/797 (67%), Positives = 644/797 (81%), Gaps = 5/797 (1%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CPAPMKATSNG FQGD+P+D+ALPL I+QIC+VV LTR LAYLLRPLRQPRVIAE+IGG+
Sbjct  12    CPAPMKATSNGVFQGDNPIDFALPLAILQICIVVALTRGLAYLLRPLRQPRVIAEVIGGI  71

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             +LGPS  GRS+ YLN IFP KSLTVL+TLA+LG+LFFLFL GLE+D  SLRRTGKKAL+I
Sbjct  72    MLGPSLLGRSKGYLNTIFPSKSLTVLETLANLGILFFLFLAGLEIDTGSLRRTGKKALAI  131

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             A AGISLPF +GIG+SF+L+ATI+KGV    FL+FMGVALSITAFPVLARILAELKLLTT
Sbjct  132   AAAGISLPFVMGIGSSFVLKATISKGVDGTAFLIFMGVALSITAFPVLARILAELKLLTT  191

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             D+G++AMSAAAVNDVAAWILLALAIALSG+  SPL+SLWV L G GFV L IL++P +F+
Sbjct  192   DIGRLAMSAAAVNDVAAWILLALAIALSGSNTSPLVSLWVFLGGCGFVTLAILIIPPVFR  251

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             W+ SRC EGEP++E Y+CA L  VL  GFVTD +GIHA+FGAFV+GVL+PK+GP A ALV
Sbjct  252   WIGSRCHEGEPINETYICAALTIVLACGFVTDAVGIHAMFGAFVVGVLIPKEGPFAGALV  311

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVSGLFLPLYFV+SGLKTNVATIQG QSWGLLVLVIFTACFGKI+GT+ VS   +
Sbjct  312   EKVEDLVSGLFLPLYFVASGLKTNVATIQGLQSWGLLVLVIFTACFGKIVGTLAVSLALK  371

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +P +EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTFITTPIV+A+Y
Sbjct  372   VPTREAVALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFITTPIVVAVY  431

Query  1374  KPAKLAVT--EYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVY  1201
             KPA+ +    +YK+RTI+R+ PS QLRIL+CFH  RNIPS+INL+EASRG EK     VY
Sbjct  432   KPARRSKKPDDYKHRTIERESPSSQLRILSCFHGTRNIPSMINLLEASRGIEKGEDLCVY  491

Query  1200  AMHLMELSERSSAILMCHKARKNGLPFWNTRG-EPTDSTEIVVAFETFEHLSKVSIRPST  1024
             A+HL E SERSSAILM +K RKNGLPFWN +    +++ ++VVAF+ F+ LS+V++RP T
Sbjct  492   ALHLREFSERSSAILMVNKVRKNGLPFWNRKSVGGSNADQVVVAFQAFQQLSRVTVRPMT  551

Query  1023  AISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSV  844
             AIS++S +HEDI  +A  KR A+IILPFHKHQ++DG  ETTR++   VNR+VL+ APCSV
Sbjct  552   AISSLSDIHEDICTTAAKKRAAIIILPFHKHQRLDGSLETTRSDYGWVNRKVLQNAPCSV  611

Query  843   GILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDP  664
             GI VDRGLGG++HVSA +V Y++ VL+FGG DD EALAYG RM EHPGI L V RF + P
Sbjct  612   GIFVDRGLGGSTHVSAKDVAYSVVVLFFGGRDDHEALAYGLRMAEHPGIALTVIRFIVSP  671

Query  663   ETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVV-KSAAETMEAI  487
             E +G  V++DV     ++   +S DE+ L+  ++R S   S+K+EEK V K+A +   A+
Sbjct  672   EKSGEIVRVDVKNDDPAARNFRS-DEEVLSEIRKRASVEESIKFEEKRVGKAATDVASAV  730

Query  486   RGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTEL  307
                 R +L +VGRMPEGEI  A+ +K ECPELGP+G+LL   E  T ASVLVVQQY    
Sbjct  731   EEVRRSSLFLVGRMPEGEIAVALREKIECPELGPIGSLLISPESPTAASVLVVQQYSGGR  790

Query  306   SKNGLKEDDSVDGDYES  256
             +   L E  S   + +S
Sbjct  791   AAPDLAEKPSSSPEKDS  807



>ref|XP_010436112.1| PREDICTED: cation/H(+) antiporter 18-like [Camelina sativa]
 ref|XP_010436113.1| PREDICTED: cation/H(+) antiporter 18-like [Camelina sativa]
Length=806

 Score =   962 bits (2488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/781 (67%), Positives = 634/781 (81%), Gaps = 4/781 (1%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
             +N T  CPAPMKATSNG FQGD+P+D+ALPL I+QI +V++LTR+LAYLLRPLRQPRVIA
Sbjct  4     TNSTKACPAPMKATSNGVFQGDNPIDFALPLAILQIVIVIVLTRLLAYLLRPLRQPRVIA  63

Query  2472  EIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTG  2293
             E+IGG++LGPS  GRS+ +L+A+FPKKSLTVL+TLA+LGLLFFLFL GLE+D K+LR TG
Sbjct  64    EVIGGIMLGPSLLGRSKVFLDAVFPKKSLTVLETLANLGLLFFLFLAGLEIDTKALRHTG  123

Query  2292  KKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAE  2113
              KAL IA+AGISLPF LGIG+SF+L+ATI+KGV    FLVFMGVALSITAFPVLARILAE
Sbjct  124   NKALGIAMAGISLPFALGIGSSFVLKATISKGVDSTAFLVFMGVALSITAFPVLARILAE  183

Query  2112  LKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILV  1933
             LKLLTT++G++AMSAAAVNDVAAWILLALAIALSG+  SPL+SLWV L G  FV+    +
Sbjct  184   LKLLTTEIGRLAMSAAAVNDVAAWILLALAIALSGSNTSPLVSLWVFLAGCAFVIGAAFI  243

Query  1932  VPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
             +P IF+W+A RC EGEP++E Y+CA LA VL  GF+TD IGIH++FGAFV+GVL+PK+GP
Sbjct  244   IPPIFRWIARRCHEGEPIEETYICATLAVVLVCGFITDAIGIHSMFGAFVVGVLIPKEGP  303

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
              A ALVEKVEDLVSGLFLPLYFV+SGLKTNVATIQGAQSWGLLVLV FTACFGKI+GT+ 
Sbjct  304   FAGALVEKVEDLVSGLFLPLYFVASGLKTNVATIQGAQSWGLLVLVTFTACFGKIVGTLG  363

Query  1572  VSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTP  1393
             VS   +IP +EAITLGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTFITTP
Sbjct  364   VSLAFKIPMREAITLGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFITTP  423

Query  1392  IVIALYKPAKLAVT--EYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             +V+A+YKPA+ A    EYK RT++R++ + QLRILTCFH   +IPS+INL+EASRG EK 
Sbjct  424   VVMAVYKPARRAKKEGEYKNRTVERENTNTQLRILTCFHGAGSIPSIINLLEASRGIEKG  483

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
              G  VYA+HL ELSERSSAILM HK RKNG+PFWN RG   D+ ++VVAF+ F+ LS+V+
Sbjct  484   EGLCVYALHLRELSERSSAILMVHKVRKNGMPFWNRRGVNADADQVVVAFQAFQQLSRVN  543

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             +RP TAIS+MS +HEDI  +A  KR A++ILPFHKHQ++DG  ETTR + R VNRRVL  
Sbjct  544   VRPMTAISSMSDIHEDICTTAARKRAAIVILPFHKHQQLDGSLETTRGDYRWVNRRVLLE  603

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             APCSVGI VDRGLGG+S VSA +V Y++ VL+FGG DDREALAYG RM EHPGI L V R
Sbjct  604   APCSVGIFVDRGLGGSSQVSAQDVSYSVVVLFFGGRDDREALAYGLRMAEHPGIVLTVFR  663

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAA-E  502
             F + PE     V         ++ +    DE+ ++  ++++S + S+K+ EK V++AA +
Sbjct  664   FVVAPERV-GEVVNVEVGDNGNNEKNLKWDEEIMSEIRKKSSVDESIKFVEKRVENAAVD  722

Query  501   TMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQ  322
                AI    R NL +VGR+P GEI  A+ +  ECPELGP+G+LL   E ST ASVLV+QQ
Sbjct  723   VRSAIEEVRRSNLFLVGRVPGGEIALAIRENSECPELGPVGSLLISPESSTRASVLVIQQ  782

Query  321   Y  319
             Y
Sbjct  783   Y  783



>gb|KDP25352.1| hypothetical protein JCGZ_20508 [Jatropha curcas]
Length=802

 Score =   962 bits (2488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/805 (68%), Positives = 654/805 (81%), Gaps = 14/805 (2%)
 Frame = -1

Query  2658  MGSNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M SN T+   CP PMKATSNG FQGDSPL+Y+LPL I+QIC+V++LTR LA+LLRPLRQP
Sbjct  1     MASNTTIGLKCPGPMKATSNGVFQGDSPLNYSLPLAILQICMVIVLTRGLAFLLRPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEII G+LLGPSA GRSE +L+A+FP KSLTVLDTLA++GL++F+FLVGLELDPKSL
Sbjct  61    RVIAEIIAGILLGPSALGRSERFLHAVFPTKSLTVLDTLANIGLIYFMFLVGLELDPKSL  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             R+TGKK+L+IA+AGI+LPF +GIG+SFILRATIAKGV+   FL+FMGVALSITAFPVLAR
Sbjct  121   RQTGKKSLAIAIAGITLPFAMGIGSSFILRATIAKGVNGSSFLLFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTTD+G++AMSAAAVNDVAAW+LLALAIALSG+ +SPL+S WVLL G  FV+ 
Sbjct  181   ILAELKLLTTDLGRIAMSAAAVNDVAAWVLLALAIALSGSNNSPLVSFWVLLSGCVFVVC  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
              +++V  IFK M+ RC EGEP++E  VCA L  VL AGFVTD IGIHA+FG FVIGVLVP
Sbjct  241   SVVIVRPIFKLMSQRCHEGEPIEEQIVCATLVTVLAAGFVTDAIGIHAMFGGFVIGVLVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             K+GP A ALVEKVEDLVSGLFLPLYFVSSGLKTNVATI G QSWGLL LVIFTACFGKI+
Sbjct  301   KEGPFAHALVEKVEDLVSGLFLPLYFVSSGLKTNVATIHGLQSWGLLALVIFTACFGKIV  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GT LVS  C++PF+EA+ LG LMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTF
Sbjct  361   GTFLVSLSCKVPFREALALGLLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTF  420

Query  1404  ITTPIVIALYKPA-KLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             ITTP+V+A+YKPA K+ + +YKYRTI RK+ + QLRIL CFHS RN+PS+INL+EASRG 
Sbjct  421   ITTPLVMAVYKPARKVRMADYKYRTIDRKNSNTQLRILACFHSARNVPSIINLLEASRGI  480

Query  1227  EKSG-GFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHL  1051
             +K      VYA+HLMELSER SAILM HKARKNGLP WN +   +++  ++VAFE  E L
Sbjct  481   QKKAEALCVYALHLMELSERPSAILMVHKARKNGLPTWN-KDHRSNANHVIVAFEALEQL  539

Query  1050  SKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRR  871
             S+VS+RP TAIS+MS +HEDI A+AE KR A+IILPFHKHQ++DG  ETTR + R VNRR
Sbjct  540   SQVSVRPMTAISSMSDLHEDICATAERKRAAIIILPFHKHQRLDGSLETTRTDYRWVNRR  599

Query  870   VLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICL  691
             VLE APCSVGILVDRGLGGT+H+ AS V   I VL+FGGHDDREALAYGARM EHPGI L
Sbjct  600   VLENAPCSVGILVDRGLGGTTHIPASKVSCLIVVLFFGGHDDREALAYGARMAEHPGINL  659

Query  690   VVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKS  511
             +V RF + PE+    + +D+  + +++P     DE FL  FK++   + SV Y EK+V +
Sbjct  660   MVIRFLVAPESQDEIIPVDLEGNSNTTPGSW--DEVFLLEFKKKIVWDDSVNYIEKLVTN  717

Query  510   AAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLV  331
             AA  ++ IR  + CNL +VGR PEGEI+ A++++ EC ELG +G+ L+  +  T ASVLV
Sbjct  718   AAGIIDVIRESSHCNLFLVGRRPEGEILVALNRRNECSELGTVGSFLASSDSPTKASVLV  777

Query  330   VQQYRTEL-------SKNGLKEDDS  277
             VQQY  ++       + + L E DS
Sbjct  778   VQQYNDQVVSDLASETGDNLLEKDS  802



>ref|XP_004146577.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis sativus]
 ref|XP_004164367.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis sativus]
 gb|KGN53372.1| hypothetical protein Csa_4G050270 [Cucumis sativus]
Length=798

 Score =   961 bits (2484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/793 (69%), Positives = 646/793 (81%), Gaps = 17/793 (2%)
 Frame = -1

Query  2637  VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGG  2458
             VCP  MKATS+G FQGD+PL+YALPL I+QICLVVLLTR+L++LLRP+RQPRVIAEI+GG
Sbjct  15    VCPPAMKATSDGIFQGDNPLNYALPLAILQICLVVLLTRLLSFLLRPIRQPRVIAEIVGG  74

Query  2457  VLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALS  2278
             +LLGPSA GR+ AYL+ IFP +SLTVLDTLA+LGLLFFLFLVGLELD KSLRRTGK+A+ 
Sbjct  75    ILLGPSALGRNLAYLHTIFPPRSLTVLDTLANLGLLFFLFLVGLELDLKSLRRTGKRAMC  134

Query  2277  IALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLT  2098
             IA AGI+LPF LGIGTSFILR+TI+KGV++   LVFMGVALSITAFPVLARILAELKLLT
Sbjct  135   IAFAGITLPFVLGIGTSFILRSTISKGVNEAALLVFMGVALSITAFPVLARILAELKLLT  194

Query  2097  TDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIF  1918
             TDVG+MAMSAAAVNDVAAWILLALAIALSGTG+SPL+SLWV L G GF++ C   +P +F
Sbjct  195   TDVGRMAMSAAAVNDVAAWILLALAIALSGTGNSPLVSLWVFLSGAGFIIFCTFAIPPVF  254

Query  1917  KWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASAL  1738
             +WM+ RCSEGEPV E+Y+CA L+ VL AGF+TD IGIHALFGAFV+GVL+PK+GP A AL
Sbjct  255   QWMSERCSEGEPVKELYICATLSIVLAAGFMTDLIGIHALFGAFVVGVLIPKEGPFAGAL  314

Query  1737  VEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLC  1558
             VEKVEDLVSGLFLPLYFVSSGLKTNVATI+GA+SWGLLVLVIF ACFGKI+GT+ VS LC
Sbjct  315   VEKVEDLVSGLFLPLYFVSSGLKTNVATIKGAKSWGLLVLVIFNACFGKIVGTVSVSLLC  374

Query  1557  RIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIAL  1378
             ++PF E++ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMA+FTTFITTPIVIA+
Sbjct  375   KMPFSESLALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMAIFTTFITTPIVIAV  434

Query  1377  YKPAKLAV-TEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVY  1201
             YKPAK    + Y++RTI+RK+P+ +LRIL CFHS  NIP+ INLIEASRG EK  G  VY
Sbjct  435   YKPAKKHTKSNYQHRTIERKNPNSELRILACFHSYGNIPATINLIEASRGIEKKDGLCVY  494

Query  1200  AMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTA  1021
             A+HL EL+ERSSAILM HKARKNG+PFWN +G   DS +IVVAFE F  LS+VSIRP TA
Sbjct  495   ALHLTELTERSSAILMVHKARKNGVPFWN-KGR-VDSNQIVVAFEAFRQLSRVSIRPMTA  552

Query  1020  ISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVG  841
             ISA+S+MHEDI +SAE KR A+IILPFHKHQ++DG  ETTR + R VNR+VLE APCS+ 
Sbjct  553   ISALSNMHEDICSSAETKRAAVIILPFHKHQRLDGSLETTRTDYRSVNRKVLEQAPCSIA  612

Query  840   ILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPE  661
             IL+DRGLGG SHV+ASNV  T+TV +FGG DDREALA+G RM EHPGI L V RFT  P 
Sbjct  613   ILIDRGLGGGSHVNASNVSSTVTVFFFGGPDDREALAFGKRMSEHPGIRLHVVRFT--PS  670

Query  660   TAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRG  481
             T                    S D D        N   +S+ YEE+ V   ++ ++A++ 
Sbjct  671   T-----DFVTESVAVDVNNNSSEDSD------GDNKALTSIAYEERNVSKGSQAVDAMKE  719

Query  480   YNRCNLLVVGRMPEGEIVAAMDKK-GECPELGPLGNLLSCKEFSTTASVLVVQQYRTELS  304
             +N+ NL++VGR PEGE+V +++   G+C ELGP+G +L+  EFST ASVLVVQQ+R E S
Sbjct  720   FNKSNLILVGRCPEGEVVRSLNTNGGDCSELGPVGGVLALPEFSTMASVLVVQQFRGEQS  779

Query  303   KNGLKEDDSVDGD  265
                ++   +  G+
Sbjct  780   VFPMESTSTSKGE  792



>ref|XP_008798688.1| PREDICTED: cation/H(+) antiporter 18-like [Phoenix dactylifera]
Length=808

 Score =   960 bits (2482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/782 (70%), Positives = 632/782 (81%), Gaps = 8/782 (1%)
 Frame = -1

Query  2652  SNGTV-VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVI  2476
             +N TV  CP P  ATSNG FQGD+PL  ALPL I+QICLV+++TR LA+LLRPLRQPRVI
Sbjct  2     ANVTVNACPKPPAATSNGVFQGDNPLHSALPLAILQICLVIVITRCLAFLLRPLRQPRVI  61

Query  2475  AEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRT  2296
             AEIIGG+LLGPSA GRS+A+ + +FP  SLTVLDTLA+LGLLFFLFLVGLEL+PKSLRRT
Sbjct  62    AEIIGGILLGPSALGRSKAFRHVVFPPSSLTVLDTLANLGLLFFLFLVGLELEPKSLRRT  121

Query  2295  GKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILA  2116
             GK+A+ IA+AGISLPF LGIGTS +LR TI+KGV   PF VF+GVALSITAFPVLARILA
Sbjct  122   GKRAVGIAIAGISLPFVLGIGTSVVLRHTISKGVQGAPFQVFIGVALSITAFPVLARILA  181

Query  2115  ELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCIL  1936
             ELKLLTTD+G+MAMSAAAVNDVAAWILLALAIALSG+ HSPLISLWVLLCG GFVL CI+
Sbjct  182   ELKLLTTDIGRMAMSAAAVNDVAAWILLALAIALSGSSHSPLISLWVLLCGVGFVLFCII  241

Query  1935  VVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDG  1756
             +V  I  W+A R  EGEP+ EIYVCA LAAVL A FVTD IGIHALFGAF+IGVLVPKDG
Sbjct  242   LVRPILAWIARRTPEGEPIGEIYVCATLAAVLSASFVTDAIGIHALFGAFIIGVLVPKDG  301

Query  1755  PLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTI  1576
             P A A+VEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVI T+C GKI GT+
Sbjct  302   PFAGAMVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVILTSCLGKIAGTV  361

Query  1575  LVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITT  1396
              VS  CR+PF+EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAI VLMAL TTFITT
Sbjct  362   GVSIACRMPFREALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIFVLMALVTTFITT  421

Query  1395  PIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSG  1216
             P+V A+YKPA+ + T YK+R I+R + S QLRIL CFHS RNIP++INLIEA RGT +  
Sbjct  422   PLVTAVYKPARKSSTVYKHRRIERIESSTQLRILACFHSTRNIPTIINLIEACRGTNRRE  481

Query  1215  GFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSI  1036
             G  VYAMHLMELSER SAILM HKARKNGLPFWN   + +   ++VVAFE FE LS VSI
Sbjct  482   GLCVYAMHLMELSERPSAILMVHKARKNGLPFWNKTPQ-SGHDQVVVAFEAFERLSNVSI  540

Query  1035  RPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGA  856
             RP TAISA++ +HEDI ASAE K+ A+IILPFHKHQ++DG  E TR++ R VNR+VLE A
Sbjct  541   RPMTAISALTDIHEDICASAERKKAAVIILPFHKHQRLDGTLEMTRHDFRLVNRKVLEHA  600

Query  855   PCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF  676
             PCSVGILVDRGLGGT+HVSAS+V  +IT L+FGG DDREAL Y  RM EHPGI L V  F
Sbjct  601   PCSVGILVDRGLGGTTHVSASDVSSSITALFFGGPDDREALTYATRMAEHPGIQLTVLHF  660

Query  675   TLDPETAGTsvkldvspsgssspeekSR--DEDFLAAFKQRNSTNSSVKYEEKVVKSAAE  502
             +   E+        ++   ++    + R  DE+ L  F+ +   +S ++YEE+VV S  E
Sbjct  661   S---ESGHGFQGESIAVDVNADSSSERRLADEEVLNEFRNKTRKDSVIRYEERVVASRDE  717

Query  501   TMEAIRGYNRCNLLVVGRMPEGEIVAAM-DKKGECPELGPLGNLLSCKEFSTTASVLVVQ  325
              + AI+  +R +L++VGR PEG   AA+  ++ ECPELGP+G LL+   FSTTASVLVVQ
Sbjct  718   IVAAIQTVSRSDLILVGRRPEGAAAAALVTERSECPELGPVGGLLTSPSFSTTASVLVVQ  777

Query  324   QY  319
             QY
Sbjct  778   QY  779



>gb|EPS69438.1| hypothetical protein M569_05328 [Genlisea aurea]
Length=802

 Score =   958 bits (2477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/793 (67%), Positives = 635/793 (80%), Gaps = 16/793 (2%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
             +N TV CPAPM ATSNG  QGD PL ++LPL+I+QIC+V +LTR+LA+ LRP+RQPRV+A
Sbjct  4     TNVTVKCPAPMTATSNGVLQGDDPLHFSLPLVILQICIVFVLTRLLAFFLRPMRQPRVVA  63

Query  2472  EII---GGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLR  2302
             EII   GG+LLGPSA GRS  +LN +FP +S+TVLDTLA+LGLLFFLFLVG+ELDPK+LR
Sbjct  64    EIIVSPGGILLGPSALGRSSKFLNTVFPARSITVLDTLANLGLLFFLFLVGVELDPKALR  123

Query  2301  RTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARI  2122
             RTGKKALSIA AGISLPF LG+ TSF L++TI+KG  + PF+VFMGVALSITAFPVLARI
Sbjct  124   RTGKKALSIAAAGISLPFALGLATSFALKSTISKGAHEAPFVVFMGVALSITAFPVLARI  183

Query  2121  LAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLC  1942
             LAELKLLTTD+G+MAMSAAAVNDV AWILLALAIALSGT  SP+++LWVLLC +GF+ LC
Sbjct  184   LAELKLLTTDIGRMAMSAAAVNDVVAWILLALAIALSGTSRSPIVALWVLLCASGFIALC  243

Query  1941  ILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPK  1762
              L++P+IFKW+A++C  GEPV+E+YVC  L  VL AGFVTD IGIHALFGAFV+GVLVPK
Sbjct  244   ALILPKIFKWIATQCPSGEPVNELYVCGTLVTVLAAGFVTDAIGIHALFGAFVVGVLVPK  303

Query  1761  DGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILG  1582
             +G  A +LVEKVEDLVSGLFLPLYFVSSGLKTNVA+I GAQSWGLLVLVI  ACFGKI G
Sbjct  304   EGAFAESLVEKVEDLVSGLFLPLYFVSSGLKTNVASISGAQSWGLLVLVICAACFGKISG  363

Query  1581  TILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFI  1402
             T++VS L R+P ++AITLGFLMNTKGLVELIVLNIGKDRGVLN+QTF+I+VLMALFTTFI
Sbjct  364   TVIVSLLWRVPIRDAITLGFLMNTKGLVELIVLNIGKDRGVLNEQTFSILVLMALFTTFI  423

Query  1401  TTPIVIALYKPAKLAV-TEYKYRTIQRKDPSK-QLRILTCFHSRRNIPSLINLIEASRGT  1228
             TTPIV+ +YKP +  + T YK+RTIQRK+ +  QLRI+TCFHS  N+P+LINL+E SRG 
Sbjct  424   TTPIVMKIYKPREATIKTSYKHRTIQRKETNNTQLRIITCFHSMSNVPTLINLMEISRGK  483

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWN-TRGEPTDSTEIVVAFETFEHL  1051
              + GG +VYAMHLMELSERSSAILM HKAR+NG+PFWN  R + +DS +IVVAFE F+ L
Sbjct  484   GRKGGLRVYAMHLMELSERSSAILMVHKARRNGMPFWNKNRYQSSDSNQIVVAFEAFQQL  543

Query  1050  SKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRR  871
             S+VSI P+T IS M ++H+DI +SA  KRVA+IILPFHK  ++DG  ETTR++LR+ N+ 
Sbjct  544   SQVSISPTTVISPMPTVHQDICSSAANKRVALIILPFHKQLRLDGQLETTRSDLRYANKN  603

Query  870   VLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICL  691
             VL  APCSVGILVDRGLGG+SHVSASNV+  +T L+FGG DDREAL+YGA M EH GI L
Sbjct  604   VLNQAPCSVGILVDRGLGGSSHVSASNVNCKVTALFFGGPDDREALSYGALMAEHTGIYL  663

Query  690   VVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKS  511
              V RF  DP  + T           S+      D +FL    +  S + S  YEE  + S
Sbjct  664   NVIRFVPDPSFSET--------QHHSTTLNDDEDGEFLKRICKIASMDDSTSYEEVSIGS  715

Query  510   AAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDK--KGECPELGPLGNLLSCKEFSTTASV  337
             AA  +E IR    CNL VVGR P+G+I  A++   + EC ELGP+GNLL      T ASV
Sbjct  716   AAAAIETIRNAASCNLFVVGRTPQGKIADALNDGMRKECAELGPIGNLLISPALKTMASV  775

Query  336   LVVQQYRTELSKN  298
             L++QQYR +L+ +
Sbjct  776   LIIQQYRNQLTGD  788



>ref|XP_004146578.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis sativus]
 ref|XP_004164368.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis sativus]
 gb|KGN53373.1| hypothetical protein Csa_4G050280 [Cucumis sativus]
Length=805

 Score =   954 bits (2467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/779 (69%), Positives = 640/779 (82%), Gaps = 5/779 (1%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CPA MKATSNG FQGD+PLD+ALPL I+QICLVV+LTR+L +  RPLRQPRVIAEI+GG+
Sbjct  11    CPAVMKATSNGVFQGDNPLDFALPLAILQICLVVILTRLLGFAFRPLRQPRVIAEIVGGI  70

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GRS+ +L+ +FP +SL+VLDTLA+LGLLFFLFLVGLELD KSLRRTGK A++I
Sbjct  71    LLGPSALGRSQEFLHTVFPARSLSVLDTLANLGLLFFLFLVGLELDLKSLRRTGKGAMAI  130

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             A+AGI+LPF LGIGTS++LR+TI+KGVS  PFLVFMGVALSITAFPVLARILAELKLLTT
Sbjct  131   AVAGITLPFVLGIGTSYVLRSTISKGVSGPPFLVFMGVALSITAFPVLARILAELKLLTT  190

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             +VG+MAMSAAAVND+AAWILLALAIALSGTG SPL+SLWV LCG GFVL C   +P +F+
Sbjct  191   NVGRMAMSAAAVNDIAAWILLALAIALSGTGRSPLVSLWVFLCGAGFVLFCFFALPPVFQ  250

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             W++ RCS+GEPV E+Y+CAIL+ VL AGFVTD IGIHALFGAFV+GVLVPKDGPLA ALV
Sbjct  251   WISRRCSDGEPVSELYICAILSTVLAAGFVTDLIGIHALFGAFVVGVLVPKDGPLAGALV  310

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVSGLFLPLYFVSSGLKTN+ATI+GAQSWGLLVLV+FTACFGKI+GTI V+   +
Sbjct  311   EKVEDLVSGLFLPLYFVSSGLKTNIATIKGAQSWGLLVLVVFTACFGKIIGTISVALCFK  370

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +PFQE++ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAI+VLMA+ TTFITTPIV+A+Y
Sbjct  371   MPFQESVALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAILVLMAIITTFITTPIVMAVY  430

Query  1374  KPAKL-AVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSG-GFKVY  1201
             KPAK  + +EY  RTI+R +P+ +LR+L CFHS  NIPS++NLIE SRG E  G    VY
Sbjct  431   KPAKRKSKSEYINRTIERDEPNSELRVLACFHSVNNIPSILNLIEVSRGKEGRGRRLCVY  490

Query  1200  AMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTA  1021
             AMHLMEL+ERSSAI+M ++ARKNGLPFWN +G  +DS +I+VAFE F+ LS+VSIRP TA
Sbjct  491   AMHLMELTERSSAIVMVNRARKNGLPFWN-KGGKSDSDQIIVAFEAFQQLSRVSIRPMTA  549

Query  1020  ISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVG  841
             IS  S MHED+  SAE KR A+IILPFHKHQ+ DG  ETTR + R VN++VLE  PCSVG
Sbjct  550   ISPFSDMHEDVCNSAERKRAAIIILPFHKHQRFDGSLETTRTDFRWVNQKVLEQPPCSVG  609

Query  840   ILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPE  661
             ILVDRGLGG SH+ ASNV  TITV +FGG DDREALAYG RMVEHPGI L +    L   
Sbjct  610   ILVDRGLGGGSHICASNVSSTITVFFFGGRDDREALAYGRRMVEHPGITLNIVHI-LPSS  668

Query  660   TAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRG  481
                T   +    S   +      D+  L  F  +   + S++YEE+ V    +T+E IR 
Sbjct  669   DMATESTVIDMHSKDDTNTSTLMDQKVLMEFNVKKIDDESIRYEERTVTKYNDTIEVIRE  728

Query  480   YNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTEL  307
             ++RCNL++VGR PEG+++ ++  K G+CPELGP+GNLL+  E ST+ASVLVVQQ+R  L
Sbjct  729   FSRCNLILVGRAPEGQVIESLHFKGGDCPELGPIGNLLTSTEISTSASVLVVQQFRGPL  787



>ref|XP_010043343.1| PREDICTED: cation/H(+) antiporter 19 [Eucalyptus grandis]
Length=799

 Score =   954 bits (2466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/794 (68%), Positives = 629/794 (79%), Gaps = 17/794 (2%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M  N TV CP PMKATSNGSFQGDSPLDYALPL+I+QICLVV  TR+LA +LRPLRQPRV
Sbjct  1     MAGNATV-CPKPMKATSNGSFQGDSPLDYALPLVILQICLVVAFTRLLALILRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEIIGG+LLGPSA GRSE +L+A+FP +SLTVLDTLA++GLL+FLFLVGLELD  S++R
Sbjct  60    IAEIIGGILLGPSALGRSEKFLHAVFPTQSLTVLDTLANIGLLYFLFLVGLELDISSIKR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKAL+IALAGISLPF LGIGTS +LR+TI+KGVSQGPFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKKALAIALAGISLPFILGIGTSVVLRSTISKGVSQGPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG++AMSAAAVNDVAAWILLALAIALSG+  SPL+SLWVLLCG  FVLL I
Sbjct  180   AELKLLTTDVGRIAMSAAAVNDVAAWILLALAIALSGSNTSPLVSLWVLLCGVAFVLLAI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
               +     WMA R  EGEPV E+Y+C  L+ VL AGFVTDTIGIHALFGAFV+G+++PKD
Sbjct  240   FALNPALAWMARRSPEGEPVKELYICITLSLVLAAGFVTDTIGIHALFGAFVVGIVMPKD  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP A  L+EK+EDLVSGL LPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKI+GT
Sbjct  300   GPFAGVLIEKIEDLVSGLLLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             + VS LC++PF+EA+TLGFLMNTKGLVELIVLNIGKDR VLNDQTFA++VLMALFTTFIT
Sbjct  360   LSVSMLCKVPFKEALTLGFLMNTKGLVELIVLNIGKDRKVLNDQTFAVLVLMALFTTFIT  419

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             TP+V A+YKPA+  V  YK+RTI+RKD   +LR+L CFHS RNIP++INLIE+SRGT K 
Sbjct  420   TPVVTAVYKPARRGV-PYKHRTIRRKDLDTELRLLVCFHSTRNIPTMINLIESSRGTRKR  478

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
             G   VYAMHLMELSERSSAI M HKAR+NGLPFWN   E  D  ++V+AFE ++ LS V+
Sbjct  479   GRLSVYAMHLMELSERSSAISMVHKARRNGLPFWNKVRE--DQDQMVIAFEAYQQLSSVT  536

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             +RP TAIS +S++HEDI  SA  KR AMI+LPFHKHQ++DG  E+  +  + VN+RVL  
Sbjct  537   VRPMTAISPLSTIHEDICTSAHQKRSAMILLPFHKHQRLDGVMESLGHSFQVVNQRVLRY  596

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             APCSVGILVDRGLGGT+ VSAS+V YTI V +FGG DD EAL +G RM EHPGI L V +
Sbjct  597   APCSVGILVDRGLGGTTQVSASDVSYTIAVPFFGGPDDHEALTFGVRMAEHPGIVLSVVK  656

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAET  499
             F   P TA             ++ E    D+            N S+ YEE+ V +  + 
Sbjct  657   FVFPPGTA------------VAAQESSEDDDSPNDLLDVTTGKNESITYEERTVGTKEDI  704

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             + A++  +RCNL +VGR P    V  +D+  +CPELG +G  L+   FSTTASVLVVQQY
Sbjct  705   VAALKSMSRCNLFIVGRTPSTAPV-LVDRTSDCPELGHVGGYLASSGFSTTASVLVVQQY  763

Query  318   RTELSKNGLKEDDS  277
                 S + L E+ +
Sbjct  764   NPLGSLHPLVEEQT  777



>emb|CDY39729.1| BnaA04g11240D [Brassica napus]
Length=787

 Score =   951 bits (2458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/784 (67%), Positives = 629/784 (80%), Gaps = 20/784 (3%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +N T  CPA MKATSNG FQGD+P+D+ALPL I+QI +V++LTR+LAYLLRPLRQPRV
Sbjct  1     MAAN-TSACPAFMKATSNGVFQGDNPIDFALPLAILQIVIVIILTRLLAYLLRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             +AE+IGG++LGPS  GRS+A+L+A+FPK SLTVL+TLA+LGLLFFLFL GLE+D KSLR 
Sbjct  60    VAEVIGGIMLGPSLLGRSKAFLDAVFPKNSLTVLETLANLGLLFFLFLAGLEIDTKSLRN  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKAL IALAGISLPF LGIG+SF+LRATI+KGV    FL+FMGVALSITAFPVLARIL
Sbjct  120   TGKKALGIALAGISLPFALGIGSSFVLRATISKGVDSVAFLIFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTT++G++AMSAAAVNDVAAWILLALAIALSG+  S L+SLWV L G GFV+  I
Sbjct  180   AELKLLTTEIGRLAMSAAAVNDVAAWILLALAIALSGSDTSALVSLWVFLAGCGFVVAAI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              ++P +F+W+A RC EGEP++E Y+CA LA VL  GF+TD IGIH++FGAFV+GVL+PK+
Sbjct  240   CIIPPVFRWIARRCHEGEPIEETYICATLAVVLVCGFITDAIGIHSMFGAFVVGVLIPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP A AL+EKVEDLVSGLFLPLYFV+SGLKTNVATIQGAQSWGLLVLV FTACFGKI+GT
Sbjct  300   GPFAGALIEKVEDLVSGLFLPLYFVASGLKTNVATIQGAQSWGLLVLVTFTACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             + VS   +IP +EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTF+T
Sbjct  360   LGVSLAFKIPMREAVALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFMT  419

Query  1398  TPIVIALYKPAKLAVT--EYKYRTIQRKDPSK-QLRILTCFHSRRNIPSLINLIEASRGT  1228
             TPIV+A+YKPA+ A    EYK+RT++R + +  QLRILTCFH   +IPS+INL+EASRG 
Sbjct  420   TPIVMAVYKPARRAKKEREYKHRTVERDNNTNTQLRILTCFHGAGSIPSMINLLEASRGI  479

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
             EK  G  VYA+HL ELSERSSAILM HK RKNG+PFWN RG   ++ ++VVAF+ F+ LS
Sbjct  480   EKGEGLCVYALHLRELSERSSAILMVHKVRKNGMPFWNRRGNNNNADQVVVAFQAFQQLS  539

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +V++RP TAIS+MS +HEDI  +A  KR +++ILPFHKHQ++DG  ETTR + R VNRRV
Sbjct  540   RVNVRPMTAISSMSDIHEDICTTAARKRASIVILPFHKHQQVDGSLETTRGDYRWVNRRV  599

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             L  APCSVGI VDRGLGG+S VSA +V Y++ VL+FGG DDREALAYG RM EHPGI L 
Sbjct  600   LVEAPCSVGIFVDRGLGGSSQVSAQDVSYSVVVLFFGGRDDREALAYGLRMAEHPGISLT  659

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSA  508
             V RF   PE  G   +                DE+ ++  ++++S + SVK  EK V++A
Sbjct  660   VFRFVTSPERDGEITRS---------------DEEVMSEIRKKSSVDESVKLVEKRVENA  704

Query  507   A-ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLV  331
             A +   AI    R NL +VGRMP GEI  A+ +  EC ELGP+G+LL   E  T ASVLV
Sbjct  705   AVDVRSAIEEMRRSNLFLVGRMPGGEIALAIRENSECAELGPVGSLLISTESPTRASVLV  764

Query  330   VQQY  319
             +QQY
Sbjct  765   IQQY  768



>ref|XP_009140104.1| PREDICTED: cation/H(+) antiporter 18 [Brassica rapa]
Length=800

 Score =   950 bits (2455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/784 (67%), Positives = 638/784 (81%), Gaps = 7/784 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +N T  CPA MKATSNG FQGD+P+D+ALPL I+QI +V++LTR+LAYLLRPLRQPRV
Sbjct  1     MAAN-TSACPAFMKATSNGVFQGDNPIDFALPLAILQIVIVIILTRLLAYLLRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             +AE+IGG++LGPS  GRS+A+L+A+FPKKSLTVL+TLA+LGLLFFLFL GLE+D K+LR 
Sbjct  60    VAEVIGGIMLGPSLLGRSKAFLDAVFPKKSLTVLETLANLGLLFFLFLAGLEIDTKALRN  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKAL IALAGISLPF LGIG+SF+LRATI+KGV    FL+FMGVALSITAFPVLARIL
Sbjct  120   TGKKALGIALAGISLPFALGIGSSFVLRATISKGVDSVAFLIFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTT++G++AMSAAAVNDVAAWILLALAIALSG+  S L+SLWV L G GFV+  I
Sbjct  180   AELKLLTTEIGRLAMSAAAVNDVAAWILLALAIALSGSDTSALVSLWVFLAGCGFVVAAI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              ++P +FKW+A RC EGEP++E Y+CA LA VL  GF+TD IGIH++FGAFV+GVL+PK+
Sbjct  240   CIIPPVFKWIARRCHEGEPIEETYICATLAVVLVCGFITDAIGIHSMFGAFVVGVLIPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP A AL+EKVEDLVSGLFLPLYFV+SGLKTNVATIQGAQSWGLLVLV FTACFGKI+GT
Sbjct  300   GPFAGALIEKVEDLVSGLFLPLYFVASGLKTNVATIQGAQSWGLLVLVTFTACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             + VS   +IP +EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTF+T
Sbjct  360   LGVSLAFKIPMREAVALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFMT  419

Query  1398  TPIVIALYKPAKLAVT--EYKYRTIQRKDPSK-QLRILTCFHSRRNIPSLINLIEASRGT  1228
             TPIV+A+YKPA+ A    EYK+RT++R + +  QLRILTCFH   +IPS+INL+EASRG 
Sbjct  420   TPIVMAVYKPARRAKKEGEYKHRTVERDNNTNTQLRILTCFHGAGSIPSMINLLEASRGI  479

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
             EK  G  VYA+HL ELSERSSAILM HK RKNG+PFWN RG   ++ ++VVAF+ F+ LS
Sbjct  480   EKGEGLCVYALHLRELSERSSAILMVHKVRKNGMPFWNRRGN-NNADQVVVAFQAFQQLS  538

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +V++RP TAIS+MS +HEDI  +A  KR +++ILPFHKHQ++DG  ETTR + R VNRRV
Sbjct  539   RVNVRPMTAISSMSDIHEDICTTAARKRASIVILPFHKHQQVDGSLETTRGDYRWVNRRV  598

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             L  APCSVGI VDRGLGG+S VSA +V Y++ VL+FGG DDREALAYG RM EHPGI L 
Sbjct  599   LVEAPCSVGIFVDRGLGGSSQVSAQDVSYSVVVLFFGGRDDREALAYGLRMAEHPGISLT  658

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSA  508
             V RF   PE  G   ++DV  +  +    KS DE+ ++  ++++S + SVK+ EK V++A
Sbjct  659   VFRFVTSPERVGEITRVDVDTNNENGGILKS-DEEVMSEIRKKSSVDESVKFLEKRVENA  717

Query  507   A-ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLV  331
             A +   AI    R NL +VGRMP GEI  A+ +  EC ELGP+G+LL   E  T ASVLV
Sbjct  718   AVDVRSAIEEMRRSNLFLVGRMPGGEIALAIRENSECAELGPVGSLLISTESPTRASVLV  777

Query  330   VQQY  319
             +QQY
Sbjct  778   IQQY  781



>emb|CDP12105.1| unnamed protein product [Coffea canephora]
Length=784

 Score =   947 bits (2448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/779 (69%), Positives = 632/779 (81%), Gaps = 4/779 (1%)
 Frame = -1

Query  2643  TVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEII  2464
              V CP PMKATSNG+FQ D+PLD+ALPL I+QICLV+++TR LA+ L+PLRQPRVIAEI+
Sbjct  4     NVTCPGPMKATSNGAFQHDNPLDFALPLAILQICLVLVVTRCLAFALKPLRQPRVIAEIV  63

Query  2463  GGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKA  2284
             GG+LLGPSA GR+++YL A+FP +SLTVLDTLA++GLLFFLFL GLEL+ K+L+RTGK A
Sbjct  64    GGILLGPSALGRNKSYLKAVFPPRSLTVLDTLANIGLLFFLFLAGLELNFKTLQRTGKTA  123

Query  2283  LSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKL  2104
             LSIA+AGIS+PF LGIG++F LRATIA+  +   F VFMGVALSITAFPVLARILAELKL
Sbjct  124   LSIAIAGISVPFALGIGSAFALRATIAEDANAAAFFVFMGVALSITAFPVLARILAELKL  183

Query  2103  LTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPR  1924
             LTTD+G+MAMSAAAVNDVAAWILLALA+ALSG   S ++ LWV LCG GFV+   L V  
Sbjct  184   LTTDIGKMAMSAAAVNDVAAWILLALAVALSGHNVSHIVPLWVFLCGCGFVICASLFVSP  243

Query  1923  IFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLAS  1744
             IFKWM+ RC EGEPV E Y+CA LAAVL A FVTDTIGIHA+FGAFV+GVLVPK+GP A 
Sbjct  244   IFKWMSRRCQEGEPVSETYICATLAAVLAAAFVTDTIGIHAMFGAFVLGVLVPKEGPFAG  303

Query  1743  ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVST  1564
             ALVEKVEDLVSGLFLPLYFVSSGLKTNVATI+G QSWGLLVLVI TAC GKI+GT  V+ 
Sbjct  304   ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIRGVQSWGLLVLVICTACLGKIVGTFTVAK  363

Query  1563  LCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI  1384
             L ++P  EA+ LGFLMN+KGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTFITTP+V+
Sbjct  364   LWKMPTAEAVALGFLMNSKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFITTPVVM  423

Query  1383  ALYKPAK-LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFK  1207
             A+YKPAK     +YK+RTI+RK+ + QLR+L CFHS RNIPS+INL EASRGT+K     
Sbjct  424   AVYKPAKRTKKIDYKHRTIERKNANSQLRLLACFHSARNIPSMINLFEASRGTDKHESLC  483

Query  1206  VYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPS  1027
             VYAMHLMELSERSSAI M  KAR+NGLPFWN +G  +    IVVAFE F+ LSKVS+R  
Sbjct  484   VYAMHLMELSERSSAIQMVQKARRNGLPFWN-KGHSSGGNHIVVAFEAFQQLSKVSVRSM  542

Query  1026  TAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCS  847
             T+IS++S MHEDI  +AE KR A+IILPFHKHQ++DG  ETTR E R VN RVLE A CS
Sbjct  543   TSISSLSDMHEDICGTAERKRAAVIILPFHKHQRLDGSLETTRAEFRGVNSRVLEHASCS  602

Query  846   VGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLD  667
             VGILVDRGLGG +HVSASNV Y I VL+FGGHDD EALAYG RM EHPGI L V RF ++
Sbjct  603   VGILVDRGLGGNAHVSASNVSYQIVVLFFGGHDDHEALAYGTRMAEHPGIKLTVVRFLVE  662

Query  666   PETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAI  487
             P+T G  V+++   +   +      DE+ LA  K R S + SV Y+E+ V S+ E + AI
Sbjct  663   PKTVGERVRIEGESNPGGNAVSA--DEEVLADMKDRESEDDSVNYKERAVGSSNEVIAAI  720

Query  486   RGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTE  310
             R Y+RC L +VGRMP+GEI  A++++ E PELGP+G+LL+  + STTASVLVVQQY  +
Sbjct  721   RDYSRCTLFLVGRMPDGEIALALNERIEYPELGPVGSLLTSPDLSTTASVLVVQQYNEK  779



>ref|XP_006405324.1| hypothetical protein EUTSA_v10027645mg [Eutrema salsugineum]
 gb|ESQ46777.1| hypothetical protein EUTSA_v10027645mg [Eutrema salsugineum]
Length=812

 Score =   937 bits (2422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/778 (67%), Positives = 632/778 (81%), Gaps = 8/778 (1%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CP PMKA SNG FQGD+P+D+ALPL I+QI +VV+LTRVLAYLLRPLRQPRVIAE+IGG+
Sbjct  11    CPDPMKAASNGVFQGDNPIDFALPLAILQIVIVVVLTRVLAYLLRPLRQPRVIAEVIGGI  70

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             +LGPS  GRS+ +L+A+FPKKSLTVL+TLA+LGLLFFLFL GLE+D KSLR+TGKKAL I
Sbjct  71    MLGPSLLGRSKVFLDAVFPKKSLTVLETLANLGLLFFLFLAGLEIDTKSLRQTGKKALGI  130

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             ALAGISLPF LGIG+SF+LRATI+KGV    FL+FMGVALSITAFPVLARILAELKLLTT
Sbjct  131   ALAGISLPFALGIGSSFVLRATISKGVDSIAFLIFMGVALSITAFPVLARILAELKLLTT  190

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             ++G++AMSAAAVNDVAAWILLALAIALSG+  SPL+SLWV L G  FV++  +++P IFK
Sbjct  191   EIGRLAMSAAAVNDVAAWILLALAIALSGSDTSPLVSLWVFLSGCAFVIVAAIIIPPIFK  250

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             W+A RC EGEPV+E Y+C  LA VL  GF+TD IGIH++FGAFV+GVL+PK+GP A ALV
Sbjct  251   WIARRCHEGEPVEETYICTTLAVVLVCGFITDAIGIHSMFGAFVVGVLIPKEGPFAGALV  310

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVSGLFLPLYFV+SGLKTNVATIQGAQSWGLLVLV FTACFGKI GT+ VS   +
Sbjct  311   EKVEDLVSGLFLPLYFVASGLKTNVATIQGAQSWGLLVLVTFTACFGKIAGTLGVSLAFK  370

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             IP +EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTFITTP+V+A+Y
Sbjct  371   IPMREAVALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFITTPVVMAVY  430

Query  1374  KPAKLAVT--EYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVY  1201
             KPA+ A    EYK+RT++R + + QLRILTCFH   +IPS+INL+EASRG EK  G  VY
Sbjct  431   KPARRAKKEGEYKHRTVERDNTNTQLRILTCFHGSGSIPSIINLLEASRGIEKGEGLCVY  490

Query  1200  AMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTA  1021
             A+HL ELSERSSAILM HK R+NG+PFWN R    ++ ++VVAF+ F+ LS+V++RP TA
Sbjct  491   ALHLRELSERSSAILMVHKVRRNGMPFWNRR--EINADQVVVAFQAFQQLSRVTVRPMTA  548

Query  1020  ISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVG  841
             IS+MS +HEDI  +A  KR A++ILPFHKHQ++DG  ETTR + R +NRRVL  APCSVG
Sbjct  549   ISSMSDIHEDICTTASRKRAAIVILPFHKHQQLDGSLETTRGDYRWINRRVLLEAPCSVG  608

Query  840   ILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPE  661
             I VDRGLGG+S VSA +V Y++  L+FGG DDREALAYG RM EHPGI L V RF + PE
Sbjct  609   IFVDRGLGGSSQVSAQDVSYSVVALFFGGCDDREALAYGLRMAEHPGISLTVFRFVVSPE  668

Query  660   TAGTsvkldvspsgssspeekSR---DEDFLAAFKQRNSTNSSVKYEEKVVKSAA-ETME  493
               G   ++DV+ + +S  +       DE+ ++  ++++  + S+K  E+ V++AA +   
Sbjct  669   RIGEITRVDVNNNNNSENQIGKNLNSDEEVMSVIRKKSEVDESIKLVERRVENAAVDVRS  728

Query  492   AIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             AI    R NL +VGRMP GEI  A+ +  ECPELGP+G+LL   E ST ASVLV+QQY
Sbjct  729   AIEEMRRSNLFLVGRMPGGEIALAIRENSECPELGPVGSLLISPESSTRASVLVIQQY  786



>emb|CDY44462.1| BnaCnng11150D [Brassica napus]
Length=790

 Score =   936 bits (2418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/785 (66%), Positives = 628/785 (80%), Gaps = 19/785 (2%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +N T  CPA MKATSNG FQGD+P+D+ALPL I+QI +V++LTR+LAYLLRPLRQPRV
Sbjct  1     MAAN-TSACPAFMKATSNGVFQGDNPIDFALPLAILQIVIVIILTRLLAYLLRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAE+IGG++LGPS  GRS+A+L+A+FPKKSLTVL+TLA+LGLLFFLFL GLE+D KSLR 
Sbjct  60    IAEVIGGIMLGPSLLGRSKAFLDAVFPKKSLTVLETLANLGLLFFLFLAGLEIDTKSLRN  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKAL IALAGISLPF LGIG+SF+LRATI+KGV    FL+FMGVALSITAFPVLARIL
Sbjct  120   TGKKALGIALAGISLPFALGIGSSFVLRATISKGVDSVAFLIFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTT++G++AMSAAAVNDVAAWILLALAIALSG+  S L+SLWV L G GFV+  I
Sbjct  180   AELKLLTTEIGRLAMSAAAVNDVAAWILLALAIALSGSDTSALVSLWVFLAGCGFVVAAI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              ++P +FKW+A RC EGEP++E Y+CA LA VL  GF+TD IGIH++FGAFV+GVL+PK+
Sbjct  240   CIIPPVFKWIARRCHEGEPIEETYICATLAVVLVCGFITDAIGIHSMFGAFVVGVLIPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP A AL+EKVEDLVSGLFLPLYFV+SGLKTNVATIQGAQSWGLLVLV FTACFGKI+GT
Sbjct  300   GPFAGALIEKVEDLVSGLFLPLYFVASGLKTNVATIQGAQSWGLLVLVTFTACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             + VS   + P +EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMAL TTF+T
Sbjct  360   LGVSLAFKTPMREAVALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALVTTFMT  419

Query  1398  TPIVIALYKPAKLAVT--EYKYRTIQRKDPSK-QLRILTCFHSRRNIPSLINLIEASRGT  1228
             TPIV+A+YKPA+ A    EYK+RT++R + +  QLRILTCFH   +IPS+INL+EASRG 
Sbjct  420   TPIVMAVYKPARRAKKEGEYKHRTVERDNNTNTQLRILTCFHGAGSIPSMINLLEASRGI  479

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFW-NTRGEPTDSTEIVVAFETFEHL  1051
             EK  G  VYA+HL ELSERSSAILM HK RKNG+PFW        ++ ++VVAF+ F+ L
Sbjct  480   EKGEGLCVYALHLRELSERSSAILMVHKVRKNGMPFWNRRGNNNNNADQVVVAFQAFQQL  539

Query  1050  SKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRR  871
             S+V++RP TAIS+MS +HEDI  +A  KR +++ILPFHKHQ++DG  ETTR + R VNRR
Sbjct  540   SRVNVRPMTAISSMSDIHEDIWTTAARKRASIVILPFHKHQQVDGSLETTRGDYRWVNRR  599

Query  870   VLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICL  691
             VL  APCSVGI VDRGLGG+S VSA +V Y++ VL+FGG DDREALAYG RM EHPGI L
Sbjct  600   VLVEAPCSVGIFVDRGLGGSSQVSAQDVSYSVVVLFFGGRDDREALAYGLRMAEHPGISL  659

Query  690   VVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKS  511
              V RF   PE+AG   ++D              DE+ ++  ++++S + SV + EK V++
Sbjct  660   TVLRFVTSPESAGEITRVDS-------------DEEVMSEIRKKSSVDESVTFVEKRVEN  706

Query  510   AA-ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVL  334
             A  +   AI    R NL +VGRMP GEI  A+ +  EC ELGP+G+LL   E  T ASVL
Sbjct  707   ATMDVRSAIEEMRRSNLFLVGRMPGGEIALAIRENSECAELGPVGSLLISTESPTRASVL  766

Query  333   VVQQY  319
             V+QQY
Sbjct  767   VIQQY  771



>ref|XP_008451982.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis melo]
Length=805

 Score =   934 bits (2414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/779 (68%), Positives = 632/779 (81%), Gaps = 5/779 (1%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CPA MKATSNG FQGD+PLD+ALPL I+QICLVVLLTR+L + LRPLRQPRVIAEI+GG+
Sbjct  11    CPAAMKATSNGVFQGDNPLDFALPLAILQICLVVLLTRLLGFALRPLRQPRVIAEIVGGI  70

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GRS+ +L+ +FP +SL VLDTLA+LGLLFFLFLVGLELD KSLRRTGK A++I
Sbjct  71    LLGPSALGRSQEFLHRVFPARSLAVLDTLANLGLLFFLFLVGLELDLKSLRRTGKGAMAI  130

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             A+AGI+LPF LGIGTS++LR+TI+KGV   PFLVFMGVALSITAFPVLARILAELKLLTT
Sbjct  131   AVAGITLPFVLGIGTSYVLRSTISKGVDGPPFLVFMGVALSITAFPVLARILAELKLLTT  190

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             +VG+MAMSAAAVND+AAWILLALAIALSGTG SPL+SLWV LCG  FVL+     P IF+
Sbjct  191   NVGRMAMSAAAVNDIAAWILLALAIALSGTGRSPLVSLWVFLCGAAFVLISFFTFPPIFQ  250

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             W++ RCS+GEPV E+Y+CAIL+ VL AGFVTD IGIHALFGAFV+GVLVPK+GPLA ALV
Sbjct  251   WISRRCSDGEPVSELYICAILSTVLAAGFVTDLIGIHALFGAFVVGVLVPKEGPLAGALV  310

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVSGLFLPLYFVSSGLKTN+ATI+GAQSWGLLVLV+FTACFGKI+GTI V+   +
Sbjct  311   EKVEDLVSGLFLPLYFVSSGLKTNIATIKGAQSWGLLVLVVFTACFGKIIGTISVALCFK  370

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +P QE+I LGFLMNTKGLVELIVLNIGKDR VLNDQTFAI+VLMA+ TTFITTPIV+A+Y
Sbjct  371   MPLQESIALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAILVLMAIITTFITTPIVMAVY  430

Query  1374  KPAKL-AVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEAS-RGTEKSGGFKVY  1201
             KPAK  + +EY  RTI+R +P+ +LRIL CFHS  NIPS++NLIE S     +     VY
Sbjct  431   KPAKRKSKSEYINRTIERDEPNSELRILACFHSVNNIPSILNLIEVSRGREGRGRRLCVY  490

Query  1200  AMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTA  1021
             AMHLMEL+ERSSAI+M ++ARKNGLPFWN +G  +DS +I+VAFE F+ LS+VSIRP TA
Sbjct  491   AMHLMELTERSSAIVMVNRARKNGLPFWN-KGGKSDSDQIIVAFEAFQQLSRVSIRPMTA  549

Query  1020  ISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVG  841
             IS  S MHED+  SAE KR A+IILPFHKHQ+ DG  ETTR + R VN++VLE  PCSVG
Sbjct  550   ISPFSDMHEDVCNSAERKRAAIIILPFHKHQRFDGSLETTRTDFRWVNQKVLEQPPCSVG  609

Query  840   ILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPE  661
             ILVDRGLGG SH+ ASNV  TITV +FGG DDREALAYG RM EHPGI L + R  L   
Sbjct  610   ILVDRGLGGGSHICASNVSSTITVFFFGGCDDREALAYGRRMAEHPGITLNIIRI-LPSS  668

Query  660   TAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRG  481
                T   +    S   +      D+  L  F  +   + S++YEE+ V    ET+E IR 
Sbjct  669   DMATESTVIDMHSKDDTNTSTLMDQKVLMEFNAKKIDDESIRYEERTVNKYNETIEVIRE  728

Query  480   YNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTEL  307
             +++CNL++VGR PEG+++ +   K G+CPELGP+GNLL+  E ST+AS+LVVQQ+R  L
Sbjct  729   FSKCNLILVGRAPEGKVIESFHFKGGDCPELGPIGNLLTSSEVSTSASILVVQQFRGPL  787



>ref|XP_010541366.1| PREDICTED: cation/H(+) antiporter 17-like [Tarenaya hassleriana]
Length=820

 Score =   930 bits (2404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/793 (66%), Positives = 629/793 (79%), Gaps = 14/793 (2%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +NGT  CP PMKA SNG FQG++PLDYALPLLI+QIC+VV+LTR LA+ LRPLRQPRV
Sbjct  1     MATNGTT-CPKPMKAASNGVFQGENPLDYALPLLILQICIVVVLTRTLAFFLRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA G+S  +LN +FP KS+TVLDT+A+LGLLFFLFLVGLELDPKSLRR
Sbjct  60    IAEIVGGILLGPSALGKSSKFLNTVFPAKSITVLDTIANLGLLFFLFLVGLELDPKSLRR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGK ALSIA+AGI+LPF LGIGTSF LR TI+ GVS  PFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKNALSIAVAGITLPFVLGIGTSFALRHTISDGVSNAPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE+KLLTTD+G++A+SAAAVNDVAAW+LLALAIALSG G SPL SLWV L G GFVL CI
Sbjct  180   AEIKLLTTDIGKIALSAAAVNDVAAWVLLALAIALSGEGDSPLTSLWVFLSGFGFVLFCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              VV  + KWM  RC EGEPV E YVC  LAAVL A F+TD IGIHALFGAF++G + PK+
Sbjct  240   FVVRPVMKWMVKRCPEGEPVKEQYVCCTLAAVLAASFITDAIGIHALFGAFILGAIFPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  AS+LVEKVEDLVSGLFLPLYFVSSGLKT+VATI+GAQSWGLL LVIF ACFGKI+GT
Sbjct  300   GNFASSLVEKVEDLVSGLFLPLYFVSSGLKTDVATIRGAQSWGLLFLVIFNACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             ++VS  C++P  E++ LGFLMNTKGLVELIVLNIGKDRGVLNDQ FAIMVLMA+FTTFIT
Sbjct  360   VVVSIFCKVPVAESLALGFLMNTKGLVELIVLNIGKDRGVLNDQVFAIMVLMAIFTTFIT  419

Query  1398  TPIVIALYKPAK-LAVTEYKYRTIQRKDPS-KQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKPAK L+  EYK+R +++ + S KQLR+L C+HS  NIP+++NLIEASRGT 
Sbjct  420   TPLVMAVYKPAKALSKGEYKHRNVEKSNESNKQLRLLVCYHSMINIPTMVNLIEASRGTN  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             +  G  VYAMHLMELSER SAILM HKARK GLPFWN       S  I+VAFE F  LS+
Sbjct  480   RKEGLCVYAMHLMELSERPSAILMVHKARKFGLPFWNKGIFGNSSDVIMVAFEVFCQLSR  539

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             VS+RP TAISAM++MHEDI  SAE KR AM+I+PFHKH  ++G +ETTR+E R +N+RV+
Sbjct  540   VSVRPMTAISAMATMHEDICQSAERKRAAMVIIPFHKHMTLEGTWETTRSEYRWINKRVM  599

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             E +PCSV ILVDRGLGGT+ VS+S+    +TVL+FGG+DDREALA+GARM EHPGI L V
Sbjct  600   EQSPCSVAILVDRGLGGTTRVSSSDFSLVVTVLFFGGNDDREALAFGARMAEHPGISLTV  659

Query  684   ARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSS----------VK  535
              RF    +    +VK++++  G+ + E    D   +   K +     S          + 
Sbjct  660   VRFIPSQDFKRDNVKVEITEDGTGTSENNLLDIQAINKLKAKTKQEESSSSVSDSDSLIV  719

Query  534   YEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKE-  358
             YEEK VK + E +E I+ Y R NL ++G+ PE  +V+ ++ + + PE+GP+GNLL   + 
Sbjct  720   YEEKFVKRSEEAVEIIKEYKRSNLFLLGKSPESPVVSGLNVRSDTPEIGPVGNLLISNDV  779

Query  357   FSTTASVLVVQQY  319
              ST+ASVLVVQQY
Sbjct  780   VSTSASVLVVQQY  792



>ref|XP_007028838.1| Cation/H+ exchanger 19 [Theobroma cacao]
 gb|EOY09340.1| Cation/H+ exchanger 19 [Theobroma cacao]
Length=796

 Score =   927 bits (2396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/798 (65%), Positives = 631/798 (79%), Gaps = 18/798 (2%)
 Frame = -1

Query  2652  SNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             +NGT   VCPAPMKATSNG+FQ ++PLD+ALPLLIVQI LVV LTRVLA++LRPLRQPRV
Sbjct  4     NNGTAAPVCPAPMKATSNGAFQNENPLDFALPLLIVQIILVVTLTRVLAFMLRPLRQPRV  63

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEIIGG+LLGPSA GR++ ++N IFPK+S+TVLDTLA++GLLFFLFLVGLELD +++RR
Sbjct  64    IAEIIGGILLGPSALGRNKEFMNKIFPKRSMTVLDTLANIGLLFFLFLVGLELDIRAIRR  123

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKAL IA AGISLPF LGIGTSF+LR+TI KGV +  FLVFMGVALSITAFPVLARIL
Sbjct  124   TGKKALGIAAAGISLPFVLGIGTSFVLRSTINKGVGEIAFLVFMGVALSITAFPVLARIL  183

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG++AMSAAAVNDV AWILLALAIAL+G+ +SPL+S+WVLLCG  FVL  I
Sbjct  184   AELKLLTTDVGRIAMSAAAVNDVVAWILLALAIALTGSNNSPLVSVWVLLCGAAFVLFAI  243

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              ++  I   MA RC +GEPV E+Y+C  L+ VL AGFVTDTIGIHALFGAFV+G++VPKD
Sbjct  244   FLLKPILTLMARRCLDGEPVKELYICITLSLVLAAGFVTDTIGIHALFGAFVVGIIVPKD  303

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP A  L+EK+EDLVSGLFLPLYF SSGLKTNVATI+G QSWGLLVLVIF ACFGKI+GT
Sbjct  304   GPFAGVLIEKIEDLVSGLFLPLYFASSGLKTNVATIKGGQSWGLLVLVIFNACFGKIVGT  363

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             I VS L ++PF+EA+TLGFLMNTKGLVELIVLNIGKDR VLNDQ+FAI+VLMALFTTFIT
Sbjct  364   IGVSMLFKVPFREALTLGFLMNTKGLVELIVLNIGKDRKVLNDQSFAILVLMALFTTFIT  423

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             TPIV+A+YKPA+     YK+R I RKD   +LRIL CFHS RNIP+LINLIE+SRG +K 
Sbjct  424   TPIVMAIYKPARKG-EPYKHRRIHRKDFDTELRILACFHSTRNIPTLINLIESSRGIQKR  482

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
             G   VYAMHLMELSERSSAI M HKARKNGLPFWN + +  D  ++V+AFE ++ LS V+
Sbjct  483   GHLCVYAMHLMELSERSSAITMIHKARKNGLPFWNKKRQ--DQDQMVIAFEAYQQLSSVT  540

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             +RP TAISA +S+HEDI  SA+ KR A+I++PFHKHQ++DG  E+       VN+RVL  
Sbjct  541   VRPMTAISAFNSIHEDICTSADRKRAALILMPFHKHQRLDGSMESLGYSFHLVNQRVLRH  600

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             APCSVGILVDRGLGGT+ V AS V Y++ V +FGG DDREALAYG RM EHPGI L V +
Sbjct  601   APCSVGILVDRGLGGTTQVVASEVSYSVVVPFFGGQDDREALAYGMRMAEHPGINLTVLK  660

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAET  499
             FT  P  +          + +    E  +D + L+ F   +  N S+ +EEK+V S  + 
Sbjct  661   FTAKPGMS--------LDAKADVGAESDKDNEILSEFISLSKRNESIGHEEKIVGSKEDI  712

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             + A+R  ++ +L +VGRM     +   ++  +CPELG LG+ L+  +FSTT+S+LVVQQY
Sbjct  713   IAALRSMSKSSLFLVGRM--SPTMPLTERSTDCPELGHLGSYLASSDFSTTSSILVVQQY  770

Query  318   RTELSKNGLKEDDSVDGD  265
               + S N + E    DG+
Sbjct  771   --DPSTNTM-EQAQFDGN  785



>ref|NP_188390.2| cation/H(+) antiporter 19 [Arabidopsis thaliana]
 sp|Q9LUN4.1|CHX19_ARATH RecName: Full=Cation/H(+) antiporter 19; AltName: Full=Protein 
CATION/H+ EXCHANGER 19; Short=AtCHX19 [Arabidopsis thaliana]
 dbj|BAB02053.1| Na+/H+ exchangeing protein-like [Arabidopsis thaliana]
 gb|AAX49547.1| cation/H+ exchanger [Arabidopsis thaliana]
 gb|AEE75983.1| cation/H(+) antiporter 19 [Arabidopsis thaliana]
Length=800

 Score =   925 bits (2391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/792 (66%), Positives = 622/792 (79%), Gaps = 9/792 (1%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
             +N T  CP PMKATSNG+FQ +SPLD+ALPL+I+QI LVV+ TR+LAY L+PL+QPRVIA
Sbjct  4     TNVTGQCPGPMKATSNGAFQNESPLDFALPLIILQIVLVVVFTRLLAYFLKPLKQPRVIA  63

Query  2472  EIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTG  2293
             EIIGG+LLGPSA GRS+AYL+ IFPKKSLTVLDTLA++GLLFFLFLVGLELD  ++++TG
Sbjct  64    EIIGGILLGPSALGRSKAYLDTIFPKKSLTVLDTLANIGLLFFLFLVGLELDFAAIKKTG  123

Query  2292  KKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAE  2113
             KK+L IA+AGISLPF +G+GTSF+L ATI+KGV Q PF+VFMGVALSITAFPVLARILAE
Sbjct  124   KKSLLIAIAGISLPFIVGVGTSFVLSATISKGVDQLPFIVFMGVALSITAFPVLARILAE  183

Query  2112  LKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILV  1933
             LKLLTTD+G+MAMSAA VNDVAAWILLALAIALSG G SPL+S+WVLLCGTGFV+  ++ 
Sbjct  184   LKLLTTDIGRMAMSAAGVNDVAAWILLALAIALSGDGTSPLVSVWVLLCGTGFVIFAVVA  243

Query  1932  VPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
             +  +  +MA RC EGEPV E+YVC  L  VL A FVTDTIGIHALFGAFV+G++ PK+GP
Sbjct  244   IKPLLAYMARRCPEGEPVKELYVCVTLTVVLAASFVTDTIGIHALFGAFVVGIVAPKEGP  303

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
                 L EK+EDLVSGL LPLYF +SGLKT+V TI+GAQSWGLLVLVI T CFGKI+GT+ 
Sbjct  304   FCRILTEKIEDLVSGLLLPLYFAASGLKTDVTTIRGAQSWGLLVLVILTTCFGKIVGTVG  363

Query  1572  VSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTP  1393
              S LC++PF+EA+TLGFLMNTKGLVELIVLNIGKDR VLNDQ FAI+VLMALFTTFITTP
Sbjct  364   SSMLCKVPFREAVTLGFLMNTKGLVELIVLNIGKDRKVLNDQAFAILVLMALFTTFITTP  423

Query  1392  IVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGG  1213
             IV+ +YKPA+     YK+RTIQRKD   +LRIL CFHS RNIP+LINLIE+SRGT K G 
Sbjct  424   IVMLIYKPARKG-APYKHRTIQRKDHDSELRILACFHSTRNIPTLINLIESSRGTGKKGR  482

Query  1212  FKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIR  1033
               VYAMHLMELSERSSAI M HKAR NGLP WN     TD  ++V+AFE ++HL  V++R
Sbjct  483   LCVYAMHLMELSERSSAIAMVHKARNNGLPIWNKIERSTD--QMVIAFEAYQHLRAVAVR  540

Query  1032  PSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAP  853
             P TAIS +SS+HEDI  SA  KRVAMI+LPFHKHQ++DG  E+  +    VN+RVL+ AP
Sbjct  541   PMTAISGLSSIHEDICTSAHQKRVAMILLPFHKHQRMDGAMESIGHRFHEVNQRVLQRAP  600

Query  852   CSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFT  673
             CSVGILVDRGLGGTS V AS V Y + + +FGG DDREALAYG +MVEHPGI L V +F 
Sbjct  601   CSVGILVDRGLGGTSQVVASEVAYKVVIPFFGGLDDREALAYGMKMVEHPGITLTVYKFV  660

Query  672   LDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETME  493
                   GT  + + S       +EK  DE+F+         N S+ YEE+VV+S  + + 
Sbjct  661   ---AARGTLKRFEKSEHDEKEKKEKETDEEFVRELMNDPRGNESLAYEERVVESKDDIIA  717

Query  492   AIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRT  313
              ++  ++CNL VVGR      VA++ K  +CPELGP+G LLS  EFSTTASVLVVQ Y  
Sbjct  718   TLKSMSKCNLFVVGR---NAAVASLVKSTDCPELGPVGRLLSSSEFSTTASVLVVQGYDP  774

Query  312   ELSKNGLKEDDS  277
                   L E+D+
Sbjct  775   AADTRPLVEEDA  786



>ref|XP_002883073.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59332.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=800

 Score =   923 bits (2386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/800 (66%), Positives = 622/800 (78%), Gaps = 12/800 (2%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
             +N T  CP PMKATSNG+FQ +SPLD+ALPL+I+QI LVV+ TR+LAY L+PL+QPRVIA
Sbjct  4     TNVTGQCPGPMKATSNGAFQNESPLDFALPLIILQIVLVVVFTRLLAYFLKPLKQPRVIA  63

Query  2472  EIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTG  2293
             EIIGG+LLGPSA GRS+AYL+ IFPKKSLTVLDTLA++GLLFFLFLVGLELD  ++R+TG
Sbjct  64    EIIGGILLGPSALGRSKAYLDTIFPKKSLTVLDTLANIGLLFFLFLVGLELDFTAIRKTG  123

Query  2292  KKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAE  2113
             KK+L IALAGISLPF +G+GTSF+L ATI+KGV+Q PF+VFMGVALSITAFPVLARILAE
Sbjct  124   KKSLLIALAGISLPFVVGVGTSFVLSATISKGVNQLPFIVFMGVALSITAFPVLARILAE  183

Query  2112  LKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILV  1933
             LKLLTTD+G++AMSAA VNDVAAWILLALAIALSG G SPL+S+WVLLCG+GFV+  ++ 
Sbjct  184   LKLLTTDIGRIAMSAAGVNDVAAWILLALAIALSGDGTSPLVSVWVLLCGSGFVIFAVVA  243

Query  1932  VPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
             +  +  +MA RC EGEPV E+YVC  L  VL A FVTDTIGIHALFGAFV+G++ PK+GP
Sbjct  244   IKPLLAYMARRCPEGEPVKELYVCVTLTVVLAASFVTDTIGIHALFGAFVVGIVAPKEGP  303

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
                 L EK+EDLVSGL LPLYF +SGLKT+V TI+GAQSWGLLVLVI T CFGKI+GT+ 
Sbjct  304   FCRILTEKIEDLVSGLLLPLYFAASGLKTDVTTIRGAQSWGLLVLVILTTCFGKIVGTVG  363

Query  1572  VSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTP  1393
              S LC++PF+EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQ FAI+VLMALFTTFITTP
Sbjct  364   ASMLCKVPFREAMALGFLMNTKGLVELIVLNIGKDRKVLNDQAFAILVLMALFTTFITTP  423

Query  1392  IVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGG  1213
             IV+ +YKPA+     YK+RTIQRKD   +LRIL CFHS RNIP+LINLIE+SRGT K G 
Sbjct  424   IVMLIYKPARKG-APYKHRTIQRKDHDSELRILACFHSTRNIPTLINLIESSRGTGKKGR  482

Query  1212  FKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIR  1033
               VYAMHLMELSERSSAI M HKAR NGLP WN     TD  ++V+AFE ++HL  V++R
Sbjct  483   LCVYAMHLMELSERSSAIAMVHKARNNGLPIWNKIERSTD--QMVIAFEAYQHLRAVAVR  540

Query  1032  PSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAP  853
             P TAIS +SS+HEDI  SA  KRVAMI+LPFHKHQ++DG  E+  +    VN+RVL+ AP
Sbjct  541   PMTAISGLSSIHEDICTSAHQKRVAMILLPFHKHQRVDGAMESIGHGFHEVNQRVLQRAP  600

Query  852   CSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFT  673
             CSVGILVDRGLGGTS V AS V Y + V +FGG DDREALAYG +MVEHPGI L V +F 
Sbjct  601   CSVGILVDRGLGGTSQVVASEVAYKVVVPFFGGLDDREALAYGMKMVEHPGITLTVHKFV  660

Query  672   LDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETME  493
                   GT  + + S        EK  DE+F+         N S+ YEE+VV+S  + + 
Sbjct  661   ---AARGTLKRFEKSEHDEKEKTEKETDEEFVRELMNDPRGNESLAYEERVVESKEDIIA  717

Query  492   AIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRT  313
              ++  ++CNL VVGR      VA++    +CPELGP+G LLS  EFSTTASVLVVQ Y  
Sbjct  718   TLKSMSKCNLFVVGR---NAAVASLVNSTDCPELGPVGRLLSSSEFSTTASVLVVQGYDP  774

Query  312   ELSKNGLKEDDSVDGDYESA  253
                   L E+D     YE A
Sbjct  775   AADTRPLVEEDE---SYEQA  791



>emb|CDY24802.1| BnaA08g15080D [Brassica napus]
Length=799

 Score =   918 bits (2373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/785 (66%), Positives = 625/785 (80%), Gaps = 19/785 (2%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             MG+NGT  C   MKATSNG FQGD PL YALPLLI+QIC+V+LLTRVLA+LLRPLRQPRV
Sbjct  1     MGTNGTT-CSGTMKATSNGVFQGDDPLHYALPLLILQICIVLLLTRVLAFLLRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA G+S  +LN +FP KSLTVLDTLA+LGL+FFLFLVGLELDPKSL+R
Sbjct  60    IAEIVGGILLGPSALGKSSKFLNTVFPAKSLTVLDTLANLGLIFFLFLVGLELDPKSLKR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIALAGI+ PF LGIGTSF+LR++IA GVS+ PFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKKALSIALAGITFPFILGIGTSFVLRSSIADGVSKAPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE+KLLTTD+G++A+SAAAVNDVAAWILLALA+ALSG G+SPL SLWV L G+GFVL CI
Sbjct  180   AEIKLLTTDIGKIALSAAAVNDVAAWILLALAVALSGDGNSPLTSLWVFLAGSGFVLFCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
               V    KW+A RC EGEPV E YVC  L  VL A FVTD IGIHALFGAFVIGV+ PK+
Sbjct  240   YAVQPGIKWIAKRCPEGEPVKEQYVCYTLGIVLAASFVTDLIGIHALFGAFVIGVIFPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A++LVEKVEDLVSGLFLPLYFVSSGLKT+VATIQGAQSWGLLVLVIFTACFGKI+GT
Sbjct  300   GNFANSLVEKVEDLVSGLFLPLYFVSSGLKTDVATIQGAQSWGLLVLVIFTACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             + VS  C++P  E++ LGFLMNTKGLVELIVLNIGKDRGVLNDQ FAIMVLMA+FTTF+T
Sbjct  360   VGVSLYCKVPLDESLALGFLMNTKGLVELIVLNIGKDRGVLNDQVFAIMVLMAIFTTFMT  419

Query  1398  TPIVIALYKPAKLAVT-EYKYRTIQRKDP-SKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKP K      +K +T++  +  +K LR++ CFHS  NIP+++NLIEASRGT 
Sbjct  420   TPLVLAVYKPGKSTTKGTFKNQTVEETNQLNKPLRLMFCFHSIMNIPTIVNLIEASRGTN  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTE-IVVAFETFEHLS  1048
             +     VYAMHLMELSERSSAILM HK RKNGLPFWN     T S++ +VVAFE F  LS
Sbjct  480   RKESLSVYAMHLMELSERSSAILMAHKVRKNGLPFWNKDKPGTSSSDMVVVAFEAFRRLS  539

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +VS+RP TAISA+S++HEDI  SAE K V M+ILPFHKH ++D  +ETTRN+ R +N++V
Sbjct  540   RVSVRPMTAISAISTIHEDICRSAERKSVGMVILPFHKHVRLDRTWETTRNDYRWINKKV  599

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             ++ +PCSV ILVDRGLGGT+ V++S+    ITVL+FGG+DDREALA+  RM EHPGI L 
Sbjct  600   MDESPCSVAILVDRGLGGTTRVASSDFSLAITVLFFGGNDDREALAFAVRMAEHPGITLT  659

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSA  508
             V RF    E    +VKL+++             ED   + +  + T S + YEE++VK  
Sbjct  660   VVRFIPSEEFKPDNVKLEIT-------------EDQAESSRSDSDTESQIVYEERIVKCQ  706

Query  507   AETMEAIRGYNRCNLLVVGRMPEGEIVAAMDK-KGECPELGPLGNLLSCKE-FSTTASVL  334
                 EAI+ Y+R NL +VG+ P+G + + +D  + + PELGP+GNLL+  E  ST ASVL
Sbjct  707   EGVCEAIKEYSRSNLFLVGKSPDGSVASGLDVLRSDTPELGPVGNLLTSSESVSTVASVL  766

Query  333   VVQQY  319
             VVQQY
Sbjct  767   VVQQY  771



>emb|CDY35447.1| BnaC03g62130D [Brassica napus]
Length=799

 Score =   917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/789 (66%), Positives = 621/789 (79%), Gaps = 27/789 (3%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             MG+NGT  C   MKATSNG FQGD PL YALPLLI+QIC+V+LLTRVLA+LLRPLRQPRV
Sbjct  1     MGTNGTT-CSGTMKATSNGVFQGDDPLHYALPLLILQICIVLLLTRVLAFLLRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA G+S  +LN +FP KSLTVLDTLA+LGL+FFLFLVGLELDPKSL+R
Sbjct  60    IAEIVGGILLGPSALGKSSKFLNTVFPAKSLTVLDTLANLGLIFFLFLVGLELDPKSLKR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIALAGI+LPF LGIGTSF+LR++IA GVS+ PFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKKALSIALAGITLPFILGIGTSFVLRSSIADGVSKAPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE+KLLTTD+G++A+SAAAVNDVAAWILLALA+ALSG G+SPL SLWV L G GFVL CI
Sbjct  180   AEIKLLTTDIGKIALSAAAVNDVAAWILLALAVALSGDGNSPLTSLWVFLAGCGFVLFCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
               V    KW+A RC EGEPV E YVC  L  VL A FVTD IGIHALFGAFVIGV+ PK+
Sbjct  240   YAVQPGIKWIAKRCPEGEPVKEQYVCYTLGIVLAASFVTDLIGIHALFGAFVIGVIFPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A++LVEKVEDLVSGLFLPLYFVSSGLKT+VATIQGAQSWGLLVLVIFTACFGKI+GT
Sbjct  300   GNFANSLVEKVEDLVSGLFLPLYFVSSGLKTDVATIQGAQSWGLLVLVIFTACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             + VS  C++P  +++ LGFLMNTKGLVELIVLNIGKDRGVLNDQ FAIMVLMA+FTTF+T
Sbjct  360   VGVSLYCKVPLDQSLALGFLMNTKGLVELIVLNIGKDRGVLNDQVFAIMVLMAIFTTFMT  419

Query  1398  TPIVIALYKPAK-LAVTEYKYRTIQRKDPS-KQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKP K +    +K +T++  + S K LR++ CFHS  NIP+++NLIEASRGT 
Sbjct  420   TPLVLAVYKPGKSITKGNFKNQTVEETNQSNKPLRLMFCFHSIMNIPTIVNLIEASRGTN  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTE-IVVAFETFEHLS  1048
             +     VYAMHLMELSERSSAILM HK RKNGLPFWN     T S++ +VVAFE F  LS
Sbjct  480   RKESLSVYAMHLMELSERSSAILMAHKVRKNGLPFWNKDKPGTSSSDMVVVAFEAFRRLS  539

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +VS+RP TAISA+S++HEDI  SAE K V M+ILPFHKH ++D  +ETTRN+ R +N++V
Sbjct  540   RVSVRPMTAISAISTIHEDICRSAERKSVGMVILPFHKHVRLDRTWETTRNDYRSINKKV  599

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             ++ +PCSV ILVDRGLGGT+ V++S+    ITVL+FGG+DDREALA+  RM EHPGI L 
Sbjct  600   MDESPCSVAILVDRGLGGTTRVASSDFSLAITVLFFGGNDDREALAFAVRMAEHPGITLT  659

Query  687   VARFT----LDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKV  520
             V RF       PE     +                  ED     +  + + S + YEE++
Sbjct  660   VVRFIPSEEFKPENVKLEIT-----------------EDQADTSRSDSDSVSQIVYEERI  702

Query  519   VKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDK-KGECPELGPLGNLLSCKE-FSTT  346
             VK   E  EAI+ Y+R NL +VG+ P+G + + ++  + + PELGP+GNLL+  E  ST 
Sbjct  703   VKCHEEVCEAIKEYSRSNLFLVGKSPDGSVASGLNVLRSDTPELGPVGNLLTSSESVSTV  762

Query  345   ASVLVVQQY  319
             ASVLVVQQY
Sbjct  763   ASVLVVQQY  771



>gb|AES94002.2| cation/H+ exchanger 3 [Medicago truncatula]
Length=773

 Score =   917 bits (2370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/793 (64%), Positives = 605/793 (76%), Gaps = 26/793 (3%)
 Frame = -1

Query  2658  MGSNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M SN T   V P PM+  SNG FQGD PLDYAL                    L  LRQP
Sbjct  1     MTSNTTSKNVFPPPMQPASNGVFQGDDPLDYALT-------------------LAILRQP  41

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RV+AEI+GG++LGPSA GR+++YL A+FP KSL VLD+LA+LGL+FFLFL G+ELDPKSL
Sbjct  42    RVVAEIVGGIILGPSALGRNKSYLRAVFPSKSLPVLDSLANLGLIFFLFLAGIELDPKSL  101

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
              +TG +  +IA+AGISLPF L IG+SF+ + TIAKGV+   FLV+MGVALSI AFPVLAR
Sbjct  102   GKTGGRVFAIAMAGISLPFALRIGSSFVRQGTIAKGVNTSAFLVYMGVALSINAFPVLAR  161

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTT VG+MAMSAAAVNDVA+WILLALA+ALSG+  SP +SLWV L G GFV+ 
Sbjct  162   ILAELKLLTTSVGRMAMSAAAVNDVASWILLALAVALSGSSQSPFVSLWVFLSGCGFVVC  221

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
              IL+V  IFKWMA +C EGEPVDE+Y+CA LAAVL AGFVTD IGIHA+FGAFV G+LVP
Sbjct  222   SILIVLPIFKWMAQQCHEGEPVDELYICATLAAVLAAGFVTDAIGIHAMFGAFVFGILVP  281

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             KDG  A ALVEK+EDLVSGL LPLYFVSSGLKT++ATIQG QSWGLLV V FTACFGKI+
Sbjct  282   KDGAFAGALVEKIEDLVSGLLLPLYFVSSGLKTDIATIQGLQSWGLLVFVTFTACFGKIV  341

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GTI+VS LC++PF E++ LGFLMN+KGLVELIVLNIGKDR VLNDQTFAIMVLMAL TTF
Sbjct  342   GTIVVSLLCKVPFNESLVLGFLMNSKGLVELIVLNIGKDRKVLNDQTFAIMVLMALITTF  401

Query  1404  ITTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             +TTP+V+A YK  K   + YKYRTI+RK+   QLRIL CFH  RNIPS+INLIEASRG +
Sbjct  402   MTTPLVLAAYK-RKERKSNYKYRTIERKNADGQLRILACFHGSRNIPSVINLIEASRGIK  460

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             K     VYAMHL E  ERSS+ILM  K R+NGLPFW+ +G   DS  ++VAFE ++ LS+
Sbjct  461   KHDALCVYAMHLKEFCERSSSILMAQKVRQNGLPFWD-KGRHGDSVHVIVAFEAYQKLSQ  519

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             V +RP  AIS+M+++HEDI A+A+ KR A+IILPFHK Q++DG     RN+ R VN+RVL
Sbjct  520   VCVRPMIAISSMANIHEDICATADRKRAAVIILPFHKQQRLDGSLGIIRNDFRLVNKRVL  579

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             E A CSVGI VDRGLGG+ HVSASNV Y I VL+FGG DD EALAYGARM EHPGI LVV
Sbjct  580   EHASCSVGIFVDRGLGGSCHVSASNVSYCIAVLFFGGGDDHEALAYGARMAEHPGIRLVV  639

Query  684   ARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAA  505
              RF ++P   G           SS     S D++FLA FK + ++  SV YEE++VK AA
Sbjct  640   IRFLVEPNIVGQ--ITKFDVGDSSRSNSISEDDEFLAEFKLKTASYDSVIYEEEIVKDAA  697

Query  504   ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQ  325
             ET+  IRG N CNL +VGR P  E+  A+ K+ ECPELGP+G LL+ ++F TTASVLV+Q
Sbjct  698   ETVATIRGINCCNLFLVGRRPTSELAFAL-KRSECPELGPVGGLLASQDFRTTASVLVMQ  756

Query  324   QYRTELSKNGLKE  286
             QY   +  N + E
Sbjct  757   QYPNGVPINFVPE  769



>ref|XP_003611044.1| Cation proton exchanger [Medicago truncatula]
Length=817

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/793 (64%), Positives = 605/793 (76%), Gaps = 26/793 (3%)
 Frame = -1

Query  2658  MGSNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M SN T   V P PM+  SNG FQGD PLDYAL                    L  LRQP
Sbjct  45    MTSNTTSKNVFPPPMQPASNGVFQGDDPLDYALT-------------------LAILRQP  85

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RV+AEI+GG++LGPSA GR+++YL A+FP KSL VLD+LA+LGL+FFLFL G+ELDPKSL
Sbjct  86    RVVAEIVGGIILGPSALGRNKSYLRAVFPSKSLPVLDSLANLGLIFFLFLAGIELDPKSL  145

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
              +TG +  +IA+AGISLPF L IG+SF+ + TIAKGV+   FLV+MGVALSI AFPVLAR
Sbjct  146   GKTGGRVFAIAMAGISLPFALRIGSSFVRQGTIAKGVNTSAFLVYMGVALSINAFPVLAR  205

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTT VG+MAMSAAAVNDVA+WILLALA+ALSG+  SP +SLWV L G GFV+ 
Sbjct  206   ILAELKLLTTSVGRMAMSAAAVNDVASWILLALAVALSGSSQSPFVSLWVFLSGCGFVVC  265

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
              IL+V  IFKWMA +C EGEPVDE+Y+CA LAAVL AGFVTD IGIHA+FGAFV G+LVP
Sbjct  266   SILIVLPIFKWMAQQCHEGEPVDELYICATLAAVLAAGFVTDAIGIHAMFGAFVFGILVP  325

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             KDG  A ALVEK+EDLVSGL LPLYFVSSGLKT++ATIQG QSWGLLV V FTACFGKI+
Sbjct  326   KDGAFAGALVEKIEDLVSGLLLPLYFVSSGLKTDIATIQGLQSWGLLVFVTFTACFGKIV  385

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GTI+VS LC++PF E++ LGFLMN+KGLVELIVLNIGKDR VLNDQTFAIMVLMAL TTF
Sbjct  386   GTIVVSLLCKVPFNESLVLGFLMNSKGLVELIVLNIGKDRKVLNDQTFAIMVLMALITTF  445

Query  1404  ITTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             +TTP+V+A YK  K   + YKYRTI+RK+   QLRIL CFH  RNIPS+INLIEASRG +
Sbjct  446   MTTPLVLAAYK-RKERKSNYKYRTIERKNADGQLRILACFHGSRNIPSVINLIEASRGIK  504

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             K     VYAMHL E  ERSS+ILM  K R+NGLPFW+ +G   DS  ++VAFE ++ LS+
Sbjct  505   KHDALCVYAMHLKEFCERSSSILMAQKVRQNGLPFWD-KGRHGDSVHVIVAFEAYQKLSQ  563

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             V +RP  AIS+M+++HEDI A+A+ KR A+IILPFHK Q++DG     RN+ R VN+RVL
Sbjct  564   VCVRPMIAISSMANIHEDICATADRKRAAVIILPFHKQQRLDGSLGIIRNDFRLVNKRVL  623

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             E A CSVGI VDRGLGG+ HVSASNV Y I VL+FGG DD EALAYGARM EHPGI LVV
Sbjct  624   EHASCSVGIFVDRGLGGSCHVSASNVSYCIAVLFFGGGDDHEALAYGARMAEHPGIRLVV  683

Query  684   ARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAA  505
              RF ++P   G           SS     S D++FLA FK + ++  SV YEE++VK AA
Sbjct  684   IRFLVEPNIVGQ--ITKFDVGDSSRSNSISEDDEFLAEFKLKTASYDSVIYEEEIVKDAA  741

Query  504   ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQ  325
             ET+  IRG N CNL +VGR P  E+  A+ K+ ECPELGP+G LL+ ++F TTASVLV+Q
Sbjct  742   ETVATIRGINCCNLFLVGRRPTSELAFAL-KRSECPELGPVGGLLASQDFRTTASVLVMQ  800

Query  324   QYRTELSKNGLKE  286
             QY   +  N + E
Sbjct  801   QYPNGVPINFVPE  813



>ref|XP_009109299.1| PREDICTED: cation/H(+) antiporter 17-like [Brassica rapa]
Length=824

 Score =   916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/797 (66%), Positives = 630/797 (79%), Gaps = 18/797 (2%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             MG+NGT  C   MKATSNG FQGD PL YALPLLI+QIC+V+LLTRVLA+LLRPLRQPRV
Sbjct  1     MGTNGTT-CSGTMKATSNGVFQGDDPLHYALPLLILQICIVLLLTRVLAFLLRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA G+S  +LN +FP KSLTVLDTLA+LGL+FFLFLVGLELDPKSL+R
Sbjct  60    IAEIVGGILLGPSALGKSSKFLNTVFPAKSLTVLDTLANLGLIFFLFLVGLELDPKSLKR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIALAGI+ PF LGIGTSF+LR++IA GVS+ PFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKKALSIALAGITFPFILGIGTSFVLRSSIADGVSKAPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE+KLLTTD+G++A+SAAAVNDVAAWILLALA+ALSG G+SPL SLWV L G+GFVL CI
Sbjct  180   AEIKLLTTDIGKIALSAAAVNDVAAWILLALAVALSGDGNSPLTSLWVFLAGSGFVLFCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
               V    KW+A RC EGEPV E YVC  L  VL A FVTD IGIHALFGAFVIGV+ PK+
Sbjct  240   YAVQPGIKWIAKRCPEGEPVKEQYVCYTLGIVLAASFVTDLIGIHALFGAFVIGVIFPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A++LVEKVEDLVSGLFLPLYFVSSGLKT+VATIQGAQSWGLLVLVIFTACFGKI+GT
Sbjct  300   GNFANSLVEKVEDLVSGLFLPLYFVSSGLKTDVATIQGAQSWGLLVLVIFTACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             + VS  C++P  E++ LGFLMNTKGLVELIVLNIGKDRGVLNDQ FAIMVLMA+FTTF+T
Sbjct  360   VGVSLYCKVPLDESLALGFLMNTKGLVELIVLNIGKDRGVLNDQVFAIMVLMAIFTTFMT  419

Query  1398  TPIVIALYKPAKLAVT-EYKYRTIQRKDPS-KQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKP K      +K +T++  + S K LR++ CFHS  NIP+++NLIEASRGT 
Sbjct  420   TPLVLAVYKPGKSTTKGTFKNQTVEETNQSNKPLRLMFCFHSIMNIPTIVNLIEASRGTN  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTE-IVVAFETFEHLS  1048
             +     VYAMHLMELSERSSAILM HK RKNGLPFWN     T S++ +VVAFE F  LS
Sbjct  480   RKESLSVYAMHLMELSERSSAILMAHKVRKNGLPFWNKDKPGTSSSDMVVVAFEAFRRLS  539

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
             +VS+RP TAISA+S++HEDI  SAE K V M+ILPFHKH ++D  +ETTRN+ R +N++V
Sbjct  540   RVSVRPMTAISAISTIHEDICRSAERKSVGMVILPFHKHVRLDRTWETTRNDYRWINKKV  599

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             ++ +PCSV ILVDRGLGGT+ V++S+    ITVL+FGG+DDREALA+  RM EHPGI L 
Sbjct  600   MDESPCSVAILVDRGLGGTTRVASSDFSLAITVLFFGGNDDREALAFAVRMAEHPGITLN  659

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDED------FLAAFKQRNS------TNS  544
             V RF    E    +VKL+++     S   ++R  D        A  K++ S      T S
Sbjct  660   VVRFIPSEEFKPDNVKLEITEDQVGSCSGETRLTDIEAITELKAKIKEQESSRSDSDTES  719

Query  543   SVKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDK-KGECPELGPLGNLLS  367
              + YEE++VK      EAI+ Y+R NL +VG+ P+G + + +D  + + PELGP+GNLL+
Sbjct  720   QIVYEERIVKCQEGVCEAIKEYSRSNLFLVGKSPDGSVASGLDVLRSDTPELGPVGNLLT  779

Query  366   CKE-FSTTASVLVVQQY  319
               E  ST ASVLVVQQY
Sbjct  780   SSESVSTVASVLVVQQY  796



>gb|KDO76398.1| hypothetical protein CISIN_1g0036452mg, partial [Citrus sinensis]
 gb|KDO76399.1| hypothetical protein CISIN_1g0036452mg, partial [Citrus sinensis]
Length=732

 Score =   916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/734 (68%), Positives = 596/734 (81%), Gaps = 12/734 (2%)
 Frame = -1

Query  2463  GGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKA  2284
             GG+LLGPSA GRSE +L A+FP KS TVLDTLA+LGL+FF+FLVGLELDPKSLR+TGKKA
Sbjct  1     GGILLGPSALGRSERFLQAVFPPKSQTVLDTLANLGLIFFMFLVGLELDPKSLRQTGKKA  60

Query  2283  LSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKL  2104
             L IA+AGISLPF LGIG+SF+LR TI+KGV    FLVFMGVALSITAFPVLARILAELKL
Sbjct  61    LGIAIAGISLPFALGIGSSFLLRETISKGVDSTSFLVFMGVALSITAFPVLARILAELKL  120

Query  2103  LTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPR  1924
             LT DVG+MAMSAAAVNDVAAWILLALA+ALSG+G S L+ +WV L G  FV+   L VP 
Sbjct  121   LTADVGRMAMSAAAVNDVAAWILLALAVALSGSGQSSLVPVWVFLSGCVFVICLTLFVPP  180

Query  1923  IFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLAS  1744
              FKWMA +C EGEPV+E YVCA LAAVL AGF+TD IGIHA+FGAFV+GVLVPK+GP A+
Sbjct  181   TFKWMARQCHEGEPVEETYVCATLAAVLAAGFITDAIGIHAMFGAFVVGVLVPKEGPFAN  240

Query  1743  ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVST  1564
             ALVEKVEDLVSG+FLPLYFVSSGLKTN+ATIQG QSWGLL LVI TAC GKI+GT +VS 
Sbjct  241   ALVEKVEDLVSGIFLPLYFVSSGLKTNIATIQGLQSWGLLALVILTACLGKIVGTFVVSL  300

Query  1563  LCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI  1384
               ++P +EA+ LG LMNTKGLVELIVLNIGKDR VLNDQ FAIM+LMA+ TTF+TTP+V+
Sbjct  301   SFKVPLREALALGILMNTKGLVELIVLNIGKDRKVLNDQVFAIMILMAVVTTFMTTPLVM  360

Query  1383  ALYKPAKLA-VTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFK  1207
             A+YKPA+ A V +YK+RT++RK+   Q RIL CFHS RNIPS INL+EA RG +KS G  
Sbjct  361   AVYKPARRARVADYKHRTVERKNSKAQFRILACFHSARNIPSTINLLEALRGIQKSEGLC  420

Query  1206  VYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPS  1027
             VYA+HLMELSERSSAILM HKAR+NGLPFWN RG  ++   IVVAFE F+ LS+VS+RP 
Sbjct  421   VYALHLMELSERSSAILMVHKARRNGLPFWN-RGRQSNPNHIVVAFEAFQQLSRVSVRPM  479

Query  1026  TAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCS  847
             TAIS+MS MHEDI  +AE KR A+IILPFHKHQ++DG  ETTR++ R VN+RVL+ APCS
Sbjct  480   TAISSMSDMHEDICTTAESKRAAIIILPFHKHQRLDGSLETTRSDFRWVNQRVLKHAPCS  539

Query  846   VGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLD  667
             VGIL+DRGLGGT+ VSASNV YTITVL+FGG DDREALA GARM EHPGI  +V RF L 
Sbjct  540   VGILIDRGLGGTTQVSASNVSYTITVLFFGGRDDREALACGARMAEHPGISFIVIRFLLA  599

Query  666   PETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAI  487
              +  G +V +D++ + S        DE+ L+ FK + S N SV+YEE++V++ AET+  I
Sbjct  600   ADAIGNTVSVDMAGNASM-------DEEVLSEFKLKTSRNGSVRYEERLVRNTAETIAVI  652

Query  486   RGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTEL  307
             R  +RCNLL+VGRMP+GE+  A+  + +C ELGP+G+LL+  EFS TASVL++QQY   +
Sbjct  653   REVSRCNLLLVGRMPDGELALALSTRSDCLELGPVGSLLTSLEFS-TASVLIIQQYSDRV  711

Query  306   SKNGLK--EDDSVD  271
               N     E+DS D
Sbjct  712   FMNLASELEEDSPD  725



>ref|XP_007225273.1| hypothetical protein PRUPE_ppa001482mg [Prunus persica]
 gb|EMJ26472.1| hypothetical protein PRUPE_ppa001482mg [Prunus persica]
Length=816

 Score =   913 bits (2359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/808 (65%), Positives = 629/808 (78%), Gaps = 25/808 (3%)
 Frame = -1

Query  2628  APMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLL  2449
             APMKATSNGSFQG++PLD+ALPLLI+QICLVV+ TR LA+LL+PLRQPRVIAE+IGG+LL
Sbjct  9     APMKATSNGSFQGENPLDFALPLLILQICLVVVFTRTLAFLLKPLRQPRVIAEVIGGILL  68

Query  2448  GPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIAL  2269
             GPSA GRSE +L+ +FP KS+TVLDT+A++GLLFFLFL+GLELD +++RRTGKK+L IA+
Sbjct  69    GPSALGRSEKFLHTVFPAKSMTVLDTVANIGLLFFLFLIGLELDIRAIRRTGKKSLGIAV  128

Query  2268  AGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDV  2089
             AGI+LPF LG+ TSF+LR+T++KGVSQGPFLVF+GVALSITAFPVLARILAELKLLTTDV
Sbjct  129   AGITLPFVLGVFTSFVLRSTVSKGVSQGPFLVFIGVALSITAFPVLARILAELKLLTTDV  188

Query  2088  GQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWM  1909
             G++AMSAAA+NDVAAWILLALAIAL+GT  SPL+S+WVLLCG GFV  CI  +  +   M
Sbjct  189   GRIAMSAAAINDVAAWILLALAIALTGTNTSPLVSVWVLLCGAGFVGFCIFALRPLLAMM  248

Query  1908  ASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEK  1729
             A R  EGEPV E+Y+C  L+ VL A FVTDTIGIHALFGAFV+G++VPKDGP A  L+EK
Sbjct  249   ARRSPEGEPVKELYICITLSLVLAASFVTDTIGIHALFGAFVVGIVVPKDGPFAGVLIEK  308

Query  1728  VEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIP  1549
             +EDLVSGLFLPLYFVSSGLKTNVATI G  SWGLLVLVIFTA FGKI+GT+ +S +C++ 
Sbjct  309   IEDLVSGLFLPLYFVSSGLKTNVATISGGLSWGLLVLVIFTASFGKIVGTVALSMMCKVH  368

Query  1548  FQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKP  1369
             F+EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAI VLMALFTTFITTP+V+A+YKP
Sbjct  369   FREALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIFVLMALFTTFITTPLVMAIYKP  428

Query  1368  AKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHL  1189
             A+     YK R+  RK+P  +LR+L CFHS RNIP++INLIE+SRGT K G   VYAMHL
Sbjct  429   ARRG-APYKNRSFFRKNPDTELRMLACFHSTRNIPTMINLIESSRGTRKRGRLTVYAMHL  487

Query  1188  MELSERSSAILMCHKARKNGLPFWNTRGEPTDSTE--IVVAFETFEHLSKVSIRPSTAIS  1015
             MELSERSSAI M HKAR NGLPFWN + + T+S +  +V+AFE +E LS V +RP TAIS
Sbjct  488   MELSERSSAISMVHKARYNGLPFWNKKTDDTNSNKDHMVIAFEAYEQLSTVKVRPMTAIS  547

Query  1014  AMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGIL  835
             +++ +HEDI ASA  K VAMI+LPFHKHQ++DG  E+  N  R VN RVL  APCSVGIL
Sbjct  548   SLNDIHEDICASAHHKSVAMILLPFHKHQRLDGTMESLGNSFRSVNERVLRHAPCSVGIL  607

Query  834   VDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDP---  664
             VDRGLGGT+ VSAS+V Y + V +FGG DDREALAYG R+ EHPGI + + +F   P   
Sbjct  608   VDRGLGGTAQVSASDVSYNVVVAFFGGRDDREALAYGMRLAEHPGIVMTLVKFVAPPGKT  667

Query  663   -----ETAG-TsvkldvspsgssspeekSRDEDFLAAFKQ-RNSTNS-----SVKYEEKV  520
                  +  G TS K           +EK  DE FLA +   RNS N      S+ YEEKV
Sbjct  668   LIFGAKLVGITSDKNKKIVKEEDCGDEKEDDESFLAEYMSVRNSKNKEGGEPSMLYEEKV  727

Query  519   VKSAAETMEAIRGYNR-CNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTA  343
             V+S AE    ++   R  NL VVGRMP       +D   +C ELGP+G+ L+  EFS+TA
Sbjct  728   VESKAEICVVLKSMGRNVNLFVVGRMP--PTAPLVDSTSDCAELGPVGSFLASSEFSSTA  785

Query  342   SVLVVQQYRTELSKNGLKEDDSVDGDYE  259
             SV+V+QQY    S+  + E    + DYE
Sbjct  786   SVVVLQQYNPTASQPLVVE----EADYE  809



>ref|XP_006297013.1| hypothetical protein CARUB_v10013004mg [Capsella rubella]
 ref|XP_006297014.1| hypothetical protein CARUB_v10013004mg [Capsella rubella]
 gb|EOA29911.1| hypothetical protein CARUB_v10013004mg [Capsella rubella]
 gb|EOA29912.1| hypothetical protein CARUB_v10013004mg [Capsella rubella]
Length=800

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/800 (65%), Positives = 618/800 (77%), Gaps = 12/800 (2%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
             +N T  CP PMKATSNG+FQ +SPLD+ALPL+I+QI LVV  TR+LAY L+PL+QPRVIA
Sbjct  4     TNVTGQCPGPMKATSNGAFQNESPLDFALPLIILQIVLVVAFTRLLAYFLKPLKQPRVIA  63

Query  2472  EIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTG  2293
             EIIGG+LLGPSA GRS+ YL+ IFPKKSLTVLDTLA++GLLFFLFLVGLELD  ++R+TG
Sbjct  64    EIIGGILLGPSALGRSKVYLDTIFPKKSLTVLDTLANIGLLFFLFLVGLELDFAAIRKTG  123

Query  2292  KKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAE  2113
             KK+L IALAGISLPF LG+GTSF+L ATI+KGV Q PF+VFMGVALSITAFPVLARILAE
Sbjct  124   KKSLLIALAGISLPFILGVGTSFVLSATISKGVHQLPFIVFMGVALSITAFPVLARILAE  183

Query  2112  LKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILV  1933
             LKLLTTD+G+MAMSAA VNDVAAWILLALAIALSG G SPL+S+WVLLCG+GFV+  ++ 
Sbjct  184   LKLLTTDIGRMAMSAAGVNDVAAWILLALAIALSGDGTSPLVSVWVLLCGSGFVIFAVVA  243

Query  1932  VPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
             +  +  +MA RC EGEPV E+YVC  L  VL A FVTDTIGIHALFGAFV+G++ PK+GP
Sbjct  244   IKPLLAYMARRCPEGEPVKELYVCVTLTLVLSASFVTDTIGIHALFGAFVVGIVTPKEGP  303

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
                 L EK+EDLVSGL LPLYF +SGLKT+V TI+G QSWGLLVLVI T CFGKI GT+ 
Sbjct  304   FCRVLTEKIEDLVSGLLLPLYFAASGLKTDVTTIRGGQSWGLLVLVILTTCFGKIFGTVG  363

Query  1572  VSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTP  1393
              S LC++PF+EA+ LG LMNTKGLVELIVLNIGKDR VLNDQ FAI+VLMALFTTFITTP
Sbjct  364   ASMLCKVPFREAMALGVLMNTKGLVELIVLNIGKDRKVLNDQAFAILVLMALFTTFITTP  423

Query  1392  IVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGG  1213
             I++A+YKPA+     YK+RTIQRKD   +LRIL CFHS RNIP+LINLIE+SRGT K G 
Sbjct  424   ILMAIYKPARKG-APYKHRTIQRKDHDSELRILACFHSSRNIPTLINLIESSRGTGKKGR  482

Query  1212  FKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIR  1033
               VYAMHLMELSERSSAI M HKAR NG+P WN     TD  ++V+AFE ++HL  V++R
Sbjct  483   LCVYAMHLMELSERSSAIAMVHKARNNGIPIWNKIERSTD--QMVIAFEAYQHLRAVAVR  540

Query  1032  PSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAP  853
             P TAIS +SS+H DI  SA  KRVAMI+LPFHKHQ++DG  E+  N    VN+RVL+ AP
Sbjct  541   PMTAISDLSSIHVDICTSAHQKRVAMILLPFHKHQRVDGAMESIGNGFHEVNQRVLQRAP  600

Query  852   CSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFT  673
             CSVGILVDRGLGG S V AS V Y + V +FGG DDREALAYG +MVEHPGI L V +F 
Sbjct  601   CSVGILVDRGLGGASQVVASEVAYKVVVPFFGGLDDREALAYGMKMVEHPGITLTVLKFV  660

Query  672   LDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETME  493
                   GT  + + S    +  +EK  DE+F+         N S+ YEE+VV+S  +   
Sbjct  661   ---AARGTLKRFEKSTQDENEKKEKETDEEFVRELMNDPRGNESLAYEERVVESKDDINA  717

Query  492   AIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRT  313
              ++  ++CNL VVGR      VA++    +CPELGP+G LLS  EFSTTASVLVVQ Y  
Sbjct  718   TLKSMSKCNLFVVGR---NAAVASLISSTDCPELGPVGRLLSSSEFSTTASVLVVQGYDP  774

Query  312   ELSKNGLKEDDSVDGDYESA  253
                   L E+D+   +Y+ A
Sbjct  775   AADTRPLVEEDA---NYDHA  791



>ref|XP_004162369.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis sativus]
Length=790

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/782 (65%), Positives = 620/782 (79%), Gaps = 11/782 (1%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CPA MKATSNG FQGD+PLD+ALPL I QICLVVLLTR+L +LLRPLR+PRVIAEI+GG+
Sbjct  6     CPAEMKATSNGVFQGDNPLDFALPLAIFQICLVVLLTRLLGFLLRPLREPRVIAEIVGGI  65

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GRS+ +L  +FP+KSLTVLDTLA++GLLFFLFLVGLELDPKSLRRTGK A+ I
Sbjct  66    LLGPSAVGRSQGFLQRVFPEKSLTVLDTLANMGLLFFLFLVGLELDPKSLRRTGKGAMGI  125

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             A+AGI+LP  LGIGTS++LR+TI+KGV+  PFL+F+ VALSITAFPVLARILAELKLLTT
Sbjct  126   AMAGITLPLLLGIGTSYVLRSTISKGVNGPPFLIFIAVALSITAFPVLARILAELKLLTT  185

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             ++G++AMSAAAVNDVAAWILLALAIALSGT  SPL+SLWV LC + FVL C   +P  F+
Sbjct  186   NLGRIAMSAAAVNDVAAWILLALAIALSGTPRSPLVSLWVFLCSSVFVLFCFFTLPPAFR  245

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             W++ R S+GEPV E+Y+CA L+ VL AGF+TD IGIHALFGAFV+GVLVPK+GPLA ALV
Sbjct  246   WISHRSSKGEPVSELYICATLSTVLAAGFITDLIGIHALFGAFVVGVLVPKEGPLAGALV  305

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVS LFLPLYFVSSGLKTN+ TIQG QSWGLL+LVIFTACFGKI+GTIL++  C+
Sbjct  306   EKVEDLVSSLFLPLYFVSSGLKTNITTIQGIQSWGLLILVIFTACFGKIIGTILMALFCK  365

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +P QE+I LGFLMNTKGLVELIVLNIGKDR VLNDQTFAI+VLMA+ TTF TTPIV+A+Y
Sbjct  366   MPIQESIALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAILVLMAVITTFFTTPIVMAVY  425

Query  1374  KPAKL-AVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGG----F  1210
             KPAK  + +EY  RTI+R++P+ +LRIL CFHS  NIPS++NLIE SRG E   G     
Sbjct  426   KPAKRKSKSEYINRTIEREEPNSELRILACFHSVNNIPSILNLIEVSRGMEGKEGCGSEL  485

Query  1209  KVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRP  1030
              VYAMHLMEL+ERSSAI+M H+ARKNG PFWN +G  +   EI VAF+ FE LS+VSIRP
Sbjct  486   CVYAMHLMELTERSSAIVMVHRARKNGRPFWN-KGGKSSCDEIGVAFKAFEQLSRVSIRP  544

Query  1029  STAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPC  850
              TAIS +S MHED+   AE KR A+IILPFHKHQ+ DGH E TR + + VN++VL+ +PC
Sbjct  545   MTAISRLSDMHEDVCNRAERKRAAIIILPFHKHQRFDGHLEATRGDFQSVNQKVLQQSPC  604

Query  849   SVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTL  670
             SVGILVDRG GG SH+S++N+  TIT+ +FGG DDREALA+G RM +H    L +  F  
Sbjct  605   SVGILVDRGFGGGSHISSTNISSTITIFFFGGCDDREALAFGRRMSQHSKTTLNIVHFIF  664

Query  669   DPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEA  490
                       +       +       DE  L  F  + +   S++YEE+VV S +  +E 
Sbjct  665   TSNVNNAESTMVEMSKDDTKSSTVI-DERVLMEFNGKKTNEMSIRYEERVVSSFSNVIEV  723

Query  489   IRGYNRCNLLVVGRMPEGEIVAAMDK----KGECPELGPLGNLLSCKEFSTTASVLVVQQ  322
             IR ++RCNL++VG+ PEGE+V  + +      ECPELGP+GNLL  KE S +AS+LV+QQ
Sbjct  724   IREFSRCNLILVGQKPEGEVVKNLVEYFKINVECPELGPVGNLLISKELSISASILVLQQ  783

Query  321   YR  316
             +R
Sbjct  784   FR  785



>ref|XP_004149769.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis sativus]
Length=790

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/782 (65%), Positives = 620/782 (79%), Gaps = 11/782 (1%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CPA MKATSNG FQGD+PLD+ALPL I QICLVVLLTR+L +LLRPLR+PRVIAEI+GG+
Sbjct  6     CPAEMKATSNGVFQGDNPLDFALPLAIFQICLVVLLTRLLGFLLRPLREPRVIAEIVGGI  65

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GRS+ +L  +FP+KSLTVLDTLA++GLLFFLFLVGLELDPKSLRRTGK A+ I
Sbjct  66    LLGPSAVGRSQGFLRRVFPEKSLTVLDTLANMGLLFFLFLVGLELDPKSLRRTGKGAMGI  125

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             A+AGI+LP  LGIGTS++LR+TI+KGV+  PFL+F+ VALSITAFPVLARILAELKLLTT
Sbjct  126   AMAGITLPLLLGIGTSYVLRSTISKGVNGPPFLIFIAVALSITAFPVLARILAELKLLTT  185

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             ++G++AMSAAAVNDVAAWILLALAIALSGT  SPL+SLWV LC + FVL C   +P  F+
Sbjct  186   NLGRIAMSAAAVNDVAAWILLALAIALSGTPRSPLVSLWVFLCSSVFVLFCFFTLPPAFR  245

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             W++ R S+GEPV E+Y+CA L+ VL AGF+TD IGIHALFGAFV+GVLVPK+GPLA ALV
Sbjct  246   WISHRSSKGEPVSELYICATLSTVLAAGFITDLIGIHALFGAFVVGVLVPKEGPLAGALV  305

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVS LFLPLYFVSSGLKTN+ TIQG QSWGLL+LVIFTACFGKI+GTIL++  C+
Sbjct  306   EKVEDLVSSLFLPLYFVSSGLKTNITTIQGIQSWGLLILVIFTACFGKIIGTILMALFCK  365

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +P QE+I LGFLMNTKGLVELIVLNIGKDR VLNDQTFAI+VLMA+ TTF TTPIV+A+Y
Sbjct  366   MPIQESIALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAILVLMAVITTFFTTPIVMAVY  425

Query  1374  KPAKL-AVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGG----F  1210
             KPAK  + +EY  RTI+R++P+ +LRIL CFHS  NIPS++NLIE SRG E   G     
Sbjct  426   KPAKRKSKSEYINRTIEREEPNSELRILACFHSVNNIPSILNLIEVSRGMEGKEGCGSEL  485

Query  1209  KVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRP  1030
              VYAMHLMEL+ERSSAI+M H+ARKNG PFWN +G  +   EI VAF+ FE LS+VSIRP
Sbjct  486   CVYAMHLMELTERSSAIVMVHRARKNGRPFWN-KGGKSSCDEIGVAFKAFEQLSRVSIRP  544

Query  1029  STAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPC  850
              TAIS +S MHED+   AE KR A+IILPFHKHQ+ DGH E TR + + VN++VL+ +PC
Sbjct  545   MTAISRLSDMHEDVCNRAERKRAAIIILPFHKHQRFDGHLEATRGDFQSVNQKVLQQSPC  604

Query  849   SVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTL  670
             SVGILVDRG GG SH+S++N+  TIT+ +FGG DDREALA+G RM +H    L +  F  
Sbjct  605   SVGILVDRGFGGGSHISSTNISSTITIFFFGGCDDREALAFGRRMSQHSKTTLNIVHFIF  664

Query  669   DPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEA  490
                       +       +       DE  L  F  + +   S++YEE+VV S +  +E 
Sbjct  665   TSNVNNAESTMVEMNKDDTKSSAVI-DERVLMEFNGKKTNEMSIRYEERVVSSFSNVIEV  723

Query  489   IRGYNRCNLLVVGRMPEGEIVAAMDK----KGECPELGPLGNLLSCKEFSTTASVLVVQQ  322
             IR ++RCNL++VG+ PEGE+V  + +      ECPELGP+GNLL  KE S +AS+LV+QQ
Sbjct  724   IREFSRCNLILVGQKPEGEVVKNLVEYFKINVECPELGPVGNLLISKELSISASILVLQQ  783

Query  321   YR  316
             +R
Sbjct  784   FR  785



>gb|ACC91238.1| putative cation/hydrogen exchanger [Arabidopsis halleri]
Length=821

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/822 (64%), Positives = 639/822 (78%), Gaps = 23/822 (3%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             MG+NGT  CP PMKATSNG FQG++PLD+ALPLLI+QIC+V+LLTR+LA+LLRPLRQPRV
Sbjct  1     MGTNGTT-CPGPMKATSNGVFQGENPLDHALPLLILQICIVLLLTRILAFLLRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA G+S  ++N +FP KSLTVLDTLA+LGL+FFLFLVGLELDPKSL+R
Sbjct  60    IAEIVGGILLGPSALGKSSKFINTVFPPKSLTVLDTLANLGLIFFLFLVGLELDPKSLKR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGK+ALSIALAGI+LPF LGIGTSF LR++IA GVS+ PFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKRALSIALAGITLPFILGIGTSFALRSSIADGVSKAPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE+KLLTTD+G++A+SAAAVNDVAAWILLALA+ALSG G SPL SLWV L G GFVL CI
Sbjct  180   AEIKLLTTDIGKIALSAAAVNDVAAWILLALAVALSGEGSSPLTSLWVFLSGCGFVLFCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              VV    K +A RC EGEPV+E+YVC  L  VL A FVTD IGIHALFGAFVIGV+ PK+
Sbjct  240   FVVQPGIKLIAKRCPEGEPVNELYVCCTLGIVLAASFVTDLIGIHALFGAFVIGVIFPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A+ALVEKVEDLVSGLFLPLYFVSSGLKT+VATIQGAQSWGLLVLVIF ACFGKI+GT
Sbjct  300   GNFANALVEKVEDLVSGLFLPLYFVSSGLKTDVATIQGAQSWGLLVLVIFNACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             +LVS  C++P  +++ LGFLMNTKGLVELIVLNIGKDRGVLNDQ FAIMVLMA+FTTF+T
Sbjct  360   VLVSLYCKVPLDQSLALGFLMNTKGLVELIVLNIGKDRGVLNDQVFAIMVLMAIFTTFMT  419

Query  1398  TPIVIALYKPAK-LAVTEYKYRTIQRKDPS-KQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKP K L   +YK RT++  + S K L ++ CF S  NIP+++NLIEASRG  
Sbjct  420   TPLVLAVYKPGKSLTKGDYKNRTVEETNRSNKPLCLMFCFQSIMNIPTIVNLIEASRGIN  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWN---TRGEPTDSTEIVVAFETFEH  1054
             +     VYAMHLMELSERSSAILM HK R+NGLPFWN   T    + S  +VVAFE F  
Sbjct  480   RKENLSVYAMHLMELSERSSAILMAHKVRRNGLPFWNKDKTGNNSSTSDMVVVAFEAFRR  539

Query  1053  LSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNR  874
             LS+VS+RP TAIS M+++HEDI  SAE K+ AM+ILPFHKH ++D  +ETTRN+ R +N+
Sbjct  540   LSRVSVRPMTAISPMATIHEDICQSAERKKTAMVILPFHKHVRLDRTWETTRNDYRWINK  599

Query  873   RVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGIC  694
             +V+E +PCSV ILVDRGLGGT+ V++S+    ITVL+FGG+DDREALA+  RM EHPGI 
Sbjct  600   KVMEESPCSVAILVDRGLGGTTRVASSDFSLAITVLFFGGNDDREALAFAVRMAEHPGIT  659

Query  693   LVVARFT----LDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSS-----  541
             L V RF       PE     +  D   SG +   +     +  A  K++ S+ S+     
Sbjct  660   LTVVRFIPSEEFKPENVKVEIIEDQVGSGETRLIDIEAITELKAKIKEQESSRSNSDSES  719

Query  540   -VKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLLS  367
              + YEEK+V+   E +E I  Y+R NL +VG+ PEG + + ++  + + PELGP+GNLL+
Sbjct  720   LIVYEEKIVQCYEEVIEVINEYSRSNLFLVGKSPEGLVASGVNLVRSDTPELGPIGNLLT  779

Query  366   CKE-FSTTASVLVVQQYRTEL----SKNGLKEDDSVDGDYES  256
               E  ST AS+LVVQQY T      SKN   E+  V  D ES
Sbjct  780   ASESISTVASILVVQQYITSRLVVGSKNVTIEESHVK-DSES  820



>ref|XP_010541354.1| PREDICTED: cation/H(+) antiporter 17-like [Tarenaya hassleriana]
Length=826

 Score =   911 bits (2355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/803 (65%), Positives = 620/803 (77%), Gaps = 28/803 (3%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +NGT  CP PMKATSNG FQG++PLDYALPL+I+QIC+VV+LTR L++ LRPLRQPRV
Sbjct  1     MATNGT--CPEPMKATSNGIFQGENPLDYALPLVILQICIVVVLTRTLSFFLRPLRQPRV  58

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA G+S  + + IFP +SLTVLDT+A+LGLLFFLFLVGLELDP+SLRR
Sbjct  59    IAEIVGGILLGPSALGKSSKFRDTIFPPRSLTVLDTVANLGLLFFLFLVGLELDPRSLRR  118

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGK ALSIA+AG++ PF LGIGTSF LR TI+ GV   PFLVFMGVALSITAFPVLARIL
Sbjct  119   TGKNALSIAIAGMTFPFVLGIGTSFALRHTISDGVDNAPFLVFMGVALSITAFPVLARIL  178

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE+KLLTTD+G++A+SAAAVNDVAAWILLALA+ALSG   SPL SLWV L    FV+ C+
Sbjct  179   AEIKLLTTDIGKIALSAAAVNDVAAWILLALAVALSGDSDSPLTSLWVFLSSCIFVIFCV  238

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              VV    KWMA RC EGEPV E YVC  LAAVL A FVTD IGIHALFGAFV+GV+ PK+
Sbjct  239   FVVRPGLKWMAKRCHEGEPVKEQYVCCTLAAVLAASFVTDAIGIHALFGAFVLGVIFPKE  298

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  AS+LVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIF ACFGKI+GT
Sbjct  299   GNFASSLVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFNACFGKIVGT  358

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             ++VS  C++P  E++ LGFLMNTKGLVELIVLNIGKDRGVLNDQ FAIMVLMA+FTTFIT
Sbjct  359   VVVSIFCKVPVAESLALGFLMNTKGLVELIVLNIGKDRGVLNDQVFAIMVLMAIFTTFIT  418

Query  1398  TPIVIALYKPAK-LAVTEYKYRTIQRKDPSK-QLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKPAK L+  EYK+RT+++   S  QLR+L C+HS  NIP+++NLIEASRGT+
Sbjct  419   TPLVMAVYKPAKTLSKGEYKHRTVEKASESNAQLRLLVCYHSIMNIPTIVNLIEASRGTD  478

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             +  G  VYAMHLMELSER SAILM HKA KNGLPFW        S  I+VAFE F HLS 
Sbjct  479   REEGLCVYAMHLMELSERPSAILMVHKAGKNGLPFWKKGLFGNSSDVIMVAFEAFRHLSH  538

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             VS+RP TAIS M+++HEDI  SAE KR AM+I+PFHKH  +DG +ETTR E R +N++++
Sbjct  539   VSVRPMTAISGMATIHEDICHSAERKRAAMVIIPFHKHATLDGTWETTRTEYRSINKKII  598

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             E +PCSV ILVDRGLG T+ VS+SN    ITVL+FGG+DDREALA+  RM EHPGI L V
Sbjct  599   EHSPCSVAILVDRGLGRTTRVSSSNFSLVITVLFFGGNDDREALAFALRMAEHPGISLTV  658

Query  684   ARFT----LDPETAGTsvkldvspsgssspeekSRD----EDFLAAFKQRNSTN------  547
              +F     L PE                + E K RD     +  A  KQR  ++      
Sbjct  659   LQFIPIHFLKPEEV---KLEITEDRIIGTSETKLRDAQAISELKAKVKQRQESSSGSDAG  715

Query  546   ------SSVKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGP  385
                   S + YEEK+VK + + +E IR Y+R N+ +VG+ P+G +++ +++  + PELGP
Sbjct  716   PSSASYSQIVYEEKIVKRSEDVVEIIREYSRSNIFLVGKSPDGPVLSGLNRISDTPELGP  775

Query  384   LGNLLSCKE-FSTTASVLVVQQY  319
             +GN+L+  E   T ASVLVVQ Y
Sbjct  776   VGNMLTWNEVVRTPASVLVVQHY  798



>gb|KGN53374.1| hypothetical protein Csa_4G050780 [Cucumis sativus]
Length=797

 Score =   911 bits (2355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/794 (65%), Positives = 625/794 (79%), Gaps = 14/794 (2%)
 Frame = -1

Query  2661  IMGSNGTVV---CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLR  2491
             +M  N T+V   CPA MKATSNG FQGD+PLD+ALPL I QICLVVLLTR+L +LLRPLR
Sbjct  1     MMVVNTTMVGSGCPAEMKATSNGVFQGDNPLDFALPLAIFQICLVVLLTRLLGFLLRPLR  60

Query  2490  QPRVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPK  2311
             +PRVIAEI+GG+LLGPSA GRS+ +L  +FP+KSLTVLDTLA++GLLFFLFLVGLELDPK
Sbjct  61    EPRVIAEIVGGILLGPSAVGRSQGFLRRVFPEKSLTVLDTLANMGLLFFLFLVGLELDPK  120

Query  2310  SLRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVL  2131
             SLRRTGK A+ IA+AGI+LP  LGIGTS++LR+TI+KGV+  PFL+F+ VALSITAFPVL
Sbjct  121   SLRRTGKGAMGIAMAGITLPLLLGIGTSYVLRSTISKGVNGPPFLIFIAVALSITAFPVL  180

Query  2130  ARILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFV  1951
             ARILAELKLLTT++G++AMSAAAVNDVAAWILLALAIALSGT  SPL+SLWV LC + FV
Sbjct  181   ARILAELKLLTTNLGRIAMSAAAVNDVAAWILLALAIALSGTPRSPLVSLWVFLCSSVFV  240

Query  1950  LLCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVL  1771
             L C   +P  F+W++ R S+GEPV E+Y+CA L+ VL AGF+TD IGIHALFGAFV+GVL
Sbjct  241   LFCFFTLPPAFRWISHRSSKGEPVSELYICATLSTVLAAGFITDLIGIHALFGAFVVGVL  300

Query  1770  VPKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGK  1591
             VPK+GPLA ALVEKVEDLVS LFLPLYFVSSGLKTN+ TIQG QSWGLL+LVIFTACFGK
Sbjct  301   VPKEGPLAGALVEKVEDLVSSLFLPLYFVSSGLKTNITTIQGIQSWGLLILVIFTACFGK  360

Query  1590  ILGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFT  1411
             I+GTIL++  C++P QE+I LGFLMNTKGLVELIVLNIG DR VLNDQTFAI+VLMA+ T
Sbjct  361   IIGTILMALFCKMPIQESIALGFLMNTKGLVELIVLNIGNDRKVLNDQTFAILVLMAVIT  420

Query  1410  TFITTPIVIALYKPAKL-AVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASR  1234
             TF TTPIV+A+YKPAK  + +EY  RTI+R++P+ +LRIL CFHS  NIPS++NLIE SR
Sbjct  421   TFFTTPIVMAVYKPAKRKSKSEYINRTIEREEPNSELRILACFHSVNNIPSILNLIEVSR  480

Query  1233  GTEKSGG----FKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFE  1066
             G E   G      VYAMHLMEL+ERSSAI+M H+ARKNG PFWN +G  +   EI VAF+
Sbjct  481   GMEGKEGCGSELCVYAMHLMELTERSSAIVMVHRARKNGRPFWN-KGGKSSCDEIGVAFK  539

Query  1065  TFEHLSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELR  886
              FE LS+VSIRP TAIS +S MHED+   AE KR A+IILPFHKHQ+ DGH E TR + +
Sbjct  540   AFEQLSRVSIRPMTAISRLSDMHEDVCNRAERKRAAIIILPFHKHQRFDGHLEATRGDFQ  599

Query  885   HVNRRVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEH  706
              VN++VL+ +PCSVGILVDRG GG SH+S++N+  TIT+ +FGG DDREALA+G RM +H
Sbjct  600   SVNQKVLQQSPCSVGILVDRGFGGGSHISSTNISSTITIFFFGGCDDREALAFGRRMSQH  659

Query  705   PGICLVVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEE  526
                 L +  F            +       +       DE  L  F  + +   S++YEE
Sbjct  660   SKTTLNIVHFIFTSNVNNAESTMVEMNKDDTKSSAVI-DERVLMEFNGKKTNEMSIRYEE  718

Query  525   KVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDK----KGECPELGPLGNLLSCKE  358
             +VV S +  +E IR ++RCNL++VG+ PEGE+V  + +      ECPELGP+GNLL  KE
Sbjct  719   RVVSSFSNVIEVIREFSRCNLILVGQKPEGEVVKNLVEYFKINVECPELGPVGNLLISKE  778

Query  357   FSTTASVLVVQQYR  316
              S +AS+LV+QQ+R
Sbjct  779   LSISASILVLQQFR  792



>emb|CDY47629.1| BnaA01g13360D [Brassica napus]
Length=798

 Score =   909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/816 (65%), Positives = 627/816 (77%), Gaps = 34/816 (4%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             MG+N T  CP PMKATSNG FQG++PL +ALPLLI+QIC+V+ LTRVLA++LRPLRQPRV
Sbjct  1     MGTNDTT-CPGPMKATSNGVFQGENPLQHALPLLILQICIVLFLTRVLAFILRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA G+S  +L+ +FP KSLTVLDTLA+LGL+FFLFLVGLELDPKSL+R
Sbjct  60    IAEIVGGILLGPSALGKSSKFLDTVFPAKSLTVLDTLANLGLIFFLFLVGLELDPKSLKR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIALAGI+LPF  GIGTSF LR++IA G S+ PFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKKALSIALAGITLPFIFGIGTSFALRSSIADGASKAPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE+KLLTTD+G++A+SAAAVNDVAAWILLALA+ALSG G SPL SLWV L G GFV+ CI
Sbjct  180   AEIKLLTTDIGKIALSAAAVNDVAAWILLALAVALSGEGSSPLTSLWVFLAGCGFVVFCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              VV    KW+A RC EGEPV E YVC  L  VL A FVTD IGIHALFGAFVIGV+ PK+
Sbjct  240   FVVQPGMKWIAKRCPEGEPVKEHYVCLTLGIVLAASFVTDLIGIHALFGAFVIGVIFPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A++LVEK+EDLVSGLFLPLYFVSSGLKT+VATIQGAQSWGLLVLVIF ACFGKI+GT
Sbjct  300   GNFANSLVEKLEDLVSGLFLPLYFVSSGLKTDVATIQGAQSWGLLVLVIFNACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             ++VS  C++P  E++ LGFLMNTKGLVELIVLNIGKDRGVLNDQ FAIMVLMA+FTTF+T
Sbjct  360   VVVSLYCKVPLDESLALGFLMNTKGLVELIVLNIGKDRGVLNDQIFAIMVLMAIFTTFMT  419

Query  1398  TPIVIALYKPAKLAVT-EYKYRTIQRKDPS-KQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKP K +   +Y  RTI+  + S K LR++ CF S  NIP+++NLIEASRGT 
Sbjct  420   TPLVLAVYKPGKSSTKGDYNNRTIEETNRSNKPLRLMFCFQSIMNIPTIVNLIEASRGTN  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             +     VYAMHLMELSERSSAILM HK RKNGLPFWN       S  +VVAFE ++ LS+
Sbjct  480   RKETLSVYAMHLMELSERSSAILMAHKVRKNGLPFWNKDKSGNSSDMVVVAFEAYQRLSR  539

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             VS+RP TAISAM+++HEDI  SAE KR AM+ILPFHKH ++D  +ETTRNE R +N++V+
Sbjct  540   VSVRPMTAISAMATIHEDICRSAERKRAAMVILPFHKHVRLDRTWETTRNEYRLINKKVM  599

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             E APCSV ILVDRGLGG + VS+S+    ITVL+FGG+DDREALA+  RM EHPGI L V
Sbjct  600   EEAPCSVAILVDRGLGGATRVSSSDFSLAITVLFFGGNDDREALAFAVRMAEHPGISLTV  659

Query  684   ARFT----LDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVV  517
              RF       PE     +                  ED  A  K++ S+   + YEEK+V
Sbjct  660   VRFIPSEEFKPENVKLEIT-----------------EDQTAKLKEQESSECQIVYEEKIV  702

Query  516   KSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLL-SCKEFSTTA  343
             K   E  +A+  Y+R NL +VG+ PEG + + +   + + PELGP+GNLL S +  ST+A
Sbjct  703   KCHEEVCKAMDEYSRSNLFLVGKSPEGSVASGLHVMRSDTPELGPVGNLLTSSESVSTSA  762

Query  342   SVLVVQQYRTE-------LSKNGLKEDDSVDGDYES  256
             SVLVVQQY          + KN  KED  V  D ES
Sbjct  763   SVLVVQQYVASRDSPVVGVLKNATKEDSPVK-DTES  797



>ref|XP_010246811.1| PREDICTED: cation/H(+) antiporter 19 [Nelumbo nucifera]
Length=806

 Score =   909 bits (2349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/784 (65%), Positives = 619/784 (79%), Gaps = 11/784 (1%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M  N T VCPAPMKATSNGSFQG+ PLDYALPLLI+QICLVV+ TRV+  +L+PLRQPRV
Sbjct  1     MAKNVTTVCPAPMKATSNGSFQGEDPLDYALPLLILQICLVVVFTRVIGLILKPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEIIGG+LLGPSAFGRSE +L+ +FP + +TVLDTLA++GLL+FLFLVGLELD +++RR
Sbjct  61    IAEIIGGILLGPSAFGRSEKFLHKVFPARGMTVLDTLANIGLLYFLFLVGLELDLRAIRR  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKAL+IAL GIS PF LG+GTS +LRATI+KG   GPFLVFMGV+LSITAFPVLARIL
Sbjct  121   TGKKALAIALVGISFPFILGVGTSVVLRATISKGAKHGPFLVFMGVSLSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTD+G+MAMSAAAVNDVAAWILLALAIALSG+  SP+ISLWVLL G  FV   I
Sbjct  181   AELKLLTTDLGRMAMSAAAVNDVAAWILLALAIALSGSDTSPVISLWVLLSGAAFVTFAI  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
             LV+      MA R  EGEPV E+Y+CA L+ VL AGFVTDTIGIHALFGAFV+GV+VPKD
Sbjct  241   LVLRPALALMARRSPEGEPVKELYICATLSLVLAAGFVTDTIGIHALFGAFVVGVIVPKD  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP A  L+EK+EDLVSGLFLPLYFVSSGLKTNVATI+G QSWGLL LVIF ACFGKI+GT
Sbjct  301   GPFAGVLIEKIEDLVSGLFLPLYFVSSGLKTNVATIRGGQSWGLLCLVIFNACFGKIVGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             +++S +C++P +EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAI+VLMALFTTF+T
Sbjct  361   VVISIICKVPKREAVALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAILVLMALFTTFVT  420

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             TPIV+A+YKPA+ A   YK+RTI+R D   +LRIL CF+S RNIP++IN+IE+SRGT +S
Sbjct  421   TPIVMAVYKPARKA-APYKHRTIKRHDRDTELRILACFNSTRNIPTMINVIESSRGT-RS  478

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
              G  VYAMHLME SERSSAI M HKARKNGLPFWN +    D  ++V+AFE ++ LS V+
Sbjct  479   RGVCVYAMHLMEFSERSSAISMVHKARKNGLPFWNKKH--GDRDQMVIAFEAYQQLSNVT  536

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             IRP TAISA+ ++HEDI ASA+ KR ++I+LPFHKHQ++DG  E+  +    +N++VL  
Sbjct  537   IRPMTAISALQTIHEDICASAQRKRASIILLPFHKHQRLDGTMESLGHSFHLINQQVLRH  596

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             +PCSVGILVDRGLGGT+ VSAS V Y+I V +FGG DDREALAY  RM EHPGI L V +
Sbjct  597   SPCSVGILVDRGLGGTTQVSASEVSYSIVVPFFGGRDDREALAYAFRMAEHPGIVLTVVK  656

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQ----RNSTNSSVKYEEKVVKS  511
             F   P T+ T      +   +S       +++  A  +     R +   S  +EE+VV  
Sbjct  657   FEAQPGTSLTGDSNSGNRGSTSITVGTEEEDEKKADMEYLEELRENVPESTTFEERVVGG  716

Query  510   AAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLV  331
               +    ++  N+CNL +VGR P   IV  MD+  +CPELGP+G  L+  EFSTT+SV+V
Sbjct  717   KEDIRAVLKTMNKCNLFLVGRKP--PIVQLMDRT-DCPELGPVGAFLASSEFSTTSSVIV  773

Query  330   VQQY  319
             + QY
Sbjct  774   IHQY  777



>emb|CDY03530.1| BnaC01g15520D [Brassica napus]
Length=798

 Score =   907 bits (2345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/816 (65%), Positives = 626/816 (77%), Gaps = 34/816 (4%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             MG+N T  CP PMKATSNG FQG++PL +ALPLLI+QIC+V+ LTRVLA+LLRPLRQPRV
Sbjct  1     MGTNDTT-CPGPMKATSNGVFQGENPLQHALPLLILQICIVLFLTRVLAFLLRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA G+S  +LN +FP KSLTVLDTLA+LGL+FFLFLVGLELDPKSL+R
Sbjct  60    IAEIVGGILLGPSALGKSSKFLNTVFPAKSLTVLDTLANLGLIFFLFLVGLELDPKSLKR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIALAGI+LPF  GIGTSF LR++IA G S+ PFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKKALSIALAGITLPFIFGIGTSFALRSSIADGASKAPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE+KLLTTD+G++A+SAAAVNDVAAWILLALA+ALSG G SPL SLWV L G GFVL CI
Sbjct  180   AEIKLLTTDIGKIALSAAAVNDVAAWILLALAVALSGEGSSPLTSLWVFLAGCGFVLFCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              V+    KW+A RC EGEPV E YVC  L  VL A FVTD IGIHALFGAFVIGV+ PK+
Sbjct  240   FVLQPGMKWIAKRCPEGEPVKEHYVCLTLGIVLAASFVTDLIGIHALFGAFVIGVIFPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A++LVEK+EDLVSGLFLPLYFVSSGLKT+VATIQGAQSWGLLVLVIF ACFGKI+GT
Sbjct  300   GNFANSLVEKLEDLVSGLFLPLYFVSSGLKTDVATIQGAQSWGLLVLVIFNACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             ++VS  C++P  E++ LGFLMNTKGLVELIVLNIGKDRGVLNDQ FAIMVLMA+FTTF+T
Sbjct  360   VVVSLYCKVPLDESLALGFLMNTKGLVELIVLNIGKDRGVLNDQIFAIMVLMAIFTTFMT  419

Query  1398  TPIVIALYKPAKLAVT-EYKYRTIQRKDPS-KQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKP K +   +Y  RTI+  + S K LR++ CF S  NIP+++NLIEASRGT 
Sbjct  420   TPLVLAVYKPGKSSTKGDYNNRTIEETNRSNKPLRLMFCFQSIMNIPTIVNLIEASRGTN  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             +     VYAMHLMELSERSSAILM HK RKNGLPFWN       S  +VVAFE ++ LS+
Sbjct  480   RKETLSVYAMHLMELSERSSAILMAHKVRKNGLPFWNKDKSGNSSDMVVVAFEAYQRLSR  539

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             VS+RP TAISAM+++HEDI  SAE KR AM+ILPFHKH ++D  +ETTRNE R +N++V+
Sbjct  540   VSVRPMTAISAMATIHEDICRSAERKRAAMVILPFHKHVRLDRTWETTRNEYRLINKKVM  599

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             E APCSV ILVDRGLGG + VS+S+    ITVL+FGG+DDREALA+  RM EHPGI L V
Sbjct  600   EEAPCSVAILVDRGLGGATRVSSSDFSLAITVLFFGGNDDREALAFAVRMAEHPGISLTV  659

Query  684   ARFT----LDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVV  517
              RF       PE     +                  ED  A  K++ S+   + YEEK+V
Sbjct  660   VRFIPSEEFKPENVKLEIT-----------------EDQTAKLKEQESSECQIVYEEKIV  702

Query  516   KSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLL-SCKEFSTTA  343
                 E  +A+  Y+R NL +VG+ PEG + + +   + + PELGP+GNLL S +  ST+A
Sbjct  703   NCHEEVCKAMDEYSRSNLFLVGKSPEGSVASGLHVMRSDTPELGPVGNLLTSSESVSTSA  762

Query  342   SVLVVQQYRTE-------LSKNGLKEDDSVDGDYES  256
             SVLV+QQY          + KN  KED  V  D ES
Sbjct  763   SVLVMQQYVASRDSPVVGVLKNVTKEDSPVK-DTES  797



>ref|XP_002270854.1| PREDICTED: cation/H(+) antiporter 19 [Vitis vinifera]
Length=802

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/799 (64%), Positives = 624/799 (78%), Gaps = 14/799 (2%)
 Frame = -1

Query  2658  MGSNGTV-VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPR  2482
             M +NGT  VCPAPMKATSNGSFQGD+PLD+ALPLLI+QICLVV+ TR LA +L+PLRQPR
Sbjct  1     MATNGTAKVCPAPMKATSNGSFQGDNPLDFALPLLILQICLVVVFTRTLALILKPLRQPR  60

Query  2481  VIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLR  2302
             VIAEIIGG+LLGPSA GRS  +L+ +FP +S+TVLDT+A++GLLFFLFLVGLELD +++R
Sbjct  61    VIAEIIGGILLGPSALGRSTKFLHRVFPARSMTVLDTVANIGLLFFLFLVGLELDIRAIR  120

Query  2301  RTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARI  2122
             RTGK++L IA+ GI+ PF LGIGTS +LR+TI+KGV   PFLVFMGV+LSITAFPVLARI
Sbjct  121   RTGKQSLGIAVVGITFPFVLGIGTSVVLRSTISKGVDHAPFLVFMGVSLSITAFPVLARI  180

Query  2121  LAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLC  1942
             LAELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSG   SPL+S+WVLLCG  FV   
Sbjct  181   LAELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGDNTSPLVSVWVLLCGCAFVAAA  240

Query  1941  ILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPK  1762
             IL +     +MA R   GEPV+E+Y+C  L+ VL AGFVTDTIGIHALFGAFV+G++VPK
Sbjct  241   ILFLRPALAFMARRSLGGEPVNELYICITLSLVLAAGFVTDTIGIHALFGAFVVGIVVPK  300

Query  1761  DGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILG  1582
             DGP    L+EK+EDLVSGLFLPLYFVSSGLKTNVATI G QSWGLLVLVIF ACFGKILG
Sbjct  301   DGPFGEILIEKIEDLVSGLFLPLYFVSSGLKTNVATISGGQSWGLLVLVIFNACFGKILG  360

Query  1581  TILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFI  1402
             T++VS + ++P +EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAI+VLMALFTTFI
Sbjct  361   TVVVSRIFKVPMREAVVLGFLMNTKGLVELIVLNIGKDRKVLNDQTFAILVLMALFTTFI  420

Query  1401  TTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEK  1222
             TTPIV ALYKPA+  +  Y +RT+QR+ P  + RIL CFHS RNIP++INLIE+SRGT +
Sbjct  421   TTPIVTALYKPAR-KIASYTHRTVQRRGPDSEFRILACFHSTRNIPTMINLIESSRGTRR  479

Query  1221  SGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKV  1042
              G   VYAMHLMELSERSSAI M HKAR+NGLPFWN +    D  ++V+AFE ++ LS V
Sbjct  480   -GRLCVYAMHLMELSERSSAISMVHKARRNGLPFWNKKRTHKD--QMVIAFEAYQQLSSV  536

Query  1041  SIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLE  862
             S+RP TAIS ++S+HEDI  SA  K+VAMI+LPFHK+Q++DG  E+  +    VN+RV+ 
Sbjct  537   SVRPMTAISPLNSIHEDICTSAHQKQVAMILLPFHKYQRLDGVMESLGHSFHLVNQRVIR  596

Query  861   GAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVA  682
              APCSVGILVDRGLGGTS VSAS+V Y+I + +FGG DDREALAYG RM EHPGI L V 
Sbjct  597   HAPCSVGILVDRGLGGTSQVSASHVSYSIAIPFFGGRDDREALAYGVRMAEHPGIKLTVI  656

Query  681   RFTLDPETA---GTsvkldvspsgssspeekSRDEDFLAAFKQRNST-NSSVKYEEKVVK  514
              F   P  +     S     +   +   ++   D D L  F + N T N S+ YE++VV+
Sbjct  657   NFVAPPGKSLLDWNSGDGAATVQINEITQDGKEDNDQL--FSEPNFTENESISYEKRVVE  714

Query  513   SAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVL  334
               A  +  +      NL +VGRM     VA + ++ +CPELGP+G+ L+  EFSTTASVL
Sbjct  715   EKAGIVAKLTSMTNTNLFLVGRM---SAVAGLTERSDCPELGPVGSFLASSEFSTTASVL  771

Query  333   VVQQYRTELSKNGLKEDDS  277
             V+QQY    + + L E+++
Sbjct  772   VIQQYNPTANFSALAEEEA  790



>ref|XP_009137322.1| PREDICTED: cation/H(+) antiporter 17 [Brassica rapa]
Length=817

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/818 (65%), Positives = 636/818 (78%), Gaps = 19/818 (2%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             MG+N T  CP PMKATSNG FQG++PL +ALPLLI+QIC+V+ LTRVLA++LRPLRQPRV
Sbjct  1     MGTNDTT-CPGPMKATSNGVFQGENPLQHALPLLILQICIVLFLTRVLAFILRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA G++  +L+ +FP KSLTVLDTLA+LGL+FFLFLVGLELDPKSL+R
Sbjct  60    IAEIVGGILLGPSALGKNSKFLDTVFPAKSLTVLDTLANLGLIFFLFLVGLELDPKSLKR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIALAGI+LPF  GIGTSF LR++IA G S+ PFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKKALSIALAGITLPFIFGIGTSFALRSSIADGASKAPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE+KLLTTD+G++A+SAAAVNDVAAWILLALA+ALSG G SPL SLWV L G GFV+ CI
Sbjct  180   AEIKLLTTDIGKIALSAAAVNDVAAWILLALAVALSGEGSSPLTSLWVFLAGCGFVVFCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              VV    KW+A RC EGEPV E YVC  L  VL A FVTD IGIHALFGAFVIGV+ PK+
Sbjct  240   FVVQPGMKWIAKRCPEGEPVKEHYVCLTLGIVLAASFVTDLIGIHALFGAFVIGVIFPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A++LVEK+EDLVSGLFLPLYFVSSGLKT+VATIQGAQSWGLLVLVIF ACFGKI+GT
Sbjct  300   GNFANSLVEKLEDLVSGLFLPLYFVSSGLKTDVATIQGAQSWGLLVLVIFNACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             ++VS  C++P  E++ LGFLMNTKGLVELIVLNIGKDRGVLNDQ FAIMVLMA+FTTF+T
Sbjct  360   VVVSLYCKVPLDESLALGFLMNTKGLVELIVLNIGKDRGVLNDQIFAIMVLMAIFTTFMT  419

Query  1398  TPIVIALYKPAKLAVT-EYKYRTIQRKDPS-KQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKP K +   +Y  RTI+  + S K LR++ CF S  NIP+++NLIEASRGT 
Sbjct  420   TPLVLAVYKPGKSSTKGDYNNRTIEETNRSNKPLRLMFCFQSIMNIPTIVNLIEASRGTN  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             +     VYAMHLMELSERSSAILM HK RKNGLPFWN       S  +VVAFE ++ LS+
Sbjct  480   RKETLSVYAMHLMELSERSSAILMAHKVRKNGLPFWNKDKSGNSSDMVVVAFEAYQRLSR  539

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             VS+RP TAISAM+++HEDI  SAE KR AM+ILPFHKH ++D  +ETTRNE R +N++V+
Sbjct  540   VSVRPMTAISAMATIHEDICRSAERKRAAMVILPFHKHVRLDRTWETTRNEYRLINKKVM  599

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             E APCSV ILVDRGLGG + VS+S+    ITVL+FGG+DDREALA+  RM EHPGI L V
Sbjct  600   EEAPCSVAILVDRGLGGATRVSSSDFSLAITVLFFGGNDDREALAFAVRMAEHPGISLTV  659

Query  684   ARFTLDPETAGTsvkldvspsgssspeekSRDED------FLAAFKQRNSTNSSVKYEEK  523
              RF    E    +VKL+++   + S   ++R  D        A  K++ S+   + YEEK
Sbjct  660   VRFIPSEEFKPENVKLEITEDQTGSCSGETRLVDIEAITELKAKLKEQESSECQIVYEEK  719

Query  522   VVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLL-SCKEFST  349
             +VK   E  +A+  Y+R NL +VG+ PEG + + +   + + PELGP+GNLL S +  ST
Sbjct  720   IVKCHEEVCKAMDEYSRSNLFLVGKSPEGSVASGLHVMRSDTPELGPVGNLLTSSESVST  779

Query  348   TASVLVVQQYRTE-------LSKNGLKEDDSVDGDYES  256
             +ASVLVVQQY          + KN  KED  V  D ES
Sbjct  780   SASVLVVQQYVASRDSPVVGVLKNATKEDSPVK-DTES  816



>ref|XP_010465813.1| PREDICTED: cation/H(+) antiporter 19 isoform X1 [Camelina sativa]
 ref|XP_010465814.1| PREDICTED: cation/H(+) antiporter 19 isoform X1 [Camelina sativa]
 ref|XP_010465815.1| PREDICTED: cation/H(+) antiporter 19 isoform X2 [Camelina sativa]
Length=800

 Score =   904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/793 (64%), Positives = 610/793 (77%), Gaps = 9/793 (1%)
 Frame = -1

Query  2655  GSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVI  2476
             G+N T  CP PMKATSNG+FQ +SPLD+ALPL+I+QI LVV+ TR+LAY+L+PL+QPRVI
Sbjct  3     GTNVTGSCPGPMKATSNGAFQNESPLDFALPLIILQIVLVVVFTRLLAYILKPLKQPRVI  62

Query  2475  AEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRT  2296
             AEIIGG+LLGPSA GRS+ YL+ IFPKKSLTVLDTLA++GLLFFLFLVGLELD  ++R+T
Sbjct  63    AEIIGGILLGPSALGRSKVYLDTIFPKKSLTVLDTLANIGLLFFLFLVGLELDFAAIRKT  122

Query  2295  GKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILA  2116
             GKK++ IA+AGISLPF LG+GTSF+L ATI+KGV Q PF+VFMGVALSITAFPVLARILA
Sbjct  123   GKKSMLIAVAGISLPFILGVGTSFVLSATISKGVHQLPFIVFMGVALSITAFPVLARILA  182

Query  2115  ELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCIL  1936
             ELKLLTTD+G+MAMSAA VNDV AWILLALAIA+SG   SPL+S+WVLLCG+GFV+  ++
Sbjct  183   ELKLLTTDIGRMAMSAAGVNDVVAWILLALAIAVSGDDSSPLVSVWVLLCGSGFVIFAVV  242

Query  1935  VVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDG  1756
              +  +  +M  RC EGEPV E+YVC  L  VL A FVTDTIGIHALFGAFVIG++ PK+G
Sbjct  243   AIKPLLAYMGRRCPEGEPVKELYVCVTLTLVLSASFVTDTIGIHALFGAFVIGIVTPKEG  302

Query  1755  PLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTI  1576
             P    L EK+EDLVSGL LPLYF +SGLKT+V TI+G  SWGLLVLVI T CFGKI GT+
Sbjct  303   PFCRVLTEKIEDLVSGLLLPLYFAASGLKTDVTTIRGGVSWGLLVLVIITTCFGKIFGTV  362

Query  1575  LVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITT  1396
               + LC++PF+EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQ FAI+VLMALFTTFITT
Sbjct  363   GAAMLCKVPFREAMALGFLMNTKGLVELIVLNIGKDRKVLNDQAFAILVLMALFTTFITT  422

Query  1395  PIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSG  1216
             PIVIA+YKPA+     YK++TIQRKD   +LRIL CFHS RNIP+LINLIE+SRGT K G
Sbjct  423   PIVIAIYKPARKG-APYKHKTIQRKDHDSELRILACFHSTRNIPTLINLIESSRGTGKKG  481

Query  1215  GFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSI  1036
                VYAMH+MELSERSSAI M HKAR NGLP WN     TD  ++V+AFE ++HL  V++
Sbjct  482   RLCVYAMHMMELSERSSAIAMVHKARNNGLPIWNKIERSTD--QMVIAFEAYQHLRAVAV  539

Query  1035  RPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGA  856
             RP TAIS ++S+H+DII SA  KRVAMI+LPFHKHQ+ DG  E+  +    VN R+L+ A
Sbjct  540   RPMTAISDLTSIHKDIITSAHQKRVAMILLPFHKHQRADGTMESIGHGFHEVNNRILQRA  599

Query  855   PCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF  676
             PCSVGILVDRGLGG S V AS V Y + V +FGG DDREALAYG +MVEHPGI L V +F
Sbjct  600   PCSVGILVDRGLGGPSQVVASEVAYKVVVPFFGGLDDREALAYGMKMVEHPGITLTVLKF  659

Query  675   TLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETM  496
                    GT    + S       +EK  DE+F+           S+ YEE+VV+S  +  
Sbjct  660   V---AAKGTLKTFETSAPDEKEKKEKETDEEFVKELMNDPRGKESLSYEERVVESKDDIN  716

Query  495   EAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYR  316
               ++  N+CNL VVGR      V ++    +CPELGP+G LLS  EFSTTASVLVVQ Y 
Sbjct  717   ATLKSMNKCNLFVVGRTAA---VVSLVHSTDCPELGPVGRLLSSSEFSTTASVLVVQGYD  773

Query  315   TELSKNGLKEDDS  277
                    L E+D+
Sbjct  774   PAADTRPLVEEDA  786



>ref|XP_010448669.1| PREDICTED: cation/H(+) antiporter 17-like [Camelina sativa]
Length=824

 Score =   904 bits (2335),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/797 (66%), Positives = 629/797 (79%), Gaps = 18/797 (2%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             MG+NGT  CP PMKATSNG FQG++PL++ALPLLI+QIC+V+LLTR+LA+LLRPLRQPRV
Sbjct  1     MGTNGTT-CPGPMKATSNGVFQGENPLEHALPLLILQICIVLLLTRLLAFLLRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA G+S  +L  +FP +SLTVLDTLA+LGL+FFLFLVGLELDPKSL+R
Sbjct  60    IAEIVGGILLGPSALGKSSKFLTTVFPPRSLTVLDTLANLGLIFFLFLVGLELDPKSLKR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGK+ALSIALAGI+LPF LGIGTSF+LR+TIA GVS+ PFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKRALSIALAGITLPFILGIGTSFVLRSTIADGVSKAPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE+KLLTTDVG++A+SAAAVNDV AWILLALA+A+SG G SPL SLWV L G GFVL CI
Sbjct  180   AEIKLLTTDVGKIALSAAAVNDVVAWILLALAVAISGDGGSPLTSLWVFLAGCGFVLFCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              VV    K +A RC EGEPV+E+YVC  L  VL A FVTD IGIHALFGAFVIGV+ PK+
Sbjct  240   FVVQPGIKLIAKRCPEGEPVNELYVCCTLGIVLAASFVTDLIGIHALFGAFVIGVIFPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A+ALVEKVEDLVSG+FLPLYFVSSGLKT+VATIQGAQSWGLLVLVIF ACFGKI+GT
Sbjct  300   GNFANALVEKVEDLVSGIFLPLYFVSSGLKTDVATIQGAQSWGLLVLVIFNACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             +LVS  C++P  E++ LGFLMNTKGLVELIVLNIGKDRGVLNDQ FAIMVLMA+FTTF+T
Sbjct  360   VLVSLYCKVPLDESLALGFLMNTKGLVELIVLNIGKDRGVLNDQVFAIMVLMAIFTTFMT  419

Query  1398  TPIVIALYKPAK-LAVTEYKYRTIQR-KDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKP K LA  +Y+ RTI+  K  +K LR++ CF S  NIP+++NLIEASRG+ 
Sbjct  420   TPLVLAVYKPGKALAKGDYQNRTIEETKKSNKPLRLMFCFQSIMNIPTIVNLIEASRGSN  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTR--GEPTDSTEIVVAFETFEHL  1051
             +     VYAMHLMELSERSSA+LM HK RKNGLPFWN    G  + S  +VVAFE F  L
Sbjct  480   RKETLSVYAMHLMELSERSSAVLMAHKVRKNGLPFWNKDKTGNNSSSDMVVVAFEAFRRL  539

Query  1050  SKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRR  871
             S+VS+RP TAISAM+++HEDI  SAE K  AM+ILPFHKH ++D  +ETTRN+ R +N++
Sbjct  540   SRVSVRPMTAISAMATIHEDICQSAERKSTAMVILPFHKHVRLDRTWETTRNDYRWINKK  599

Query  870   VLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICL  691
             V+E APCSV ILVDRGLGGT+ V++S+    ITVL+FGG+DDREALA+  RM EHPGI L
Sbjct  600   VMEEAPCSVAILVDRGLGGTTRVASSDFSLVITVLFFGGNDDREALAFAMRMAEHPGISL  659

Query  690   VVARF----TLDPETAGTsvkldvspsgssspeekSRD-EDFLAAFKQRNSTNSS-----  541
              V RF       PE     +  D +     +         +  A  K++ ST S+     
Sbjct  660   TVIRFIPSEEFKPENVKLEILEDHASCSGDTKLIDIEAITELKAMIKEQESTLSNSDSES  719

Query  540   -VKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLLS  367
              + YEEK+VK   E  E I+  ++ NL +VG+ PEG + + +  ++ + PELGP+GNLL+
Sbjct  720   LIVYEEKIVKCYKEVFEVIKECSKSNLFLVGKSPEGSVASGLHVERSDTPELGPIGNLLT  779

Query  366   CKE-FSTTASVLVVQQY  319
               E  STTASVLVVQQY
Sbjct  780   ASENVSTTASVLVVQQY  796



>ref|XP_010433872.1| PREDICTED: cation/H(+) antiporter 17-like [Camelina sativa]
Length=824

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/797 (66%), Positives = 628/797 (79%), Gaps = 18/797 (2%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             MG+NGT  CP PMKATSNG FQG++PL +ALPLLI+QIC+V+LLTR+LA+LLRPLRQPRV
Sbjct  1     MGTNGTT-CPGPMKATSNGVFQGENPLKHALPLLILQICIVLLLTRLLAFLLRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA G+S  +L  +FP +SLTVLDTLA+LGL+FFLFLVGLELDPKSL+R
Sbjct  60    IAEIVGGILLGPSALGKSSKFLTTVFPPRSLTVLDTLANLGLIFFLFLVGLELDPKSLKR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGK+ALSIALAGI+LPF LGIGTSF+LR+TIA GVS+ PFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKRALSIALAGITLPFILGIGTSFVLRSTIADGVSKAPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE+KLLTTDVG++A+SAAAVNDV AWILLALA+A+SG G SPL SLWV L G GFVL CI
Sbjct  180   AEIKLLTTDVGKIALSAAAVNDVVAWILLALAVAISGDGGSPLTSLWVFLSGCGFVLFCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              VV    K +A RC EGEPV+E+YVC  L  VL A FVTD IGIHALFGAFVIGV+ PK+
Sbjct  240   FVVQPGIKLIAKRCPEGEPVNELYVCCTLGIVLAASFVTDLIGIHALFGAFVIGVIFPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A+ALVEKVEDLVSG+FLPLYFVSSGLKT+VATIQGAQSWGLLVLVIF ACFGKI+GT
Sbjct  300   GNFANALVEKVEDLVSGIFLPLYFVSSGLKTDVATIQGAQSWGLLVLVIFNACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             +LVS  C++P  E++ LGFLMNTKGLVELIVLNIGKDRGVLNDQ FAIMVLMA+FTTF+T
Sbjct  360   VLVSLYCKVPLDESLALGFLMNTKGLVELIVLNIGKDRGVLNDQVFAIMVLMAIFTTFMT  419

Query  1398  TPIVIALYKPAK-LAVTEYKYRTIQR-KDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKP K LA  +Y+ RTI+  K  +K LR++ CF S  NIP+++NLIEASRG+ 
Sbjct  420   TPLVLAVYKPGKALAKGDYQNRTIEETKKSNKPLRLMFCFQSIMNIPTIVNLIEASRGSN  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTR--GEPTDSTEIVVAFETFEHL  1051
             +     VYAMHLMELSERSSA+LM HK RKNGLPFWN    G  + S  +VVAFE F  L
Sbjct  480   RKETLSVYAMHLMELSERSSAVLMAHKVRKNGLPFWNKDKTGNNSSSDMVVVAFEAFRRL  539

Query  1050  SKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRR  871
             S+VS+RP TAISAM+++HEDI  SAE K  AM+ILPFHKH ++D  +ETTRN+ R +N++
Sbjct  540   SRVSVRPMTAISAMATIHEDICQSAERKSTAMVILPFHKHVRLDRTWETTRNDYRWINKK  599

Query  870   VLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICL  691
             V+E APCSV ILVDRGLGGT+ V++S+    ITVL+FGG+DDREALA+  RM EHPGI L
Sbjct  600   VMEEAPCSVAILVDRGLGGTTRVASSDFSLVITVLFFGGNDDREALAFAMRMAEHPGISL  659

Query  690   VVARF----TLDPETAGTsvkldvspsgssspeekSRD-EDFLAAFKQRNSTNSS-----  541
              V RF       PE     +  D +     +         +  A  K++ ST S+     
Sbjct  660   TVIRFIPSEEFKPENVKLEILEDHASCSGETKLIDIEAITELKAMIKEQESTLSNSDSES  719

Query  540   -VKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLLS  367
              + YEEK+VK   E  E I+  ++ NL +VG+ PEG + + +  ++ + PELGP+GNLL+
Sbjct  720   LIVYEEKIVKCYKEVFEVIKECSKSNLFLVGKSPEGSVASGLHVERSDTPELGPIGNLLT  779

Query  366   CKE-FSTTASVLVVQQY  319
               E  STTASVLVVQQY
Sbjct  780   ASENVSTTASVLVVQQY  796



>ref|NP_194101.1| cation/H(+) antiporter 17 [Arabidopsis thaliana]
 sp|Q9SUQ7.1|CHX17_ARATH RecName: Full=Cation/H(+) antiporter 17; AltName: Full=Protein 
CATION/H+ EXCHANGER 17; Short=AtCHX17 [Arabidopsis thaliana]
 emb|CAA23036.1| putative Na+/H+-exchanging protein [Arabidopsis thaliana]
 emb|CAB79325.1| putative Na+/H+-exchanging protein [Arabidopsis thaliana]
 gb|AAX49545.1| cation/H+ exchanger [Arabidopsis thaliana]
 gb|AEE84796.1| cation/H(+) antiporter 17 [Arabidopsis thaliana]
Length=820

 Score =   903 bits (2333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/821 (64%), Positives = 642/821 (78%), Gaps = 22/821 (3%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             MG+NGT  CP PMKATSNG FQG++PL++ALPLLI+QIC+V+LLTR+LA+LLRPLRQPRV
Sbjct  1     MGTNGTT-CPGPMKATSNGVFQGENPLEHALPLLILQICIVLLLTRLLAFLLRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA G+S  ++N +FP KSLTVLDTLA+LGL+FFLFLVGLELDPKSL+R
Sbjct  60    IAEIVGGILLGPSALGKSTKFINTVFPPKSLTVLDTLANLGLIFFLFLVGLELDPKSLKR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGK+ALSIALAGI+LPF LGIGTSF LR++IA G S+ PFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKRALSIALAGITLPFVLGIGTSFALRSSIADGASKAPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE+KLLTTD+G++A+SAAAVNDVAAWILLALA+ALSG G SPL SLWV L G GFVL CI
Sbjct  180   AEIKLLTTDIGKIALSAAAVNDVAAWILLALAVALSGEGSSPLTSLWVFLSGCGFVLFCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              VV    K +A RC EGEPV+E+YVC  L  VL A FVTD IGIHALFGAFVIGV+ PK+
Sbjct  240   FVVQPGIKLIAKRCPEGEPVNELYVCCTLGIVLAASFVTDFIGIHALFGAFVIGVIFPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A+ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIF ACFGKI+GT
Sbjct  300   GNFANALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFNACFGKIIGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             +LVS  C++P  +++ LGFLMNTKGLVELIVLNIGKDRGVLNDQ FAIMVLMA+FTTF+T
Sbjct  360   VLVSLYCKVPLDQSLALGFLMNTKGLVELIVLNIGKDRGVLNDQIFAIMVLMAIFTTFMT  419

Query  1398  TPIVIALYKPAK-LAVTEYKYRTIQRKDPS-KQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKP K L   +YK RT++  + S K L ++ CF S  NIP+++NLIEASRG  
Sbjct  420   TPLVLAVYKPGKSLTKADYKNRTVEETNRSNKPLCLMFCFQSIMNIPTIVNLIEASRGIN  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWN---TRGEPTDSTEIVVAFETFEH  1054
             +     VYAMHLMELSERSSAILM HK R+NGLPFWN   +    + S  +VVAFE F  
Sbjct  480   RKENLSVYAMHLMELSERSSAILMAHKVRRNGLPFWNKDKSENNSSSSDMVVVAFEAFRR  539

Query  1053  LSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNR  874
             LS+VS+RP TAIS M+++HEDI  SAE K+ AM+ILPFHKH ++D  +ETTRN+ R +N+
Sbjct  540   LSRVSVRPMTAISPMATIHEDICQSAERKKTAMVILPFHKHVRLDRTWETTRNDYRWINK  599

Query  873   RVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGIC  694
             +V+E +PCSV ILVDRGLGGT+ V++S+   TITVL+FGG+DDREALA+  RM EHPGI 
Sbjct  600   KVMEESPCSVAILVDRGLGGTTRVASSDFSLTITVLFFGGNDDREALAFAVRMAEHPGIS  659

Query  693   LVVARFT----LDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSS-----  541
             L V RF       PE     +  D   SG++   +     +  A  K++ S+ S+     
Sbjct  660   LTVVRFIPSDEFKPENVRIEITEDQLCSGATRLIDIEAITELKAKIKEKESSRSNSDSES  719

Query  540   -VKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSC  364
              + YEEK+VK   E +E I+ Y++ NL +VG+ PEG + + ++ + + PELGP+GNLL+ 
Sbjct  720   HIIYEEKIVKCYEEVIEVIKEYSKSNLFLVGKSPEGSVASGINVRSDTPELGPIGNLLTE  779

Query  363   KE-FSTTASVLVVQQYRTE----LSKNGLKEDDSVDGDYES  256
              E  ST ASVLVVQQY       +SKN   E+  V+ D ES
Sbjct  780   SESVSTVASVLVVQQYIASRPVGISKNVTTEESLVE-DSES  819



>ref|XP_007131515.1| hypothetical protein PHAVU_011G019400g [Phaseolus vulgaris]
 gb|ESW03509.1| hypothetical protein PHAVU_011G019400g [Phaseolus vulgaris]
Length=814

 Score =   901 bits (2329),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/804 (64%), Positives = 621/804 (77%), Gaps = 23/804 (3%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CP PMKATSNG+FQ ++PLDYALPLLI+QICLVV+ TR LA+LL+PLRQPRVIAE+IGG+
Sbjct  8     CPPPMKATSNGAFQHENPLDYALPLLILQICLVVIFTRFLAFLLKPLRQPRVIAEVIGGI  67

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GR+E +LN IFPKKSLTVL+T+A+LGLLFFLFLVGLELD +S+R+TG KAL+I
Sbjct  68    LLGPSAIGRNEKFLNTIFPKKSLTVLETVANLGLLFFLFLVGLELDMRSIRKTGHKALAI  127

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             ALAGISLPF L IGTS+ LRATI+K V   PFL+FMGVALSITAFPVLARILAELKLLTT
Sbjct  128   ALAGISLPFVLAIGTSYALRATISKNVDPTPFLIFMGVALSITAFPVLARILAELKLLTT  187

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             D G++AMSAAAVNDVAAWILLALAIALSG+  SPL+SLWV+LC   FVLL I  +  +  
Sbjct  188   DAGRIAMSAAAVNDVAAWILLALAIALSGSNSSPLVSLWVILCAIAFVLLAIFAIKPLLG  247

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
              MA R  EGEPV EIY+C  L  VL   FVTDTIGIHALFGAFV+G+++PKDGP A  L+
Sbjct  248   IMAKRSPEGEPVQEIYICITLTLVLACSFVTDTIGIHALFGAFVVGIVMPKDGPFAGVLI  307

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLV  L LPLYFVSSGLKT+V TI GA SW +LVLVIFTACFGKI+GT LVS LC+
Sbjct  308   EKVEDLVMSLLLPLYFVSSGLKTDVTTISGALSWSMLVLVIFTACFGKIVGTFLVSLLCK  367

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +PF+EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAI VLMALFTTFITTPIV+A+Y
Sbjct  368   VPFREALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAICVLMALFTTFITTPIVMAVY  427

Query  1374  KPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAM  1195
             KPA+   + Y ++T+QRKDP  +LR+L+CFHS  NIP+LINLIE+SRGT K G   VY+M
Sbjct  428   KPARRG-SPYTHKTVQRKDPDTELRVLSCFHSTCNIPTLINLIESSRGTRKRGKMCVYSM  486

Query  1194  HLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAIS  1015
             HLMELSER SAI M H AR NGLPFWN + +  D  ++V+AF+ +  LS V +RP TAIS
Sbjct  487   HLMELSERPSAITMVHTARNNGLPFWNKKRDNRD--QMVIAFQAYGQLSSVDVRPMTAIS  544

Query  1014  AMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGIL  835
             A S+MHEDI  SA  KR A+I+LPFHKHQ  DG  E+  N LR +N  VL  APCSVGIL
Sbjct  545   AFSNMHEDICTSAHQKRAAIILLPFHKHQHFDGTMESLGNSLRVMNGNVLSHAPCSVGIL  604

Query  834   VDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPE--  661
             VDRGLGG S V AS+V Y + V +FGG DDREALAYG R+ EHPGI L V +F + P   
Sbjct  605   VDRGLGGKSQVQASDVSYNVVVGFFGGKDDREALAYGMRLAEHPGISLTVVKFVVAPGKT  664

Query  660   ----------TAGTsvkldvspsgssspeekSRDEDFLAAF--KQRNSTNSSVKYEEKVV  517
                       TA    K+     G+S  E+K  DE F + F   + NST+ S+  EE++V
Sbjct  665   FAFGAKLIGITANRDKKVINVAEGTSYGEDKVEDEQFWSEFLGVKSNSTD-SIMSEERMV  723

Query  516   KSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASV  337
             +S  + +  +R  N+ NL++VGRMP+   VA +  K +CPELGP+G+ L+  EFST+ASV
Sbjct  724   ESKEDVIAVLREKNKSNLILVGRMPQ---VAPLVDKSDCPELGPIGSYLASSEFSTSASV  780

Query  336   LVVQQY--RTELSKNGLKEDDSVD  271
             LV+QQY  +T++    ++  D +D
Sbjct  781   LVLQQYNPKTDVYPLVMEVSDYMD  804



>emb|CDY69175.1| BnaCnng62230D [Brassica napus]
Length=776

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/799 (64%), Positives = 608/799 (76%), Gaps = 36/799 (5%)
 Frame = -1

Query  2649  NGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAE  2470
             N T  CPA MKATSNG+FQ ++PLDYALPL+I+QICLVV+ TR+LAYLL+PL+QPRVIAE
Sbjct  5     NATGNCPAAMKATSNGAFQNENPLDYALPLIILQICLVVVFTRLLAYLLKPLKQPRVIAE  64

Query  2469  IIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGK  2290
             IIGG+LLGP+A GRS+ YL+ IFP+KS+TVLDTLA++GLLFFLFLVGLELD  ++R+TGK
Sbjct  65    IIGGILLGPTALGRSKVYLDTIFPEKSMTVLDTLANIGLLFFLFLVGLELDFAAIRKTGK  124

Query  2289  KALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAEL  2110
             K+L IALAGISLPF +G+G SFIL +TI+KGV Q PF+VFMGVALSITAFPVLARILAEL
Sbjct  125   KSLLIALAGISLPFVIGVGASFILSSTISKGVHQLPFIVFMGVALSITAFPVLARILAEL  184

Query  2109  KLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVV  1930
             KLLTTDVG+MAMSAA VND+AAWI LALAIALSG   S L+ LWVLL G+GFV+  ILV+
Sbjct  185   KLLTTDVGRMAMSAAGVNDIAAWIFLALAIALSGNDSSSLVPLWVLLSGSGFVIFAILVI  244

Query  1929  PRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPL  1750
               I  +MA RC EGEPV E+YVC  L  VL A F+TDTIGIHALFGAFV+G++ PK GP 
Sbjct  245   KPILGFMAKRCPEGEPVKELYVCVTLTLVLAASFLTDTIGIHALFGAFVVGIVTPKQGPF  304

Query  1749  ASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILV  1570
                L EK+EDLVSGL LPLYF SSGLKT+V TI+GAQSWGLLVLVI T CFGKI+GT+  
Sbjct  305   CRILTEKIEDLVSGLLLPLYFASSGLKTDVTTIRGAQSWGLLVLVILTTCFGKIVGTVGA  364

Query  1569  STLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPI  1390
             S LC++PF+EA+ LG LMNTKGLVELIVLNIGKDR VLNDQ FAI+VLMAL TTFITTP+
Sbjct  365   SMLCKVPFREAMALGVLMNTKGLVELIVLNIGKDRKVLNDQVFAILVLMALVTTFITTPL  424

Query  1389  VIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGF  1210
             ++A+YKPA+     YK+RTIQRKD   +LRIL CFHS RNIP+LIN+IE+SRGT   G  
Sbjct  425   LLAIYKPARKG-APYKHRTIQRKDHDSELRILACFHSTRNIPTLINMIESSRGTGLKGRL  483

Query  1209  KVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRP  1030
              VYAMHLMELSERSSAI M HKAR NGLP WN     TD  ++V+AFE ++HL  V++RP
Sbjct  484   CVYAMHLMELSERSSAIAMVHKARYNGLPIWNKIERSTD--QMVIAFEGYQHLRAVAVRP  541

Query  1029  STAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPC  850
              TAIS +S++HEDI  SA  KRVAMI+LPFHKHQ++DG  E+  +    VN+RVL+ APC
Sbjct  542   MTAISDLSTIHEDICTSAHQKRVAMILLPFHKHQRMDGAMESIGHAFHEVNKRVLQQAPC  601

Query  849   SVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTL  670
             SVGILVDRGLGG SHV AS VDY I V +FGG DDREALAYG +MVEHPGI L + +F  
Sbjct  602   SVGILVDRGLGGASHVVASEVDYKIVVPFFGGLDDREALAYGMKMVEHPGITLTILKFV-  660

Query  669   DPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEA  490
                + GT                       L  F++    + S+ YEE+VV+S  +    
Sbjct  661   --ASRGT-----------------------LKRFEKEIDEDFSLAYEERVVESKEDVRAT  695

Query  489   IRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTE  310
             ++  ++CNL VVGR      V  +    +CPELGP+G LLS  EFSTTASVLVVQ Y + 
Sbjct  696   LKATSKCNLFVVGR---NAAVVPLVNSTDCPELGPVGRLLSSSEFSTTASVLVVQGYDSA  752

Query  309   LSKNGLKEDDSVDGDYESA  253
                  + EDD    DYE +
Sbjct  753   ADTRPVVEDD----DYEQS  767



>ref|XP_006413527.1| hypothetical protein EUTSA_v10024412mg [Eutrema salsugineum]
 gb|ESQ54980.1| hypothetical protein EUTSA_v10024412mg [Eutrema salsugineum]
Length=826

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/818 (65%), Positives = 642/818 (78%), Gaps = 23/818 (3%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             MG+NGT  C   MKATSNG FQG++PL +ALPLLI+QIC+V+LLTRVLA+LLRPLRQPRV
Sbjct  1     MGTNGTT-CGGAMKATSNGVFQGENPLHHALPLLILQICIVLLLTRVLAFLLRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA G+S  +LN +FP KSLTVLDTLA+LGL+FFLFLVGLELDPKSL+R
Sbjct  60    IAEIVGGILLGPSALGKSSKFLNTVFPSKSLTVLDTLANLGLIFFLFLVGLELDPKSLKR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIALAGI+LPF LGIGTSF+LR +IA GVS+ PFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKKALSIALAGITLPFILGIGTSFVLRGSIADGVSKAPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE+KLLTTD+G++A+SAAAVNDVAAWILLALA+ALSG G+SPL SLWV L G GFV+ CI
Sbjct  180   AEIKLLTTDIGKIALSAAAVNDVAAWILLALAVALSGEGNSPLTSLWVFLAGCGFVVFCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              VV    KW+A RC EGEPV E YVC  L  VL A FVTD IGIHALFGAFVIGV+ PK+
Sbjct  240   FVVQPGMKWIAKRCPEGEPVKEQYVCFTLGIVLAASFVTDLIGIHALFGAFVIGVIFPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A++LVEKVEDLVSG+FLPLYFVSSGLKT+VATIQGAQSWGLLVLVIFTACFGKI+GT
Sbjct  300   GNFANSLVEKVEDLVSGIFLPLYFVSSGLKTDVATIQGAQSWGLLVLVIFTACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             +LVS  C++P  E++ LGFLMNTKGLVELIVLNIGKDRGVLNDQ FAIMVLMA+FTTF+T
Sbjct  360   VLVSLYCKVPLDESLALGFLMNTKGLVELIVLNIGKDRGVLNDQVFAIMVLMAIFTTFMT  419

Query  1398  TPIVIALYKPAK-LAVTEYKYRTIQRKDPS-KQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKP K L    Y+ RT++  + S K LR++ CF S  NIP+++NLIEASRGT 
Sbjct  420   TPLVLAVYKPGKSLTKGNYQNRTVEETNQSNKPLRLMFCFQSIMNIPTIVNLIEASRGTN  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTE--IVVAFETFEHL  1051
             +     VYAMHLMELSERSSAILM HK RKNGLPFWN       S+   +VVAFE F  L
Sbjct  480   RKESLSVYAMHLMELSERSSAILMAHKVRKNGLPFWNKDKSANSSSSDMVVVAFEAFRRL  539

Query  1050  SKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRR  871
             S+VS+RP TAISAM+++HEDI  SAE KR AM+ILPFHKH ++D  +ETTRN+ R +N++
Sbjct  540   SRVSVRPMTAISAMATIHEDICRSAEHKRTAMVILPFHKHVRLDRTWETTRNDYRWINKK  599

Query  870   VLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICL  691
             V+E +PCSV ILVDRGLGGT+ V++S+    ITVL+FGG+DDREALA+  RM EHPGI L
Sbjct  600   VMEESPCSVAILVDRGLGGTTRVASSDFSLAITVLFFGGNDDREALAFAVRMAEHPGISL  659

Query  690   VVARFT----LDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQR---------NST  550
              V RF       PE        ++  +GS S + +  D + +   K +         +S 
Sbjct  660   TVVRFIPSEEFKPENV-RLEIAELDQTGSGSGDTRLTDIEAITELKAKIKEQESSRSDSE  718

Query  549   NSSVKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNL  373
             +S + YEEK+VK   E  + I  Y+R NL +VG+ P+G + + ++  +G+ PELGP+GNL
Sbjct  719   SSQIVYEEKIVKCYEEVCDGISEYSRSNLFLVGKSPDGSVASGLNVVRGDTPELGPVGNL  778

Query  372   L-SCKEFSTTASVLVVQQYRT--ELSKNGLKEDDSVDG  268
             L S +  ST+ASVLVVQQY+   + S  G+ ++ SV+G
Sbjct  779   LTSSESVSTSASVLVVQQYKASRDSSVVGVLKNVSVEG  816



>ref|XP_010433871.1| PREDICTED: cation/H(+) antiporter 17 [Camelina sativa]
 ref|XP_010433873.1| PREDICTED: cation/H(+) antiporter 17 [Camelina sativa]
Length=824

 Score =   899 bits (2323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/797 (66%), Positives = 625/797 (78%), Gaps = 18/797 (2%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             MG+NGT  CP PMKATSNG FQG++PL +ALPLLI+QIC+V+LLTR+LA+LLRPLRQPRV
Sbjct  1     MGTNGTT-CPGPMKATSNGVFQGENPLKHALPLLILQICIVLLLTRLLAFLLRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA G+S  +L  +FP +SLTVLDTLA+LGL+FFLFLVGLELDPKSL+R
Sbjct  60    IAEIVGGILLGPSALGKSSKFLTTVFPPRSLTVLDTLANLGLIFFLFLVGLELDPKSLKR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGK+ALSIALAGI+LPF LGIGTSF LR+TIA GVS+ PFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKRALSIALAGITLPFILGIGTSFALRSTIADGVSKAPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE+KLLTTDVG++A+SAAAVNDVAAWILLALA+ALSG G+SPL SLWV L G GFVL CI
Sbjct  180   AEIKLLTTDVGKIALSAAAVNDVAAWILLALAVALSGDGNSPLTSLWVFLAGCGFVLFCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              VV    K +A RC EGEPV+E+YVC  L  VL A FVTD IGIHALFGAFVIGV+ PK+
Sbjct  240   FVVQPGIKLIAKRCPEGEPVNELYVCCTLGIVLAASFVTDLIGIHALFGAFVIGVIFPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A+ALVEKVEDLVSGLFLPLYFVSSGLKT+VATIQGAQSWGLLVLVIF ACFGKI+GT
Sbjct  300   GNFANALVEKVEDLVSGLFLPLYFVSSGLKTDVATIQGAQSWGLLVLVIFNACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             +LVS  C++P  E++ LGFLMNTKGLVELIVLNIGKDRGVLNDQ FAIMVLMA+FTTF+T
Sbjct  360   VLVSLYCKVPLDESLALGFLMNTKGLVELIVLNIGKDRGVLNDQIFAIMVLMAIFTTFMT  419

Query  1398  TPIVIALYKPAK-LAVTEYKYRTIQR-KDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKP K LA  +Y+ RTI+  K  +K LR++ CF S  NIP+++NLIEASRG+ 
Sbjct  420   TPLVLAVYKPGKSLAKGDYQNRTIEETKKSNKPLRLMFCFQSIMNIPTIVNLIEASRGSN  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTR--GEPTDSTEIVVAFETFEHL  1051
             +     VYAMHLMELSERSSA+LM HK RKNGLPFWN    G  + S  +VVAFE F  L
Sbjct  480   RKETLSVYAMHLMELSERSSAVLMAHKVRKNGLPFWNKDKTGNNSSSDMVVVAFEAFRRL  539

Query  1050  SKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRR  871
             S+VS+RP TAISAM+++HEDI  SAE K  AM+ILPFHKH ++D  +ETTRN+ R +N++
Sbjct  540   SRVSVRPMTAISAMATIHEDICQSAERKSTAMVILPFHKHVRLDRTWETTRNDYRWINKK  599

Query  870   VLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICL  691
             V+E APCSV ILVDRGLGGT+ V++S+    ITVL+FGG+DDREALA+  RM EHPGI L
Sbjct  600   VMEEAPCSVAILVDRGLGGTTRVASSDFSLVITVLFFGGNDDREALAFAMRMAEHPGISL  659

Query  690   VVARF----TLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRN-------STNS  544
              V RF       PE     +  D +     +          L A  +          + S
Sbjct  660   TVVRFIPSEEFKPENVKLEIIEDQASCSGDTKLIDIEAISDLKAMIEEQESSLSNSDSES  719

Query  543   SVKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLLS  367
              + YEEK+VK   E  E I+  ++ NL +VG+ PEG + + +  ++ + PELGP+GNLL+
Sbjct  720   LIVYEEKIVKCYKEVFEVIKECSKSNLFLVGKSPEGSVASGLHVERSDTPELGPIGNLLT  779

Query  366   CKE-FSTTASVLVVQQY  319
               E  STTASVLVVQQY
Sbjct  780   ASENVSTTASVLVVQQY  796



>ref|XP_009353458.1| PREDICTED: cation/H(+) antiporter 19 [Pyrus x bretschneideri]
Length=818

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/797 (64%), Positives = 619/797 (78%), Gaps = 25/797 (3%)
 Frame = -1

Query  2628  APMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLL  2449
             APMKATSNGSFQG++PLD+ALPLLI+QI LVV+ TR LA+LLRPLRQPRVIAE+IGG+LL
Sbjct  9     APMKATSNGSFQGENPLDFALPLLILQIVLVVVFTRTLAFLLRPLRQPRVIAEVIGGILL  68

Query  2448  GPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIAL  2269
             GPSA GRS+ +L+ +FP K++TVLDT+A++GLLFFLFLVGLELD +++RRTGKK+L IA+
Sbjct  69    GPSALGRSQKFLHTVFPAKAMTVLDTVANIGLLFFLFLVGLELDIRAIRRTGKKSLGIAV  128

Query  2268  AGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDV  2089
             AGI+LPF LG+ TSF LRAT++KGVSQGPFLVF+GVALSITAFPVLARILAELKLLTTDV
Sbjct  129   AGITLPFVLGVFTSFALRATVSKGVSQGPFLVFIGVALSITAFPVLARILAELKLLTTDV  188

Query  2088  GQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWM  1909
             G++AMSAAAVNDVAAWILLALAIAL+GT  SPL+S+WVLL G GFV  CI  +  +   M
Sbjct  189   GRIAMSAAAVNDVAAWILLALAIALTGTNTSPLVSVWVLLSGAGFVGFCIFALRPLLAMM  248

Query  1908  ASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEK  1729
             A R  +GEPV E+Y+C  L+ VL A FVTD IGIHALFGAFV+G++VPKDGP A  L+EK
Sbjct  249   ARRSPDGEPVKELYICITLSLVLAASFVTDVIGIHALFGAFVVGIIVPKDGPFAGVLIEK  308

Query  1728  VEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIP  1549
             +EDLVSGLFLPLYFVSSGLKTNVATI G QSW LL+LVIFTA FGKI+GT+ +S  C++P
Sbjct  309   LEDLVSGLFLPLYFVSSGLKTNVATISGGQSWALLLLVIFTATFGKIVGTVSLSMACKVP  368

Query  1548  FQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKP  1369
             F+EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAI VLMALFTTFITTP+V+A+YKP
Sbjct  369   FREALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIFVLMALFTTFITTPLVVAIYKP  428

Query  1368  AKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHL  1189
             A+     YK+R++ RK+P  +LR+L CFHS RNIP++INLIE+SRGT K G   VYAMHL
Sbjct  429   ARRG-APYKHRSVFRKNPDTELRMLACFHSTRNIPTMINLIESSRGTRKRGRLTVYAMHL  487

Query  1188  MELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAM  1009
             MELSERSSAI M HKAR NGLPFWN +    +  ++V+AFE +E LS V +RP TAIS++
Sbjct  488   MELSERSSAISMVHKARHNGLPFWNKKTNENNKDQMVIAFEAYEQLSSVKVRPMTAISSL  547

Query  1008  SSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVD  829
             + +HEDI ASA  K  A+I+LPFHKHQ++DG  E+  N LR VN RVL+ APCSVGILVD
Sbjct  548   NDIHEDICASAHQKNAAVILLPFHKHQRLDGTMESLGNALRSVNERVLKHAPCSVGILVD  607

Query  828   RGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGT  649
             RGLGGT+ VSAS+V Y I V +FGG DDREALAYG R+VEHPGI + + RF + PE    
Sbjct  608   RGLGGTAQVSASDVSYNIVVAFFGGRDDREALAYGMRLVEHPGIVMTLIRF-VAPEGKTL  666

Query  648   svkldvspsgssspeekSRDED------------FLAAFK--QRNSTNS------SVKYE  529
                  +    S + ++   +ED             LA +   ++NS N       S+ YE
Sbjct  667   RFGAKLVGITSDNNKKILEEEDCGRGDDKEDDESLLAEYMNVRKNSGNKEGGGEPSMLYE  726

Query  528   EKVVKSAAETMEAIRGYNR-CNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFS  352
             EKVV S A+    ++   +  NL +VGRMP       +D   +C ELGP+G+ L+  +FS
Sbjct  727   EKVVDSKADICVVLKSMAKNVNLFIVGRMP--PTAPLVDSSSDCAELGPVGSFLASSDFS  784

Query  351   TTASVLVVQQYRTELSK  301
             +TASV+V+QQY    S+
Sbjct  785   STASVMVLQQYNPTASQ  801



>ref|XP_010999352.1| PREDICTED: cation/H(+) antiporter 19-like [Populus euphratica]
Length=815

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/802 (63%), Positives = 621/802 (77%), Gaps = 23/802 (3%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
             SN T   P PMKATSNG+FQ ++PLDYALPLLI+QICLVV  TR LA+LL+PLRQPRVIA
Sbjct  6     SNVTAALPKPMKATSNGAFQHENPLDYALPLLILQICLVVAFTRTLAFLLKPLRQPRVIA  65

Query  2472  EIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTG  2293
             EIIGG+LLGPSA GRSE +L+ +FP KS+TVLDT+A++GLLFFLFLVGLELD +S+RRTG
Sbjct  66    EIIGGILLGPSALGRSERFLHTVFPPKSMTVLDTVANIGLLFFLFLVGLELDIRSIRRTG  125

Query  2292  KKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAE  2113
             KK+L+IA AGI+LPF LGIGTSF+LR+TI+KG +  PFLVFMGV+LSITAFPVLARILAE
Sbjct  126   KKSLAIAGAGITLPFLLGIGTSFVLRSTISKGSAHAPFLVFMGVSLSITAFPVLARILAE  185

Query  2112  LKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILV  1933
             LKLLTTDVG++AMSAAAVNDV AWILLALAIALSG+  SPLISLWVLLCG GFV+  + V
Sbjct  186   LKLLTTDVGRIAMSAAAVNDVVAWILLALAIALSGSNTSPLISLWVLLCGVGFVVFSVYV  245

Query  1932  VPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
             +  + + MA R  +GEPV EIY+C  L+ VL + FVTD+IGIHALFGAFV+G+LVPKD P
Sbjct  246   IRPLLELMARRSPDGEPVKEIYICITLSLVLASSFVTDSIGIHALFGAFVVGILVPKDSP  305

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
                 L+EK+EDLV+GLFLPLYF SSGLKTNVATI GAQSWGLLVLVI TACFGKI+GT+L
Sbjct  306   FPGVLIEKIEDLVAGLFLPLYFASSGLKTNVATISGAQSWGLLVLVIATACFGKIIGTML  365

Query  1572  VSTLC-RIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITT  1396
             VS +  ++PF+EA  LGFLMNTKGLVELIVLNIGKDR VLNDQTFA++VLMALFTTFITT
Sbjct  366   VSRMIFKVPFREAAALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAVLVLMALFTTFITT  425

Query  1395  PIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSG  1216
             PIV+A+YKPA+     YK RT++RKD   +LR+L CFHS RNIP++INL+E SRGT K G
Sbjct  426   PIVMAVYKPARKG-APYKNRTVKRKDLDTELRLLACFHSSRNIPTMINLVECSRGTRKRG  484

Query  1215  GFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSI  1036
                VYAMHLMELSERSSAI M HKARKNGLPFWN + +  D  ++V+AFE ++ LS V+I
Sbjct  485   RLCVYAMHLMELSERSSAISMVHKARKNGLPFWNKKRD--DRDQMVIAFEAYQQLSSVTI  542

Query  1035  RPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGA  856
             RP TAISA+S+++EDI  SA  KR AMI+LPFHKHQ++DG  E+  + L+ VN+RVL  +
Sbjct  543   RPMTAISALSTIYEDICTSAHQKRAAMILLPFHKHQRVDGSLESLGHSLQEVNQRVLRHS  602

Query  855   PCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR-  679
             PCSVGIL+DRG GGT+ VSAS+V Y I V +FGG DD EALAYG RM EHPGI L V + 
Sbjct  603   PCSVGILIDRGFGGTTQVSASDVSYKIVVPFFGGSDDMEALAYGMRMAEHPGIMLTVLKL  662

Query  678   --------FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQR--NSTNSSVKYE  529
                     FTL+           +      +   ++  E F + F Q        SV +E
Sbjct  663   VPASGKTLFTLEGHDTNV-----IRVENDKNYNSQADSEIFFSEFVQHAAKQLQDSVTHE  717

Query  528   EKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFST  349
             E+VV+S A+ + A++  ++ NL +VGRMP    +A +    + PELGP+G+ L+   FS 
Sbjct  718   ERVVESKADVVAALKSMSKSNLFMVGRMPP---IAPLLISTDTPELGPVGSFLATSNFSN  774

Query  348   TASVLVVQQYRTELSKNGLKED  283
             TASVLV+Q Y   ++ + L ++
Sbjct  775   TASVLVIQHYNPNVNLHPLVQE  796



>ref|XP_008451981.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis melo]
Length=797

 Score =   897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/787 (65%), Positives = 627/787 (80%), Gaps = 17/787 (2%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CPA MKATSNG FQGD+PLD+ALPL I QICLVVLLTR+L +LLRPLR+PRVIAEI+GG+
Sbjct  13    CPAEMKATSNGVFQGDNPLDFALPLAIFQICLVVLLTRLLGFLLRPLREPRVIAEIVGGI  72

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GRS+ +L  +FP+KSLTVLDTLA++GLLFFLFLVGLELD KSLRRTGK A+ I
Sbjct  73    LLGPSAVGRSQGFLQRVFPEKSLTVLDTLANMGLLFFLFLVGLELDLKSLRRTGKGAMGI  132

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             A+AGI+LP  LG+GTS++LR+TI+KGVS  PFL+F+ VALSITAFPVLARILAELKLLTT
Sbjct  133   AMAGITLPLLLGVGTSYVLRSTISKGVSGPPFLIFIAVALSITAFPVLARILAELKLLTT  192

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             ++G++AMSAAAVNDVAAWILLALAIALSGT  SPL+SLWV LC + FVL C   +P  F+
Sbjct  193   NLGRIAMSAAAVNDVAAWILLALAIALSGTPRSPLVSLWVFLCSSVFVLFCFFTLPPAFR  252

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             W++ R S+GEPV E+YVCA L+ VL AGF+TD IGIHALFGAFV+GVLVPK+GPLA ALV
Sbjct  253   WISRRSSKGEPVSELYVCATLSTVLAAGFITDLIGIHALFGAFVVGVLVPKEGPLAGALV  312

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVS LFLPLYFVSSGLKTN+ TIQG QSWGLL+LVIFTACFGKI+GTIL++  C+
Sbjct  313   EKVEDLVSSLFLPLYFVSSGLKTNITTIQGIQSWGLLILVIFTACFGKIIGTILMALFCK  372

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +P QE+I LG LMNTKGLVELIVLNIGKDR VLNDQTFAI+VLMA+ TTF TTPIV+A+Y
Sbjct  373   MPLQESIALGVLMNTKGLVELIVLNIGKDRKVLNDQTFAILVLMAVITTFFTTPIVMAVY  432

Query  1374  KPAKL-AVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFK---  1207
             +PAK  + +EY  RTI+R++P+ +LRIL CFHS  NIPS++NLIE SRG E   G +   
Sbjct  433   EPAKRKSKSEYINRTIEREEPNSELRILACFHSVNNIPSILNLIEVSRGMEGKEGCESEL  492

Query  1206  -VYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRP  1030
              VYAMHLMEL+ERSSAI+M H+ARKNG PFWN +G  +   EI VAF+ FE LS+VSIRP
Sbjct  493   CVYAMHLMELTERSSAIVMVHRARKNGRPFWN-KGGKSGCDEIGVAFKAFEQLSRVSIRP  551

Query  1029  STAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPC  850
              TAIS +S MHED+   AE KR A+IILPFHKHQ+ DG+ E TR + + VN++VL+ +PC
Sbjct  552   MTAISRLSDMHEDVCNRAERKRAAIIILPFHKHQRFDGYLEATRGDFQSVNQKVLQQSPC  611

Query  849   SVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF--  676
             SVGILVD+G GG SH+S++NV  TIT+ +FGG DDREALA+G RM +H    L +  F  
Sbjct  612   SVGILVDKGFGGGSHISSTNVSSTITIFFFGGRDDREALAFGRRMSQHSKTTLNIVHFIY  671

Query  675   TLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNS-SVKYEEKVVKSAAET  499
             T +  T  T V+++     SS+      D+  L  F     TN  S++YEE+VV + +  
Sbjct  672   TSNVNTESTMVEMNKDDIKSSAVV----DQKVLMEFIHWKKTNDLSIRYEERVVSTFSNV  727

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVAAMDK----KGECPELGPLGNLLSCKEFSTTASVLV  331
             +E I  ++RCNL++VG+ PEGE+V  + +      ECPELGP+GNLL  KE S  AS+LV
Sbjct  728   IEVIMEFSRCNLILVGQKPEGEVVKNLLEYFKINVECPELGPIGNLLISKELSIPASILV  787

Query  330   VQQYRTE  310
             VQQ+R +
Sbjct  788   VQQFREK  794



>ref|XP_006406710.1| hypothetical protein EUTSA_v10020094mg [Eutrema salsugineum]
 gb|ESQ48163.1| hypothetical protein EUTSA_v10020094mg [Eutrema salsugineum]
Length=801

 Score =   897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/795 (65%), Positives = 613/795 (77%), Gaps = 9/795 (1%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
             +N T  CP PMKATSNG+FQ +SPLD+ALPL+I+QICLVV+ TR+LAYLL+PL+QPRVIA
Sbjct  4     TNVTGHCPGPMKATSNGAFQNESPLDFALPLIILQICLVVVFTRLLAYLLKPLKQPRVIA  63

Query  2472  EIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTG  2293
             EIIGG+LLGP+A GRS+ YL+ IFPKKS+TVLDTLA++GLLFFLFLVGLELD  ++R+TG
Sbjct  64    EIIGGILLGPTALGRSKVYLDTIFPKKSMTVLDTLANIGLLFFLFLVGLELDFSAIRKTG  123

Query  2292  KKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAE  2113
             KK+L IA+AGISLPF +G+GTSF+L +TI+KGV Q PF+VFMGVALSITAFPVLARILAE
Sbjct  124   KKSLLIAVAGISLPFIMGVGTSFVLSSTISKGVHQLPFIVFMGVALSITAFPVLARILAE  183

Query  2112  LKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILV  1933
             LKLLTTD+G+MAMSAA VNDVAAWILLALAIALSG   SPL+ LWVLLCG+GFV+  ++ 
Sbjct  184   LKLLTTDIGRMAMSAAGVNDVAAWILLALAIALSGDDSSPLVPLWVLLCGSGFVIFAVVA  243

Query  1932  VPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
             +  +  +MA RC EGEPV E+YVC  L  VL A F+TDTIGIHALFGAFVIG++ PK+GP
Sbjct  244   IKPLLAYMARRCPEGEPVKELYVCVTLTLVLAASFLTDTIGIHALFGAFVIGIVTPKEGP  303

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
                 L EK+EDLVSGL LPLYF SSGLKT+V TI+GAQSWGLL LVI T CFGKI+GT+ 
Sbjct  304   FCRVLTEKIEDLVSGLLLPLYFASSGLKTDVTTIRGAQSWGLLALVILTTCFGKIVGTVG  363

Query  1572  VSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTP  1393
              S LC++PF+EA+ LG LMNTKGLVELIVLNIGKDR VLNDQ FAI+VLMALFTTFITTP
Sbjct  364   ASLLCKVPFREAMALGVLMNTKGLVELIVLNIGKDRKVLNDQAFAILVLMALFTTFITTP  423

Query  1392  IVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGG  1213
             +++A+YKPA+     YK+RTIQRKD   +LRIL CFHS RNIP+LINLIE+SRGT + G 
Sbjct  424   LLMAIYKPARKG-APYKHRTIQRKDHDSELRILACFHSTRNIPTLINLIESSRGTGQKGR  482

Query  1212  FKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIR  1033
               VYAMHLMELSERSSAI M HKAR NGLP WN      D  ++V+AFE ++HL  V++R
Sbjct  483   LCVYAMHLMELSERSSAIAMVHKARNNGLPIWNKIERSAD--QMVIAFEAYQHLRAVAVR  540

Query  1032  PSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAP  853
             P TAIS + S+HEDI  SA  KRVAMI+LPFHKHQ++DG  E+  +    VN+RVL+ AP
Sbjct  541   PMTAISDLKSIHEDICTSAHQKRVAMILLPFHKHQRVDGSMESIGHGFHVVNQRVLQRAP  600

Query  852   CSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFT  673
             CSVGILVDRGLGGTS V AS V Y + V +FGG DDREALAYG +M+EHPGI L V +F 
Sbjct  601   CSVGILVDRGLGGTSQVVASEVAYKVVVPFFGGLDDREALAYGMKMMEHPGITLTVLKFA  660

Query  672   LDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETME  493
                   GT  + D         +EK  DE+FL         N S  YEE+VV+S  +   
Sbjct  661   --AARGGTLKRFDGGEEDEKEKKEKEVDEEFLRELMNDPRGNESCAYEERVVESKDDVTA  718

Query  492   AIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRT  313
              ++  ++CNL VVGR      VA++    +CPELGP+G LLS  EFS TASVL+VQ Y  
Sbjct  719   TLKAMSKCNLFVVGR---NAAVASLVNSTDCPELGPVGRLLSSSEFSKTASVLIVQGYDP  775

Query  312   ELSKNGL-KEDDSVD  271
                   L  EDDS +
Sbjct  776   AADTRPLVVEDDSYE  790



>ref|XP_003543796.1| PREDICTED: cation/H(+) antiporter 19-like [Glycine max]
Length=813

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/786 (64%), Positives = 612/786 (78%), Gaps = 19/786 (2%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CPAPMKATSNG+FQ ++PLDYALPLLI+QIC+VV+ TR LA++ +PLRQPRVIAE+IGG+
Sbjct  8     CPAPMKATSNGAFQHENPLDYALPLLILQICVVVVFTRFLAFICKPLRQPRVIAEVIGGI  67

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GRSE +LN IFPK+SLTVL+T+A++GLLFFLFLVGLELD +S+R+TG KAL I
Sbjct  68    LLGPSAMGRSEKFLNTIFPKRSLTVLETVANIGLLFFLFLVGLELDLRSIRKTGHKALFI  127

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             AL+GI+ PF LGIGTS+ LRATI+K  +   FLVFMGVALSITAFPVLARILAELKLLTT
Sbjct  128   ALSGITFPFILGIGTSYALRATISKNANPTSFLVFMGVALSITAFPVLARILAELKLLTT  187

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             +VG++AMSAAA+NDVAAWILLALAIALSG+  SPL+SLWV+LC  GFVL  +  +  +  
Sbjct  188   NVGRIAMSAAAINDVAAWILLALAIALSGSNTSPLVSLWVILCAAGFVLFAMFAISPLLG  247

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
              MA R  EGEPV EIY+C  +  VL  GF+TDTIGIHALFGAFV+G+++PKDGP A AL+
Sbjct  248   MMAKRSPEGEPVQEIYICITMTLVLACGFITDTIGIHALFGAFVVGIVMPKDGPFAGALI  307

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EK+EDLV  LFLPLYFVSSGLKT+VA+I GA SWG+LVLVIFTACFGKI+GT LVS LC+
Sbjct  308   EKIEDLVMSLFLPLYFVSSGLKTDVASISGALSWGMLVLVIFTACFGKIIGTFLVSLLCK  367

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +PF+EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQ FAI VLMALFTTFITTPIV+A+Y
Sbjct  368   VPFREALALGFLMNTKGLVELIVLNIGKDRKVLNDQAFAICVLMALFTTFITTPIVMAVY  427

Query  1374  KPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAM  1195
             KPA+   + Y ++T+QR DP+ +LR+L CFHS RNIP+LINLIE+SRGT+K     VYAM
Sbjct  428   KPARTG-SRYTHKTVQRNDPNTELRVLACFHSTRNIPTLINLIESSRGTKKRAKLCVYAM  486

Query  1194  HLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAIS  1015
             HLMELSER SAI M H AR NG+PFWN + +  D  ++V+AF+ + HLS V++RP TAIS
Sbjct  487   HLMELSERPSAITMVHTARNNGMPFWNKKHDNRD--QVVIAFQAYGHLSSVNVRPMTAIS  544

Query  1014  AMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGIL  835
             A S++HEDI  SA  KR A+I LPFHKHQ+ DG  E+  N LR +N  VL  APCSVGIL
Sbjct  545   AFSNIHEDICTSAHQKRAAIIFLPFHKHQRFDGTMESVGNSLRAMNGLVLSHAPCSVGIL  604

Query  834   VDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPE--  661
             VDRGLGGTS V AS+V Y + V +FGG DDREALAYG RM EHPG+ + V +F + P   
Sbjct  605   VDRGLGGTSQVQASDVSYKVVVGFFGGRDDREALAYGMRMAEHPGVSITVVKFVVPPGMT  664

Query  660   ----------TAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNS-SVKYEEKVVK  514
                       TA    K+     G+++  EK  DE F + F      N+ S+ YEE++V+
Sbjct  665   LAFGAKLIGVTADKDRKVIKVAEGTTTDVEKQEDEHFWSEFLGVCCKNAESIMYEERLVE  724

Query  513   SAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVL  334
             S  + +  +R  N+ NL++VGRMP    V  +    +CPELGP+G+ L+  EFST+ASV+
Sbjct  725   SKEDILTTMREMNKSNLILVGRMPP---VVPLVDTSDCPELGPVGSYLASSEFSTSASVI  781

Query  333   VVQQYR  316
             V QQY 
Sbjct  782   VFQQYN  787



>ref|XP_006283122.1| hypothetical protein CARUB_v10004144mg [Capsella rubella]
 gb|ACC91256.1| putative cation/hydrogen exchanger [Capsella rubella]
 gb|EOA16020.1| hypothetical protein CARUB_v10004144mg [Capsella rubella]
Length=819

 Score =   896 bits (2316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/819 (65%), Positives = 637/819 (78%), Gaps = 22/819 (3%)
 Frame = -1

Query  2655  GSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVI  2476
             G+NGT  CP PMKATSNG FQG++PL++ALPLLI+QIC+V+LLTR+LA+LLRPLRQPRVI
Sbjct  3     GTNGTT-CPGPMKATSNGVFQGENPLEHALPLLILQICIVLLLTRLLAFLLRPLRQPRVI  61

Query  2475  AEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRT  2296
             AEI+GG+LLGPSA G+S  YL  IFP KSLTVLDTLA+LGL+FFLFLVGLELDPKSL+RT
Sbjct  62    AEIVGGILLGPSALGKSSKYLTTIFPPKSLTVLDTLANLGLIFFLFLVGLELDPKSLKRT  121

Query  2295  GKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILA  2116
             GK+ALSIALAG++ PF LGIGTSF LR++IA GVS+ PFLVFMGVALSITAFPVLARILA
Sbjct  122   GKRALSIALAGMTFPFILGIGTSFALRSSIADGVSKAPFLVFMGVALSITAFPVLARILA  181

Query  2115  ELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCIL  1936
             E+KLLTTDVG++A+SAAAVNDVAAWILLALA+ALSG G+SPL SLWV L G GFVL CI 
Sbjct  182   EIKLLTTDVGKIALSAAAVNDVAAWILLALAVALSGDGNSPLTSLWVFLAGCGFVLFCIF  241

Query  1935  VVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDG  1756
             VV    K +A RC EGEPV+E+YVC  L  VL A FVTD IGIHALFGAFVIGV+ PK+G
Sbjct  242   VVQPGIKLIAKRCPEGEPVNELYVCCTLGIVLAASFVTDLIGIHALFGAFVIGVIFPKEG  301

Query  1755  PLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTI  1576
               A+ALVEKVEDLVSGLFLPLYFVSSGLKT+VATIQGAQSWGLLVLVIF ACFGKI+GT+
Sbjct  302   NFANALVEKVEDLVSGLFLPLYFVSSGLKTDVATIQGAQSWGLLVLVIFNACFGKIVGTV  361

Query  1575  LVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITT  1396
             LVS  C++P  E++ LGFLMNTKGLVELIVLNIGKDRGVLNDQ FAIMVLMA+FTTF+TT
Sbjct  362   LVSLYCKVPLDESLALGFLMNTKGLVELIVLNIGKDRGVLNDQVFAIMVLMAIFTTFMTT  421

Query  1395  PIVIALYKPAK-LAVTEYKYRTIQR-KDPSKQLRILTCFHSRRNIPSLINLIEASRGTEK  1222
             P+V+A+YKP K LA  +Y+ RTI+  K  +K LR++ CF S  NIP+++NLIEASRG+ +
Sbjct  422   PLVLAVYKPGKSLAKGDYQNRTIEDTKKSNKPLRLMFCFQSIMNIPTIVNLIEASRGSNR  481

Query  1221  SGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKV  1042
                  VYAMHLMELSERSSA+LM HK RKNGLPFWN +G  + S  +VVAFE F  LS+V
Sbjct  482   KETLSVYAMHLMELSERSSAVLMAHKVRKNGLPFWN-KGNDSSSDMVVVAFEAFRRLSRV  540

Query  1041  SIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLE  862
             S+RP TAISAM+++HEDI  SA  K  AM+ILPFHKH ++D  +ETTRN+ R +N++V+E
Sbjct  541   SVRPMTAISAMATIHEDICQSATRKSTAMVILPFHKHVRLDRTWETTRNDYRWINKKVME  600

Query  861   GAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVA  682
              A CSV ILVDRGLGGT+ V++S+    ITVL+FGG+DDREALA+  RM EHPGI L V 
Sbjct  601   EASCSVAILVDRGLGGTTRVASSDFSLVITVLFFGGNDDREALAFAMRMAEHPGISLNVV  660

Query  681   RF----TLDPETAGTsvkldvspsgssspeekSRD-EDFLAAFKQR------NSTNSSVK  535
             RF       PE     +  D +     +         +  A  K++        + S + 
Sbjct  661   RFIPSEEFKPENVKLEISEDHASCSVETRLVDIEAITELKAKIKEQESSLSNLESESLIV  720

Query  534   YEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLLSCKE  358
             YEEK+VKS  E  EAI+  ++ NL +VG+ PEG + + +  ++ + PELGP+GNLL+  E
Sbjct  721   YEEKIVKSHEEVFEAIKECSKSNLFLVGKSPEGSVASGLHVERSDTPELGPIGNLLTASE  780

Query  357   -FSTTASVLVVQQYRT----ELSKNGLKEDDSVDGDYES  256
               ST ASVLVVQQY       LSK+ + E   V+ D ES
Sbjct  781   SVSTVASVLVVQQYIASRVPSLSKDVMNEKSLVE-DSES  818



>ref|XP_010439142.1| PREDICTED: cation/H(+) antiporter 17-like [Camelina sativa]
Length=824

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/797 (65%), Positives = 624/797 (78%), Gaps = 18/797 (2%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             MG+NGT  CP PMKATSNG FQG++PL++ALPLLI+QIC+V+LLTR+LA+LLRPLRQPRV
Sbjct  1     MGTNGTT-CPGPMKATSNGVFQGENPLEHALPLLILQICIVLLLTRLLAFLLRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA G+S  +L  +FP +SLTVLDTLA+LGL+FFLFLVGLELDPKSL+R
Sbjct  60    IAEIVGGILLGPSALGKSSKFLTTVFPPRSLTVLDTLANLGLIFFLFLVGLELDPKSLKR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGK+ALSIALAGI+LPF LGIGTSF LR+TIA GVS+ PFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKRALSIALAGITLPFILGIGTSFALRSTIADGVSKAPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE+KLLTTDVG++A+SAAAVNDV AWILLALA+A+SG G SPL SLWV L G GFVL CI
Sbjct  180   AEIKLLTTDVGKIALSAAAVNDVVAWILLALAVAISGDGGSPLTSLWVFLAGCGFVLFCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              VV    K +A RC EGEPV+E+YVC  L  VL A FVTD IGIHALFGAFVIGV+ PK+
Sbjct  240   FVVQPGIKLIAKRCPEGEPVNELYVCCTLGIVLAASFVTDLIGIHALFGAFVIGVIFPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A+ALVEKVEDLVSGLFLPLYFVSSGLKT+VATIQGAQSWGLLVLVIF ACFGKI+GT
Sbjct  300   GNFANALVEKVEDLVSGLFLPLYFVSSGLKTDVATIQGAQSWGLLVLVIFNACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             +LVS  C++P  E++ LGFLMNTKGLVELIVLNIGKDRGVLNDQ FAIMVLMA+FTTF+T
Sbjct  360   VLVSLYCKVPLDESLALGFLMNTKGLVELIVLNIGKDRGVLNDQVFAIMVLMAIFTTFMT  419

Query  1398  TPIVIALYKPAK-LAVTEYKYRTIQR-KDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKP K LA  +Y+ RTI+  K  +K LR++ CF S  NIP+++NLIEASRG+ 
Sbjct  420   TPLVLAVYKPGKSLAKGDYQNRTIEETKKSNKPLRLMFCFQSIMNIPTIVNLIEASRGSN  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTR--GEPTDSTEIVVAFETFEHL  1051
             +     VYAMHLMELSERSSA+LM HK RKNGLPFWN    G  + S  +VVAFE F  L
Sbjct  480   RKETLSVYAMHLMELSERSSAVLMAHKVRKNGLPFWNKDKTGNNSSSDMVVVAFEAFRRL  539

Query  1050  SKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRR  871
             S+VS+RP TAISAM+++HEDI  SAE K  AM+ILPFHKH ++D  +ETTRN+ R +N++
Sbjct  540   SRVSVRPMTAISAMATIHEDICQSAERKSTAMVILPFHKHVRLDRTWETTRNDYRWINKK  599

Query  870   VLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICL  691
             V+E APCSV ILVDRGLGGT+ V++S+    ITVL+FGG+DDREALA+  RM EHPGI L
Sbjct  600   VMEEAPCSVAILVDRGLGGTTRVASSDFSLVITVLFFGGNDDREALAFAMRMAEHPGISL  659

Query  690   VVARFT----LDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRN-------STNS  544
              V RF       PE     +  D +     +          L A  +          + S
Sbjct  660   TVIRFIPSEEFKPENVKLEIIEDHASCSGETKLIDIEAITELKAMIKGQESSLSNSDSES  719

Query  543   SVKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLLS  367
              + YEEK+VK   E  E I+  ++ NL +VG+ PEG + + +  ++ + PELGP+GNLL+
Sbjct  720   LIVYEEKIVKCYKEVFEVIKECSKSNLFLVGKSPEGSVASGLHVERSDTPELGPIGNLLT  779

Query  366   CKE-FSTTASVLVVQQY  319
               E  STTASVLVVQQY
Sbjct  780   ASENVSTTASVLVVQQY  796



>ref|XP_009135538.1| PREDICTED: cation/H(+) antiporter 19 [Brassica rapa]
Length=799

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/799 (64%), Positives = 612/799 (77%), Gaps = 13/799 (2%)
 Frame = -1

Query  2649  NGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAE  2470
             N T  CP  MKA+SNG+FQ ++PLDYALPL+I+QICLVV+ TR+LAYLL+PL+QPRVIAE
Sbjct  5     NATGNCPTAMKASSNGAFQNENPLDYALPLIILQICLVVVFTRLLAYLLKPLKQPRVIAE  64

Query  2469  IIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGK  2290
             IIGG+LLGP+A GRS+ YL  IFP+KS+TVLDTLA++GLLFFLFLVGLELD  ++R+TGK
Sbjct  65    IIGGILLGPTALGRSKVYLETIFPEKSMTVLDTLANIGLLFFLFLVGLELDFAAIRKTGK  124

Query  2289  KALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAEL  2110
             K+L IALAGISLPF +G+G SFIL +TI+KGV Q PF+VFMGVALSITAFPVLARILAEL
Sbjct  125   KSLLIALAGISLPFVIGVGASFILSSTISKGVHQLPFIVFMGVALSITAFPVLARILAEL  184

Query  2109  KLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVV  1930
             KLLTTDVG+MAMSAA VND+AAWI LALAIALSG   S L+ LWVLL G+GFV+  ILV+
Sbjct  185   KLLTTDVGRMAMSAAGVNDIAAWIFLALAIALSGNDSSSLVPLWVLLSGSGFVIFAILVI  244

Query  1929  PRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPL  1750
               I  +MA RC EGEPV E+YVC  L  VL A F+TDTIGIHALFGAFV+G++ PK GP 
Sbjct  245   KPILGFMAKRCPEGEPVKELYVCVTLTLVLAASFLTDTIGIHALFGAFVVGIVTPKQGPF  304

Query  1749  ASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILV  1570
                L EK+EDLVSGL LPLYF SSGLKT+V TI+GAQSWGLLVLVI T CFGKI+GT+  
Sbjct  305   CRILTEKIEDLVSGLLLPLYFASSGLKTDVTTIRGAQSWGLLVLVILTTCFGKIVGTVGA  364

Query  1569  STLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPI  1390
             S LC++PF+EA+ LG LMNTKGLVELIVLNIGKDR VLNDQ FAI+VLMAL TTFITTP+
Sbjct  365   SMLCKVPFREAMALGVLMNTKGLVELIVLNIGKDRKVLNDQVFAILVLMALVTTFITTPL  424

Query  1389  VIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGF  1210
             ++A+YKPA+     YK+RTIQRKD   +LRIL CFHS RNIP+LIN+IE+SRGT   G  
Sbjct  425   LLAIYKPARKG-APYKHRTIQRKDHDSELRILACFHSTRNIPTLINMIESSRGTGLKGRL  483

Query  1209  KVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRP  1030
              VYAMHLMELSERSSAI M HKAR NGLP WN     TD  ++V+AFE ++HL  V++RP
Sbjct  484   CVYAMHLMELSERSSAIAMVHKARYNGLPIWNKIERSTD--QMVIAFEGYQHLRAVAVRP  541

Query  1029  STAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPC  850
              TAIS +S++HEDI  SA  KRVAMI+LPFHKHQ++DG  E+  +    VN+RVL+ APC
Sbjct  542   MTAISDLSTIHEDICTSAHQKRVAMILLPFHKHQRMDGAMESIGHAFHEVNKRVLQQAPC  601

Query  849   SVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTL  670
             SVGILVDRGLGG SHV AS VDY I V +FGG DDREALAYG +MVEHPGI L + +F  
Sbjct  602   SVGILVDRGLGGASHVVASEVDYKIVVPFFGGLDDREALAYGMKMVEHPGITLTILKFV-  660

Query  669   DPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEA  490
                + GT  + +         +EK  DE+F+         N S+ YEE+VV+S  +    
Sbjct  661   --ASRGTLKRFEKGEEEEDEKKEKEIDEEFVRELMNDPRGNESLAYEERVVESKEDVRAT  718

Query  489   IRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTE  310
             ++  ++CNL VVGR      V  +    +CPELGP+G LLS  EFSTTASVLVVQ Y + 
Sbjct  719   LKATSKCNLFVVGR---NAAVVPLVNSTDCPELGPVGRLLSSAEFSTTASVLVVQGYDSA  775

Query  309   LSKNGLKEDDSVDGDYESA  253
                  + EDD    D+E +
Sbjct  776   AETRPVVEDD----DFEQS  790



>ref|XP_009137382.1| PREDICTED: cation/H(+) antiporter 17-like [Brassica rapa]
Length=823

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/796 (65%), Positives = 626/796 (79%), Gaps = 17/796 (2%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             MG+N T  CP PMKATSNG FQG++P+ YALPLLI+QIC+V+ LTR LA+LLRPLRQPRV
Sbjct  1     MGTNDTT-CPGPMKATSNGVFQGENPMHYALPLLILQICIVLFLTRALAFLLRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA G+S  +L+ +FP KSLTVLDTLA+LGLLFFLFLVGLELDPKSL+R
Sbjct  60    IAEIVGGILLGPSALGKSSKFLSTVFPAKSLTVLDTLANLGLLFFLFLVGLELDPKSLKR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIALAGI+LPF  GIGTSF LR++IA GVS+ PFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKKALSIALAGITLPFIFGIGTSFALRSSIADGVSKAPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE+KLLTTD+G++A+SAAAVNDVAAWILLALA+ALSG G SPL SLWV L G GFVL CI
Sbjct  180   AEIKLLTTDIGKIALSAAAVNDVAAWILLALAVALSGDGSSPLTSLWVFLAGCGFVLFCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
               V    +W+A RC EGEPV E YVC  L  VL A FVTD IGIHALFGAFVIGV+ PK+
Sbjct  240   FAVQPGMQWLAKRCPEGEPVKEHYVCLTLGVVLAASFVTDLIGIHALFGAFVIGVMFPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  AS+LVEKVEDLVSGLFLPLYFVSSGLKT+VATIQGAQSWGLLVLVIF ACFGKI+GT
Sbjct  300   GHFASSLVEKVEDLVSGLFLPLYFVSSGLKTDVATIQGAQSWGLLVLVIFNACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             ++VS  C++P  E++ LGFLMNTKGLVELIVLNIG+DRGVLNDQ FAIMVLMA+ TTF+T
Sbjct  360   VVVSLYCKVPLDESLALGFLMNTKGLVELIVLNIGRDRGVLNDQVFAIMVLMAIVTTFMT  419

Query  1398  TPIVIALYKPAK-LAVTEYKYRTIQRKDPS-KQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKP K L   EY  RT++  + S K L ++ CF S  NIP+++NLIEASRGT 
Sbjct  420   TPLVLAVYKPGKSLTKGEYNNRTVEDTNQSNKPLCLMFCFQSIMNIPTIVNLIEASRGTN  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             +     VYAMHLMELSERSSAILM HK R+NGLPFWN       S  +VVAFE F+ LS+
Sbjct  480   RKESLSVYAMHLMELSERSSAILMAHKVRRNGLPFWNKDKTGNSSDMVVVAFEAFQRLSR  539

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             VS+RP TAISAM+++HEDI  SAE KR AM+ILPFHKH ++D  +ETTRN+ R +N++V+
Sbjct  540   VSVRPMTAISAMATIHEDICRSAESKRTAMVILPFHKHVRLDRTWETTRNDYRLINKKVM  599

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             E APCSV ILVDRGLGGT+ V++S+    ITVL+FGG+DDREALA+  RM EHPGI L V
Sbjct  600   EEAPCSVAILVDRGLGGTTRVASSDFTLVITVLFFGGNDDREALAFAVRMAEHPGISLTV  659

Query  684   ARFTLDPETAGTsvkldvspsgssspeekSRDED------FLAAFKQRNST------NSS  541
              RF    E    +VKL+++   + S   +++  D        A  K++ S+       S 
Sbjct  660   IRFIPSEEFKPENVKLEITEDQAGSCSGETKLTDIEAIAELKAKVKEQESSRSDSDIESK  719

Query  540   VKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLL-S  367
             + YE+K+V+   E  E I+ Y+R NL +VG+ PEG + + ++  + + PELGP+GNLL S
Sbjct  720   IIYEDKIVRCHDEICEVIKEYSRSNLFLVGKSPEGSVASGLNVGRSDTPELGPVGNLLTS  779

Query  366   CKEFSTTASVLVVQQY  319
              +  ST+ASVLVVQQY
Sbjct  780   SESVSTSASVLVVQQY  795



>emb|CDY67925.1| BnaA03g58740D [Brassica napus]
Length=793

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/790 (65%), Positives = 615/790 (78%), Gaps = 35/790 (4%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             MG+N T  CP PMKATSNG FQG++PL YALPLLI+QIC+V+ LTR LA+LLRPLRQPRV
Sbjct  1     MGTNDTT-CPGPMKATSNGVFQGENPLHYALPLLILQICIVLFLTRALAFLLRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA G+S  +L+ +FP KSLTVLDTLA+LGLLFFLFLVGLELDPKSL+R
Sbjct  60    IAEIVGGILLGPSALGKSSKFLSTVFPAKSLTVLDTLANLGLLFFLFLVGLELDPKSLKR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIALAGI+LPF  GIGTSF LR++IA GVS+ PFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKKALSIALAGITLPFIFGIGTSFALRSSIADGVSKAPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE+KLLTTD+G++A+SAAAVNDVAAWILLALA+ALSG G SPL SLWV L G GFVL CI
Sbjct  180   AEIKLLTTDIGKIALSAAAVNDVAAWILLALAVALSGDGSSPLTSLWVFLAGCGFVLFCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
               V    +W+A RC EGEPV E YVC  L  VL A FVTD IGIHALFGAFVIGV+ PK+
Sbjct  240   FAVQPGMQWLAKRCPEGEPVKEHYVCLTLGVVLAASFVTDLIGIHALFGAFVIGVIFPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  AS+LVEKVEDLVSGLFLPLYFVSSGLKT+VATIQGAQSWGLLVLVIF ACFGKI+GT
Sbjct  300   GHFASSLVEKVEDLVSGLFLPLYFVSSGLKTDVATIQGAQSWGLLVLVIFNACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             ++VS  C++P  E++ LGFLMNTKGLVELIVLNIG+DRGVLNDQ FAIMVLMA+ TTF+T
Sbjct  360   VVVSLYCKVPLDESLALGFLMNTKGLVELIVLNIGRDRGVLNDQVFAIMVLMAIVTTFMT  419

Query  1398  TPIVIALYKPAK-LAVTEYKYRTIQRKDPS-KQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKP K L   EY  RT++  + S K L ++ CF S  NIP+++NLIEASRGT 
Sbjct  420   TPLVLAVYKPGKSLTKGEYNNRTVEDTNQSNKPLCLMFCFQSIMNIPTIVNLIEASRGTN  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             +     VYAMHLMELSERSSAILM HK R+NGLPFWN       S  +VVAFE F+ LS+
Sbjct  480   RKESLSVYAMHLMELSERSSAILMAHKVRRNGLPFWNKDKTGNSSDMVVVAFEAFQRLSR  539

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             VS+RP TAISAM+++HEDI  SAE KR AM+ILPFHKH ++D  +ETTRN+ R +N++V+
Sbjct  540   VSVRPMTAISAMATIHEDICRSAESKRTAMVILPFHKHVRLDRTWETTRNDYRLINKKVM  599

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             E APCSV ILVDRGLGGT+ V++S+    ITVL+FGG+DDREALA+  RM EHPGI L V
Sbjct  600   EEAPCSVAILVDRGLGGTTRVASSDFTLVITVLFFGGNDDREALAFAVRMAEHPGISLTV  659

Query  684   ARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNST------NSSVKYEEK  523
              RF   P+                         +  A  K++ S+       S + YE+K
Sbjct  660   IRFI--PKAIA----------------------ELKAKVKEQESSRSDSDIESKIIYEDK  695

Query  522   VVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLL-SCKEFST  349
             +V+   E  E I+ Y+R NL +VG+ PEG + + ++  + + PELGP+GNLL S +  ST
Sbjct  696   IVRCHDEICEVIKEYSRSNLFLVGKSPEGSVASGLNVGRSDTPELGPVGNLLTSSESVST  755

Query  348   TASVLVVQQY  319
             +ASVLVVQQY
Sbjct  756   SASVLVVQQY  765



>ref|XP_008369567.1| PREDICTED: cation/H(+) antiporter 19-like [Malus domestica]
Length=817

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/810 (63%), Positives = 624/810 (77%), Gaps = 28/810 (3%)
 Frame = -1

Query  2628  APMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLL  2449
             APMKATSNGSFQG++PLD+A+PLLI+QI LVV+ TR LA+LL+PLRQPRVIAE+IGG+LL
Sbjct  9     APMKATSNGSFQGENPLDFAIPLLILQIVLVVVFTRTLAFLLKPLRQPRVIAEVIGGILL  68

Query  2448  GPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIAL  2269
             GPSAFGRS+ +L+ +FP K++TVLDT+A++GLLFFLFLVGLELD +++RRTGKK+L IA+
Sbjct  69    GPSAFGRSQKFLHTVFPAKAMTVLDTVANIGLLFFLFLVGLELDIRAIRRTGKKSLGIAV  128

Query  2268  AGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDV  2089
             AGI+LPF LG+ TSF LRAT++KGVSQGPFLVF+GVALSITAFPVLARILAELKLLTTDV
Sbjct  129   AGITLPFVLGVFTSFALRATVSKGVSQGPFLVFIGVALSITAFPVLARILAELKLLTTDV  188

Query  2088  GQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWM  1909
             G++AMSAAAVNDVAAWILLALAIAL+GT  SPL+S+WVLL G GFV  C++ +  +   M
Sbjct  189   GRIAMSAAAVNDVAAWILLALAIALTGTNTSPLVSVWVLLSGAGFVGFCVIALRPLLAMM  248

Query  1908  ASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEK  1729
             A R  +GEPV E+Y+C  L+ VL A FVTD IGIHALFGAFV+G++VPK+GP A  L+EK
Sbjct  249   ARRSPDGEPVKELYICITLSLVLSASFVTDVIGIHALFGAFVVGIIVPKEGPFAGVLIEK  308

Query  1728  VEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIP  1549
             +EDLVSGLFLPLYFVSSGLKTNVATI G QSW LL+LVIFTA FGKI+GT+ VS  C++P
Sbjct  309   LEDLVSGLFLPLYFVSSGLKTNVATISGGQSWALLLLVIFTASFGKIVGTVTVSMACKVP  368

Query  1548  FQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKP  1369
             F+EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAI VLMALFTTFITTP+V+A+YKP
Sbjct  369   FREALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIFVLMALFTTFITTPLVMAVYKP  428

Query  1368  AKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHL  1189
             A+     YK+R++ RK+P  +LR+L CFHS RNIP++INLIE+SRGT K G   VYAMHL
Sbjct  429   ARRG-APYKHRSVFRKNPDTELRMLACFHSTRNIPTVINLIESSRGTRKRGRLTVYAMHL  487

Query  1188  MELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAM  1009
             MELSERSSAI M HKAR NGLPFWN + +  +  ++V+AFE +E LS V +RP TAIS++
Sbjct  488   MELSERSSAISMVHKARNNGLPFWNKKNDENNKDQMVIAFEAYEQLSSVKVRPMTAISSL  547

Query  1008  SSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVD  829
              ++HEDI ASA  K  A+I+L FHKHQ++DG+ E+  N  R VN RVL+ APCSVGILVD
Sbjct  548   DNIHEDICASAHQKNAAVILLRFHKHQRLDGNMESLGNAFRSVNERVLKHAPCSVGILVD  607

Query  828   RGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGT  649
             RGLGGT+ VSAS V Y I V +FGG DDREALAYG R+ EHPGI + + RF + P+    
Sbjct  608   RGLGGTAQVSASEVSYNIMVAFFGGRDDREALAYGMRLAEHPGIVMTLIRF-VAPQGKTL  666

Query  648   svkldvspsgssspeekSRDED-----------FLAAFKQ--RNSTNS------SVKYEE  526
             S    +    S   +E  ++ED            LA +    +NS N       S+ YEE
Sbjct  667   SFGAKLVGITSDKNKEILKEEDCGGDQKEDDESLLAEYMNVMKNSGNKEGGGEPSMLYEE  726

Query  525   KVVKSAAETMEAIRGYNR-CNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFST  349
             KVV S AE    ++   +  NL +VGRMP       +D   +C ELGP+G+ L+  +FS+
Sbjct  727   KVVDSKAEICVVLKSMAKNVNLFIVGRMP--PTAPLVDSSSDCAELGPVGSFLASSDFSS  784

Query  348   TASVLVVQQYRTELSKNGLKEDDSVDGDYE  259
             TASV+V QQY    S+  + E    + DYE
Sbjct  785   TASVVVFQQYNPTSSQPLVVE----EADYE  810



>emb|CDX82359.1| BnaA03g34620D [Brassica napus]
Length=778

 Score =   894 bits (2310),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/801 (64%), Positives = 607/801 (76%), Gaps = 38/801 (5%)
 Frame = -1

Query  2649  NGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAE  2470
             N T  CP  MKA+SNG+FQ ++PLDYALPL+I+QICLVV+ TR+LAYLL+PL+QPRVIAE
Sbjct  5     NATGNCPTAMKASSNGAFQNENPLDYALPLIILQICLVVVFTRLLAYLLKPLKQPRVIAE  64

Query  2469  IIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGK  2290
             IIGG+LLGP+A GRS+ YL+ IFP+KS+TVLDTLA++GLLFFLFLVGLELD  ++R+TGK
Sbjct  65    IIGGILLGPTALGRSKVYLDTIFPEKSMTVLDTLANIGLLFFLFLVGLELDFAAIRKTGK  124

Query  2289  KALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAEL  2110
             K+L IALAGISLPF +G+G SFIL +TI+KGV Q PF+VFMGVALSITAFPVLARILAEL
Sbjct  125   KSLLIALAGISLPFVIGVGASFILSSTISKGVHQLPFIVFMGVALSITAFPVLARILAEL  184

Query  2109  KLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVV  1930
             KLLTTDVG+MAMSAA VND+AAWI LALAIALSG   S L+ LWVLL G+GFV+  ILV+
Sbjct  185   KLLTTDVGRMAMSAAGVNDIAAWIFLALAIALSGNDSSSLVPLWVLLSGSGFVIFAILVI  244

Query  1929  PRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPL  1750
               I  +MA RC EGEPV E+YVC  L  VL A F+TDTIGIHALFGAFV+G++ PK GP 
Sbjct  245   KPILGFMAKRCPEGEPVKELYVCVTLTLVLAASFLTDTIGIHALFGAFVVGIVTPKQGPF  304

Query  1749  ASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILV  1570
                L EK+EDLVSGL LPLYF SSGLKT+V TI+GAQSWGLLVLVI T CFGKI+GT+  
Sbjct  305   CRILTEKIEDLVSGLLLPLYFASSGLKTDVTTIRGAQSWGLLVLVILTTCFGKIVGTVGA  364

Query  1569  STLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPI  1390
             S LC++PF+EA+ LG LMNTKGLVELIVLNIGKDR VLNDQ FAI+VLMAL TTFITTP+
Sbjct  365   SMLCKVPFREAMALGVLMNTKGLVELIVLNIGKDRKVLNDQVFAILVLMALVTTFITTPL  424

Query  1389  VIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGF  1210
             ++A+YKPA+     YK+RTIQRKD   +LRIL CFHS RNIP+LIN+IE+SRGT   G  
Sbjct  425   LLAIYKPARKG-APYKHRTIQRKDHDSELRILACFHSTRNIPTLINMIESSRGTGLKGRL  483

Query  1209  KVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRP  1030
              VYAMHLMELSERSSAI M HKAR NGLP WN     TD  ++V+AFE ++HL  V++RP
Sbjct  484   CVYAMHLMELSERSSAIAMVHKARYNGLPIWNKIERSTD--QMVIAFEGYQHLRAVAVRP  541

Query  1029  STAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPC  850
              TAIS +S++HEDI  SA  KRVAMI+LPFHKHQ++DG  E+  +    VN+RVL+ APC
Sbjct  542   MTAISDLSTIHEDICTSAHQKRVAMILLPFHKHQRMDGAMESIGHAFHEVNKRVLQQAPC  601

Query  849   SVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTL  670
             SVGILVDRGLGG SHV AS VDY I V +FGG DDREALAYG +MVEHPGI L + +F  
Sbjct  602   SVGILVDRGLGGASHVVASEVDYKIVVPFFGGLDDREALAYGMKMVEHPGITLTILKFV-  660

Query  669   DPETAGTsvkldvspsgssspeekSRDEDFLAAFKQR--NSTNSSVKYEEKVVKSAAETM  496
                + GT                       L  F++      N S+ YEE+VV+S  +  
Sbjct  661   --ASRGT-----------------------LKRFEKEIDEEGNESLAYEERVVESKEDVR  695

Query  495   EAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYR  316
               ++  ++CNL VVGR      V  +    +CPELGP+G LLS  EFSTTASVLVVQ Y 
Sbjct  696   ATLKATSKCNLFVVGR---NAAVVPLVNSTDCPELGPVGRLLSSSEFSTTASVLVVQGYD  752

Query  315   TELSKNGLKEDDSVDGDYESA  253
             +      + EDD    DYE +
Sbjct  753   SAADTRPVVEDD----DYEQS  769



>ref|XP_008390248.1| PREDICTED: cation/H(+) antiporter 19 [Malus domestica]
Length=817

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/796 (63%), Positives = 614/796 (77%), Gaps = 24/796 (3%)
 Frame = -1

Query  2628  APMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLL  2449
             APMKATSNGSFQG++PLD+ALPLLI+QI LVV+ TR LA+LLRPLRQPRVIAE+IGG+LL
Sbjct  9     APMKATSNGSFQGENPLDFALPLLILQIVLVVVFTRTLAFLLRPLRQPRVIAEVIGGILL  68

Query  2448  GPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIAL  2269
             GPSA GRS+ +L+ +FP K++TVLDT+A++GLLFFLFLVGLELD +++RRTGKK+L IA+
Sbjct  69    GPSALGRSQKFLHTVFPAKAMTVLDTVANIGLLFFLFLVGLELDIRAIRRTGKKSLGIAV  128

Query  2268  AGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDV  2089
             AGI+LPF LG+ TSF LRAT++KGVSQGPFLVF+GVALSITAFPVLARILAELKLLTTDV
Sbjct  129   AGITLPFVLGVFTSFALRATVSKGVSQGPFLVFIGVALSITAFPVLARILAELKLLTTDV  188

Query  2088  GQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWM  1909
             G++AMSAAAVNDVAAWILLALAIAL+GT  SPL+S+WVLL G  FV  CI  +  +   M
Sbjct  189   GRIAMSAAAVNDVAAWILLALAIALTGTNTSPLVSVWVLLSGACFVGFCIFALRPLLVMM  248

Query  1908  ASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEK  1729
             A R  +GEPV E+Y+C  L+ VL A FVTD IGIHALFGAFV+G++VPKDGP A  L+EK
Sbjct  249   ARRSPDGEPVKELYICITLSLVLAASFVTDVIGIHALFGAFVVGIIVPKDGPFAGVLIEK  308

Query  1728  VEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIP  1549
             +EDLVSGLFLPLYFVSSGLKTNVATI G QSW LL+LVIFTA FGKI+GT+ +S  C++P
Sbjct  309   IEDLVSGLFLPLYFVSSGLKTNVATISGGQSWALLLLVIFTASFGKIVGTVSLSMACKVP  368

Query  1548  FQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKP  1369
             F+EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAI VLMALFTTFITTP+V+A+YKP
Sbjct  369   FREALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIFVLMALFTTFITTPLVVAIYKP  428

Query  1368  AKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHL  1189
             A+     YK+R++  K+P  +LR+L CFHS RNIP++INLIE+SRGT K G   VYAMHL
Sbjct  429   ARRG-APYKHRSVFXKNPDTELRMLACFHSTRNIPTMINLIESSRGTRKRGRLTVYAMHL  487

Query  1188  MELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAM  1009
             MELSERSSAI M HKAR NGLPFWN + +  +  ++V+AFE +E LS V +RP TAIS++
Sbjct  488   MELSERSSAISMVHKARHNGLPFWNKKTDENNKDQMVIAFEAYEQLSSVKVRPMTAISSL  547

Query  1008  SSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVD  829
               +HEDI ASA  K  A+I+LPFHKHQ++DG  E+  N LR VN RVL+ APCSVGILVD
Sbjct  548   XDIHEDICASAHQKNTAVILLPFHKHQRLDGTMESLGNALRSVNERVLKHAPCSVGILVD  607

Query  828   RGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGT  649
             RGLGGT+ VSAS+V Y I V +FGG DDREALAYG R+ EHPGI + + RF + PE    
Sbjct  608   RGLGGTAQVSASDVSYNIVVAFFGGRDDREALAYGMRLAEHPGIVMTLIRF-VAPEGKTL  666

Query  648   svkldvspsgssspeekSRDED-----------FLAAFK--QRNSTNS------SVKYEE  526
                  +    S    +   +ED            LA F   ++NS N       S+ YEE
Sbjct  667   RFGAKLVGITSDKNMKILEEEDCGGDEKENDESLLAEFMNVRKNSGNKEGGGEPSMLYEE  726

Query  525   KVVKSAAETMEAIRGYNR-CNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFST  349
             KVV S AE    ++   +  NL +VGRMP       ++   +C ELGP+G+ L+  +FS+
Sbjct  727   KVVDSKAEICVVLKSMAKNVNLFIVGRMP--PTAPLVNSSSDCAELGPVGSFLASSDFSS  784

Query  348   TASVLVVQQYRTELSK  301
             TASV+V+QQY    S+
Sbjct  785   TASVMVLQQYNPTASQ  800



>ref|XP_009402107.1| PREDICTED: cation/H(+) antiporter 19-like [Musa acuminata subsp. 
malaccensis]
Length=808

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/778 (65%), Positives = 616/778 (79%), Gaps = 13/778 (2%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CP PM ATSNGS+QGD+PLD ALPL I+QICLV+ LTR LA++L PLRQPRV+AEIIGGV
Sbjct  8     CPEPMGATSNGSWQGDNPLDSALPLAILQICLVIALTRFLAFVLHPLRQPRVVAEIIGGV  67

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GRSE +L  +FPK+SLTVLDTLAS+GL+FFLFLVG+ELD +++RRTG++AL+I
Sbjct  68    LLGPSAIGRSERFLKMVFPKQSLTVLDTLASVGLIFFLFLVGMELDLRAIRRTGQRALAI  127

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             A+AGISLPF +GIGTS +LR T+AKGV + PFLVFMGVALSITAFPVLARILAELKLLTT
Sbjct  128   AIAGISLPFVMGIGTSVVLRHTVAKGVPEAPFLVFMGVALSITAFPVLARILAELKLLTT  187

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             D+G+MAMSAAAVND+AAWILLALAIALSG+G SPL+SLWVLL G GFV    + V  +  
Sbjct  188   DLGRMAMSAAAVNDIAAWILLALAIALSGSG-SPLVSLWVLLSGVGFVAFVAIFVRPVLD  246

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             WMA R  EGEPV+E+++CA LA VL AGFVTDTIGIHALFGAF++GV+VPKDGP A  L+
Sbjct  247   WMARRSPEGEPVNEMFICATLATVLAAGFVTDTIGIHALFGAFIVGVVVPKDGPFAGVLI  306

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EK+EDL+SGLFLPLYFVSSGLKTNVATI G +SW LL LVI TAC GKI GT++VS L +
Sbjct  307   EKIEDLISGLFLPLYFVSSGLKTNVATISGGESWALLALVICTACLGKICGTVIVSLLVK  366

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +P +EAI LGFLMNTKGLVELIVLNIGKDR VLND+TFAI+VLMAL TTF+TTPIV+A+Y
Sbjct  367   VPAREAIALGFLMNTKGLVELIVLNIGKDRKVLNDETFAILVLMALVTTFLTTPIVMAIY  426

Query  1374  KPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAM  1195
             KPA+ +   YK+RTIQR D   +LR+L CFH  RNIP++INLIE+SRG  +  G  VYAM
Sbjct  427   KPARRS-APYKHRTIQRNDTDSELRVLACFHGSRNIPTMINLIESSRGIRRR-GITVYAM  484

Query  1194  HLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTE-IVVAFETFEHLSKVSIRPSTAI  1018
             HLMELSERSSAI M HKAR NGLPFWN +G+  +  + +V+AF+ ++ LS VS+RP  AI
Sbjct  485   HLMELSERSSAIFMVHKARLNGLPFWNRKGDSDNGADHLVIAFQAYQQLSNVSVRPMIAI  544

Query  1017  SAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGI  838
             S + +MHEDII SA+ KR A I+LPFHK Q+IDG  E+T +    +NRRVL  APCSVG+
Sbjct  545   SDLETMHEDIITSADQKRAAFILLPFHKLQQIDGSMESTGHAYHLINRRVLRRAPCSVGV  604

Query  837   LVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPET  658
             LVDRGLGGT+ V AS V YT+  L+FGG DDREALAY ARM EHPGI L+V RF + P+T
Sbjct  605   LVDRGLGGTAQVVASEVSYTVATLFFGGRDDREALAYSARMAEHPGIQLIVVRF-IPPQT  663

Query  657   AGTsvkldv----spsgssspeekSRDEDFLAAFKQRN-STNSSVKYEEKVVKSAAETME  493
                 ++       S S      E S D+  +  F+ +  ++N S++Y++KV+ S  E + 
Sbjct  664   GNWFLERSRGGGGSVSIIVDANEISADDACITEFRDKVLASNESIRYDDKVMGSRVEIIA  723

Query  492   AIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             AI+   RCNL +VG+ P    +  + +K + PELGP+G+ L+  EFSTT SVLV++Q+
Sbjct  724   AIKSIGRCNLFLVGQAPP---IMVLSEKADSPELGPVGSYLASSEFSTTTSVLVIKQH  778



>ref|XP_004298244.1| PREDICTED: cation/H(+) antiporter 19-like [Fragaria vesca subsp. 
vesca]
Length=845

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/782 (64%), Positives = 608/782 (78%), Gaps = 19/782 (2%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             MKATSNGSFQGDSPLDYALPLLI+QI LVV+ TR LAY+L+PLRQPRVIAE+IGG+LLGP
Sbjct  1     MKATSNGSFQGDSPLDYALPLLILQIILVVVFTRCLAYILKPLRQPRVIAEVIGGILLGP  60

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SA GR++A+LN IFP K +TVL+T+A++GL FFLFLVGLELD  S+RRTGKK+L IA+ G
Sbjct  61    SALGRNKAFLNGIFPPKGMTVLETVANIGLCFFLFLVGLELDFNSIRRTGKKSLGIAICG  120

Query  2262  ISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQ  2083
             I+LPF LGI TS ILRATI+KGV  GPFLVF GVALSITAFPVLARILAELKLLTTDVG+
Sbjct  121   ITLPFVLGIATSAILRATISKGVQHGPFLVFNGVALSITAFPVLARILAELKLLTTDVGR  180

Query  2082  mamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMAS  1903
             +AMSAAAVNDVAAWILLALAIAL+GT HSPL+S+WVLLCG GFV   ++ +  +   MA 
Sbjct  181   IAMSAAAVNDVAAWILLALAIALTGT-HSPLVSVWVLLCGAGFVGFAVVAILPLLAMMAR  239

Query  1902  RCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVE  1723
             +  +GEPV E+Y+C  L+ VL A FVTDTIGIHALFGAFV+G+++PK+GP A  L+EK+E
Sbjct  240   KSPDGEPVKELYICVTLSIVLAAAFVTDTIGIHALFGAFVVGIIMPKEGPFAGVLIEKIE  299

Query  1722  DLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQ  1543
             DLVSGLFLPLYFVSSGLKTNVATI GAQSWGLLVLVIFTA FGKI+GT+ +S   ++P +
Sbjct  300   DLVSGLFLPLYFVSSGLKTNVATISGAQSWGLLVLVIFTASFGKIVGTVALSLFFKVPLR  359

Query  1542  EAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAK  1363
             EA+ LG LMNTKGLVELIVLNIGKDR VLNDQTFAI V+MALFTTFITTP+V+A+YKPA+
Sbjct  360   EAVALGVLMNTKGLVELIVLNIGKDRKVLNDQTFAIFVMMALFTTFITTPLVMAVYKPAR  419

Query  1362  LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLME  1183
                  YK RTI RK+P  +LRIL CFH+ RNIP++IN+IE+SRGT K G   VYAMHLME
Sbjct  420   KG-APYKLRTIFRKNPDTELRILACFHTTRNIPTMINIIESSRGTRKRGRLTVYAMHLME  478

Query  1182  LSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMSS  1003
             LSERSSAI M HKAR NGLPFWN + +  D  ++V+AFE +E LS V IRP+TAIS++++
Sbjct  479   LSERSSAISMVHKARHNGLPFWNKKSDNKD--QMVIAFEAYEQLSTVKIRPATAISSLNN  536

Query  1002  MHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDRG  823
             MHEDI A A  K  AMI+LPFHKHQ++DG  E+  +  + VN RVL  APCSVGILVDRG
Sbjct  537   MHEDICACAHQKTAAMILLPFHKHQRLDGTMESLGHSFQVVNERVLRHAPCSVGILVDRG  596

Query  822   LGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFT--------LD  667
             LGGT+ VSAS+V YT  V +FGG DDREALAYG R+ EHPGI L V RF           
Sbjct  597   LGGTTQVSASDVSYTALVAFFGGRDDREALAYGMRLAEHPGIALTVFRFIARKGKTLRFG  656

Query  666   PETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTN----SSVKYEEKVVKSAAET  499
              +  G +           S +E   DE FL  +K+  S++     S+ YEEK+V S  E 
Sbjct  657   AQLVGITADNKKILKEEDSSQENEEDEKFLEEYKKLMSSSKENEESMLYEEKMVDSKGEI  716

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
               A++  ++ NL +VGRMP       + +  +C ELGP+G+ L+  +FS+TASV+V+QQY
Sbjct  717   AVALKTLSKHNLFIVGRMPP---TLPLVESSDCAELGPIGSFLASSDFSSTASVVVIQQY  773

Query  318   RT  313
              T
Sbjct  774   DT  775



>ref|XP_009359907.1| PREDICTED: cation/H(+) antiporter 19-like [Pyrus x bretschneideri]
Length=824

 Score =   891 bits (2303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/817 (62%), Positives = 626/817 (77%), Gaps = 35/817 (4%)
 Frame = -1

Query  2628  APMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLL  2449
             APMKATSNGSFQG++PLD+A+PLLIVQI LVV+ TR LA+LL+PLRQPRVIAE+IGG+LL
Sbjct  9     APMKATSNGSFQGENPLDFAIPLLIVQIVLVVVFTRTLAFLLKPLRQPRVIAEVIGGILL  68

Query  2448  GPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIAL  2269
             GPSAFGRS+ +L+ +FP K++TVLDT+A++GLLFFLFLVGLELD +++RRTGKK+L IA+
Sbjct  69    GPSAFGRSQKFLHTVFPAKAMTVLDTVANIGLLFFLFLVGLELDIRAIRRTGKKSLGIAV  128

Query  2268  AGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDV  2089
             AGI+LPF LG+ TSF LRAT++KGVSQGPFLVF+GVALSITAFPVLARILAELKLLTTDV
Sbjct  129   AGITLPFVLGVFTSFALRATVSKGVSQGPFLVFIGVALSITAFPVLARILAELKLLTTDV  188

Query  2088  GQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIF---  1918
             G++AMSAAAVNDVAAWILLALAIAL+GT  SPL+S+WVLL G GFV  C++ +  +    
Sbjct  189   GRIAMSAAAVNDVAAWILLALAIALTGTNTSPLVSVWVLLSGAGFVGFCVIALSPLLIAL  248

Query  1917  ----KWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPL  1750
                   MA R  +GEPV E+Y+C  L+ VL A FVTD IGIHALFGAFV+G++VPK+GP 
Sbjct  249   RPLLAMMARRSPDGEPVKELYICITLSLVLSASFVTDVIGIHALFGAFVVGIIVPKEGPF  308

Query  1749  ASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILV  1570
             A  L+EK+EDLVSGLFLPLYFVSSGLKTNVATI G QSW LL+LVIFTA FGKI+GT+ V
Sbjct  309   AGVLIEKLEDLVSGLFLPLYFVSSGLKTNVATISGGQSWALLLLVIFTASFGKIVGTVTV  368

Query  1569  STLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPI  1390
             S +C++PF+EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAI VLMALFTTFITTP+
Sbjct  369   SMVCKVPFREALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIFVLMALFTTFITTPL  428

Query  1389  VIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGF  1210
             V+A+YKPA+     YK+R++ RK+P  +LR+L CFHS RNIP++INLIE+SRGT K G  
Sbjct  429   VMAVYKPARRG-APYKHRSVFRKNPDTELRMLACFHSTRNIPTVINLIESSRGTRKRGRL  487

Query  1209  KVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRP  1030
              VYAMHLMELSERSSAI M HKAR NGLPFWN + +  +  ++V+AFE +E LS V +RP
Sbjct  488   TVYAMHLMELSERSSAISMVHKARNNGLPFWNKKNDENNKDQMVIAFEAYEKLSSVKVRP  547

Query  1029  STAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPC  850
              TAIS++ ++HEDI ASA  K  A+I+LPFHKHQ++DG+ E+  N  R VN RVL+ APC
Sbjct  548   MTAISSLDNIHEDICASAHQKNAAVILLPFHKHQRLDGNMESLGNAFRSVNERVLKHAPC  607

Query  849   SVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTL  670
             SVGILVDRGLGGT+ VSAS V Y I V +FGG DDREALAYG R+ EHPGI + + RF +
Sbjct  608   SVGILVDRGLGGTAQVSASEVSYNIMVAFFGGRDDREALAYGMRLAEHPGIVMTLIRF-V  666

Query  669   DPETAGTsvkldvspsgssspeekSRDED-----------FLAAFKQ--RNSTNS-----  544
              P+    S    +    S   +E  ++ED            LA +    +NS N      
Sbjct  667   APQGKTLSFGAKLVGITSDKNKEILKEEDCGGDQKGDDESLLAEYMNVMKNSGNKEGGGE  726

Query  543   -SVKYEEKVVKSAAETMEAIRGYNR-CNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLL  370
              S+ YEEKVV S  E    ++   +  NL +VGRMP    +A  D   +C ELGP+G+ L
Sbjct  727   PSMLYEEKVVDSKGEICVVLKSMAKNVNLFIVGRMPPTAPLA--DSSSDCAELGPVGSFL  784

Query  369   SCKEFSTTASVLVVQQYRTELSKNGLKEDDSVDGDYE  259
             +  +FS+TASV+V QQY    S+  + E    + DYE
Sbjct  785   ASSDFSSTASVVVFQQYNPTSSQPLVVE----EADYE  817



>ref|XP_008776559.1| PREDICTED: cation/H(+) antiporter 19-like [Phoenix dactylifera]
Length=806

 Score =   890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/793 (66%), Positives = 622/793 (78%), Gaps = 18/793 (2%)
 Frame = -1

Query  2652  SNGTVV-CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVI  2476
             +NGT + C APMKATS+G++QGDSPL +ALPL+I+QICLVV++TR LA+LLRPLRQPRVI
Sbjct  4     TNGTTIACKAPMKATSDGAWQGDSPLHHALPLIILQICLVVVVTRSLAFLLRPLRQPRVI  63

Query  2475  AEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRT  2296
             AEIIGG+LLGPSA GRS+ +LN++FPK+SLTVLDT+A++GLLFFLFLVGLELD +++RRT
Sbjct  64    AEIIGGILLGPSALGRSKRFLNSVFPKESLTVLDTVANIGLLFFLFLVGLELDLRAIRRT  123

Query  2295  GKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILA  2116
             GKKAL+IALAGISLPF LGIGTS +LR+T+ KG  QGPFLVFMGVALSITAFPVLARILA
Sbjct  124   GKKALAIALAGISLPFVLGIGTSVVLRSTVVKGTRQGPFLVFMGVALSITAFPVLARILA  183

Query  2115  ELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCIL  1936
             ELKLLTTD+G+MAMSAAAVNDVAAWILLALAIALSG+G SPLISLWVLL G  FV L  L
Sbjct  184   ELKLLTTDLGRMAMSAAAVNDVAAWILLALAIALSGSG-SPLISLWVLLTGAAFVALAAL  242

Query  1935  VVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDG  1756
             ++     WMA R  +GEPV E Y+CA LA VL AGFVTDTIGIHALFGAFV+G++VPKDG
Sbjct  243   LLRPALAWMACRSPDGEPVKEAYICATLATVLAAGFVTDTIGIHALFGAFVVGIIVPKDG  302

Query  1755  PLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTI  1576
             P A  L+EKVEDL+SGLFLPLYFVSSGLKTNVATI GA+SWGLLVLVI  AC GKI GT+
Sbjct  303   PFAGVLIEKVEDLISGLFLPLYFVSSGLKTNVATISGARSWGLLVLVIANACLGKIAGTV  362

Query  1575  LVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITT  1396
             +VS + RIP +EA+TLGFLMNTKGLVELIVLNIGKDR VLND+ FAI+VLMALFTTFITT
Sbjct  363   IVSLIVRIPAREALTLGFLMNTKGLVELIVLNIGKDRKVLNDEAFAILVLMALFTTFITT  422

Query  1395  PIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSG  1216
             PIV+A+YKPA+ A   YK+RT++R D   +LR+L CFH  RNIP++INLIE+SR   +  
Sbjct  423   PIVVAIYKPARRA-APYKHRTVERADTESELRVLACFHGNRNIPTMINLIESSR-GTRRR  480

Query  1215  GFKVYAMHLMELSERSSAILMCHKARKNGLPFWN--TRGEPTDSTEIVVAFETFEHLSKV  1042
                VYAMHL+ELSERSSAI M HKAR+NGLPFWN  +RG   +  ++VVAFE ++ LS V
Sbjct  481   RVTVYAMHLIELSERSSAISMVHKARRNGLPFWNKVSRGAAGNGDQVVVAFEAYQQLSSV  540

Query  1041  SIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLE  862
             +IRP TAIS + +MHEDI+ASA  KR A+IILPFHK Q++DG  E+     ++VN+RVL 
Sbjct  541   AIRPMTAISDIHTMHEDIVASALQKRAAVIILPFHKTQRLDGSLESLGTAFQYVNQRVLR  600

Query  861   GAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVA  682
              APCSV ILVDRGLGG   V AS+V YTI V +FGG DDREALAYGARM EHPGI L V 
Sbjct  601   HAPCSVAILVDRGLGGAVQVLASDVSYTIAVPFFGGPDDREALAYGARMAEHPGIALTVV  660

Query  681   RFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAE  502
             RF L    A        +   + S       ED           +SSVKYEE+ V   AE
Sbjct  661   RFLLPSLPAEVDADERAADVAALSDLATKAAED-----------SSSVKYEEQAVAERAE  709

Query  501   TMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQ  322
              +  I+   RCNL +VGR P+  ++  +++  +C ELG +G+ L+C EFST+ASVLV+Q 
Sbjct  710   VVGVIKALGRCNLFLVGRSPQSGVLRLVERT-DCLELGHVGSYLACSEFSTSASVLVIQH  768

Query  321   YRTELSKNGLKED  283
             Y +    + L E+
Sbjct  769   YDSRADPSMLVEE  781



>ref|XP_002867692.1| ATCHX17 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43951.1| ATCHX17 [Arabidopsis lyrata subsp. lyrata]
Length=823

 Score =   890 bits (2300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/824 (64%), Positives = 638/824 (77%), Gaps = 25/824 (3%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             MG+NGT  CP PMKATSNG FQG++PLD+ALPLLI+QIC+V+LLTR+LA+LLRPLRQPRV
Sbjct  1     MGTNGTT-CPGPMKATSNGVFQGENPLDHALPLLILQICIVLLLTRLLAFLLRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA G+S  ++N +FP KSLTVLDTLA+LGL+FFLFLVGLELDPKSL+R
Sbjct  60    IAEIVGGILLGPSALGKSSKFINTVFPPKSLTVLDTLANLGLIFFLFLVGLELDPKSLKR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGK+ALSIALAGI+LPF LGIGTSF LR++IA G S+ PFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKRALSIALAGITLPFILGIGTSFALRSSIADGASKAPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE+KLLTTD+G++A+SAAAVNDVAAWILLALA+ALSG G SPL SLWV L G GFVL CI
Sbjct  180   AEIKLLTTDIGKIALSAAAVNDVAAWILLALAVALSGEGSSPLTSLWVFLSGCGFVLFCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
              VV    K +A RC EGEP++E+YVC  L  VL A FVTD IGIHALFGAFVIGV+ PK+
Sbjct  240   FVVQPGIKLIAKRCPEGEPINELYVCCTLGIVLAASFVTDLIGIHALFGAFVIGVIFPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A+ALVEKVEDLVSGLFLPLYFVSSGLKT+VATIQGAQSWGLLVLVIF ACFGKI+GT
Sbjct  300   GNFANALVEKVEDLVSGLFLPLYFVSSGLKTDVATIQGAQSWGLLVLVIFNACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGV-LNDQTFAIMVLMALFTTFI  1402
             +LVS  C++P  +++ LGFLMNTKGLVELIVLNIGKDRGV L DQ FAIMVLMA+FTTF+
Sbjct  360   VLVSLYCKVPLDQSLALGFLMNTKGLVELIVLNIGKDRGVSLKDQVFAIMVLMAIFTTFM  419

Query  1401  TTPIVIALYKPAK-LAVTEYKYRTIQRKDPS-KQLRILTCFHSRRNIPSLINLIEASRGT  1228
             TTP+V+A+YKP K L   +YK RT++  + S K L ++ CF S  NIP+++NLIEASRG 
Sbjct  420   TTPLVLAVYKPGKSLTKGDYKNRTVEETNRSNKPLCLMFCFQSIMNIPTIVNLIEASRGI  479

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWN---TRGEPTDSTEIVVAFETFE  1057
              +     VYAMHLMELSERSSAILM HK R+NGLPFWN   T    + S  +VVAFE F 
Sbjct  480   NRKENLSVYAMHLMELSERSSAILMAHKVRRNGLPFWNKDKTGNNSSSSDMVVVAFEAFR  539

Query  1056  HLSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVN  877
              LS+VS+RP TAIS M+++HEDI  SAE K+ AM+ILPFHKH ++D  +ETTRN+ R +N
Sbjct  540   RLSRVSVRPMTAISPMATIHEDICQSAERKKTAMVILPFHKHVRLDRTWETTRNDYRWIN  599

Query  876   RRVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGI  697
             ++V+E +PCSV ILVDRGLGGT+ V++S+    ITVL+FGG+DDREALA+  RM EHPGI
Sbjct  600   KKVMEESPCSVAILVDRGLGGTTRVASSDFSLAITVLFFGGNDDREALAFAVRMAEHPGI  659

Query  696   CLVVARFT----LDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRN------STN  547
              L V RF       PE     +  D   SG +   +     +  A  K++        + 
Sbjct  660   TLTVVRFIPSEEFKPENVMVEIIEDQVGSGETRLIDIEAITELKAKIKEQESSRSNSDSE  719

Query  546   SSVKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLL  370
             S + YEEK+VK   E +E I  Y+R NL +VG+ PEG + + ++ ++ + PELGP+GNLL
Sbjct  720   SQIVYEEKIVKCYEEVIEVINEYSRSNLFLVGKSPEGLVASGVNLERSDTPELGPIGNLL  779

Query  369   SCKE-FSTTASVLVVQQYRTE-----LSKNGLKEDDSVDGDYES  256
             +  E  S+ ASVLVVQQY +      +SKN   E+  V+ D ES
Sbjct  780   TASESISSVASVLVVQQYTSSRPVVGISKNVTIEESLVE-DSES  822



>ref|XP_010505628.1| PREDICTED: cation/H(+) antiporter 19-like [Camelina sativa]
Length=800

 Score =   890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/793 (65%), Positives = 611/793 (77%), Gaps = 9/793 (1%)
 Frame = -1

Query  2655  GSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVI  2476
             G N T  CP PMKATSNG+FQ +SPLD+ALPL+I+QI LVV+ TR+LAY+L+PL+QPRVI
Sbjct  3     GPNVTGNCPGPMKATSNGAFQNESPLDFALPLIILQIVLVVVFTRLLAYILKPLKQPRVI  62

Query  2475  AEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRT  2296
             AEIIGG+LLGPSA GRS+ YL+ IFPKKSLTVLDTLA++GLLFFLFLVGLELD  ++R+T
Sbjct  63    AEIIGGILLGPSALGRSKVYLDTIFPKKSLTVLDTLANIGLLFFLFLVGLELDFAAIRKT  122

Query  2295  GKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILA  2116
             GKK+L IALAGISLPF LG+GTSF+L ATI+KGV Q PF+VFMGVALSITAFPVLARILA
Sbjct  123   GKKSLLIALAGISLPFILGVGTSFVLSATISKGVHQLPFIVFMGVALSITAFPVLARILA  182

Query  2115  ELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCIL  1936
             ELKLLTTD+G+MAMSAA VNDV AWILLALAIA+SG   SPL+S+WVLLCG+GFV+  ++
Sbjct  183   ELKLLTTDIGRMAMSAAGVNDVVAWILLALAIAVSGDDSSPLVSVWVLLCGSGFVIFAVV  242

Query  1935  VVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDG  1756
              +  +  +M  RC EGEPV E+YVC  L  VL A FVTDTIGIHALFGAFV+G++ PK+G
Sbjct  243   AIKPLLAYMGRRCPEGEPVKELYVCVTLTLVLSASFVTDTIGIHALFGAFVVGIVTPKEG  302

Query  1755  PLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTI  1576
             P    L EK+EDLVSGL LPLYF +SGLKT+V TI+G  SWGLLVLVI T CFGKI GT+
Sbjct  303   PFCRVLTEKIEDLVSGLLLPLYFAASGLKTDVTTIRGGVSWGLLVLVIITTCFGKIFGTV  362

Query  1575  LVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITT  1396
               + LC++PF+EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQ FAI+VLMALFTTFITT
Sbjct  363   GAAMLCKVPFREAMALGFLMNTKGLVELIVLNIGKDRKVLNDQAFAILVLMALFTTFITT  422

Query  1395  PIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSG  1216
             PIVIA+YKPA+     YK++TIQRKD   +LRIL CFHS RNIP+LINLIE+SRGT K G
Sbjct  423   PIVIAIYKPARKG-APYKHKTIQRKDHDSELRILACFHSTRNIPTLINLIESSRGTGKKG  481

Query  1215  GFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSI  1036
                VYAMH+MELSERSSAI M HKAR NGLP WN     TD  ++V+AFE ++HL  V++
Sbjct  482   RLCVYAMHMMELSERSSAIAMVHKARNNGLPIWNKIERSTD--QMVIAFEAYQHLRAVAV  539

Query  1035  RPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGA  856
             RP TAIS ++S+H+DII SA  KRVAMI+LPFHKHQ+ DG  E+  +    VN R+L+ A
Sbjct  540   RPMTAISDLTSIHKDIITSAHQKRVAMILLPFHKHQRADGTMESIGHGFHEVNNRILQRA  599

Query  855   PCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF  676
             PCSVGILVDRGLGG S V AS V Y + V +FGG DDREALAYG +MVEHPGI L V +F
Sbjct  600   PCSVGILVDRGLGGPSQVVASEVSYKVVVPFFGGLDDREALAYGMKMVEHPGITLTVLKF  659

Query  675   TLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETM  496
                    GT  + + S       +EK  DE+FL         N S+ YEE+VV+S  +  
Sbjct  660   V---AAKGTLKRFETSAPDEKEKKEKETDEEFLRELMSDPKGNESLAYEERVVESKDDIN  716

Query  495   EAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYR  316
               ++  N+CNL VVGR      V ++    +CPELGP+G LLS  +FS+TASVLVVQ Y 
Sbjct  717   ATLKSMNKCNLFVVGRTAG---VVSLVHSTDCPELGPVGRLLSSSDFSSTASVLVVQGYD  773

Query  315   TELSKNGLKEDDS  277
                    L E+D+
Sbjct  774   PAADTRPLVEEDA  786



>emb|CDX94208.1| BnaC07g38420D [Brassica napus]
Length=798

 Score =   889 bits (2298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/788 (65%), Positives = 611/788 (78%), Gaps = 26/788 (3%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             MG+N    C  PMKATSNG FQG++PL YALPLLI+QIC+V+ LTRVLA+L RPLRQPRV
Sbjct  1     MGTNDAT-CSGPMKATSNGVFQGENPLHYALPLLILQICIVLFLTRVLAFLFRPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEI+GG+LLGPSA G+S  +L+ +FP KSLTVLDTLA+LGLLFFLFLVGLELDPKSL+R
Sbjct  60    IAEIVGGILLGPSALGKSSKFLSTVFPTKSLTVLDTLANLGLLFFLFLVGLELDPKSLKR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKALSIALAGI+LPF  GIGTSF LR++IA GVS+ PFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKKALSIALAGITLPFIFGIGTSFALRSSIADGVSKAPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE+KLLTTD+G++A+SAAAVNDVAAWILLALA+ALSG G SPL SLWV L G GFV+ CI
Sbjct  180   AEIKLLTTDIGKIALSAAAVNDVAAWILLALAVALSGDGSSPLTSLWVFLAGCGFVVFCI  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
             + V    +W+A RC EGEPV E YVC  L  VL A FVTD IGIHALFGAFVIGV+ PK+
Sbjct  240   IAVQPGMQWLAKRCPEGEPVKEHYVCLTLGVVLAASFVTDLIGIHALFGAFVIGVIFPKE  299

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A++LVEKVEDLVSGLFLPLYFVSSGLKT+VATIQGAQSWGLLVLVIF ACFGKI+GT
Sbjct  300   GHFATSLVEKVEDLVSGLFLPLYFVSSGLKTDVATIQGAQSWGLLVLVIFNACFGKIVGT  359

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             ++VS  C +P  E++ LGFLMNTKGLVELIVLNIG+DRGVLNDQ FAIMVLMA+ TTF+T
Sbjct  360   VVVSLYCEVPLDESLALGFLMNTKGLVELIVLNIGRDRGVLNDQVFAIMVLMAIVTTFMT  419

Query  1398  TPIVIALYKPAK-LAVTEYKYRTIQRKDPS-KQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             TP+V+A+YKP K L   EY  RT++  + S K L ++ CF S  NIP+++NLIEASRGT 
Sbjct  420   TPLVLAVYKPGKSLTKGEYNNRTVEDTNQSNKPLCLMFCFQSIMNIPTIVNLIEASRGTN  479

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
             +     VYAMHLMELSERSSAILM HK R+NGLPFWN       S  +VVAFE F+ LS+
Sbjct  480   RKESLSVYAMHLMELSERSSAILMAHKVRRNGLPFWNKDKTGNSSDMVVVAFEAFQRLSR  539

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             VS+RP TAISAM+++HEDI  SAE KR AM+ILPFHKH ++D  +ETTRN+ R +N++V+
Sbjct  540   VSVRPMTAISAMATIHEDICRSAESKRTAMVILPFHKHVRLDRTWETTRNDYRLINKKVM  599

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             E APCSV ILVDRGLGG + V++S+    ITVL+FGG+DDREALA+  RM EHPGI L V
Sbjct  600   EEAPCSVAILVDRGLGGATRVASSDFTLVITVLFFGGNDDREALAFAVRMAEHPGISLTV  659

Query  684   ARF----TLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVV  517
              RF       PE     +                  ED   + +  +   S + YE+K+V
Sbjct  660   IRFIPSEEFKPENVKLEIT-----------------EDQAESSRSDSDIESKIIYEDKIV  702

Query  516   KSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLL-SCKEFSTTA  343
             +   E  E I+ Y+R NL +VG+ PEG + + ++  + + PELGP+GNLL S +  ST+A
Sbjct  703   RCHDEICEVIKEYSRSNLFLVGKSPEGSVASGLNVVRSDTPELGPVGNLLTSSESVSTSA  762

Query  342   SVLVVQQY  319
             SVLVVQQY
Sbjct  763   SVLVVQQY  770



>ref|XP_002314344.2| hypothetical protein POPTR_0010s00740g [Populus trichocarpa]
 gb|EEF00515.2| hypothetical protein POPTR_0010s00740g [Populus trichocarpa]
Length=800

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/808 (63%), Positives = 623/808 (77%), Gaps = 21/808 (3%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             MKATSNG+FQ ++PLDYALPLLI+QICLVV  TR LA+LL+PLRQPRVIAEIIGG+LLGP
Sbjct  1     MKATSNGAFQHENPLDYALPLLILQICLVVAFTRTLAFLLKPLRQPRVIAEIIGGILLGP  60

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SA GRSE +L+ +FP KS+TVLDT+A++GLLFFLFLVGLELD +S+RRTGKK+L+IA AG
Sbjct  61    SALGRSERFLHTVFPPKSMTVLDTVANIGLLFFLFLVGLELDIRSIRRTGKKSLAIAGAG  120

Query  2262  ISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQ  2083
             I+LPF LGIGTSF+LR+TI+KG +  PFLVFMGV+LSITAFPVLARILAELKLLTTDVG+
Sbjct  121   ITLPFLLGIGTSFVLRSTISKGSAHAPFLVFMGVSLSITAFPVLARILAELKLLTTDVGR  180

Query  2082  mamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMAS  1903
             +AMSAAAVNDV AWILLALAIALSG+  SPLISLWVLLCG GFV+  + V+  + + MA 
Sbjct  181   IAMSAAAVNDVVAWILLALAIALSGSNTSPLISLWVLLCGVGFVVFSVYVIRPLLELMAR  240

Query  1902  RCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVE  1723
             R  +GEPV EIY+C  L+ VL + FVTD+IGIHALFGAFV+G+LVPKD P    L+EK+E
Sbjct  241   RSPDGEPVKEIYICITLSLVLASSFVTDSIGIHALFGAFVVGILVPKDSPFPGVLIEKIE  300

Query  1722  DLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTL-CRIPF  1546
             DLV+GLFLPLYF SSGLKTNVATI GAQSWGLLVLVI TACFGKI+GT+ VS +  ++PF
Sbjct  301   DLVAGLFLPLYFASSGLKTNVATISGAQSWGLLVLVIATACFGKIIGTMFVSRMFFKVPF  360

Query  1545  QEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPA  1366
             +EA  LGFLMNTKGLVELIVLNIGKDR VLNDQTFA++VLMALFTTFITTPIV+A+YKPA
Sbjct  361   REAAALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAVLVLMALFTTFITTPIVMAVYKPA  420

Query  1365  KLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLM  1186
             +  V  YK RT++RKD   +LR+L CFHS RNIP++INL+E SRGT K G   VYAMHLM
Sbjct  421   R-RVAPYKNRTVKRKDLDTELRLLACFHSSRNIPTMINLVECSRGTRKRGRLCVYAMHLM  479

Query  1185  ELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMS  1006
             ELSERSSAI M HKARKNGLPFWN + +  D  ++V+AFE ++ LS V+IRP TAISA++
Sbjct  480   ELSERSSAISMVHKARKNGLPFWNKKRD--DRDQMVIAFEAYQQLSSVTIRPMTAISALN  537

Query  1005  SMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDR  826
             +++EDI  SA  KR AMI+LPFHKHQ++DG  E+  + L+ VN+RVL  +PCS GIL+DR
Sbjct  538   TIYEDICTSAHQKRAAMILLPFHKHQRVDGSLESLGHSLQEVNQRVLRHSPCSAGILIDR  597

Query  825   GLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGTs  646
             G GGT+ VSAS+V Y I V +FGG DD EALAYG RM EHPGI L V +F   P +  T 
Sbjct  598   GFGGTTQVSASDVSYKIAVPFFGGSDDMEALAYGIRMAEHPGIMLTVLKFV--PASGKTL  655

Query  645   v------kldvspsgssspeekSRDEDFLAAFKQ--RNSTNSSVKYEEKVVKSAAETMEA  490
             +         +      +   ++  E F + F Q        SV +EE+VV+S A+ + A
Sbjct  656   LTLEGHDTNVIRVENDKNSNSEADSEIFFSEFVQLAAKKLQDSVTHEERVVESKADVVAA  715

Query  489   IRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTE  310
             ++  ++ NL +VGRMP    +A +    + PELGP+G+ L+   FS TASVLV+Q Y   
Sbjct  716   LKSMSKSNLFLVGRMPP---IAPLLISTDTPELGPVGSFLASSNFSNTASVLVIQHYNPN  772

Query  309   LSKNGLKE----DDSVDGDYESA*VHKF  238
             ++ + L E    +D+ DG      V K+
Sbjct  773   VNLHPLVEEKENEDTDDGTDTPVLVDKY  800



>ref|XP_011012790.1| PREDICTED: cation/H(+) antiporter 19-like [Populus euphratica]
Length=834

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/802 (63%), Positives = 617/802 (77%), Gaps = 20/802 (2%)
 Frame = -1

Query  2688  AGFLRFSAEIMG---SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRV  2518
             AGF R S E M    SN T   P PMKATSNG+FQ ++PLDYALPLLI+QICLVV  TR 
Sbjct  15    AGFCRGSCENMDTNTSNVTAALPKPMKATSNGAFQHENPLDYALPLLILQICLVVAFTRT  74

Query  2517  LAYLLRPLRQPRVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflf  2338
             LA+LL+PLRQPRVIAEIIGG+LLGPSA GRSE +L+ +FP KS+TVLDT+A++GLLFFLF
Sbjct  75    LAFLLKPLRQPRVIAEIIGGILLGPSALGRSERFLHTVFPPKSMTVLDTVANIGLLFFLF  134

Query  2337  lvgleLDPKSLRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVA  2158
             LVGLELD +S+RRTGKK+L+IA AGI+LPF LGIGTSF+LR+TI+KG +  PFLVFMGV+
Sbjct  135   LVGLELDIRSIRRTGKKSLAIAGAGITLPFLLGIGTSFVLRSTISKGSAHAPFLVFMGVS  194

Query  2157  LSITAFPVLARILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLW  1978
             LSITAFPVLARILAELKLLTTDVG++AMSAAAVNDV AWILLALAIALSG+  SPLISLW
Sbjct  195   LSITAFPVLARILAELKLLTTDVGRIAMSAAAVNDVVAWILLALAIALSGSNTSPLISLW  254

Query  1977  VLLCGTGFVLLCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHAL  1798
             VLLCG GFV+  +  +  + + MA R  +GEPV EIY+C  L+ VL + FVTD+IGIHAL
Sbjct  255   VLLCGVGFVVFSVYAIRPLLELMARRSPDGEPVKEIYICITLSLVLASSFVTDSIGIHAL  314

Query  1797  FGAFVIGVLVPKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVL  1618
             FGAFV+G+LVPKD P    L+EK+EDLV+GLFLPLYF SSGLKTNVATI GAQSWGLLVL
Sbjct  315   FGAFVVGILVPKDSPFPGVLIEKIEDLVAGLFLPLYFASSGLKTNVATISGAQSWGLLVL  374

Query  1617  VIFTACFGKILGTILVSTL-CRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTF  1441
             VI TACFGKI+GT+ VS +  ++PF+EA  LGFLMNTKGLVELIVLNIGKDR VLNDQTF
Sbjct  375   VIATACFGKIIGTLFVSRMFFKVPFREAAALGFLMNTKGLVELIVLNIGKDRKVLNDQTF  434

Query  1440  AIMVLMALFTTFITTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPS  1261
             A++VLMALFTTFITTPIV+A+YKPA+     YK RT++RKD   +LR+L CFHS RNIP+
Sbjct  435   AVLVLMALFTTFITTPIVMAVYKPARRG-APYKNRTVKRKDLDTELRLLACFHSSRNIPT  493

Query  1260  LINLIEASRGTEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEI  1081
             +INL+E SRGT + G   VYAMHLMELSERSSAI M HKARKNGLPFWN + +  D  ++
Sbjct  494   MINLVECSRGTRQRGRLCVYAMHLMELSERSSAISMVHKARKNGLPFWNKKRD--DRDQM  551

Query  1080  VVAFETFEHLSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETT  901
             V+AFE ++ LS V+IRP TAISA+++++EDI  SA  KR AMI+LPFHKHQ+ DG  E  
Sbjct  552   VIAFEAYQQLSSVTIRPMTAISALNTIYEDICTSAHQKRAAMILLPFHKHQRADGSLEFL  611

Query  900   RNELRHVNRRVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGA  721
                L+ VN+RVL  +PCSVGIL+DRG GGT+ VSAS+V   I V +FGG DD EALAYG 
Sbjct  612   GRSLQEVNQRVLRHSPCSVGILIDRGFGGTTQVSASDVSSKIVVPFFGGSDDMEALAYGM  671

Query  720   RMVEHPGICLVVARFTLDPETAGTsv------kldvspsgssspeekSRDEDFLAAFKQR  559
             RM EHPGI L V +F   P +  T +                +   ++  E F + F Q 
Sbjct  672   RMAEHPGIMLTVLKFV--PVSGKTLLTLEGHDTNVNRVENDKNSNSQADSEIFFSEFVQH  729

Query  558   NST--NSSVKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGP  385
              +     SV +EE VV+S A+ + A++  ++ NL +VGRMP    +A +    + PELGP
Sbjct  730   AAKKLQDSVTHEEIVVESKADVVAALKSMSKSNLFMVGRMPP---IAPLVISTDTPELGP  786

Query  384   LGNLLSCKEFSTTASVLVVQQY  319
             +G++L+   FS TASVLV+Q Y
Sbjct  787   VGSILASSNFSNTASVLVIQHY  808



>ref|XP_009383924.1| PREDICTED: cation/H(+) antiporter 19-like [Musa acuminata subsp. 
malaccensis]
Length=793

 Score =   886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/770 (66%), Positives = 609/770 (79%), Gaps = 9/770 (1%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             MKATSNGS+QGD+PLDYALPL IVQICLV+ +TR LA++LRPLRQPRVIAEIIGG+LLGP
Sbjct  1     MKATSNGSWQGDNPLDYALPLAIVQICLVITVTRFLAFVLRPLRQPRVIAEIIGGILLGP  60

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SA GRSEA+LN +FPK+SLTVLDTLA++GLLFFLFLVGLELD +++RRTGK+AL IA+AG
Sbjct  61    SALGRSEAFLNTVFPKQSLTVLDTLANIGLLFFLFLVGLELDIRAIRRTGKRALGIAVAG  120

Query  2262  ISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQ  2083
             ISLPF +GIGTS +LR T++KGV  GPFLVFMGVALSITAFPVLARILAELKLLTTD+G+
Sbjct  121   ISLPFIMGIGTSVVLRHTVSKGVRAGPFLVFMGVALSITAFPVLARILAELKLLTTDLGR  180

Query  2082  mamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMAS  1903
             MAMSAAAVNDVAAWILLALAIAL+G+G SPLISLWVLL G GFV+   L+V  +  WMA 
Sbjct  181   MAMSAAAVNDVAAWILLALAIALTGSG-SPLISLWVLLTGVGFVVFVALLVRPVLDWMAR  239

Query  1902  RCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVE  1723
             R   GEPV EIY+CA LA VL AGFVTDTIGIHALFGAF+IG++VPKDGP A  L+EK+E
Sbjct  240   RSPVGEPVKEIYICATLATVLAAGFVTDTIGIHALFGAFIIGIVVPKDGPFAGVLIEKIE  299

Query  1722  DLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQ  1543
             DL++GLFLPLYFVSSGLKTNVATI+G QSW LLVLVI TA FGKI GT++VS L ++P +
Sbjct  300   DLIAGLFLPLYFVSSGLKTNVATIRGGQSWALLVLVICTASFGKIGGTLVVSLLVKVPMR  359

Query  1542  EAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAK  1363
             EA+TLG LMNTKGLVELIVLNIGKDR VLND+TFAI+VLMALFTTFITTPIV+A+YKPA+
Sbjct  360   EALTLGILMNTKGLVELIVLNIGKDRKVLNDETFAILVLMALFTTFITTPIVMAVYKPAR  419

Query  1362  LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLME  1183
              +   YK+R+I R D   + RIL CFH  RNIP++INLIE+SRGT +  G  VYA+HLME
Sbjct  420   RS-PPYKHRSILRDDAESEFRILACFHGSRNIPTMINLIESSRGTRRR-GITVYAVHLME  477

Query  1182  LSERSSAILMCHKARKNGLPFWNTRGEPTD-STEIVVAFETFEHLSKVSIRPSTAISAMS  1006
             LSERSSAI M HKAR+NGLPFWN +    D   ++VVAF+ ++ LS V++R  TAIS + 
Sbjct  478   LSERSSAISMVHKARRNGLPFWNKKQCYEDGGDQLVVAFQAYQQLSNVTVRSMTAISDLQ  537

Query  1005  SMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDR  826
             ++HEDII SAE KR + I+LPFHK Q+IDG  E+  +    VN+RVL  APCSVGILVDR
Sbjct  538   TIHEDIITSAEQKRTSFILLPFHKLQQIDGSMESIGHAYHLVNQRVLRCAPCSVGILVDR  597

Query  825   GLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGTs  646
             GLGG + V AS V YT+ VL+FGG DDREALA G RM EHPGI L V RF    +     
Sbjct  598   GLGGAAQVVASEVFYTVAVLFFGGRDDREALALGMRMAEHPGIQLTVTRFIPQADQL-RG  656

Query  645   vkldvspsgssspeekSRDEDFLAAFKQRN-STNSSVKYEEKVVKSAAETMEAIRGYNRC  469
                  S +      E + DED++  F+ +   +N S+ Y++KV    AE + AI+   RC
Sbjct  657   RDGGGSVTIRMDANEIAADEDYITVFRDKVLPSNESITYDDKVAGGKAEIVAAIKDMGRC  716

Query  468   NLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             NL +VG+ P      A+  K +CPELGP+G+ L+  EF TT+SVLV++Q+
Sbjct  717   NLFLVGQAPA---TVALTDKNDCPELGPVGSYLASSEFGTTSSVLVIKQF  763



>ref|XP_002440851.1| hypothetical protein SORBIDRAFT_09g008200 [Sorghum bicolor]
 gb|EES19281.1| hypothetical protein SORBIDRAFT_09g008200 [Sorghum bicolor]
Length=796

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/796 (63%), Positives = 614/796 (77%), Gaps = 35/796 (4%)
 Frame = -1

Query  2625  PMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLG  2446
             PMKATS+G FQG++PL  ALPL I+QIC+VV+LTRVLA++LRPLRQPRV+AEIIGG+LLG
Sbjct  11    PMKATSDGVFQGENPLHSALPLAILQICIVVVLTRVLAFILRPLRQPRVVAEIIGGILLG  70

Query  2445  PSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALA  2266
             PSA GRS A+LN +FPK+SLTVLDTLA++GLL+FLFLVGLELD +++RRTG  AL IA+A
Sbjct  71    PSAVGRSTAFLNTVFPKQSLTVLDTLANIGLLYFLFLVGLELDLRAIRRTGSTALVIAVA  130

Query  2265  GISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVG  2086
             GISLPF +GIGTSF+L+ T+A+GV  GPFLVFMGVALSITAFPVLARILAELKLLTTD+G
Sbjct  131   GISLPFIMGIGTSFVLQHTVARGVPTGPFLVFMGVALSITAFPVLARILAELKLLTTDIG  190

Query  2085  QmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMA  1906
             +MAMSAAAVNDV AWILLALAIALSG+G SPL+SLWVLL G GFVL   L++  +  WMA
Sbjct  191   RMAMSAAAVNDVVAWILLALAIALSGSG-SPLVSLWVLLAGAGFVLAAFLLIRPVLTWMA  249

Query  1905  SRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKV  1726
              R  EGEPV E+Y+CA LA VL AGF TDTIGIHALFGAF++G++VPKDGP A  L+EKV
Sbjct  250   RRSPEGEPVKELYICATLAIVLAAGFATDTIGIHALFGAFIVGIVVPKDGPFAGVLLEKV  309

Query  1725  EDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPF  1546
             EDL+SGLFLPLYFVSSGLKTNV TI+G  SW LLVLV+ TAC GKI GT++ S + R+PF
Sbjct  310   EDLISGLFLPLYFVSSGLKTNVMTIKGGDSWALLVLVVATACIGKIGGTVIASLIVRVPF  369

Query  1545  QEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPA  1366
             +EA+TLGFLMNTKGLVELIVLNIGKDR VLND+TFAI+VLMAL TTFITTP+V+A+YKPA
Sbjct  370   REALTLGFLMNTKGLVELIVLNIGKDRHVLNDETFAILVLMALITTFITTPVVMAIYKPA  429

Query  1365  KLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLM  1186
             +     YK R ++R +P  + R++ CFHS RNIP++INL+E+SRGT K  G  VYAMHL+
Sbjct  430   RRG-PPYKNRAVERANPHDEFRMMACFHSTRNIPTIINLMESSRGTRKR-GITVYAMHLV  487

Query  1185  ELSERSSAILMCHKARKNGLPFWNTRGE-PTDSTEIVVAFETFEHLSKVSIRPSTAISAM  1009
             ELSERSSAI M HKAR+NG+PFWN R     D  ++VVAFET++ LS+VSIR  TAIS +
Sbjct  488   ELSERSSAISMVHKARRNGMPFWNKRRNGDGDGDQLVVAFETYQQLSRVSIRAMTAISDL  547

Query  1008  SSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVD  829
              ++HED++ SA  KR A+I+LPFHK  ++DGH E+  ++ +H+N+RVL  APCSVGILVD
Sbjct  548   HTIHEDVVTSAHQKRAALIVLPFHKLHQMDGHMESLGDQYQHINQRVLHHAPCSVGILVD  607

Query  828   RGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGT  649
             RGLGG + V+AS+V YTI V++FGG DDREALAY  RMVEHPGI L V RF L   ++  
Sbjct  608   RGLGGAAQVAASDVSYTIVVIFFGGRDDREALAYAMRMVEHPGIGLHVLRFCLVQSSS--  665

Query  648   svkldvspsgssspeekSRDEDFLAAFKQRNST-NSSVKYEEKVVKSAAETMEAIRGYNR  472
                                D+ FL  F+ + +  N SV+YE+K      E +EAI+    
Sbjct  666   ---------------TDVDDDAFLEDFRTKVANGNDSVRYEDKPAGGKEEVVEAIKAIGP  710

Query  471   CNLLVVGR----MPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTELS  304
             CNL +VG+    MP       +D   +CPELGPLG  L+  EFST ASVLV++QY     
Sbjct  711   CNLFLVGQGTPCMP------LIDWSTDCPELGPLGTYLALPEFSTVASVLVMKQYDPTAK  764

Query  303   KNGLKE---DDSVDGD  265
                L E   D +VD D
Sbjct  765   HYDLVEEVADIAVDVD  780



>ref|XP_008654236.1| PREDICTED: uncharacterized protein LOC100191437 isoform X1 [Zea 
mays]
 gb|AFW81495.1| hypothetical protein ZEAMMB73_283365 [Zea mays]
Length=796

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/805 (63%), Positives = 613/805 (76%), Gaps = 35/805 (4%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
              N T     PMKATS+G FQG++PL  ALPL I+QIC+VV+LTRVLA++LRPLRQPRVIA
Sbjct  2     DNATAEALKPMKATSDGVFQGENPLHSALPLAILQICIVVVLTRVLAFILRPLRQPRVIA  61

Query  2472  EIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTG  2293
             EIIGG+LLGPSA GRS A+LN +FPK+SLTVLDT+A++GLL+FLFLVGLELD +++R TG
Sbjct  62    EIIGGILLGPSAVGRSTAFLNTVFPKQSLTVLDTIANIGLLYFLFLVGLELDLRAIRHTG  121

Query  2292  KKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAE  2113
               AL IA+AGISLPF +GIGTSF+L+ T+A+GV   PFLVFMGVALSITAFPVLARILAE
Sbjct  122   STALVIAVAGISLPFIMGIGTSFVLQHTVARGVPTAPFLVFMGVALSITAFPVLARILAE  181

Query  2112  LKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILV  1933
             LKLLTTD+G+MAMSAAAVNDV AWILLALAIALSGTG SPL+SLWVLL GTGFVL   L+
Sbjct  182   LKLLTTDLGRMAMSAAAVNDVVAWILLALAIALSGTG-SPLVSLWVLLAGTGFVLAAFLL  240

Query  1932  VPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
             +     WMA R  EGEPV E+Y+CA LA VL AGF TD IGIHALFGAF++G++VPKDGP
Sbjct  241   LRPGLTWMARRSPEGEPVKELYICATLAIVLAAGFATDAIGIHALFGAFIVGIIVPKDGP  300

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
              A  L+EKVEDL+SGLFLPLYFVSSGLKTNV TI+G  SW LLVLV+ TAC GKI GT++
Sbjct  301   FAGVLLEKVEDLISGLFLPLYFVSSGLKTNVMTIKGGDSWALLVLVVATACIGKIGGTVI  360

Query  1572  VSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTP  1393
              S + R+PF+EA+TLGFLMNTKGLVELIVLNIGKDR VLND+TFAI+VLMAL TTFITTP
Sbjct  361   ASLIVRVPFREALTLGFLMNTKGLVELIVLNIGKDRHVLNDETFAILVLMALITTFITTP  420

Query  1392  IVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGG  1213
             +V+ +YKPA+     YK RT+QR +P  + R++ CFHS RNIP++INL+E+SRGT K  G
Sbjct  421   VVMTIYKPARRG-APYKNRTVQRANPHDEFRMMACFHSTRNIPTIINLMESSRGTRKR-G  478

Query  1212  FKVYAMHLMELSERSSAILMCHKARKNGLPFWN-TRGEPTDSTEIVVAFETFEHLSKVSI  1036
               VYAMHL+ELSERSSAI M HKAR+NG+PFWN  R       ++VVAFET++ LS+VSI
Sbjct  479   ITVYAMHLVELSERSSAICMVHKARRNGMPFWNRRRNGDGGGDQLVVAFETYQQLSRVSI  538

Query  1035  RPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGA  856
             R  TAIS + ++HED++ SA  KR A+I+LPFHK  +IDGH E+  ++ +H+N+RVL  A
Sbjct  539   RAMTAISDLETIHEDVVTSAHQKRAALIVLPFHKLHQIDGHMESLGDQYQHINQRVLHHA  598

Query  855   PCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF  676
             PCSVGILVDRGLGG + V+AS+V YTI V++FGG DDREALAYG RMVEHPGI L V RF
Sbjct  599   PCSVGILVDRGLGGVAQVAASDVSYTIVVIFFGGRDDREALAYGMRMVEHPGIGLHVLRF  658

Query  675   TLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNST-NSSVKYEEKVVKSAAET  499
              L    A +                   D  FL  F+ + +  N SV+YE++ V    E 
Sbjct  659   LLQSGGAAS-----------------DDDASFLEEFRTKVANGNDSVRYEDRTVGGKEEV  701

Query  498   MEAIRGYNRCNLLVVGR----MPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLV  331
             +EAI+   RCNL +VG+    MP       +D   + PELGP+G  L+  EFST ASVLV
Sbjct  702   VEAIKATGRCNLFLVGQGTPCMP------LVDWSTDSPELGPVGTYLALPEFSTVASVLV  755

Query  330   VQQYRTELSKNGLKE---DDSVDGD  265
             ++QY      +   E   D +VD D
Sbjct  756   MKQYDPMAKHDDFVEEVADIAVDVD  780



>ref|XP_003542393.1| PREDICTED: cation/H(+) antiporter 19-like [Glycine max]
Length=813

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/810 (62%), Positives = 614/810 (76%), Gaps = 20/810 (2%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +     CPA MKATSNG+FQ ++PLDYALPLLI+QICLVV+ TRV+A+L RPLRQPRV
Sbjct  1     MATANNASCPAFMKATSNGAFQHENPLDYALPLLILQICLVVVFTRVIAFLCRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEIIGG+LLGPSA GR+E +L+ +FPKKS+TVLDTL ++GLLFFLFLVGLELD +++RR
Sbjct  61    IAEIIGGILLGPSAIGRNEKFLSTVFPKKSITVLDTLGNVGLLFFLFLVGLELDMRAIRR  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TG KAL+IAL GI++PF LGIGTSF LRAT++KG     FLVFMGVALSITAFPVLARIL
Sbjct  121   TGHKALAIALCGITVPFVLGIGTSFALRATVSKGAEPVSFLVFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG++AMSAAAVNDVAAWILLALAIA+SG+  SP + LWVLL G  FV+  +
Sbjct  181   AELKLLTTDVGRIAMSAAAVNDVAAWILLALAIAISGSNGSPFVPLWVLLSGVAFVIFAV  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
               +  +   MA+R  EGEPV E+Y+C  L  VL   FVTDTIGIHALFGAFVIG ++PK+
Sbjct  241   FAIRPLLVAMANRSPEGEPVKEVYICITLTLVLACSFVTDTIGIHALFGAFVIGTIMPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  +  ++EK+EDLVSGLFLPL+FVSSGLKTNVATI G  SW +LVLVIF ACFGKI+GT
Sbjct  301   GSFSVVMIEKIEDLVSGLFLPLFFVSSGLKTNVATISGGLSWAMLVLVIFNACFGKIVGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             I+VS  C++P QEA+ LGFLMNTKGLVELIVLNIGKDR VLNDQ FAI VLMALFTTFIT
Sbjct  361   IVVSLTCKVPSQEAVALGFLMNTKGLVELIVLNIGKDRKVLNDQAFAICVLMALFTTFIT  420

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             TPIV+A+YKPA+     YK+RTIQR+DP  +LR+L CFH+ RNIP+LINLIE+SRG  K 
Sbjct  421   TPIVMAVYKPARRG-APYKHRTIQRRDPDTELRMLACFHTTRNIPTLINLIESSRGIRKR  479

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
             G   +YAMHLMELSERSSAI M HKARKNG+PFWN +  P D  ++++AF+ +E L  V+
Sbjct  480   GKLCIYAMHLMELSERSSAITMVHKARKNGMPFWNKK--PDDKDQMIIAFQAYEKLRSVN  537

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             +RP TAISA++S+HEDI  SA  KR AMIILPFHKHQ++DG  E+  + L  +N+ VL  
Sbjct  538   VRPMTAISALNSIHEDICTSAHQKRAAMIILPFHKHQRVDGSMESLGHSLHVMNQLVLSH  597

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             APCSVGILVDRGLGGTS V AS+V Y + V +FGG DDREAL YG RM EHPGI L V +
Sbjct  598   APCSVGILVDRGLGGTSQVQASDVSYKVVVPFFGGRDDREALCYGMRMAEHPGILLNVVK  657

Query  678   FTLDPET-----------AGTsvkldvspsgssspeekSRDEDFLAAFKQR-NSTNSSVK  535
             F   P             +    K  +   G S  ++K +D+   + F    N+   S+K
Sbjct  658   FVPPPGASLAFGAKLVGMSSNKDKKAMEVVGGSYYDDKQQDDQLWSEFLSACNNNQESMK  717

Query  534   YEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEF  355
             YE+K+V S  +   A++  NR NL++VGRMP    V  +  + +CPELGP+G+ ++  +F
Sbjct  718   YEQKLVASKGDIEAALKEMNRSNLILVGRMPS---VGPLVSRSDCPELGPVGSYMASSDF  774

Query  354   STTASVLVVQQYR--TELSKNGLKEDDSVD  271
             ST  SV+V+QQY   T++    ++E D  D
Sbjct  775   STVTSVMVIQQYNPSTDIHPLVMEEFDYPD  804



>gb|KHN45029.1| Cation/H(+) antiporter 19 [Glycine soja]
Length=813

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/810 (62%), Positives = 614/810 (76%), Gaps = 20/810 (2%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +     CPA MKATSNG+FQ ++PLDYALPLLI+QICLVV+ TRV+A+L RPLRQPRV
Sbjct  1     MATGNNASCPAFMKATSNGAFQHENPLDYALPLLILQICLVVVFTRVIAFLCRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEIIGG+LLGPSA GR+E +L+ +FPKKS+TVLDTL ++GLLFFLFLVGLELD +++RR
Sbjct  61    IAEIIGGILLGPSAIGRNEKFLSTVFPKKSITVLDTLGNVGLLFFLFLVGLELDMRAIRR  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TG KAL+IAL GI++PF LGIGTSF LRAT++KG     FLVFMGVALSITAFPVLARIL
Sbjct  121   TGHKALAIALCGITVPFVLGIGTSFALRATVSKGAEPVSFLVFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG++AMSAAAVNDVAAWILLALAIA+SG+  SP + LWVLL G  FV+  +
Sbjct  181   AELKLLTTDVGRIAMSAAAVNDVAAWILLALAIAISGSNGSPFVPLWVLLSGVAFVIFAV  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
               +  +   MA+R  EGEPV E+Y+C  L  VL   FVTDTIGIHALFGAFVIG ++PK+
Sbjct  241   FAIRPLLVAMANRSPEGEPVKEVYICITLTLVLACSFVTDTIGIHALFGAFVIGTIMPKE  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  +  ++EK+EDLVSGLFLPL+FVSSGLKTNVATI G  SW +LVLVIF ACFGKI+GT
Sbjct  301   GSFSVVMIEKIEDLVSGLFLPLFFVSSGLKTNVATISGGLSWAMLVLVIFNACFGKIVGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             I+VS  C++P QEA+ LGFLMNTKGLVELIVLNIGKDR VLNDQ FAI VLMALFTTFIT
Sbjct  361   IVVSLTCKVPSQEAVALGFLMNTKGLVELIVLNIGKDRKVLNDQAFAICVLMALFTTFIT  420

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             TPIV+A+YKPA+     YK+RTIQR+DP  +LR+L CFH+ RNIP+LINLIE+SRG  K 
Sbjct  421   TPIVMAVYKPARRG-APYKHRTIQRRDPDTELRMLACFHTTRNIPTLINLIESSRGIRKR  479

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
             G   +YAMHLMELSERSSAI M HKARKNG+PFWN +  P D  ++++AF+ +E L  V+
Sbjct  480   GKLCIYAMHLMELSERSSAITMVHKARKNGMPFWNKK--PDDKDQMIIAFQAYEKLRSVN  537

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             +RP TAISA++S+HEDI  SA  KR AMIILPFHKHQ++DG  E+  + L  +N+ VL  
Sbjct  538   VRPMTAISALNSIHEDICTSAHQKRAAMIILPFHKHQRVDGSMESLGHSLHVMNQLVLSH  597

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             APCSVGILVDRGLGGTS V AS+V Y + V +FGG DDREAL YG RM EHPGI L V +
Sbjct  598   APCSVGILVDRGLGGTSQVQASDVSYKVVVPFFGGRDDREALCYGMRMAEHPGILLNVVK  657

Query  678   FTLDPET-----------AGTsvkldvspsgssspeekSRDEDFLAAFKQR-NSTNSSVK  535
             F   P             +    K  +   G S  ++K +D+   + F    N+   S+K
Sbjct  658   FVPPPGASLAFGAKLVGMSSNKDKKAMEVVGGSYYDDKQQDDQLWSEFLSACNNNQESMK  717

Query  534   YEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEF  355
             YE+K+V S  +   A++  NR NL++VGRMP    V  +  + +CPELGP+G+ ++  +F
Sbjct  718   YEQKLVASKGDIEAALKEMNRSNLILVGRMPS---VGPLVSRSDCPELGPVGSYMASSDF  774

Query  354   STTASVLVVQQYR--TELSKNGLKEDDSVD  271
             ST  SV+V+QQY   T++    ++E D  D
Sbjct  775   STVTSVMVIQQYNPSTDIHPLVMEEFDYPD  804



>ref|XP_006654211.1| PREDICTED: cation/H(+) antiporter 19-like [Oryza brachyantha]
Length=786

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/781 (64%), Positives = 609/781 (78%), Gaps = 17/781 (2%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             MKATS+G FQG++PL  ALPL I+QIC+VV+LTRVLA+LLRPLRQPRVIAEIIGG+LLGP
Sbjct  1     MKATSDGVFQGENPLHSALPLAILQICIVVVLTRVLAFLLRPLRQPRVIAEIIGGILLGP  60

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SA GRS A+++ +FPK+SLTVLDTLA++GLLFFLFLVGLELD +SLRRTG  AL+IA+AG
Sbjct  61    SAIGRSSAFIDTVFPKQSLTVLDTLANIGLLFFLFLVGLELDLRSLRRTGAGALAIAVAG  120

Query  2262  ISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQ  2083
             ISLPF LGI TSF+L+ T+A+GV  GPFLVFMGVALSITAFPVLARILAELKLLTTD+G+
Sbjct  121   ISLPFVLGIATSFVLQNTVARGVPTGPFLVFMGVALSITAFPVLARILAELKLLTTDLGR  180

Query  2082  mamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMAS  1903
             MAMSAAAVNDVAAWILLALAIALSGTG SPL+SLWVLL G GFV+   L +  +  WMA 
Sbjct  181   MAMSAAAVNDVAAWILLALAIALSGTG-SPLVSLWVLLTGVGFVVSSFLFLRPLLAWMAR  239

Query  1902  RCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVE  1723
             R  EGEPV EIY+CA L+ VL AGFVTDTIGIHALFGAF++G++VPKDGP A  L+EKVE
Sbjct  240   RSPEGEPVKEIYICATLSIVLAAGFVTDTIGIHALFGAFIVGIIVPKDGPFAGVLLEKVE  299

Query  1722  DLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQ  1543
             DL+SGL LPLYFVSSGLKTNV TI+G +SWGLLVLV+ TAC GKI GT+L S +  +P +
Sbjct  300   DLISGLLLPLYFVSSGLKTNVLTIKGGESWGLLVLVVATACIGKIGGTVLASLIASVPLR  359

Query  1542  EAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAK  1363
             EA+TLG LMNTKGLVELIVLNIGKDR VLND+TFAI+VLMAL  TFITTP+V+A+YKPA+
Sbjct  360   EAVTLGVLMNTKGLVELIVLNIGKDRHVLNDETFAILVLMALINTFITTPLVMAIYKPAR  419

Query  1362  LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLME  1183
               +  YK R +QR +P  +LR++ CFHS RNIP++INL+E+SRGT +  G  VYAMHL+E
Sbjct  420   QGL-PYKNRAVQRANPEDELRMMACFHSTRNIPTMINLMESSRGTRRR-GITVYAMHLVE  477

Query  1182  LSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMSS  1003
             LSERSSAI M HKAR+NG+PFWN R    D  ++VVAF+T++ LS+VSIR  TAIS + +
Sbjct  478   LSERSSAIYMVHKARRNGMPFWNRRFN-GDGDQLVVAFQTYQQLSRVSIRAMTAISDLHT  536

Query  1002  MHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDRG  823
             MHED++ SA  KR A+I+LPFHK  ++DGH E+  +E +H+N+RV+  APCSV ILVDRG
Sbjct  537   MHEDVVTSAHQKRAALIVLPFHKLHQMDGHMESMGDEYQHINQRVVRHAPCSVAILVDRG  596

Query  822   LGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGTsv  643
             LGG + V+AS+V Y I VL+FGG DDREALAY  RMVEHPGI L V RF   P  AG   
Sbjct  597   LGGAAQVAASDVSYNIAVLFFGGRDDREALAYATRMVEHPGIALHVLRFVPKPGAAGADS  656

Query  642   kldvspsgssspeekSRDEDFLAAFKQRNST-NSSVKYEEKVVKSAAETMEAIRGYNRCN  466
               D + +          DE  LA F+   +  N SV+YEE+      + +EAI+    CN
Sbjct  657   GNDSAAA----------DEASLADFRGNVADGNDSVRYEERAAGGKTDVVEAIKAMGPCN  706

Query  465   LLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTELSKNGLKE  286
             L +VG+      V   D+  +CPELGP+G+ L+  EFST ASVLV++QY        L E
Sbjct  707   LFLVGQ--GTPCVPLADRSTDCPELGPVGSYLALPEFSTVASVLVMKQYDPTAEHYDLVE  764

Query  285   D  283
             +
Sbjct  765   E  765



>ref|NP_974866.1| cation/H(+) antiporter 18 [Arabidopsis thaliana]
 gb|AED94697.1| cation/H(+) antiporter 18 [Arabidopsis thaliana]
Length=742

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/717 (67%), Positives = 582/717 (81%), Gaps = 5/717 (1%)
 Frame = -1

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             +LGPS  GRS+A+L+A+FPKKSLTVL+TLA+LGLLFFLFL GLE+D K+LRRTGKKAL I
Sbjct  1     MLGPSLLGRSKAFLDAVFPKKSLTVLETLANLGLLFFLFLAGLEIDTKALRRTGKKALGI  60

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             ALAGI+LPF LGIG+SF+L+ATI+KGV+   FLVFMGVALSITAFPVLARILAELKLLTT
Sbjct  61    ALAGITLPFALGIGSSFVLKATISKGVNSTAFLVFMGVALSITAFPVLARILAELKLLTT  120

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             ++G++AMSAAAVNDVAAWILLALAIALSG+  SPL+SLWV L G  FV+    ++P IF+
Sbjct  121   EIGRLAMSAAAVNDVAAWILLALAIALSGSNTSPLVSLWVFLSGCAFVIGASFIIPPIFR  180

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             W++ RC EGEP++E Y+CA LA VL  GF+TD IGIH++FGAFV+GVL+PK+GP A ALV
Sbjct  181   WISRRCHEGEPIEETYICATLAVVLVCGFITDAIGIHSMFGAFVVGVLIPKEGPFAGALV  240

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDLVSGLFLPLYFV+SGLKTNVATIQGAQSWGLLVLV  TACFGKILGT+ VS   +
Sbjct  241   EKVEDLVSGLFLPLYFVASGLKTNVATIQGAQSWGLLVLVTATACFGKILGTLGVSLAFK  300

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             IP +EAITLGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTFITTP+V+A+Y
Sbjct  301   IPMREAITLGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFITTPVVMAVY  360

Query  1374  KPAKLAVT--EYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVY  1201
             KPA+ A    EYK+R ++R++ + QLRILTCFH   +IPS+INL+EASRG EK  G  VY
Sbjct  361   KPARRAKKEGEYKHRAVERENTNTQLRILTCFHGAGSIPSMINLLEASRGIEKGEGLCVY  420

Query  1200  AMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTA  1021
             A+HL ELSERSSAILM HK RKNG+PFWN RG   D+ ++VVAF+ F+ LS+V++RP TA
Sbjct  421   ALHLRELSERSSAILMVHKVRKNGMPFWNRRGVNADADQVVVAFQAFQQLSRVNVRPMTA  480

Query  1020  ISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVG  841
             IS+MS +HEDI  +A  K+ A++ILPFHKHQ++DG  ETTR + R VNRRVL  APCSVG
Sbjct  481   ISSMSDIHEDICTTAVRKKAAIVILPFHKHQQLDGSLETTRGDYRWVNRRVLLQAPCSVG  540

Query  840   ILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPE  661
             I VDRGLGG+S VSA +V Y++ VL+FGG DDREALAYG RM EHPGI L V RF + PE
Sbjct  541   IFVDRGLGGSSQVSAQDVSYSVVVLFFGGPDDREALAYGLRMAEHPGIVLTVFRFVVSPE  600

Query  660   TAG--TsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAA-ETMEA  490
               G   +V++  + + + S +    DE+ ++  ++ +S + SVK+ EK +++AA +   A
Sbjct  601   RVGEIVNVEVSNNNNENQSVKNLKSDEEIMSEIRKISSVDESVKFVEKQIENAAVDVRSA  660

Query  489   IRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             I    R NL +VGRMP GEI  A+ +  ECPELGP+G+LL   E ST ASVLV+QQY
Sbjct  661   IEEVRRSNLFLVGRMPGGEIALAIRENSECPELGPVGSLLISPESSTKASVLVIQQY  717



>ref|XP_004505591.1| PREDICTED: cation/H(+) antiporter 19-like [Cicer arietinum]
Length=815

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/785 (64%), Positives = 609/785 (78%), Gaps = 18/785 (2%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CP PMKATSNG+FQ ++P+DYALPLLIVQI LVV  TR +A+L +PLRQPRVIAE+IGG+
Sbjct  8     CPPPMKATSNGAFQHENPMDYALPLLIVQIILVVAFTRFIAFLCKPLRQPRVIAEVIGGI  67

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GRS+ +L   FP +SLTVL+TLA++GLLFFLFLVGLELD +S+RRTG KAL I
Sbjct  68    LLGPSAIGRSKKFLETFFPARSLTVLETLANVGLLFFLFLVGLELDMRSIRRTGPKALCI  127

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             A+AGI+LPF LGIGTS +LR+TI+K V    FLVFMGV+LSITAFPVLARILAELKLLTT
Sbjct  128   AVAGITLPFVLGIGTSLVLRSTISKDVDPTSFLVFMGVSLSITAFPVLARILAELKLLTT  187

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             +VG++AMSAAAVND+AAWILLALAIALSG+  SPL+SLWVLLCG GF++  +LV+  +  
Sbjct  188   EVGRIAMSAAAVNDIAAWILLALAIALSGSNSSPLVSLWVLLCGAGFIIFAVLVIKPLVA  247

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             WMA R  EGEP+ EIY+C  L+ VL   F+TDTIGIHALFGAFV GV+VPKDGP A  L 
Sbjct  248   WMAKRSPEGEPIKEIYICVTLSLVLACSFLTDTIGIHALFGAFVAGVVVPKDGPFAGVLT  307

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EK+EDLV  L LPLYFVSSGLKTNVATI GA SWGLLVLVIFTACFGKI+GT++VS LC+
Sbjct  308   EKIEDLVMSLLLPLYFVSSGLKTNVATISGALSWGLLVLVIFTACFGKIVGTLVVSLLCK  367

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +PF++A+T+GFLMNTKGLVELIVLNIGKDR VLNDQ FAI VLMALFTTFITTPIV+A+Y
Sbjct  368   VPFRDALTIGFLMNTKGLVELIVLNIGKDRKVLNDQAFAICVLMALFTTFITTPIVMAVY  427

Query  1374  KPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAM  1195
             KPA+   + Y ++TIQRKDP  +LR+L CFHS  NIP+LINLIE+SRGT K G   +YAM
Sbjct  428   KPARKG-SPYMHKTIQRKDPDTELRVLACFHSTCNIPTLINLIESSRGTRKRGKLCIYAM  486

Query  1194  HLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAIS  1015
             HLMELSER SAI M HKAR NGLPFWN + +  +  ++V+AF+ + HLS V++RP TAIS
Sbjct  487   HLMELSERPSAITMVHKARNNGLPFWN-KLQNDNKDKMVIAFQAYGHLSSVNLRPMTAIS  545

Query  1014  AMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGIL  835
             +++++HEDI +SA  KRVAMI+LPF KHQ++DG  E+  +  R +N  VL  APCSVGIL
Sbjct  546   SLNNIHEDICSSAHQKRVAMILLPFDKHQRVDGTMESLGHSFRVMNGLVLSHAPCSVGIL  605

Query  834   VDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPE--  661
             VDRGLGGTS V AS+V Y + V +FGG DDREALAYG RM EHPGI L V +F   P   
Sbjct  606   VDRGLGGTSQVHASDVSYNVVVAFFGGCDDREALAYGMRMAEHPGILLTVIKFITPPGIT  665

Query  660   ----------TAGTsvkldvspsgssspeekSRDEDFLAAFKQRN-STNSSVKYEEKVVK  514
                       +A    K+     GS+  E+K  D+ F + F         S+ YEE++V+
Sbjct  666   LAFGANLIGVSANKDRKVIKVADGSTHDEDKQEDDQFWSEFLSVCCKKEESMMYEERLVE  725

Query  513   SAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVL  334
             +  + +  +R  N+ NL++VGRMP    VA +  + +C ELGP+G+ L+  EFST ASV+
Sbjct  726   NKEDVINVLRERNKSNLILVGRMPP---VAPLLDRSDCAELGPVGSYLATSEFSTFASVV  782

Query  333   VVQQY  319
             V QQY
Sbjct  783   VFQQY  787



>gb|KEH32403.1| cation/H+ exchanger 3 [Medicago truncatula]
Length=811

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/790 (63%), Positives = 609/790 (77%), Gaps = 19/790 (2%)
 Frame = -1

Query  2643  TVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEII  2464
              V CPAPMKATSNG+FQ ++PLDYALPLLI+QIC+VV  TR +AYL +PL+QPRVIAEII
Sbjct  5     NVTCPAPMKATSNGAFQHENPLDYALPLLILQICVVVTFTRCIAYLCKPLKQPRVIAEII  64

Query  2463  GGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKA  2284
             GG+LLGPSA GRSE +L+ +FPK+SLTVLDTLA++GLLFFLFLVGLELD +S+RRTGKKA
Sbjct  65    GGILLGPSAIGRSEKFLHTVFPKRSLTVLDTLANIGLLFFLFLVGLELDMRSIRRTGKKA  124

Query  2283  LSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKL  2104
             L+IAL GI+ PF LGIGTS +LRATI+KG    PFLVFMGVALSITAFPVLARILAELKL
Sbjct  125   LAIALCGITFPFVLGIGTSVVLRATISKGAQPVPFLVFMGVALSITAFPVLARILAELKL  184

Query  2103  LTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPR  1924
             LTTDVG++AMSAAAVNDVAAW+LLALAI+LSG   SPLISLWV+LCGT F+L  +  +  
Sbjct  185   LTTDVGRIAMSAAAVNDVAAWVLLALAISLSGDDTSPLISLWVMLCGTAFILFAVFAIRP  244

Query  1923  IFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLAS  1744
             +  +MA R  EGEPV E+Y+C  L  VL   FVTDTIGIHALFGAFVIG+++PKDGP A 
Sbjct  245   LLAYMAKRSPEGEPVKELYICITLTLVLACSFVTDTIGIHALFGAFVIGIIMPKDGPFAG  304

Query  1743  ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVST  1564
              L+EK+EDLVSG+FLPLYF SSGLKTNVATI G  SW LL+LVIFTACFGKI+GTI VS 
Sbjct  305   VLIEKIEDLVSGIFLPLYFASSGLKTNVATISGGVSWALLLLVIFTACFGKIVGTISVSL  364

Query  1563  LCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI  1384
             LC++PF+EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQ FAI VLMALFTTFITTPIV+
Sbjct  365   LCKVPFREALALGFLMNTKGLVELIVLNIGKDRKVLNDQAFAICVLMALFTTFITTPIVM  424

Query  1383  ALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKV  1204
             A+YKPA+     YK++T+QRKD   +LR+L CFHS RNIP+LINL+E+SRGT K G   +
Sbjct  425   AVYKPARRG-APYKHKTVQRKDQESELRVLACFHSTRNIPTLINLVESSRGTRKRGRLCI  483

Query  1203  YAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPST  1024
             YAMHLMELSERSSAI M HKAR NG+PFWN +    D  ++V+AF+T+  L+ V++RP T
Sbjct  484   YAMHLMELSERSSAISMVHKARNNGMPFWNKKQN--DEDQMVIAFQTYGKLNSVNVRPMT  541

Query  1023  AISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSV  844
             AISA+S++HEDI  SA  KR ++I+LPFHKHQ+IDG  E+  +    +N  VL  APCSV
Sbjct  542   AISALSNIHEDICTSAHQKRASIILLPFHKHQRIDGTMESLGHSFHVMNELVLSHAPCSV  601

Query  843   GILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDP  664
             GIL+DRGLGGTS V AS V + + V++FGG DD EALAYG RM EHPGI L V +F   P
Sbjct  602   GILIDRGLGGTSQVQASEVSFKVVVIFFGGRDDHEALAYGMRMAEHPGILLHVVKFISPP  661

Query  663   --------ETAGTsvkldvspsgs----sspeekSRDEDFLAAFKQRNSTN-SSVKYEEK  523
                     +  G +     +        S    K++DE   + F    S N  S+KYEE+
Sbjct  662   GMTLSFGAKLVGVAQDKSKTVVIDDIEGSHDGSKNQDEQLWSEFHSAKSMNEESIKYEER  721

Query  522   VVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTA  343
             +V+S  +   A++  ++ NL++VGRMP    VA +    +  ELGP+G+ ++   FST+A
Sbjct  722   MVESKNDIETALKELSKSNLILVGRMPP---VAPLVSNSDSAELGPIGSYMASSSFSTSA  778

Query  342   SVLVVQQYRT  313
             S+LV+QQY +
Sbjct  779   SILVIQQYNS  788



>ref|XP_008800286.1| PREDICTED: cation/H(+) antiporter 19-like [Phoenix dactylifera]
Length=816

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/780 (65%), Positives = 612/780 (78%), Gaps = 12/780 (2%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
             +N +  CPAPMKATSNGS+QG++PL+ +LPL IVQICLV+++TR LA+LLRPLRQPRVIA
Sbjct  4     TNASHACPAPMKATSNGSWQGENPLEASLPLAIVQICLVIVVTRSLAFLLRPLRQPRVIA  63

Query  2472  EIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTG  2293
             EIIGG+LLGPSA GRSE +L   FPK+SLTVLDTLA++GLL+FLFLVGLELD +++RRTG
Sbjct  64    EIIGGILLGPSALGRSEKFLETFFPKQSLTVLDTLANIGLLYFLFLVGLELDLRAIRRTG  123

Query  2292  KKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAE  2113
             K+AL IA+AGISLPF +GIGTSF LR TIAKGV++ PFLVFMGVALSITAFPVLARILAE
Sbjct  124   KRALIIAIAGISLPFIMGIGTSFALRTTIAKGVAEAPFLVFMGVALSITAFPVLARILAE  183

Query  2112  LKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILV  1933
             LKLLTTD+G+MAMSAAAVNDVAAWILLALAIALSG G S L+SLWVLL G  FV+   L+
Sbjct  184   LKLLTTDLGRMAMSAAAVNDVAAWILLALAIALSGAG-SMLVSLWVLLSGAVFVVAAALL  242

Query  1932  VPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
             +    +WMA R  EGEPV E+Y+CA L +VL  GF+TDTIGIHALFGAFV+G++VPK+GP
Sbjct  243   LRPALEWMARRSPEGEPVKELYICATLVSVLACGFITDTIGIHALFGAFVVGIVVPKEGP  302

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
              A  L+EK+EDL+SGLFLPLYFVSSGLKTNVATI+G QSWGLLVLVI TAC GKI GT++
Sbjct  303   FAGVLIEKLEDLISGLFLPLYFVSSGLKTNVATIKGGQSWGLLVLVITTACLGKIGGTVI  362

Query  1572  VSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTP  1393
              S L ++P +EA+TLGFLMNTKGLVELIVLNIGKDR VLND+TFAI+VLMAL TTFITTP
Sbjct  363   TSLLVKVPVREALTLGFLMNTKGLVELIVLNIGKDRKVLNDETFAILVLMALVTTFITTP  422

Query  1392  IVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGG  1213
             +V+A++KPA+ A T YK+RTIQR DP  + R+L CFH  RN+P++INL+E+SRGT K   
Sbjct  423   VVMAIFKPARRAATPYKHRTIQRNDPDSEFRVLACFHGSRNVPTMINLVESSRGTRKH-R  481

Query  1212  FKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIR  1033
               VYAMHLMELSERSSAI M HKAR NGLPFWN R    D  E  VAF+ ++ LS V+IR
Sbjct  482   LTVYAMHLMELSERSSAISMVHKARLNGLPFWN-RKHNGDHLE--VAFQAYQQLSNVTIR  538

Query  1032  PSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAP  853
             P TAIS + SMHEDII+SAE KR A+++LPFHK Q+ DG  ++  +  + VN+RVL  AP
Sbjct  539   PMTAISDLYSMHEDIISSAEQKRAALVVLPFHKIQQFDGSMDSVGHGYQLVNQRVLRHAP  598

Query  852   CSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFT  673
             CSVG+LVDRGLGG++ V AS V YT+ VLYFGG DDREALAYGARM EHPGI L V +F 
Sbjct  599   CSVGVLVDRGLGGSTQVCASEVSYTVAVLYFGGGDDREALAYGARMAEHPGIELTVMQFV  658

Query  672   LDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQR-NSTNSSVKYEEKVVKSAA-ET  499
               P         + S   ++   E+  DE  +  F+ +    N SVKYEEKVV     E 
Sbjct  659   PQPGQHFVKPSSEGSMGRATDASERLADETCITEFQAKVMGANKSVKYEEKVVGGGKMEI  718

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             + AI+   + NL +VG  P    V  +  + +CPELGP+G+ L+  EFS  ASV+V+ QY
Sbjct  719   VAAIKAMGKFNLFLVGHAPR---VMPLTDRTDCPELGPVGSYLAQPEFS--ASVMVISQY  773



>ref|XP_006478542.1| PREDICTED: cation/H(+) antiporter 19-like [Citrus sinensis]
Length=813

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/798 (64%), Positives = 617/798 (77%), Gaps = 13/798 (2%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CPAPMKATSNGSFQG++PLDYALPL+I+QICLVV  TR LA+LL+PLRQPRVIAEIIGGV
Sbjct  12    CPAPMKATSNGSFQGENPLDYALPLIILQICLVVAFTRFLAFLLKPLRQPRVIAEIIGGV  71

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GRSE +LN +FPKKS+TVL+TLA++GLLFFLFLVGLELD KS+ RTGKK+L I
Sbjct  72    LLGPSALGRSERFLNTVFPKKSMTVLETLANIGLLFFLFLVGLELDIKSILRTGKKSLGI  131

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             ALAGI+LPF LGIGTSF+LR+T+ KG +Q P LVFMGV+LSITAFPVLARILAELKLLTT
Sbjct  132   ALAGITLPFALGIGTSFVLRSTVLKGANQAPLLVFMGVSLSITAFPVLARILAELKLLTT  191

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             D+G++AMSAAAVNDVAAW+LLALAIALS +  S LI++WVLL G  FVL  + V+  +  
Sbjct  192   DLGRIAMSAAAVNDVAAWVLLALAIALSSSSSS-LIAVWVLLSGAAFVLFAVFVIRPVLS  250

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
              MA R  EGEPV E+YVC  L+ VL A FVTDTIGIHALFGAFV+G+++PK+GP A  L+
Sbjct  251   LMARRSPEGEPVKELYVCITLSMVLAASFVTDTIGIHALFGAFVVGIIMPKEGPFAGVLI  310

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EK+ED+VSGLFLPLYF +SGLKTNVATI+GA SWGLL+LVI  ACFGKI+GT++V+  C+
Sbjct  311   EKIEDMVSGLFLPLYFAASGLKTNVATIRGATSWGLLLLVILNACFGKIVGTVVVAWSCK  370

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +P +E++ LGF+MNTKGLVELIVLNIGKDR VLNDQ FAI+VLMALFTTFITTPI++A+Y
Sbjct  371   VPLRESLALGFIMNTKGLVELIVLNIGKDRKVLNDQAFAILVLMALFTTFITTPILMAIY  430

Query  1374  KPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAM  1195
             KPA+  V  YK+RTIQRKD   + RIL CFHS RNIPSLINL+E+SRG  K G   +YAM
Sbjct  431   KPARKGV-PYKHRTIQRKDTETEFRILACFHSTRNIPSLINLVESSRG-RKRGKLCLYAM  488

Query  1194  HLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAIS  1015
             HLMELSERSSAI M  KAR NGLPFW+ + +  D   IV+AFE ++ LS V++RP TAIS
Sbjct  489   HLMELSERSSAIAMVQKARNNGLPFWDKKRD--DRDYIVIAFEAYQQLSSVTVRPMTAIS  546

Query  1014  AMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGIL  835
             A+SS+HEDI ASA  KR A+I+LPFHKHQ++DG  E+  +    VNRR L+ APCSVGI 
Sbjct  547   ALSSIHEDICASAHRKRAALILLPFHKHQRLDGAMESLGHTFHLVNRRALQHAPCSVGIF  606

Query  834   VDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETA  655
             VDRGLGGT+ V AS V Y++ V +FGG DD EALAYG RM EHPGI L V +F     T+
Sbjct  607   VDRGLGGTTQVVASEVSYSVVVPFFGGLDDCEALAYGMRMAEHPGIKLTVVKFVAPKGTS  666

Query  654   ---GTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNS-SVKYEEKVVKSAAETMEAI  487
                G+     +S        ++  D+  ++ FK   S N  S+  EE++V+S+ E    +
Sbjct  667   LTFGSDAPGVISIDLLRGDNDQVGDDAIISDFKSIASKNQESITLEERLVESSQEIAGVL  726

Query  486   RGYNRCNLLVVGRMPEGEIVAAMDKKGE--CPELGPLGNLLSCKEFSTTASVLVVQQYRT  313
             +  N+CNL +VGRM        MD K    C ELGP+G  L+  EFSTTASV+V+QQY  
Sbjct  727   KSMNKCNLFLVGRM--APTAPLMDTKSAEYCSELGPVGCFLASSEFSTTASVVVLQQYNP  784

Query  312   ELSKNGLKEDDSVDGDYE  259
              L+ + L E++  D   E
Sbjct  785   TLNLHPLVEEEESDDANE  802



>ref|XP_006841531.1| hypothetical protein AMTR_s00003p00155190 [Amborella trichopoda]
 gb|ERN03206.1| hypothetical protein AMTR_s00003p00155190 [Amborella trichopoda]
Length=797

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/782 (65%), Positives = 611/782 (78%), Gaps = 15/782 (2%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +   +VCP PMKA SNG+FQ ++PLDYALPL +VQICLV+ +TR LA+LL+PLRQPRV
Sbjct  1     MANATQMVCPPPMKAVSNGAFQDENPLDYALPLAMVQICLVLTVTRSLAFLLKPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEIIGG+LLGPSA GR++AYL+ IFP +S+TVLDT+A++GLLFFLFLVGLELD KS+RR
Sbjct  61    IAEIIGGILLGPSAVGRNKAYLHRIFPPRSMTVLDTIANIGLLFFLFLVGLELDLKSVRR  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TG+KAL IALAGI+LPF LG+GTSF+L++TIAKGV   PFLVFMGVALSITAFPVLARIL
Sbjct  121   TGRKALGIALAGITLPFVLGVGTSFVLKSTIAKGVGTAPFLVFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLT DVG++AMSAAAVNDV AWILLALA+ALSG+G SPL+SLWVLL G  FV+  +
Sbjct  181   AELKLLTKDVGRIAMSAAAVNDVVAWILLALAVALSGSGGSPLVSLWVLLTGIAFVIFVV  240

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
             + V     WMA +C +GEPV E YVCA LA VL  GF TDTIGIHALFG FV+G+ +PK 
Sbjct  241   VAVRPGLAWMARQCDDGEPVSEGYVCAALAVVLAGGFATDTIGIHALFGGFVVGLAMPKK  300

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  + AL+EK+EDLVSGLFLPLYFVSSGLKT+V TIQGAQSWGLLVLVI TACFGK+LGT
Sbjct  301   GAFSGALIEKIEDLVSGLFLPLYFVSSGLKTDVTTIQGAQSWGLLVLVIVTACFGKVLGT  360

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             + VS   R+PF+EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTFIT
Sbjct  361   VGVSLAFRVPFREALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFIT  420

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             TP+V+ +YKPA+ ++   KYRTIQRK+   +LRIL C H+ +++P+LI+LIEASRG  + 
Sbjct  421   TPLVMTIYKPARKSIPN-KYRTIQRKNLDSELRILACLHNVKSVPALIHLIEASRGMRRR  479

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
                 VYAMHLMELSER SAILM +KAR+NGLPFWN +  P +S  IVVAF+ ++ LS VS
Sbjct  480   -PLCVYAMHLMELSERPSAILMVNKARRNGLPFWN-KSRP-NSDHIVVAFDAYQCLSSVS  536

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             +RP TAIS+++++HEDI +SAE KR A+IILPFHKH +IDG FE T    RHVN  VL+ 
Sbjct  537   VRPMTAISSLTTIHEDICSSAEEKRAALIILPFHKHARIDGTFEPTHAGFRHVNEHVLDH  596

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             APCSVGIL+DRGLGG + + AS+   ++ VL+FGG DDREAL Y ARM EHPG+ L V R
Sbjct  597   APCSVGILIDRGLGGAARIPASDFSSSVAVLFFGGRDDREALHYAARMAEHPGVTLTVFR  656

Query  678   FTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAET  499
             F    E          +       EE+  D+ F A F+ R  T  SVKYEEKV  +  ET
Sbjct  657   FLPSGEP------NRRNVKIEMDIEEREADDAFFADFQTRAKTLESVKYEEKVAATKDET  710

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVAAMDKK--GECPELGPLGNLLSCKEFSTTASVLVVQ  325
             + AI+   RCNL++VGR  E       D++   +  ELGP+G+ L+  EFS  ASVLVVQ
Sbjct  711   VAAIKTVARCNLVLVGRGAEAP---GFDERVGSDSAELGPVGSYLATPEFSAGASVLVVQ  767

Query  324   QY  319
             QY
Sbjct  768   QY  769



>ref|XP_003550583.1| PREDICTED: cation/H(+) antiporter 19-like [Glycine max]
Length=813

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/812 (61%), Positives = 613/812 (75%), Gaps = 21/812 (3%)
 Frame = -1

Query  2661  IMGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPR  2482
             +M ++    CPAPMKATSNG+FQ ++PLDYALPLLI+QICLVV  TR +A+L RPLRQPR
Sbjct  1     MMATSNNASCPAPMKATSNGAFQHENPLDYALPLLILQICLVVFFTRFIAFLCRPLRQPR  60

Query  2481  VIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLR  2302
             VIAEIIGG+LLGPSA GR+E +LN +FPKKS+TVLDTL ++GLLFFLFLVGLELD +++R
Sbjct  61    VIAEIIGGILLGPSAIGRNEKFLNTVFPKKSITVLDTLGNIGLLFFLFLVGLELDMRAIR  120

Query  2301  RTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARI  2122
             RTG KAL IAL GI++PF LGIGTSF LRAT++KG     FLVFMGVALSITAFPVLARI
Sbjct  121   RTGHKALGIALCGITVPFVLGIGTSFALRATVSKGAEPVSFLVFMGVALSITAFPVLARI  180

Query  2121  LAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLC  1942
             LAELKLLTTDVG++AMSAAAVNDVAAWILLALAIA+SG+  SPL+ LWVLL G  FVL  
Sbjct  181   LAELKLLTTDVGRIAMSAAAVNDVAAWILLALAIAISGSNGSPLVPLWVLLSGVAFVLFA  240

Query  1941  ILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPK  1762
             +  +  +   MA+R  EGEPV E+Y+C  L  VL   FVTDTIGIHALFGAFV+G ++PK
Sbjct  241   VFAIRPLLVAMANRSPEGEPVKEVYICITLTLVLACSFVTDTIGIHALFGAFVLGTIMPK  300

Query  1761  DGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILG  1582
             DG  +  L+EK+EDLVSGLFLPL+FVSSGLKTNVA+I G  SW +LVLVIF ACFGKI+G
Sbjct  301   DGSFSGVLIEKIEDLVSGLFLPLFFVSSGLKTNVASISGGLSWAMLVLVIFNACFGKIVG  360

Query  1581  TILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFI  1402
             TI+VS +C++P  EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQ FAI VLMALFTTFI
Sbjct  361   TIVVSLICKVPSHEAVALGFLMNTKGLVELIVLNIGKDRKVLNDQAFAICVLMALFTTFI  420

Query  1401  TTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEK  1222
             TTPIV+A+YKPA+     YK++TIQR+DP  +LR+L CFH+ RNIP+LINLIE+SRG  K
Sbjct  421   TTPIVMAVYKPARRG-APYKHKTIQRRDPDTELRMLICFHTSRNIPTLINLIESSRGIRK  479

Query  1221  SGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKV  1042
              G   +YAMHL+ELSERSSAI M HKAR+NG+PFWN + +  D  ++++AF+ +E LS V
Sbjct  480   RGKLCIYAMHLVELSERSSAITMVHKARRNGMPFWNKKQD--DKDQMIIAFQAYEKLSSV  537

Query  1041  SIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLE  862
             ++RP TAISA++S+HEDI  SA  K  AMIILPFHKHQ++DG  E+  +    +N+ VL 
Sbjct  538   NVRPMTAISALNSIHEDICTSAHRKCAAMIILPFHKHQRVDGSMESLGHSFHVMNQLVLS  597

Query  861   GAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVA  682
              APCSVGILVDRG GGTS V AS+V Y + V +FGG DDREAL YG RM EHPGI L V 
Sbjct  598   HAPCSVGILVDRGFGGTSQVPASDVSYKVVVPFFGGRDDREALCYGMRMAEHPGILLNVV  657

Query  681   RFTLDPET-----------AGTsvkldvspsgssspeekSRDEDFLAAFKQ--RNSTNSS  541
             +F   P T           +    K      G +  ++K +D+   + F     N+   S
Sbjct  658   KFMPPPGTSLAFGAKLVGVSSNKDKKAFEVVGGNYYDDKQQDDQLWSEFLSACNNNNQES  717

Query  540   VKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCK  361
             +K+E+K+V S  +   A++  NR NL++VGRMP    VA +  + +CPELGP+G+ ++  
Sbjct  718   MKHEQKLVASKGDIEAALKEMNRSNLILVGRMPS---VAPLISRSDCPELGPVGSYMASS  774

Query  360   EFSTTASVLVVQQYR--TELSKNGLKEDDSVD  271
             +FS   SV+V+QQY   T++    ++E D  D
Sbjct  775   DFSNVTSVMVIQQYNPSTDIHPLVMEESDYPD  806



>ref|XP_010909726.1| PREDICTED: cation/H(+) antiporter 19 [Elaeis guineensis]
Length=807

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/791 (65%), Positives = 609/791 (77%), Gaps = 12/791 (2%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
             +N    CPAPMKATSNGS+QG++PL+ +LPL IVQICLV+ +TR LA+LLRPLRQPRVIA
Sbjct  4     TNVNHACPAPMKATSNGSWQGENPLEASLPLAIVQICLVIAVTRSLAFLLRPLRQPRVIA  63

Query  2472  EIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTG  2293
             EIIGG+LLGPSA GRSE +L   FPK SLTVLDTLA++GLL+FLFLVGLELD +++RRTG
Sbjct  64    EIIGGILLGPSALGRSETFLETFFPKNSLTVLDTLANIGLLYFLFLVGLELDLRAIRRTG  123

Query  2292  KKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAE  2113
             K+AL IA+AGISLPF +GIGTSF LR TI KGV++GPFLVFMGVALSITAFPVLARILAE
Sbjct  124   KRALIIAIAGISLPFIMGIGTSFALRTTINKGVAEGPFLVFMGVALSITAFPVLARILAE  183

Query  2112  LKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILV  1933
             LKLLTTD+G+MAMSAAAVNDVAAWILLALAIALSG G S L+SLWVLL G  FV+   L 
Sbjct  184   LKLLTTDIGRMAMSAAAVNDVAAWILLALAIALSGAG-SMLVSLWVLLSGAAFVVAAALF  242

Query  1932  VPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
             +     WMA R  EGEPV E+Y+CA L +VL  GF+TDTIGIHALFGAFV+G++VPK+GP
Sbjct  243   LRPALAWMARRSPEGEPVKELYICATLVSVLACGFITDTIGIHALFGAFVVGIIVPKEGP  302

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
              A  L+EKVEDL+SGLFLPLYFVSSGLKTNVATI+G QSWGLLVLVI TAC GKI GT++
Sbjct  303   FAGVLIEKVEDLISGLFLPLYFVSSGLKTNVATIKGGQSWGLLVLVITTACLGKIGGTVI  362

Query  1572  VSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTP  1393
              S L  +P +EA+TLGFLMNTKGLVELIVLNIGKDR VLND+TFAI+VLMALFTTFITTP
Sbjct  363   TSLLVNVPVREALTLGFLMNTKGLVELIVLNIGKDRKVLNDETFAILVLMALFTTFITTP  422

Query  1392  IVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGG  1213
             +V+ ++KPA+ A T YK+RTIQR DP  + R+L CFH  RNIP++INL+E+SRGT K   
Sbjct  423   LVMTIFKPARRAATPYKHRTIQRNDPDSEFRVLACFHGSRNIPTMINLVESSRGTRKR-R  481

Query  1212  FKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIR  1033
               VYAMHLMELSERSSAI M HKAR NGLPFWN +    +  ++ VAF+ F+ LS V+IR
Sbjct  482   LTVYAMHLMELSERSSAISMVHKARLNGLPFWNRK---HNGDQLEVAFQAFQQLSNVTIR  538

Query  1032  PSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAP  853
             P TAIS + SMHEDI+ SAE KR A+ +LPFHK ++ DG  ++  +  + VN+RVL  AP
Sbjct  539   PMTAISDLYSMHEDIVTSAEQKRAALAVLPFHKIRQFDGSMDSVGHGYQLVNQRVLRYAP  598

Query  852   CSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFT  673
             CSVGILVDRGLGG++ V AS V YT+ VLYFGG DDREALAYGARM EHPGI L V +F 
Sbjct  599   CSVGILVDRGLGGSAQVCASEVSYTVAVLYFGGRDDREALAYGARMAEHPGIELTVMQFV  658

Query  672   LDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQR-NSTNSSVKYEEKVVKSA-AET  499
               P     +   + S   ++   E+  DE  +  F+ +    N SVKY EKVV    AE 
Sbjct  659   PQPGQHFVNPSSEGSMGRATDASERLADETCITEFQAKVMGANQSVKYLEKVVGGGKAEI  718

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             + AIR   + NL +VG  P    V  +  K +CPELGP+G+ L+  EFS  ASVLV+ QY
Sbjct  719   VAAIRAMGKFNLFLVGHAPR---VMPLTDKTDCPELGPVGSYLAQPEFS--ASVLVISQY  773

Query  318   RTELSKNGLKE  286
                   + L E
Sbjct  774   DPTADASSLAE  784



>ref|XP_009393134.1| PREDICTED: cation/H(+) antiporter 19-like [Musa acuminata subsp. 
malaccensis]
Length=798

 Score =   874 bits (2259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/802 (63%), Positives = 613/802 (76%), Gaps = 38/802 (5%)
 Frame = -1

Query  2643  TVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEII  2464
             T  CP P   TSNGS+ GD+PL +ALPL+I+QICLVV++TR LA++LRPLRQPRVIAEII
Sbjct  4     TSACPTPSTVTSNGSWDGDNPLHHALPLIILQICLVVVVTRALAFVLRPLRQPRVIAEII  63

Query  2463  GGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKA  2284
             GG+LLGPSA GRS  +   +FPK S+TVLDT+A++GL+FFLFLVGLELD +++RRTGK A
Sbjct  64    GGILLGPSALGRSTRFTENVFPKHSMTVLDTVANIGLIFFLFLVGLELDIRAIRRTGKGA  123

Query  2283  LSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKL  2104
             L+IALAGISLPF LG+GTS +LR+TI KG  QGPFLVFMGVALSITAFPVLARILAELKL
Sbjct  124   LAIALAGISLPFVLGVGTSVVLRSTIVKGTRQGPFLVFMGVALSITAFPVLARILAELKL  183

Query  2103  LTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPR  1924
             LTTD+G+MAMSAAAVNDVAAWILLALAIALSG G SP++SLWVLL G  FV  C+ V  R
Sbjct  184   LTTDLGRMAMSAAAVNDVAAWILLALAIALSGNG-SPIVSLWVLLTGIAFVT-CVAVFLR  241

Query  1923  -IFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLA  1747
              +  WMA R  EGEPV E Y+CA L  VL AGF TD IGIHALFGAFV+G+ VPKDGP A
Sbjct  242   PVLAWMARRSPEGEPVKESYICATLTLVLAAGFTTDAIGIHALFGAFVVGIAVPKDGPFA  301

Query  1746  SALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVS  1567
               L+EKVEDLVSGLFLPLYFVSSGLKTNVATI+G +SWGLLVLVI  AC GKI+GTI+ S
Sbjct  302   GVLIEKVEDLVSGLFLPLYFVSSGLKTNVATIKGGRSWGLLVLVITNACLGKIVGTIIAS  361

Query  1566  TLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIV  1387
              + ++P +EA+TLGFLMNTKGLVELIVLNIGKDR VLND+TFAIMVLMALFTTFITTPIV
Sbjct  362   VVVKVPIREAVTLGFLMNTKGLVELIVLNIGKDRKVLNDETFAIMVLMALFTTFITTPIV  421

Query  1386  IALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFK  1207
             + +YKPA+ A   YK+RT++R D   +LR+L CFH  RNIP+++N+IE+SRGT +     
Sbjct  422   MGIYKPARRA-APYKHRTVERSDMDSELRVLACFHGSRNIPTMVNVIESSRGTRRR-RLT  479

Query  1206  VYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPS  1027
             VYAMHLMELSERSSAI M HKAR+NGLPFWN  G   ++ ++VVAFE +  LS V++RP 
Sbjct  480   VYAMHLMELSERSSAISMVHKARRNGLPFWNKGG---NADQMVVAFEAYRQLSAVTVRPM  536

Query  1026  TAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCS  847
             TAIS + ++HEDI+ SA+ KR A+I+LPFHK Q+IDG FE+  +    VN+RVL  APCS
Sbjct  537   TAISDLDTIHEDIVTSAQQKRAALILLPFHKLQQIDGTFESIGHAYHLVNQRVLRHAPCS  596

Query  846   VGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF---  676
             V ILVDRGLGGT+ ++++ V YT+ VL+FGG DDRE LAYG RM EHPG+ L+V RF   
Sbjct  597   VAILVDRGLGGTTKITSNEVSYTVAVLFFGGPDDREVLAYGTRMAEHPGVSLMVLRFLPA  656

Query  675   -TLDPETAGTsvkldvspsgssspeekSRDE----DFLAAFKQRNSTNSSVKYEEKVVKS  511
              T+D +                   E ++DE    +F A     ++ + SVKYEE     
Sbjct  657   ATVDQD-------------------ELAKDEACISNFRANLPSSSAPDGSVKYEETSSSD  697

Query  510   AAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLV  331
              A  + AI+   RCN+ +VGR P      A+ +K +CPELGP+G+ L+  EFSTTASV+V
Sbjct  698   KAGIIAAIKNLGRCNIFIVGRSPPA---VALVEKSDCPELGPVGSYLAASEFSTTASVVV  754

Query  330   VQQYRTELSKNGLKEDDSVDGD  265
             +Q+Y  +   + L E+ +V  D
Sbjct  755   IQRYDPKGDTSTLVEEVAVVHD  776



>ref|XP_008222309.1| PREDICTED: LOW QUALITY PROTEIN: cation/H(+) antiporter 19 [Prunus 
mume]
Length=815

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/808 (63%), Positives = 613/808 (76%), Gaps = 26/808 (3%)
 Frame = -1

Query  2628  APMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLL  2449
             APMKATSNGSFQG++PLD+ALPLLI+QICLVV+ TR LA+LL+PLRQPRVIAE+IGG+LL
Sbjct  9     APMKATSNGSFQGENPLDFALPLLILQICLVVVFTRTLAFLLKPLRQPRVIAEVIGGILL  68

Query  2448  GPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIAL  2269
             GPSA GRSE +L+ +FP KS+TVLDT+A++GLLFFLFL+GLELD +++RRTGKK+L IA+
Sbjct  69    GPSALGRSEKFLHTVFPAKSMTVLDTVANIGLLFFLFLIGLELDIRAIRRTGKKSLGIAV  128

Query  2268  AGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDV  2089
             AGI+LPF LG+ TSF+LRAT++KGVSQGPFLVF+GVALSITAFPVLARILAELKLLTTDV
Sbjct  129   AGITLPFVLGVFTSFVLRATVSKGVSQGPFLVFIGVALSITAFPVLARILAELKLLTTDV  188

Query  2088  GQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWM  1909
             G+ A+ AAA+NDVAAWILLALAIAL+GT  SPL+S+WVLLCG GFV  CI  +  +   M
Sbjct  189   GRTALGAAAINDVAAWILLALAIALTGTNTSPLVSVWVLLCGAGFVGFCIFALRPLLAMM  248

Query  1908  ASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEK  1729
             A R  +GEPV E+Y+C  L+ VL A FVTDTIGIHALFGAFV+G++VPKDGP A  L+EK
Sbjct  249   ARRSPDGEPVKELYICITLSLVLAASFVTDTIGIHALFGAFVVGIVVPKDGPFAGVLIEK  308

Query  1728  VEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIP  1549
             +EDLVSGLFLPLYFVSSGLKTNVATI G  SWGLLVLVIFTA FGKI+GT+ +S +C++ 
Sbjct  309   IEDLVSGLFLPLYFVSSGLKTNVATISGGLSWGLLVLVIFTASFGKIVGTVALSMMCKVH  368

Query  1548  FQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKP  1369
             F+EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAI VLMALFTTFITTP+V+A+YKP
Sbjct  369   FREALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIFVLMALFTTFITTPLVMAIYKP  428

Query  1368  AKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHL  1189
             A+     YK R++ RK+P  +LR+L CFHS RNIP++INLIE+SRGT K G   VYAMHL
Sbjct  429   ARRG-APYKNRSVFRKNPDTELRMLACFHSTRNIPTMINLIESSRGTRKRGRLTVYAMHL  487

Query  1188  MELSERSSAILMCHKARKNGLPFWNTRGEPTDSTE--IVVAFETFEHLSKVSIRPSTAIS  1015
             MELSERSSAI M HKAR NGLPFWN + + T+S +  +V+AFE +E LS V +RP TAIS
Sbjct  488   MELSERSSAISMVHKARYNGLPFWNKKTDDTNSNKDHMVIAFEAYEQLSTVKVRPMTAIS  547

Query  1014  AMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGIL  835
             +++ +H DI A A  K             ++DG  E+  N  R VN RVL  APCSVGIL
Sbjct  548   SLNDIHADICARAHHKXXXXXXX-XXXXXRLDGTMESLGNSFRSVNERVLRHAPCSVGIL  606

Query  834   VDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDP---  664
             VDRGLGGT+ VSAS+V Y + V +FGG DDREALAYG R+ EHPGI + + +F   P   
Sbjct  607   VDRGLGGTAQVSASDVSYNVVVAFFGGRDDREALAYGMRLAEHPGIVMTLVKFVAPPGKT  666

Query  663   -----ETAG-TsvkldvspsgssspeekSRDEDFLAAFKQ-RNSTNS-----SVKYEEKV  520
                  +  G TS K           +EK  DE  LA +   RNS N      S+ YEEKV
Sbjct  667   LIFGAKLVGITSDKNKKILKEEDCGDEKEDDESLLAEYMSVRNSKNKEGGEPSMLYEEKV  726

Query  519   VKSAAETMEAIRGYNR-CNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTA  343
             V+S AE    ++   R  NL VVGRMP       +D   +C ELGP+G+ L+  EFS+TA
Sbjct  727   VESKAEICVVLKSMGRNVNLFVVGRMP--PTAPLVDSTSDCAELGPVGSFLASSEFSSTA  784

Query  342   SVLVVQQYRTELSKNGLKEDDSVDGDYE  259
             SV+V+QQY    S+  + E    + DYE
Sbjct  785   SVVVLQQYNPTASQPLVVE----EADYE  808



>gb|AES89643.2| cation/H+ exchanger 3 [Medicago truncatula]
Length=819

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/785 (64%), Positives = 607/785 (77%), Gaps = 18/785 (2%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CP PMKATSNG+FQ ++P+DYALPLLIVQICLVV  TR++A+L +PLRQPRVIAE+IGG+
Sbjct  8     CPPPMKATSNGAFQHENPMDYALPLLIVQICLVVAFTRLIAFLCKPLRQPRVIAEVIGGI  67

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GR++ +L+  FPK+SLTVLDTLA++GLLFFLFLVGLELD +S+R+TG KAL I
Sbjct  68    LLGPSAIGRNKKFLDTFFPKRSLTVLDTLANIGLLFFLFLVGLELDMRSIRKTGSKALCI  127

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             ALAGI++PF LGIGTS +LRATI K  +   FLVFMGVALSITAFPVLARILAELKLLTT
Sbjct  128   ALAGITVPFVLGIGTSLVLRATINKDANPTSFLVFMGVALSITAFPVLARILAELKLLTT  187

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             DVG+MAMSAAAVNDVAAWILLALA+ALSG   SPL+SLWVLLCG GF+L  I  +  +  
Sbjct  188   DVGRMAMSAAAVNDVAAWILLALAVALSGANTSPLVSLWVLLCGVGFILFVIFAIKPLLA  247

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
              MA RC EGEPV EIY+C  L  VLG  F+TDTIGIHALFGAFV G++VPK+GP AS L 
Sbjct  248   IMAKRCPEGEPVKEIYICITLTLVLGCSFLTDTIGIHALFGAFVAGIVVPKEGPFASILT  307

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EK+EDLV  L LPLYFVSSGLKTNVATI GA SWGLL+LVIFTACFGK++GT++VS LC+
Sbjct  308   EKIEDLVMSLLLPLYFVSSGLKTNVATISGALSWGLLILVIFTACFGKVVGTLVVSLLCK  367

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             IPF+EA+TLGFLMNTKGLVELIVLNIGKDR VL+DQ FAI V+MAL TTFITTPIV+A+Y
Sbjct  368   IPFREALTLGFLMNTKGLVELIVLNIGKDRKVLSDQAFAICVVMALVTTFITTPIVMAVY  427

Query  1374  KPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAM  1195
             KPA+   + Y ++TIQRKDP  +LRIL CFHS  NIP+LINLIE+SRGT K G   +YAM
Sbjct  428   KPARRG-SPYMHKTIQRKDPDTELRILACFHSTYNIPTLINLIESSRGTRKRGKLCIYAM  486

Query  1194  HLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAIS  1015
             HLMELSER SAI M HKAR NGLPFWN + +  +  ++V+AF+ + HLS V++R  TAIS
Sbjct  487   HLMELSERPSAITMVHKARNNGLPFWNKK-QHDNKDQMVIAFQAYGHLSSVNVRSMTAIS  545

Query  1014  AMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGIL  835
             +++++HEDI +SA  KRVAMI+LPFHKHQ++DG  E+  +  R +N  VL  APCSVGIL
Sbjct  546   SLNNIHEDICSSAHQKRVAMILLPFHKHQRVDGTMESLGHSFRVMNGLVLSHAPCSVGIL  605

Query  834   VDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPE--  661
             VDRGLGGT+ V AS+V Y + V +FGG DDREALAYG R+ EHPGI L V +F   P   
Sbjct  606   VDRGLGGTTQVHASDVSYNVVVAFFGGCDDREALAYGMRIAEHPGISLTVLKFITPPGKT  665

Query  660   ----------TAGTsvkldvspsgssspeekSRDEDFLAAFKQR-NSTNSSVKYEEKVVK  514
                       TA    K+     G++  E+K  D+ F + F      +  S+ YEE++V+
Sbjct  666   LAFGAKLIGITADRDRKVIKVSDGNTPDEDKQEDDQFWSEFLGVCCKSEESIVYEERLVE  725

Query  513   SAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVL  334
             S  + +  +   N+ NL++ GRMP    VA +    +C ELGP+G+ L+  EFST ASV+
Sbjct  726   SKEDIVTVLSERNKSNLILAGRMPP---VAPLLDGSDCAELGPVGSYLASSEFSTFASVI  782

Query  333   VVQQY  319
             + QQY
Sbjct  783   IFQQY  787



>emb|CBI26043.3| unnamed protein product [Vitis vinifera]
Length=772

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/796 (63%), Positives = 604/796 (76%), Gaps = 45/796 (6%)
 Frame = -1

Query  2658  MGSNGTV-VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPR  2482
             M +NGT  VCPAPMKATSNGSFQGD+PLD+ALPLLI+QICLVV+ TR LA +L+PLRQPR
Sbjct  1     MATNGTAKVCPAPMKATSNGSFQGDNPLDFALPLLILQICLVVVFTRTLALILKPLRQPR  60

Query  2481  VIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLR  2302
             VIAEIIGG+LLGPSA GRS  +L+ +FP +S+TVLDT+A++GLLFFLFLVGLELD +++R
Sbjct  61    VIAEIIGGILLGPSALGRSTKFLHRVFPARSMTVLDTVANIGLLFFLFLVGLELDIRAIR  120

Query  2301  RTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARI  2122
             RTGK++L IA+ GI+ PF LGIGTS +LR+TI+KGV   PFLVFMGV+LSITAFPVLARI
Sbjct  121   RTGKQSLGIAVVGITFPFVLGIGTSVVLRSTISKGVDHAPFLVFMGVSLSITAFPVLARI  180

Query  2121  LAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLC  1942
             LAELKLLTTDVG+MAMSAAAVNDVAAWILLALAIALSG   SPL+S+WVLLCG  FV   
Sbjct  181   LAELKLLTTDVGRMAMSAAAVNDVAAWILLALAIALSGDNTSPLVSVWVLLCGCAFVAAA  240

Query  1941  ILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPK  1762
             IL +     +MA R   GEPV+E+Y+C  L+ VL AGFVTDTIGIHALFGAFV+G++VPK
Sbjct  241   ILFLRPALAFMARRSLGGEPVNELYICITLSLVLAAGFVTDTIGIHALFGAFVVGIVVPK  300

Query  1761  DGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILG  1582
             DGP    L+EK+EDLVSGLFLPLYFVSSGLKTNVATI G QSWGLLVLVIF ACFGKILG
Sbjct  301   DGPFGEILIEKIEDLVSGLFLPLYFVSSGLKTNVATISGGQSWGLLVLVIFNACFGKILG  360

Query  1581  TILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFI  1402
             T++VS + ++P +EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAI+VLMALFTTFI
Sbjct  361   TVVVSRIFKVPMREAVVLGFLMNTKGLVELIVLNIGKDRKVLNDQTFAILVLMALFTTFI  420

Query  1401  TTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEK  1222
             TTPIV ALYKPA+  +  Y +RT+QR+ P  + RIL CFHS RNIP++INLIE+SRGT +
Sbjct  421   TTPIVTALYKPAR-KIASYTHRTVQRRGPDSEFRILACFHSTRNIPTMINLIESSRGTRR  479

Query  1221  SGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKV  1042
              G   VYAMHLMELSERSSAI M                       +V+AFE ++ LS V
Sbjct  480   -GRLCVYAMHLMELSERSSAISM-----------------------MVIAFEAYQQLSSV  515

Query  1041  SIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLE  862
             S+RP TAIS ++S+HEDI  SA  K+VAMI+LPFHK+Q++DG  E+  +    VN+RV+ 
Sbjct  516   SVRPMTAISPLNSIHEDICTSAHQKQVAMILLPFHKYQRLDGVMESLGHSFHLVNQRVIR  575

Query  861   GAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVA  682
              APCSVGILVDRGLGGTS VSAS+V Y+I + +FGG DDREALAYG RM EHPGI L V 
Sbjct  576   HAPCSVGILVDRGLGGTSQVSASHVSYSIAIPFFGGRDDREALAYGVRMAEHPGIKLTVI  635

Query  681   RFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNST-NSSVKYEEKVVKSAA  505
              F   P  +                     D D L  F + N T N S+ YE++VV+  A
Sbjct  636   NFVAPPGKS-------------LLDWNSGDDNDQL--FSEPNFTENESISYEKRVVEEKA  680

Query  504   ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQ  325
               +  +      NL +VGRM     VA + ++ +CPELGP+G+ L+  EFSTTASVLV+Q
Sbjct  681   GIVAKLTSMTNTNLFLVGRM---SAVAGLTERSDCPELGPVGSFLASSEFSTTASVLVIQ  737

Query  324   QYRTELSKNGLKEDDS  277
             QY    + + L E+++
Sbjct  738   QYNPTANFSALAEEEA  753



>ref|XP_009402488.1| PREDICTED: cation/H(+) antiporter 19-like [Musa acuminata subsp. 
malaccensis]
Length=792

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/786 (63%), Positives = 604/786 (77%), Gaps = 25/786 (3%)
 Frame = -1

Query  2637  VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGG  2458
             VCPAPM ATSNGS+ GD+PL ++LPL+I+QICLV+++TR LA+LLRPLRQPRV+AEIIGG
Sbjct  6     VCPAPMTATSNGSWDGDNPLHHSLPLIILQICLVLVVTRSLAFLLRPLRQPRVVAEIIGG  65

Query  2457  VLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALS  2278
             +LLGPSA GRS+ + + +FPK+ +TVLDTLA++GLLFFLFLVGLELD +S+RRTGK AL+
Sbjct  66    ILLGPSALGRSKRFTDNVFPKQGMTVLDTLANIGLLFFLFLVGLELDLRSIRRTGKGALA  125

Query  2277  IALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLT  2098
             IA+AGI+LPF LGIGTS +LR TI +G  QGPFLVFMGVALSITAFPVLARILAEL+LLT
Sbjct  126   IAIAGITLPFVLGIGTSVVLRHTIVEGARQGPFLVFMGVALSITAFPVLARILAELRLLT  185

Query  2097  TDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIF  1918
             TD+G+MAMSAAAVNDV AWILLALAIALSG+G SPLISLWVLL G GFV    + +  + 
Sbjct  186   TDLGRMAMSAAAVNDVVAWILLALAIALSGSG-SPLISLWVLLTGIGFVACVAIFLRPVL  244

Query  1917  KWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASAL  1738
              WMA R  EGEPV E YVCA LA VL AGFVTD IGIHALFGAF++GV+VPKDGP A+ +
Sbjct  245   AWMARRSLEGEPVKESYVCATLAIVLAAGFVTDAIGIHALFGAFMVGVVVPKDGPFAAVI  304

Query  1737  VEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLC  1558
             +EKVEDLVSGLFLPLYFVSSGLKTNVATI+GA+SWGLLVLVI  AC GKI GT++ S + 
Sbjct  305   IEKVEDLVSGLFLPLYFVSSGLKTNVATIRGARSWGLLVLVITNACLGKIAGTVVASLIV  364

Query  1557  RIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIAL  1378
             +IP +EA TLGFLMNTKGLVELIVLNIGKDR VLND+TFAIMVLMALFTTFITTPIV+ +
Sbjct  365   KIPIREAFTLGFLMNTKGLVELIVLNIGKDRKVLNDETFAIMVLMALFTTFITTPIVMGI  424

Query  1377  YKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYA  1198
             YKPA+ A   YK+RT++R     +LR+L CFH  RNIP++INL+E SRG  +     VYA
Sbjct  425   YKPARRA-APYKHRTVERSHVDSELRVLACFHGVRNIPTIINLVEISRGI-RHRPLAVYA  482

Query  1197  MHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAI  1018
             +HLMELSERSSAI M HKAR+NGLPFWN R    ++  +VVAFE ++ LS V+IRP TAI
Sbjct  483   LHLMELSERSSAISMVHKARRNGLPFWNRR---DNAGHMVVAFEAYQQLSAVNIRPMTAI  539

Query  1017  SAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGI  838
               + ++HEDI+ASA  KR A+I+LPFHK Q++DG  E+  +    +N+RVL  APCSV I
Sbjct  540   YDLDTIHEDIVASALQKRAALILLPFHKMQQLDGTLESVGHPYHLINQRVLRHAPCSVAI  599

Query  837   LVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPET  658
             +VDRGLGGT+ VS+S V YT+ VL+FGG DDREAL+YG  M EHPGI L V RF   P  
Sbjct  600   VVDRGLGGTAQVSSSEVSYTVVVLFFGGPDDREALSYGGLMAEHPGIALTVLRFLPAP--  657

Query  657   AGTsvkldvspsgssspeekSRDEDFLAAFKQRN-STNSSVKYEEKVVKSAAETMEAIRG  481
                            + +  + DE  ++ F+  + S++ S+ YEE      A  + AI+ 
Sbjct  658   -------------VENVDRSAEDEACISKFRSNSQSSDGSLTYEESAAADMAGIIAAIKN  704

Query  480   YNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTELSK  301
               R NL +VGR P      A+ +K +CPELGP+G+ L   EFSTTASVL++Q+Y      
Sbjct  705   LGRRNLFLVGRSPPA---VALVEKSDCPELGPVGSYLVSAEFSTTASVLIIQRYDPSRET  761

Query  300   NGLKED  283
             + L E 
Sbjct  762   SRLVEQ  767



>ref|XP_009402780.1| PREDICTED: cation/H(+) antiporter 19-like [Musa acuminata subsp. 
malaccensis]
Length=768

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/784 (63%), Positives = 601/784 (77%), Gaps = 27/784 (3%)
 Frame = -1

Query  2643  TVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEII  2464
             T VCPAPM ATSNGS+ GD+PL ++LPL+I+QICLV+++TR LA+LLRPLRQPRVIAEII
Sbjct  4     TSVCPAPMTATSNGSWDGDNPLHHSLPLIILQICLVLVVTRSLAFLLRPLRQPRVIAEII  63

Query  2463  GGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKA  2284
             GG+LLGPSA GRS+ +++ +FPK+ +TVLDTLA++GLLFFLFLVGLELD +S+RRTGK A
Sbjct  64    GGILLGPSALGRSKRFMDNVFPKQGMTVLDTLANIGLLFFLFLVGLELDLRSIRRTGKGA  123

Query  2283  LSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKL  2104
             L+IA+AGI+LPF LGIGTS +LR TI +G  QGPFLVFMGVALSITAFPVLARILAELKL
Sbjct  124   LAIAIAGITLPFVLGIGTSVVLRHTIVEGAHQGPFLVFMGVALSITAFPVLARILAELKL  183

Query  2103  LTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPR  1924
             LTTDVG+MAMSAAAVNDV AWILLALAIALSG+G SPLISLWVLL G GFV    + +  
Sbjct  184   LTTDVGRMAMSAAAVNDVVAWILLALAIALSGSG-SPLISLWVLLAGIGFVACVAIFLRP  242

Query  1923  IFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLAS  1744
             +  WMA R  EGEPV E YVCA LA VL AGF TD IGIHALFGAF++GV+VPKDGP A 
Sbjct  243   VLAWMARRSQEGEPVKESYVCATLAIVLAAGFATDAIGIHALFGAFMVGVVVPKDGPFAG  302

Query  1743  ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVST  1564
              ++EKVEDLVSGLFLPLYFVSSGLKTNVATI+GA+SWGLLVLVI  AC GKI GT++ S 
Sbjct  303   VIIEKVEDLVSGLFLPLYFVSSGLKTNVATIRGARSWGLLVLVITNACLGKIAGTVIASL  362

Query  1563  LCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI  1384
             + +IP +EA+TLGFLMNTKGLVELIVLNIGKDR VLND+TFAIMVLMALFTTFITTPIV+
Sbjct  363   IAKIPIREALTLGFLMNTKGLVELIVLNIGKDRKVLNDETFAIMVLMALFTTFITTPIVM  422

Query  1383  ALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKV  1204
              +YKPA+ A   Y +RT++  D   +LR+L CFH  RNIP++INL+E SRG        +
Sbjct  423   GIYKPARRA-APYNHRTVESSDMGSELRVLACFHGVRNIPTMINLVEISRGIHHR-RLTL  480

Query  1203  YAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPST  1024
             YAMHLMELSERSSA+ M HKAR+NGLPFWN R    ++  +VVAFE +  LS V+IRP T
Sbjct  481   YAMHLMELSERSSAMSMVHKARRNGLPFWNRR---DNTDHMVVAFEAYRQLSAVAIRPMT  537

Query  1023  AISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSV  844
             AIS + ++HEDI+ASA  KR A+I+LPFHK Q++DG  E+  +    +N+RVL  APCSV
Sbjct  538   AISDLDTIHEDIVASALQKRTALILLPFHKMQQLDGTLESVGHAYHLINQRVLRHAPCSV  597

Query  843   GILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDP  664
              ILVDRGLGG + VS+S V YT+ VL+FGG DDREAL+YGA M EHPGI L V RF   P
Sbjct  598   AILVDRGLGGAAQVSSSEVSYTVVVLFFGGPDDREALSYGALMAEHPGIALTVLRFLPAP  657

Query  663   ETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNS-TNSSVKYEEKVVKSAAETMEAI  487
                              + ++   DE  +  F   +  ++ S+ YEE      A  + AI
Sbjct  658   ---------------VENLDQSVEDEACIFKFTSNSQPSDGSLAYEESAAADMAGIIAAI  702

Query  486   RGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY--RT  313
             +   R NL +VGR P      A+ +K +CPELGP+G+ L+  EFST +SVL++Q+Y  R 
Sbjct  703   KNLGRHNLFLVGRSPPA---VALVEKSDCPELGPVGSYLASAEFSTASSVLIIQRYDPRG  759

Query  312   ELSK  301
             E S+
Sbjct  760   ETSR  763



>gb|KDO76396.1| hypothetical protein CISIN_1g0036452mg, partial [Citrus sinensis]
Length=694

 Score =   861 bits (2224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/734 (64%), Positives = 564/734 (77%), Gaps = 50/734 (7%)
 Frame = -1

Query  2463  GGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKA  2284
             GG+LLGPSA GRSE +L A+FP KS TVLDTLA+LGL+FF+FLVGLELDPKSLR+TGKKA
Sbjct  1     GGILLGPSALGRSERFLQAVFPPKSQTVLDTLANLGLIFFMFLVGLELDPKSLRQTGKKA  60

Query  2283  LSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKL  2104
             L IA+AGISLPF LGIG+SF+LR TI+KGV    FLVFMGVALSITAFPVLARILAELKL
Sbjct  61    LGIAIAGISLPFALGIGSSFLLRETISKGVDSTSFLVFMGVALSITAFPVLARILAELKL  120

Query  2103  LTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPR  1924
             LT DVG+MAMSAAAVND                     ++ W+LL               
Sbjct  121   LTADVGRMAMSAAAVND---------------------VAAWILLA--------------  145

Query  1923  IFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLAS  1744
                   +    GEPV+E YVCA LAAVL AGF+TD IGIHA+FGAFV+GVLVPK+GP A+
Sbjct  146   ---LAVALSGSGEPVEETYVCATLAAVLAAGFITDAIGIHAMFGAFVVGVLVPKEGPFAN  202

Query  1743  ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVST  1564
             ALVEKVEDLVSG+FLPLYFVSSGLKTN+ATIQG QSWGLL LVI TAC GKI+GT +VS 
Sbjct  203   ALVEKVEDLVSGIFLPLYFVSSGLKTNIATIQGLQSWGLLALVILTACLGKIVGTFVVSL  262

Query  1563  LCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI  1384
               ++P +EA+ LG LMNTKGLVELIVLNIGKDR VLNDQ FAIM+LMA+ TTF+TTP+V+
Sbjct  263   SFKVPLREALALGILMNTKGLVELIVLNIGKDRKVLNDQVFAIMILMAVVTTFMTTPLVM  322

Query  1383  ALYKPAKLA-VTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFK  1207
             A+YKPA+ A V +YK+RT++RK+   Q RIL CFHS RNIPS INL+EA RG +KS G  
Sbjct  323   AVYKPARRARVADYKHRTVERKNSKAQFRILACFHSARNIPSTINLLEALRGIQKSEGLC  382

Query  1206  VYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPS  1027
             VYA+HLMELSERSSAILM HKAR+NGLPFWN RG  ++   IVVAFE F+ LS+VS+RP 
Sbjct  383   VYALHLMELSERSSAILMVHKARRNGLPFWN-RGRQSNPNHIVVAFEAFQQLSRVSVRPM  441

Query  1026  TAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCS  847
             TAIS+MS MHEDI  +AE KR A+IILPFHKHQ++DG  ETTR++ R VN+RVL+ APCS
Sbjct  442   TAISSMSDMHEDICTTAESKRAAIIILPFHKHQRLDGSLETTRSDFRWVNQRVLKHAPCS  501

Query  846   VGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLD  667
             VGIL+DRGLGGT+ VSASNV YTITVL+FGG DDREALA GARM EHPGI  +V RF L 
Sbjct  502   VGILIDRGLGGTTQVSASNVSYTITVLFFGGRDDREALACGARMAEHPGISFIVIRFLLA  561

Query  666   PETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAI  487
              +  G +V +D++ + S        DE+ L+ FK + S N SV+YEE++V++ AET+  I
Sbjct  562   ADAIGNTVSVDMAGNASM-------DEEVLSEFKLKTSRNGSVRYEERLVRNTAETIAVI  614

Query  486   RGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTEL  307
             R  +RCNLL+VGRMP+GE+  A+  + +C ELGP+G+LL+  EFS TASVL++QQY   +
Sbjct  615   REVSRCNLLLVGRMPDGELALALSTRSDCLELGPVGSLLTSLEFS-TASVLIIQQYSDRV  673

Query  306   SKNGLK--EDDSVD  271
               N     E+DS D
Sbjct  674   FMNLASELEEDSPD  687



>emb|CBI34425.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/650 (76%), Positives = 550/650 (85%), Gaps = 19/650 (3%)
 Frame = -1

Query  2643  TVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEII  2464
              V CP P KATSNG FQGD+P+ +ALPLLIVQICLV+++TR LA+LL+PLRQPRVIAEI+
Sbjct  4     NVTCPPPTKATSNGVFQGDNPIHFALPLLIVQICLVLVVTRCLAFLLKPLRQPRVIAEIV  63

Query  2463  GGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKA  2284
             GG+LLGPSA GR++ YL++IFP KSLTVLDTLA+LGLLFFLFLVGLELD  SLRRTGKKA
Sbjct  64    GGILLGPSALGRNKQYLHSIFPPKSLTVLDTLANLGLLFFLFLVGLELDLNSLRRTGKKA  123

Query  2283  LSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKL  2104
             LSIA+AGISLPF LG+GTS +LRATI+KGV  GPFLVFMGVALSITAFPVLARILAELKL
Sbjct  124   LSIAVAGISLPFALGVGTSVVLRATISKGVDAGPFLVFMGVALSITAFPVLARILAELKL  183

Query  2103  LTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPR  1924
             LTTDVG+MAMSAAAVNDVAAWILLALAIALSGTG SP+++LWV LCG GFVL C L+ PR
Sbjct  184   LTTDVGRMAMSAAAVNDVAAWILLALAIALSGTGRSPIVALWVFLCGFGFVLCCSLIAPR  243

Query  1923  IFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLAS  1744
             IFKWMA RC EGEPVDE+YVCA LAAVL AGFVTD IGIHALFGAFV+G+LVPK+GP A 
Sbjct  244   IFKWMAQRCPEGEPVDEMYVCATLAAVLAAGFVTDAIGIHALFGAFVMGILVPKEGPFAG  303

Query  1743  ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVST  1564
             ALVEKVEDLVSGL LPLYFVSSGLKT+VATI+G QSWGLLVLVIFTAC GKI GT+ VS 
Sbjct  304   ALVEKVEDLVSGLLLPLYFVSSGLKTDVATIRGLQSWGLLVLVIFTACLGKIAGTVAVSL  363

Query  1563  LCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI  1384
               R+P  EA+ LGFLMN+KGLVELIVLNIGK+R VLNDQTFAIMVLMALFTTFITTP+VI
Sbjct  364   SWRMPVPEALALGFLMNSKGLVELIVLNIGKERKVLNDQTFAIMVLMALFTTFITTPLVI  423

Query  1383  ALYKPAK-LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFK  1207
             A+YKPAK  +  +Y +RTI RK+P+ +LRIL CF S  +IP++INL+EASRGT K  G  
Sbjct  424   AVYKPAKRTSKADYNHRTIDRKNPNAELRILVCFQSSNSIPTIINLVEASRGTAKREGLC  483

Query  1206  VYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPS  1027
             VYAMHLMELSERSSAILM HKARKNGLPFWN                  + +  VSIRP 
Sbjct  484   VYAMHLMELSERSSAILMVHKARKNGLPFWN------------------KAVRSVSIRPM  525

Query  1026  TAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCS  847
             TAISAMS+MHEDI  SAE KR A+IILPFHKHQ+ DG  ET+R+E   VNR+VLE A CS
Sbjct  526   TAISAMSNMHEDICTSAERKRAAIIILPFHKHQRFDGTLETSRSEFGVVNRKVLEHARCS  585

Query  846   VGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGI  697
             VGILVDR LGGT+ VSASNV   ITV +FGG DDREAL+YGARM EHPGI
Sbjct  586   VGILVDRDLGGTAQVSASNVSSIITVPFFGGCDDREALSYGARMAEHPGI  635



>gb|KDO46881.1| hypothetical protein CISIN_1g003517mg [Citrus sinensis]
Length=813

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/798 (63%), Positives = 617/798 (77%), Gaps = 13/798 (2%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CPAPMKATSNGSFQG++PLDYALPL+I+QICLVV  TR LA+LL+PLRQPRVIAEIIGGV
Sbjct  12    CPAPMKATSNGSFQGENPLDYALPLIILQICLVVAFTRFLAFLLKPLRQPRVIAEIIGGV  71

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GRSE +LN +FPKKS+TVL+TLA++GLLFFLFLVGLELD KS+ RTGKK+L I
Sbjct  72    LLGPSALGRSERFLNTVFPKKSMTVLETLANIGLLFFLFLVGLELDIKSILRTGKKSLGI  131

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             ALAGI+LPF LGIGTSF+LR+T+ KG +Q P LVFMGV+LSITAFPVLARILAELKLLTT
Sbjct  132   ALAGITLPFALGIGTSFVLRSTVLKGANQAPLLVFMGVSLSITAFPVLARILAELKLLTT  191

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             D+G++AMSAAAVNDVAAW+LLALAIALS +  S LI++WVLL G  FV+  + V+  +  
Sbjct  192   DLGRIAMSAAAVNDVAAWVLLALAIALSSSSSS-LIAVWVLLSGAAFVVFAVFVIRPVLS  250

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
              MA R  EGEPV E+YVC  L+ VL A FVTDTIGIHALFGAFV+G+++PK+GP A  L+
Sbjct  251   LMARRSPEGEPVKELYVCITLSMVLAASFVTDTIGIHALFGAFVVGIIMPKEGPFAGVLI  310

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EK+ED+VSGLFLPLYF +SGLKTNVATI+GA SWGLL+LVI  ACFGKI+GT++V+  C+
Sbjct  311   EKIEDMVSGLFLPLYFAASGLKTNVATIRGATSWGLLLLVILNACFGKIVGTVVVAWSCK  370

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +P +E++ LGF+MNTKGLVELIVLNIGKDR VLNDQ FAI+VLMALFTTFITTPI++A+Y
Sbjct  371   VPLRESLALGFIMNTKGLVELIVLNIGKDRKVLNDQAFAILVLMALFTTFITTPILMAIY  430

Query  1374  KPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAM  1195
             KPA+  V  YK+RTIQRKD   + RIL CFHS RNIPSLINL+E+SRG  K G   +YAM
Sbjct  431   KPARKGV-PYKHRTIQRKDTETEFRILACFHSTRNIPSLINLVESSRG-RKRGKLCLYAM  488

Query  1194  HLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAIS  1015
             HLMELSERSSAI M  KAR NGLPFW+ + +  D   IV+AFE ++ LS V++RP TAIS
Sbjct  489   HLMELSERSSAIAMVQKARNNGLPFWDKKRD--DRDYIVIAFEAYQQLSSVTVRPMTAIS  546

Query  1014  AMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGIL  835
             A+SS+HEDI ASA  KR A+I+LPFHKHQ++DG  E+  +    VNRR L+ APCSVGI 
Sbjct  547   ALSSIHEDICASAHRKRAALILLPFHKHQRLDGAMESLGHTFHLVNRRALQHAPCSVGIF  606

Query  834   VDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETA  655
             VDRGLGGT+ V AS V Y++ V +FGG DD EALAYG RM EHPGI L V +F     T+
Sbjct  607   VDRGLGGTTQVVASEVSYSVVVPFFGGLDDCEALAYGMRMAEHPGIKLTVVKFVAPKGTS  666

Query  654   ---GTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNS-SVKYEEKVVKSAAETMEAI  487
                G+     +S        ++  D+  ++ FK   S N  S+  EE++V+S+ E    +
Sbjct  667   LTFGSDAPGVISIDLLRGDNDQVGDDAIISDFKSIASKNQESITLEERLVESSQEIAGVL  726

Query  486   RGYNRCNLLVVGRMPEGEIVAAMDKKGE--CPELGPLGNLLSCKEFSTTASVLVVQQYRT  313
             +  N+CNL +VGRM        MD K    C ELGP+G  L+  EFSTTASV+V+QQY  
Sbjct  727   KSMNKCNLFLVGRM--APTAPLMDTKSAEYCSELGPVGCFLASSEFSTTASVVVLQQYNP  784

Query  312   ELSKNGLKEDDSVDGDYE  259
              L+ + L E++  D   E
Sbjct  785   TLNLHPLVEEEESDDANE  802



>ref|XP_006441942.1| hypothetical protein CICLE_v10018885mg [Citrus clementina]
 gb|ESR55182.1| hypothetical protein CICLE_v10018885mg [Citrus clementina]
Length=813

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/798 (63%), Positives = 616/798 (77%), Gaps = 13/798 (2%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CPAPMKATSNGSFQG++PLDYALPL+I+QICLVV  TR LA+LL+PLRQPRVIAEIIGGV
Sbjct  12    CPAPMKATSNGSFQGENPLDYALPLIILQICLVVAFTRFLAFLLKPLRQPRVIAEIIGGV  71

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GRSE +LN +FPKKS+TVL+TLA++GLLFFLFLVGLELD KS+ RTGKK+L I
Sbjct  72    LLGPSALGRSERFLNTVFPKKSMTVLETLANIGLLFFLFLVGLELDIKSILRTGKKSLGI  131

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             ALAGI+LPF LGIGTSF+LR+T+ KG +Q P LVFMGV+LSITAFPVLARILAELKLLTT
Sbjct  132   ALAGITLPFALGIGTSFVLRSTVLKGANQAPLLVFMGVSLSITAFPVLARILAELKLLTT  191

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             D+G++AMSAAAVNDVAAW+LLALAIALS +  S LI++WVLL G  FV+  + V+  +  
Sbjct  192   DLGRIAMSAAAVNDVAAWVLLALAIALSSSSSS-LIAVWVLLSGAAFVVFAVFVIRPVLS  250

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
              MA R  EGEPV E+YVC  L+ VL A FVTDTIGIHALFGAFV+G+++PK+GP A  L+
Sbjct  251   LMARRSPEGEPVKELYVCITLSMVLAASFVTDTIGIHALFGAFVVGIIMPKEGPFAGVLI  310

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EK+EDLVSGLFLPLYF +SGLKTNVATI+GA SWGLL+LVI  ACFGKI+GT++V+  C+
Sbjct  311   EKIEDLVSGLFLPLYFAASGLKTNVATIRGATSWGLLLLVILNACFGKIVGTVVVAWSCK  370

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +P +E++ LGF+MNTKGLVELIVLNIGKDR VLNDQ FAI+VLMALFTTFITTPI++A+Y
Sbjct  371   VPLRESLALGFIMNTKGLVELIVLNIGKDRKVLNDQAFAILVLMALFTTFITTPILMAIY  430

Query  1374  KPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAM  1195
             KPA+     YK+RTIQRKD   + RIL CFHS RNIPSLINL+E+SRG  K G   +YAM
Sbjct  431   KPARKG-APYKHRTIQRKDTETEFRILACFHSTRNIPSLINLVESSRG-RKRGKLCLYAM  488

Query  1194  HLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAIS  1015
             HLMELSERSSAI M  KAR NGLPFW+ + +  D   IV+AFE ++ LS V++RP TAIS
Sbjct  489   HLMELSERSSAIAMVQKARNNGLPFWDKKRD--DRDYIVIAFEAYQQLSSVTVRPMTAIS  546

Query  1014  AMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGIL  835
             A+SS+HEDI ASA  KR A+I+LPFHKHQ++DG  E+  +    VNRR L+ APCSVGI 
Sbjct  547   ALSSIHEDICASAHRKRAALILLPFHKHQRLDGAMESLGHTFHLVNRRALQHAPCSVGIF  606

Query  834   VDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETA  655
             VDRGLGGT+ V AS V Y++ V +FGG DD EALAYG RM EHPGI L V +F     T+
Sbjct  607   VDRGLGGTTQVVASEVSYSVVVPFFGGPDDCEALAYGMRMAEHPGIKLTVVKFVAPKGTS  666

Query  654   ---GTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNS-SVKYEEKVVKSAAETMEAI  487
                G+     +S        ++  D+  ++ FK   S N  S+  EE++V+S+ E    +
Sbjct  667   LTFGSDAPGLISIDLLRGDNDQVGDDAIISDFKSIASKNQESITLEERLVESSQEIAGVL  726

Query  486   RGYNRCNLLVVGRMPEGEIVAAMDKKGE--CPELGPLGNLLSCKEFSTTASVLVVQQYRT  313
             +  N+CNL +VGRM        MD K    C ELGP+G  L+  EFSTTASV+V+QQY  
Sbjct  727   KSMNKCNLFLVGRM--APTAPLMDTKSAEYCSELGPVGCFLASSEFSTTASVVVLQQYNP  784

Query  312   ELSKNGLKEDDSVDGDYE  259
              L+ + L E++  D   E
Sbjct  785   TLNLHPLVEEEESDDANE  802



>ref|XP_007154518.1| hypothetical protein PHAVU_003G125300g [Phaseolus vulgaris]
 gb|ESW26512.1| hypothetical protein PHAVU_003G125300g [Phaseolus vulgaris]
Length=817

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/811 (60%), Positives = 612/811 (75%), Gaps = 22/811 (3%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +   + CPAPMKATSNG+FQ ++PLDYALPLLI+QICLVV+ TR LA+L RPLRQPRV
Sbjct  7     MATGNNMSCPAPMKATSNGAFQHENPLDYALPLLILQICLVVVFTRFLAFLFRPLRQPRV  66

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEIIGG+LLGPSA GRSE + NA+FP+KS+TVLDT+A++GLLFFLFLVGLELD +++RR
Sbjct  67    IAEIIGGILLGPSAIGRSEKFKNAVFPEKSITVLDTVANIGLLFFLFLVGLELDMRAIRR  126

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TG KAL IAL GI++PF LGIGTS  LRAT++K     PFLVFMGVALSITAFPVLARIL
Sbjct  127   TGHKALGIALCGITVPFVLGIGTSIALRATVSKDAELLPFLVFMGVALSITAFPVLARIL  186

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTDVG++AMSAAAVNDVAAWILLALAIALSG+  SP + +WVLLCG  FV+  +
Sbjct  187   AELKLLTTDVGRIAMSAAAVNDVAAWILLALAIALSGSDASPFVPIWVLLCGAAFVIFVV  246

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
               +  +   MA+   EGEPV E+Y+C  L  VL   F+TD IGIH+LFGAFV+G ++PK+
Sbjct  247   FAIRPLLVAMANSSLEGEPVKEVYICITLTLVLACSFITDIIGIHSLFGAFVVGTVMPKE  306

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  +  L E++EDLVSGLFLPLYFVSSGLKTNVATI+G  SW +L+LVIF ACFGKI+GT
Sbjct  307   GSFSGVLTERIEDLVSGLFLPLYFVSSGLKTNVATIKGGLSWAMLMLVIFNACFGKIIGT  366

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
              +VS L ++P +EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQ FAI V+MALFTTFI+
Sbjct  367   TVVSLLYKVPSREALALGFLMNTKGLVELIVLNIGKDRKVLNDQAFAICVVMALFTTFIS  426

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKS  1219
             TPIV+ +YKPA+     YK++T+QR DP  +LR+L CFHS RNIPSLINLIE SRGT++ 
Sbjct  427   TPIVMVVYKPARKG-APYKHKTVQR-DPDTELRMLACFHSTRNIPSLINLIECSRGTQRK  484

Query  1218  GGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVS  1039
             G   +YAMHLM LSERSSAI M HKA KNG+PFWN + +  D  ++++AF+ +E LS VS
Sbjct  485   GKLCIYAMHLMVLSERSSAITMVHKANKNGMPFWNKKRDGKD--QMIIAFQAYEKLSSVS  542

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             +RP TAISA++++HEDI  +A  KR AMIILPFHKHQ++DG  E+  +    +N+ VL  
Sbjct  543   VRPMTAISALNNIHEDICTTAHRKRAAMIILPFHKHQRVDGSMESLGHSFHVMNQLVLRH  602

Query  858   APCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVAR  679
             APCSVGI VDRGLGGTS V AS+V Y + V +FGG DDREAL YG R+ EHPGI L V +
Sbjct  603   APCSVGIFVDRGLGGTSQVRASDVSYKVVVPFFGGRDDREALCYGMRIAEHPGIFLNVYK  662

Query  678   FTLDP-----------ETAGTsvkldvspsgssspeekSRDEDFLAAFKQ--RNSTNSSV  538
             F   P           E +    +  +     ++ E+K +D+   + F     N+T  S+
Sbjct  663   FVTAPGTSLPFGAKLVEVSSNKDRKTMDVVDGNNYEDKGQDDQLWSEFLSACNNNTQESM  722

Query  537   KYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKE  358
             KYE+KVV S  +   A++  NRCNL++VGRMP    VA +  + +CPELGP+G+ ++  +
Sbjct  723   KYEQKVVASKGDIETALKEMNRCNLILVGRMPS---VAPLGSQSDCPELGPVGSFVASSD  779

Query  357   FSTTASVLVVQQYR--TELSKNGLKEDDSVD  271
             FST  SV+V+QQY   T++    ++E D  D
Sbjct  780   FSTVTSVMVIQQYNPSTDIHPLVMEEPDFPD  810



>gb|KHN17780.1| Cation/H(+) antiporter 19 [Glycine soja]
Length=800

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/799 (61%), Positives = 605/799 (76%), Gaps = 21/799 (3%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             MKATSNG+FQ ++PLDYALPLLI+QICLVV  TR +A+L RPLRQPRVIAEIIGG+LLGP
Sbjct  1     MKATSNGAFQHENPLDYALPLLILQICLVVFFTRFIAFLCRPLRQPRVIAEIIGGILLGP  60

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SA GR+E +LN +FPKKS+TVLDTL ++GLLFFLFLVGLELD +++RRTG KAL IAL G
Sbjct  61    SAIGRNEKFLNTVFPKKSITVLDTLGNIGLLFFLFLVGLELDMRAIRRTGHKALGIALCG  120

Query  2262  ISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQ  2083
             I++PF LGIGTSF LRAT++KG     FLVFMGVALSITAFPVLARILAELKLLTTDVG+
Sbjct  121   ITVPFVLGIGTSFALRATVSKGAEPVSFLVFMGVALSITAFPVLARILAELKLLTTDVGR  180

Query  2082  mamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMAS  1903
             +AMSAAAVNDVAAWILLALAIA+SG+  SPL+ LWVLL G  FVL  +  +  +   MA+
Sbjct  181   IAMSAAAVNDVAAWILLALAIAISGSNGSPLVPLWVLLSGVAFVLFAVFAIRPLLVAMAN  240

Query  1902  RCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVE  1723
             R  EGEPV E+Y+C  L  VL   FVTDTIGIHALFGAFV+G ++PKDG  +  L+EK+E
Sbjct  241   RSPEGEPVKEVYICITLTLVLACSFVTDTIGIHALFGAFVLGTIMPKDGSFSGVLIEKIE  300

Query  1722  DLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQ  1543
             DLVSGLFLPL+FVSSGLKTNVA+I G  SW +LVLVIF ACFGKI+GTI+VS +C++P  
Sbjct  301   DLVSGLFLPLFFVSSGLKTNVASISGGLSWAMLVLVIFNACFGKIVGTIVVSLICKVPSH  360

Query  1542  EAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAK  1363
             EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQ FAI VLMALFTTFITTPIV+A+YKPA+
Sbjct  361   EAVALGFLMNTKGLVELIVLNIGKDRKVLNDQAFAICVLMALFTTFITTPIVMAVYKPAR  420

Query  1362  LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLME  1183
                  YK++TIQR+DP  +LR+L CFH+ RNIP+LINLIE+SRG  K G   +YAMHL+E
Sbjct  421   RG-APYKHKTIQRRDPDTELRMLICFHTSRNIPTLINLIESSRGIRKRGKLCIYAMHLVE  479

Query  1182  LSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMSS  1003
             LSERSSAI M HKAR+NG+PFWN + +  D  ++++AF+ +E LS V++RP TAISA++S
Sbjct  480   LSERSSAITMVHKARRNGMPFWNKKQD--DKDQMIIAFQAYEKLSSVNVRPMTAISALNS  537

Query  1002  MHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDRG  823
             +HEDI  SA  K  AMIILPFHKHQ++DG  E+  +    +N+ VL  APCSVGILVDRG
Sbjct  538   IHEDICTSAHRKCAAMIILPFHKHQRVDGSMESLGHSFHVMNQLVLSHAPCSVGILVDRG  597

Query  822   LGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPET-----  658
              GGTS V AS+V Y + V +FGG DDREAL YG RM EHPGI L V +F   P T     
Sbjct  598   FGGTSQVPASDVSYKVVVPFFGGRDDREALCYGMRMAEHPGILLNVVKFMPPPGTSLAFG  657

Query  657   ------AGTsvkldvspsgssspeekSRDEDFLAAFKQ--RNSTNSSVKYEEKVVKSAAE  502
                   +    K      G +  ++K +D+   + F     N+   S+K+E+K+V S  +
Sbjct  658   AKLVGVSSNKDKKAFEVVGGNYYDDKQQDDQLWSEFLSACNNNNQESMKHEQKLVASKGD  717

Query  501   TMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQ  322
                A++  NR NL++VGRMP    VA +  + +CPELGP+G+ ++  +FS   SV+V+QQ
Sbjct  718   IEAALKEMNRSNLILVGRMPS---VAPLISRSDCPELGPVGSYMASSDFSNVTSVMVIQQ  774

Query  321   YR--TELSKNGLKEDDSVD  271
             Y   T++    ++E D  D
Sbjct  775   YNPSTDIHPLVMEESDYPD  793



>ref|NP_001055076.1| Os05g0276100 [Oryza sativa Japonica Group]
 gb|AAT85133.1| putative sodium/hydrogen exchanger [Oryza sativa Japonica Group]
 dbj|BAF16990.1| Os05g0276100 [Oryza sativa Japonica Group]
 dbj|BAG91247.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63074.1| hypothetical protein OsJ_17882 [Oryza sativa Japonica Group]
Length=790

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/792 (63%), Positives = 609/792 (77%), Gaps = 25/792 (3%)
 Frame = -1

Query  2625  PMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLG  2446
             PMKATS+G FQG+ PL+ ALPL IVQIC+VV+LTRVLA+ LRPLRQPRVIAEIIGG++LG
Sbjct  12    PMKATSDGVFQGEDPLEAALPLAIVQICIVVVLTRVLAFFLRPLRQPRVIAEIIGGIMLG  71

Query  2445  PSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALA  2266
             PSA GR+ A++N +FPK+SLTVLDTLA++GLLFFLFLVGLELD +++RRTG  AL+IA+A
Sbjct  72    PSAIGRNSAFINTVFPKQSLTVLDTLANIGLLFFLFLVGLELDLRAIRRTGAGALAIAVA  131

Query  2265  GISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVG  2086
             GISLPF LGIGTS +L+ T+ +GV  GPFLVFMGVALSITAFPVLARILAELKLLTTD+G
Sbjct  132   GISLPFVLGIGTSVVLQNTVNRGVPTGPFLVFMGVALSITAFPVLARILAELKLLTTDLG  191

Query  2085  QmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMA  1906
             +MAMSAAAVNDVAAWILLALAIALSG+G SP +SLWVLL G GFVL     +  +  WMA
Sbjct  192   RMAMSAAAVNDVAAWILLALAIALSGSG-SPFVSLWVLLSGVGFVLSSFFFIRPLLSWMA  250

Query  1905  SRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKV  1726
              R  EGEPV E+Y+C  L  VL AGF+TDTIGIHALFGAF++G++VPK+GP A  L+EKV
Sbjct  251   RRSPEGEPVKELYICTTLTIVLAAGFITDTIGIHALFGAFIVGIIVPKEGPFAGVLLEKV  310

Query  1725  EDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPF  1546
             EDL+SGLFLPLYFVSSGLKTNV TI+G  SWGLLVLV+ TAC GKI GT+L S + R+P 
Sbjct  311   EDLISGLFLPLYFVSSGLKTNVLTIKGGDSWGLLVLVVATACIGKIGGTVLASLIVRVPL  370

Query  1545  QEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPA  1366
             +EA+TLG LMNTKGLVELIVLNIGKDR VLND+TFAI+VLMAL  TFITTP+V+A+YKPA
Sbjct  371   REAVTLGVLMNTKGLVELIVLNIGKDRHVLNDETFAILVLMALINTFITTPLVMAIYKPA  430

Query  1365  KLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLM  1186
             + A   YK R +QR +P  +LR++ CFHS RNIP++INL+E+SRGT +  G  VYAMHL+
Sbjct  431   RRA-PPYKNRAVQRPNPDDELRMMVCFHSTRNIPTMINLMESSRGTRRR-GITVYAMHLV  488

Query  1185  ELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMS  1006
             ELSERSSAI M HKAR+NG+PFWN R    D  ++VVAFET++ LS VSIR  TAIS + 
Sbjct  489   ELSERSSAINMVHKARRNGMPFWNRR-RNGDGDQLVVAFETYQQLSHVSIRAMTAISDLH  547

Query  1005  SMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDR  826
             ++HED++ SA  KR A+I+LPFHK  ++DGH E+  +E +H+N+RVL  APCSVGILVDR
Sbjct  548   TIHEDVVTSAHQKRAALIVLPFHKLHQMDGHMESLGDEYQHINQRVLHHAPCSVGILVDR  607

Query  825   GLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGTs  646
             GLGG + V+AS+V Y I VL+FGG DDREAL+Y  RMVEHPGI L V RF   PE+ G  
Sbjct  608   GLGGAAQVAASDVSYNIVVLFFGGRDDREALSYATRMVEHPGIALHVIRFV--PESGGGG  665

Query  645   vkldvspsgssspeekSRDEDFLAAFKQRNS-TNSSVKYEEKVVKSAAETMEAIRGYNRC  469
                  +   +             A F+ + +  N S++YEE+  +  A+ +EAI+     
Sbjct  666   ANDKAAADDAFL-----------AEFRGKVAGGNDSIRYEERTSRGKADVVEAIKAMGPT  714

Query  468   NLLVVGRMPEGEIVAA-MDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTELSKNGL  292
             NL +VG   +G   A  M+   ECPELGP+G+ L+  +FST ASVLV++QY        L
Sbjct  715   NLFLVG---QGSPCAPLMEPSAECPELGPVGSYLAMPDFSTVASVLVMKQYDPTAEHYEL  771

Query  291   KE---DDSVDGD  265
              E   D +VD D
Sbjct  772   VEEVADTAVDID  783



>ref|XP_004508061.1| PREDICTED: cation/H(+) antiporter 19-like [Cicer arietinum]
Length=814

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/806 (61%), Positives = 606/806 (75%), Gaps = 24/806 (3%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             C APMKA SNG+FQ ++PLD+ALPLLI+QI +VV  TR +A+L RPL+QPRVIAEIIGG+
Sbjct  8     CLAPMKAVSNGAFQHENPLDFALPLLILQIVVVVTFTRCIAFLCRPLKQPRVIAEIIGGI  67

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GRS+ +L+ +FPK+SLTVLDTLA++GLLFFLFLVGLELD +S+R+TG KAL I
Sbjct  68    LLGPSAIGRSQKFLDTVFPKRSLTVLDTLANIGLLFFLFLVGLELDMRSIRKTGHKALGI  127

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             AL GI++PF LGIGTS  LRATI++G    PFLVFMGVALSITAFPVLARILAELKLLTT
Sbjct  128   ALCGITVPFVLGIGTSVALRATISQGAEPIPFLVFMGVALSITAFPVLARILAELKLLTT  187

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             DVG++AMSAAAVNDVAAWILLALAIALSG   SP ISLWV+L G  F+L  +  +  +  
Sbjct  188   DVGRIAMSAAAVNDVAAWILLALAIALSGNDTSPWISLWVMLSGAAFILFAVFAIRPVLV  247

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
              MA R   GEPV E+Y+C  L  VL   F+TDTIGIHALFGAFV+G+++PKDGP A  L+
Sbjct  248   SMARRSPVGEPVKELYICITLTLVLACSFITDTIGIHALFGAFVVGIIMPKDGPFAGVLI  307

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EK+EDLVSGLFLPLYF SSGLKTNVATI G  SW LLVLVIF ACFGKI+GT+ VS LC+
Sbjct  308   EKIEDLVSGLFLPLYFASSGLKTNVATISGGVSWALLVLVIFNACFGKIVGTVTVSLLCK  367

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             +PF+E++ LGFLMNTKGLVELIVLNIGKDR VLNDQ+FAI VLMALFTTFITTP+V+A+Y
Sbjct  368   VPFRESLALGFLMNTKGLVELIVLNIGKDRKVLNDQSFAICVLMALFTTFITTPLVMAVY  427

Query  1374  KPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAM  1195
             KPA+     YK++TIQR+D   +LR+L CFHS RNIP+LINL+E+SRGT K G   +YAM
Sbjct  428   KPARRG-APYKHKTIQRRDLDSELRVLACFHSTRNIPTLINLVESSRGTRKRGRVCIYAM  486

Query  1194  HLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAIS  1015
             HLMELSERSSAI M HKAR NG+PFWN +    D  ++V+AF+T+  LS V++RP TAIS
Sbjct  487   HLMELSERSSAISMVHKARNNGMPFWNNKQN--DEDQMVIAFQTYGKLSSVNVRPMTAIS  544

Query  1014  AMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGIL  835
             A+S++HEDI  SA  KR A+IILPFHKHQ++DG  E+  +    +N  VL  APCSVGIL
Sbjct  545   ALSNIHEDICTSAHQKRAAIIILPFHKHQRVDGTMESLGHSFHVINELVLSHAPCSVGIL  604

Query  834   VDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETA  655
             VDRG GGTS V AS+V + I V+YFGG DD EALAYG R+ EHPGI L V +F   P   
Sbjct  605   VDRGFGGTSQVQASDVCFKIVVVYFGGRDDNEALAYGMRIAEHPGILLSVVKFMCLPGKT  664

Query  654   GTsvkldvspsgssspeekSRDED----------------FLAAFKQRNSTNSSVKYEEK  523
              +     +  +     +    D D                +   FK +++   S+KYEE+
Sbjct  665   LSFGAKLIGIASDKIKKVVIDDVDGSTHSNDGTKNQDDQMWNEFFKVKSNNEESIKYEER  724

Query  522   VVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTA  343
             +V S  +   A++  NR NL++VGRMP    VA +  K +CPELGP+G+ ++   FSTTA
Sbjct  725   LVNSKGDIETALQELNRSNLILVGRMPP---VAPLVSKSDCPELGPVGSYMASSSFSTTA  781

Query  342   SVLVVQQYR--TELSKNGLKEDDSVD  271
             SVLV+QQY   T++    ++E D V+
Sbjct  782   SVLVIQQYNPSTDIHPLVMEEADCVE  807



>ref|XP_010436413.1| PREDICTED: cation/H(+) antiporter 17-like [Camelina sativa]
Length=787

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/743 (65%), Positives = 573/743 (77%), Gaps = 17/743 (2%)
 Frame = -1

Query  2496  LRQPRVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLD  2317
             LRQPRVIAEI+GG+LLGPSA G+S  +L  +FP +SLTVLDTLA+LGL+FFLFLVGLELD
Sbjct  17    LRQPRVIAEIVGGILLGPSALGKSSKFLTTVFPPRSLTVLDTLANLGLIFFLFLVGLELD  76

Query  2316  PKSLRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFP  2137
             PKSL+RTGK+ALSIALAGI+LPF  GIGTSF LR+TIA GVS+ PFLVFMGVALSITAFP
Sbjct  77    PKSLKRTGKRALSIALAGITLPFIFGIGTSFALRSTIADGVSKAPFLVFMGVALSITAFP  136

Query  2136  VLARILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTG  1957
             VLARILAE+KLLTTDVG++A+SAAAVNDV AWILLALA+A+SG G SPL SLWV L G G
Sbjct  137   VLARILAEIKLLTTDVGKIALSAAAVNDVVAWILLALAVAISGDGGSPLTSLWVFLAGCG  196

Query  1956  FVLLCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIG  1777
             FVL CI VV    K +A RC EGEPV+E+YVC  L  VL A FVTD IGIHALFGAFVIG
Sbjct  197   FVLFCIFVVQPGIKLIAKRCPEGEPVNELYVCCTLGIVLAASFVTDLIGIHALFGAFVIG  256

Query  1776  VLVPKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACF  1597
             V+ PK+G  A+ALVEKVEDLVSGLFLPLYFVSSGLKT+VATIQGAQSWGLLVLVIF ACF
Sbjct  257   VIFPKEGNFANALVEKVEDLVSGLFLPLYFVSSGLKTDVATIQGAQSWGLLVLVIFNACF  316

Query  1596  GKILGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMAL  1417
             GKI+GT+LVS  C++P  E++ LGFLMNTKGLVELIVLNIGKDRGVLNDQ FAIMVLMA+
Sbjct  317   GKIVGTVLVSLYCKVPLDESLALGFLMNTKGLVELIVLNIGKDRGVLNDQIFAIMVLMAI  376

Query  1416  FTTFITTPIVIALYKPAK-LAVTEYKYRTIQR-KDPSKQLRILTCFHSRRNIPSLINLIE  1243
             FTTF+TTP+V+A+YKP K LA  +Y+ RTI+  K  +K LR++ CF S  NIP+++NLIE
Sbjct  377   FTTFMTTPLVLAVYKPGKSLAKGDYQNRTIEETKKSNKPLRLMFCFQSIMNIPTIVNLIE  436

Query  1242  ASRGTEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTR--GEPTDSTEIVVAF  1069
             ASRG+ +     VYAMHLMELSERSSA+LM HK RKNGLPFWN    G  + S  +VVAF
Sbjct  437   ASRGSNRKETLSVYAMHLMELSERSSAVLMAHKVRKNGLPFWNKDKTGNNSSSDMVVVAF  496

Query  1068  ETFEHLSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNEL  889
             E F  LS+VS+RP TAISAM+++HEDI  SAE K  AM+ILPFHKH ++D  +ETTRN+ 
Sbjct  497   EAFRRLSRVSVRPMTAISAMATIHEDICQSAERKSTAMVILPFHKHVRLDRTWETTRNDY  556

Query  888   RHVNRRVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVE  709
             R +N++V+E APCSV ILVDRGLGGT+ V++S+    ITVL+FGG+DDREALA+  RM E
Sbjct  557   RWINKKVMEEAPCSVAILVDRGLGGTTRVASSDFSLVITVLFFGGNDDREALAFAMRMAE  616

Query  708   HPGICLVVARFT----LDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRN-----  556
             HPGI L V RF       PE     +  D +     +          L A  +       
Sbjct  617   HPGISLTVVRFIPSEEFKPENVKLEIIEDQASCSGDTKLIDIEAISDLKAMIEEQESSLS  676

Query  555   --STNSSVKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGP  385
                + S + YEEK+VK   E  E I+  ++ NL +VG+ PEG + + +  ++ + PELGP
Sbjct  677   NSDSESLIVYEEKIVKCYKEVFEVIKECSKSNLFLVGKSPEGSVASGLHVERSDTPELGP  736

Query  384   LGNLLSCKE-FSTTASVLVVQQY  319
             +GNLL+  E  STTASVLVVQQY
Sbjct  737   IGNLLTASENVSTTASVLVVQQY  759



>ref|XP_006841535.1| hypothetical protein AMTR_s00003p00159310 [Amborella trichopoda]
 gb|ERN03210.1| hypothetical protein AMTR_s00003p00159310 [Amborella trichopoda]
Length=794

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/780 (63%), Positives = 602/780 (77%), Gaps = 17/780 (2%)
 Frame = -1

Query  2646  GTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEI  2467
             G   CP+PMKA SNG++QGD+PLD+ALPLL++QICLV+++TR+LA+LLRPLRQPRVIAEI
Sbjct  2     GNATCPSPMKAVSNGAWQGDNPLDFALPLLMLQICLVLIVTRLLAFLLRPLRQPRVIAEI  61

Query  2466  IGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKK  2287
             IGG+LLGPSA G ++ YL  +FP +S+T+LD++A++GLLFFLFL+GLELD  S+RRTG+K
Sbjct  62    IGGILLGPSALGHNKDYLRRVFPPRSMTLLDSVANMGLLFFLFLIGLELDVNSIRRTGRK  121

Query  2286  ALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELK  2107
             AL IALAGI+LPF LG+GTSF+L++T+AKGV    FLVFMGVALSITAFPVLARILAELK
Sbjct  122   ALGIALAGITLPFLLGVGTSFVLKSTVAKGVGTASFLVFMGVALSITAFPVLARILAELK  181

Query  2106  LLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVP  1927
             LLTTD+G++AMSAAAVNDVAAWILLALA+ALSGTG SPL+SLWVLL G  FV+  +L V 
Sbjct  182   LLTTDIGRIAMSAAAVNDVAAWILLALAVALSGTGRSPLVSLWVLLSGVTFVIFAVLAVR  241

Query  1926  RIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLA  1747
              +  WMA R  +  PV E YVC +LA VL AGF TD+IGIH LFG FV+G+++PK+G  A
Sbjct  242   PVLAWMARRSDDNGPVHEGYVCVVLAVVLAAGFATDSIGIHVLFGGFVMGLVMPKEGAFA  301

Query  1746  SALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVS  1567
              +L+EK+EDLVSGLFLPLYFVSSGLKT+VATIQGAQSWG+L LVI TAC GK+LGT+ VS
Sbjct  302   GSLIEKIEDLVSGLFLPLYFVSSGLKTDVATIQGAQSWGMLGLVIVTACVGKVLGTVGVS  361

Query  1566  TLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIV  1387
                ++P +EA  LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIM+LMALFTTFITTP+V
Sbjct  362   LAFKMPCREAWALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMILMALFTTFITTPLV  421

Query  1386  IALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFK  1207
              A+YKPA+ A T YK+RTIQRK+P  +L IL C H+ R+IP+LI+LIEASRGT +     
Sbjct  422   TAVYKPARKA-TPYKHRTIQRKNPDSELCILACLHNARSIPALIHLIEASRGTRRR-SLC  479

Query  1206  VYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPS  1027
             VYAMHLMELSER SAI+M +K R NGLPFWN +  P +S   VVAF+ ++ LS VS+RP 
Sbjct  480   VYAMHLMELSERPSAIVMANKVRHNGLPFWN-KSHP-NSDHFVVAFDAYQSLSSVSVRPM  537

Query  1026  TAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCS  847
             TAIS++++MHEDI +SAE KR A+I+LPFHK  +IDG+FE TR   R VN  VL  A CS
Sbjct  538   TAISSLTTMHEDICSSAEHKRAALILLPFHKQARIDGNFEVTRPGFRQVNLHVLGNARCS  597

Query  846   VGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLD  667
             V I VDRGLGG + + ASN   +I +L+FGG DDREAL+Y  RM EHPG+ L+V RF   
Sbjct  598   VAIFVDRGLGGPARIPASNFASSIAMLFFGGQDDREALSYATRMAEHPGVSLIVLRFQPV  657

Query  666   PETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAI  487
             P+T                      DE FLA F     TN S++YEE  V+S  ET+ AI
Sbjct  658   PQT-----NQPDGVGIDMETGSHEDDEKFLADFHAMAKTNQSIRYEELEVRSREETVAAI  712

Query  486   RGYNRCNLLVVGRMPEG---EIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYR  316
             R   RCNLL+VGR  E    E+ +A     +C ELG +G+ L  +EF+  ASVLVV+QY 
Sbjct  713   RNVARCNLLLVGRRAEAPGFEMSSA-----DCTELGLVGSFLVSQEFTGGASVLVVRQYH  767



>gb|KEH27421.1| cation/H+ exchanger 3 [Medicago truncatula]
Length=669

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/671 (65%), Positives = 527/671 (79%), Gaps = 5/671 (1%)
 Frame = -1

Query  2271  LAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTD  2092
             + GISLPF LGIG+SF+L+ TIAK V+   FLV+MGVALSITAFPVLARILAELKLLTT 
Sbjct  1     MVGISLPFALGIGSSFVLKETIAKDVNTSAFLVYMGVALSITAFPVLARILAELKLLTTS  60

Query  2091  VGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKW  1912
             VG+MAMSAAAVNDVAAWILLALA+ALSG   SPL+SLWV L G GFV+  IL+V  IFKW
Sbjct  61    VGRMAMSAAAVNDVAAWILLALAVALSGNSQSPLVSLWVFLAGCGFVVCSILIVLPIFKW  120

Query  1911  MASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVE  1732
             MA +C EGEPVDE+Y+CA LA+VL AGFVTD IGIHA+FGAFV G+LVPKDGP + ALVE
Sbjct  121   MAQQCHEGEPVDELYICATLASVLAAGFVTDAIGIHAMFGAFVFGILVPKDGPFSGALVE  180

Query  1731  KVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRI  1552
             K+EDLVSGL LPLYFVSSGLKTN+ATIQG QSWGLLV V FTACFGKI+GTI+VS LC++
Sbjct  181   KIEDLVSGLLLPLYFVSSGLKTNIATIQGLQSWGLLVFVTFTACFGKIVGTIVVSLLCKV  240

Query  1551  PFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYK  1372
              F E++ LGFLMN+KGLVELIVLNIGKDR VLND+TFAIMVLMAL TTF+TTP+V+A YK
Sbjct  241   SFNESLVLGFLMNSKGLVELIVLNIGKDRKVLNDETFAIMVLMALVTTFMTTPLVMAAYK  300

Query  1371  PAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMH  1192
               K  +++YKY+T++RK+   +LRIL CFH  RNIPS+INLIEASRG +K     VYAMH
Sbjct  301   -RKAKISDYKYKTVERKNADSELRILACFHGARNIPSVINLIEASRGIKKRDALCVYAMH  359

Query  1191  LMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISA  1012
             L E SERSS+ILM  K RKNGLPFWN +G   DS  ++VAFE ++ LS+V +RP  AIS+
Sbjct  360   LKEFSERSSSILMVQKVRKNGLPFWN-KGHRADSDHVIVAFEAYQKLSQVCVRPMVAISS  418

Query  1011  MSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILV  832
             M+++HEDI A+AE KR A+IILPFH  Q++DG  + TRN+ R VN+RVLE APCSVGI V
Sbjct  419   MANIHEDICATAERKRAAVIILPFHMQQRLDGSLDVTRNDFRFVNKRVLEHAPCSVGIFV  478

Query  831   DRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAG  652
             DRGLGGT HVSASNV Y + VL+FGG DDREALAYGAR  EHPGI LV+ RF ++    G
Sbjct  479   DRGLGGTCHVSASNVSYCVAVLFFGGGDDREALAYGARTAEHPGIRLVIIRFLVESTILG  538

Query  651   TsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGYNR  472
                   V    SS  +  S DE+FLA FK + +++ SV YEEK+VK AAET+ +IR +N 
Sbjct  539   E--ISSVDVGDSSIGKSISEDEEFLAEFKLKTASDDSVIYEEKIVKDAAETVASIRKFNS  596

Query  471   CNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTELSKNGL  292
             CNL +VG  P GE+  A++++ ECPELGP+G LL  ++  TTASVLV+QQY   +  N +
Sbjct  597   CNLFLVGLRPTGELACALERR-ECPELGPVGGLLISQDCPTTASVLVMQQYHNGVPMNFV  655

Query  291   KEDDSVDGDYE  259
              E +     +E
Sbjct  656   PEMEEHSHSHE  666



>ref|XP_010436414.1| PREDICTED: cation/H(+) antiporter 17-like [Camelina sativa]
Length=766

 Score =   838 bits (2165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/732 (65%), Positives = 564/732 (77%), Gaps = 17/732 (2%)
 Frame = -1

Query  2463  GGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKA  2284
             GG+LLGPSA G+S  +L  +FP +SLTVLDTLA+LGL+FFLFLVGLELDPKSL+RTGK+A
Sbjct  7     GGILLGPSALGKSSKFLTTVFPPRSLTVLDTLANLGLIFFLFLVGLELDPKSLKRTGKRA  66

Query  2283  LSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKL  2104
             LSIALAGI+LPF  GIGTSF LR+TIA GVS+ PFLVFMGVALSITAFPVLARILAE+KL
Sbjct  67    LSIALAGITLPFIFGIGTSFALRSTIADGVSKAPFLVFMGVALSITAFPVLARILAEIKL  126

Query  2103  LTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPR  1924
             LTTDVG++A+SAAAVNDVAAWILLALA+ALSG G+SPL SLWV L G GFVL CI VV  
Sbjct  127   LTTDVGKIALSAAAVNDVAAWILLALAVALSGDGNSPLTSLWVFLAGCGFVLFCIFVVQP  186

Query  1923  IFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLAS  1744
               K +A RC EGEPV+E+YVC  L  VL A FVTD IGIHALFGAFVIGV+ PK+G  A+
Sbjct  187   GIKLIAKRCPEGEPVNELYVCCTLGIVLAASFVTDLIGIHALFGAFVIGVIFPKEGNFAN  246

Query  1743  ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVST  1564
             ALVEKVEDLVSGLFLPLYFVSSGLKT+VATIQGAQSWGLLVLVIF ACFGKI+GT+LVS 
Sbjct  247   ALVEKVEDLVSGLFLPLYFVSSGLKTDVATIQGAQSWGLLVLVIFNACFGKIVGTVLVSL  306

Query  1563  LCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI  1384
              C++P  E++ LGFLMNTKGLVELIVLNIGKDRGVLNDQ FAIMVLMA+FTTF+TTP+V+
Sbjct  307   YCKVPLDESLALGFLMNTKGLVELIVLNIGKDRGVLNDQIFAIMVLMAIFTTFMTTPLVL  366

Query  1383  ALYKPAK-LAVTEYKYRTIQR-KDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGF  1210
             A+YKP K LA  +Y+ RTI+  K  +K LR++ CF S  NIP+++NLIEASRG+ +    
Sbjct  367   AVYKPGKSLAKGDYQNRTIEETKKSNKPLRLMFCFQSIMNIPTIVNLIEASRGSNRKETL  426

Query  1209  KVYAMHLMELSERSSAILMCHKARKNGLPFWNTR--GEPTDSTEIVVAFETFEHLSKVSI  1036
              VYAMHLMELSERSSA+LM HK RKNGLPFWN    G  + S  +VVAFE F  LS+VS+
Sbjct  427   SVYAMHLMELSERSSAVLMAHKVRKNGLPFWNKDKTGNNSSSDMVVVAFEAFRRLSRVSV  486

Query  1035  RPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGA  856
             RP TAISAM+++HEDI  SAE K  AM+ILPFHKH ++D  +ETTRN+ R +N++V+E A
Sbjct  487   RPMTAISAMATIHEDICQSAERKSTAMVILPFHKHVRLDRTWETTRNDYRWINKKVMEEA  546

Query  855   PCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF  676
             PCSV ILVDRGLGGT+ V++S+    ITVL+FGG+DDREALA+  RM EHPGI L V RF
Sbjct  547   PCSVAILVDRGLGGTTRVASSDFSLVITVLFFGGNDDREALAFAMRMAEHPGISLTVVRF  606

Query  675   ----TLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRN-------STNSSVKYE  529
                    PE     +  D +     +          L A  +          + S + YE
Sbjct  607   IPSEEFKPENVKLEIIEDQASCSGDTKLIDIEAISDLKAMIEEQESSLSNSDSESLIVYE  666

Query  528   EKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLLSCKE-F  355
             EK+VK   E  E I+  ++ NL +VG+ PEG + + +  ++ + PELGP+GNLL+  E  
Sbjct  667   EKIVKCYKEVFEVIKECSKSNLFLVGKSPEGSVASGLHVERSDTPELGPIGNLLTASENV  726

Query  354   STTASVLVVQQY  319
             STTASVLVVQQY
Sbjct  727   STTASVLVVQQY  738



>ref|XP_004963208.1| PREDICTED: cation/H(+) antiporter 19-like [Setaria italica]
Length=807

 Score =   834 bits (2155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/785 (63%), Positives = 610/785 (78%), Gaps = 28/785 (4%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +N T  CP PMKATS G+FQG++PL+YALPL I+QICLVV++TR LAYLLRPLRQPRV
Sbjct  1     MAANATAKCPGPMKATSQGAFQGENPLEYALPLAILQICLVVVVTRGLAYLLRPLRQPRV  60

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEIIGG+LLGPSA GRSE +L+ +FP +S+TVLDTLA+LGLLFFLFLVGLELD  ++RR
Sbjct  61    IAEIIGGILLGPSALGRSEKFLHTVFPAQSMTVLDTLANLGLLFFLFLVGLELDISAIRR  120

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKAL+IALAGIS+PF LGIGTSF  RATI KG  QGPFLVFMGVALSITAFPVLARIL
Sbjct  121   TGKKALAIALAGISVPFALGIGTSFAFRATIVKGAPQGPFLVFMGVALSITAFPVLARIL  180

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVL-LC  1942
             AELKLLTTD+G+MAMSAAAVNDVAAWILLALAIALSG+G SP++SLWVLL  TGFV+ +C
Sbjct  181   AELKLLTTDLGRMAMSAAAVNDVAAWILLALAIALSGSG-SPIVSLWVLLTATGFVIAIC  239

Query  1941  ILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPK  1762
             + + P +  WMA R  EGEPV E+Y+CA LA VL AGFVTD IGIHALFGAF++G++VPK
Sbjct  240   LFLRP-VLAWMARRSPEGEPVKEVYICATLAIVLAAGFVTDIIGIHALFGAFMVGIVVPK  298

Query  1761  DGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILG  1582
             DGP A  L+EKVEDL+SGLFLPLYFVSSGLKTNVATI+GA+SWGLLVLVI  AC GKI G
Sbjct  299   DGPFAGVLIEKVEDLISGLFLPLYFVSSGLKTNVATIKGAKSWGLLVLVIANACLGKIGG  358

Query  1581  TILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFI  1402
             T++ S   +IP +EAITLGFLMNTKGLVELIVLNIG+DR VLND+ FAI+VLMALFTTFI
Sbjct  359   TVITSLFVKIPVREAITLGFLMNTKGLVELIVLNIGRDRKVLNDEAFAILVLMALFTTFI  418

Query  1401  TTPIVIALYKPAKLAVTEYKYRTIQ--RKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             TTPIV+A+YKPA+  V  YK RT++    D   +LR+L CFH+ R+IP+L+NL+EASRGT
Sbjct  419   TTPIVMAIYKPARKTV-PYKRRTVECTAGDAENELRVLACFHTNRHIPTLLNLVEASRGT  477

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
              +     +YAMHL+ELSERSSAI + H+AR++G+PF+N++ + T+  ++VVAFE F+ LS
Sbjct  478   GRR-RLTMYAMHLVELSERSSAISLVHRARRDGMPFFNSKEQRTE--QMVVAFEAFQQLS  534

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
              V +RP TAIS + ++H D+I SA  KR A++I+P+HK    DG F++  +    +N+RV
Sbjct  535   SVRVRPMTAISDLDTIHRDVIDSAADKRAAIVIMPYHKALHHDGSFQSLGSAYHAINKRV  594

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             L  APCSV ILVDRGLGG + VSA NV +++  L+FGG DDREALAY  RM EHPG+ + 
Sbjct  595   LREAPCSVAILVDRGLGGHAQVSAKNVSFSVVALFFGGPDDREALAYATRMAEHPGVAVT  654

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQR--NSTNSSVKYEEKVVK  514
             +ARF                   S S EE++ DE  + AFK +   + + SV++EE    
Sbjct  655   LARFQ------------PSRRLQSGSGEEEAADEAAVEAFKAKVGAAKDGSVRFEEPEAY  702

Query  513   SAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVL  334
             +  + +E I   +  N+ VVGRMP     A + ++ +  ELGP+G+ L   EF T+ASVL
Sbjct  703   TREQVLETIESLSGFNVFVVGRMPP---TAPLVERPD--ELGPVGSYLVSPEFRTSASVL  757

Query  333   VVQQY  319
             V+++Y
Sbjct  758   VIKRY  762



>ref|NP_001067282.2| Os12g0616500 [Oryza sativa Japonica Group]
 gb|ABA99860.2| cation/hydrogen exchanger, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF30301.2| Os12g0616500 [Oryza sativa Japonica Group]
Length=802

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/774 (63%), Positives = 594/774 (77%), Gaps = 28/774 (4%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CPA MKATS G+FQ ++PLD+ALPL+I+QICLVV++TRVLAYLLRPLRQPRVIAEIIGG+
Sbjct  8     CPAAMKATSQGAFQKENPLDFALPLIILQICLVVVVTRVLAYLLRPLRQPRVIAEIIGGI  67

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GRS  +L+ +FP KS+TVLDTLA+LGLLFFLFLVGLELD  ++RRTGKKAL+I
Sbjct  68    LLGPSALGRSSKFLHNVFPPKSMTVLDTLANLGLLFFLFLVGLELDISAIRRTGKKALAI  127

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             ALAGIS PF LGIGTSF  RATI KG  Q PFLVFMGVALSITAFPVLARILAELKLLTT
Sbjct  128   ALAGISAPFALGIGTSFAFRATIVKGAPQAPFLVFMGVALSITAFPVLARILAELKLLTT  187

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             D+G+MAMSAAAVNDVAAWILLALA+ALSG+G SP+ISLWVLL   GFV    L +     
Sbjct  188   DLGRMAMSAAAVNDVAAWILLALAVALSGSG-SPIISLWVLLTAAGFVAAIFLFLRPALA  246

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             WMA R  EGEPV E+Y+CA LA VL AGFVTDTIGIHALFGAF++G+ VPKDGP A  L+
Sbjct  247   WMARRSPEGEPVKELYICATLAIVLAAGFVTDTIGIHALFGAFLVGIAVPKDGPFAGVLI  306

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDL+SGLFLPLYFVSSGLKTNVATI+GA+SWGLLVLVI  AC GKI GT++ S L +
Sbjct  307   EKVEDLISGLFLPLYFVSSGLKTNVATIRGAKSWGLLVLVIVNACLGKIGGTVITSLLVK  366

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             IP +EA+TLGFLMNTKGLVELIVLNIGKDR VLND+ FAIMVLMALFTTFITTPIV+A+Y
Sbjct  367   IPVREAVTLGFLMNTKGLVELIVLNIGKDRKVLNDEAFAIMVLMALFTTFITTPIVMAIY  426

Query  1374  KPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAM  1195
             KPA+     YK RT+   +   +LR+L CFH+ RNIP+L+NL+E+SRGT + G   +YAM
Sbjct  427   KPAR-PTAPYKRRTVDGGEADGELRVLACFHTNRNIPTLLNLVESSRGTGR-GRLVMYAM  484

Query  1194  HLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAIS  1015
             HL+ELSERSSAI +  +AR+NG+PF+N+  +   + ++VVAFE F+ LS V +RP TAIS
Sbjct  485   HLVELSERSSAITLVQRARRNGMPFFNSGDK---AEQMVVAFEAFQQLSSVRVRPMTAIS  541

Query  1014  AMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGIL  835
              + ++H D+I SA  KR A++++P+HK  + DG F++  +    +N+RVL  APCSV +L
Sbjct  542   DLDTIHRDVIDSATAKRAAIVVMPYHKMLQHDGTFQSLGSAYHAINKRVLREAPCSVAVL  601

Query  834   VDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETA  655
             VDRGLGG + VSA NV +++  L+FGG DDREALAY  RM EHPG+ + + RF   P  A
Sbjct  602   VDRGLGGHAQVSAKNVAFSVAALFFGGPDDREALAYATRMAEHPGVAVTLERFR--PSRA  659

Query  654   GTsvkldvspsgssspeekSRDEDFLAAFKQRNS--TNSSVKYEEKVVKSAAETMEAIRG  481
                 +     +                AFK +     + SV+++E+  +S AE MEAI  
Sbjct  660   QPDEEDAADEAAV-------------EAFKSKVGMVKDGSVRFDERPAQSKAEVMEAINS  706

Query  480   YNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
              +  ++ VVGRMP     A + +K +  ELGP+G+ L+  EF T+ASVLVV++Y
Sbjct  707   LSMFSVFVVGRMPP---TAPLVEKPD--ELGPVGSYLASPEFRTSASVLVVKRY  755



>ref|XP_011007076.1| PREDICTED: cation/H(+) antiporter 19-like [Populus euphratica]
Length=683

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/650 (70%), Positives = 544/650 (84%), Gaps = 4/650 (1%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
             SN T   P PMKATSNG+FQ ++PLDYALPLLI+QICLVV  TR LA+LL+PLRQPRVIA
Sbjct  6     SNVTAALPKPMKATSNGAFQHENPLDYALPLLILQICLVVAFTRTLAFLLKPLRQPRVIA  65

Query  2472  EIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTG  2293
             EIIGG+LLGPSA GRSE +L+ +FP KS+TVLDT+A++GLLFFLFLVGLELD +S+RRTG
Sbjct  66    EIIGGILLGPSALGRSERFLHTVFPPKSMTVLDTVANIGLLFFLFLVGLELDIRSIRRTG  125

Query  2292  KKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAE  2113
             KK+L+IA AGI+LPF LGIGTSF+LR+TI+KG +  PFLVFMGV+LSITAFPVLARILAE
Sbjct  126   KKSLAIAGAGITLPFLLGIGTSFVLRSTISKGSAHAPFLVFMGVSLSITAFPVLARILAE  185

Query  2112  LKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILV  1933
             LKLLTTDVG++AMSAAAVNDV AWILLALAIALSG+  SPLISLWVLLCG GFV+  + V
Sbjct  186   LKLLTTDVGRIAMSAAAVNDVVAWILLALAIALSGSNTSPLISLWVLLCGVGFVVFSVYV  245

Query  1932  VPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
             +  + + MA R  +GEPV EIY+C  L+ VL + FVTD+IGIHALFGAFV+G+LVPKD P
Sbjct  246   IRPLLELMARRSPDGEPVKEIYICITLSLVLASSFVTDSIGIHALFGAFVVGILVPKDSP  305

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
                 L+EK+EDLV+GLFLPLYF SSGLKTNVATI GAQSWGLLVLVI TACFGKI+GT+L
Sbjct  306   FPGVLIEKIEDLVAGLFLPLYFASSGLKTNVATISGAQSWGLLVLVIATACFGKIIGTML  365

Query  1572  VSTLC-RIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITT  1396
             VS +  ++PF+EA  LGFLMNTKGLVELIVLNIGKDR VLNDQTFA++VLMALFTTFITT
Sbjct  366   VSRMIFKVPFREAAALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAVLVLMALFTTFITT  425

Query  1395  PIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSG  1216
             PIV+A+YKPA+     YK RT++RKD   +LR+L CFHS RNIP++INL+E SRGT + G
Sbjct  426   PIVMAVYKPARKG-APYKNRTVKRKDLDTELRLLACFHSSRNIPTMINLVECSRGTRQRG  484

Query  1215  GFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSI  1036
                VYAMHLMELSERSSAI M HKARKNGLPFWN + +  D  ++V+AFE ++ LS V+I
Sbjct  485   RLCVYAMHLMELSERSSAISMVHKARKNGLPFWNKKRD--DRDQMVIAFEAYQQLSSVTI  542

Query  1035  RPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGA  856
             RP TAISA+++++EDI  SA  KR AMI+LPFHKHQ++DG  E+  + L+ VN+RVL  +
Sbjct  543   RPMTAISALNTIYEDICTSAHQKRAAMILLPFHKHQRVDGSLESLGHSLQEVNQRVLRHS  602

Query  855   PCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEH  706
             PCSVGIL+DRG GGT+ VSAS+V   I V +FGG DD EALAYG RM EH
Sbjct  603   PCSVGILIDRGFGGTTQVSASDVSSKIVVPFFGGSDDMEALAYGMRMAEH  652



>gb|KHN33866.1| Cation/H(+) antiporter 19 [Glycine soja]
Length=751

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/729 (63%), Positives = 559/729 (77%), Gaps = 19/729 (3%)
 Frame = -1

Query  2463  GGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKA  2284
             GG+LLGPSA GRSE +LN IFPK+SLTVL+T+A++GLLFFLFLVGLELD +S+R+TG KA
Sbjct  3     GGILLGPSAMGRSEKFLNTIFPKRSLTVLETVANIGLLFFLFLVGLELDLRSIRKTGHKA  62

Query  2283  LSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKL  2104
             L IAL+GI+ PF LGIGTS+ LRATI+K  +   FLVFMGVALSITAFPVLARILAELKL
Sbjct  63    LFIALSGITFPFILGIGTSYALRATISKNANPTSFLVFMGVALSITAFPVLARILAELKL  122

Query  2103  LTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPR  1924
             LTT+VG++AMSAAA+NDVAAWILLALAIALSG+  SPL+SLWV+LC  GFVL  +  +  
Sbjct  123   LTTNVGRIAMSAAAINDVAAWILLALAIALSGSNTSPLVSLWVILCAAGFVLFAMFAISP  182

Query  1923  IFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLAS  1744
             +   MA R  EGEPV EIY+C  +  VL  GF+TDTIGIHALFGAFV+G+++PKDGP A 
Sbjct  183   LLGMMAKRSPEGEPVQEIYICITMTLVLACGFITDTIGIHALFGAFVVGIVMPKDGPFAG  242

Query  1743  ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVST  1564
             AL+EK+EDLV  LFLPLYFVSSGLKT+VA+I GA SWG+LVLVIFTACFGKI+GT LVS 
Sbjct  243   ALIEKIEDLVMSLFLPLYFVSSGLKTDVASISGALSWGMLVLVIFTACFGKIIGTFLVSL  302

Query  1563  LCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI  1384
             LC++PF+EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQ FAI VLMALFTTFITTPIV+
Sbjct  303   LCKVPFREALALGFLMNTKGLVELIVLNIGKDRKVLNDQAFAICVLMALFTTFITTPIVM  362

Query  1383  ALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKV  1204
             A+YKPA+   + Y ++T+QR DP+ +LR+L CFHS RNIP+LINLIE+SRGT+K     V
Sbjct  363   AVYKPARTG-SRYTHKTVQRNDPNTELRVLACFHSTRNIPTLINLIESSRGTKKRAKLCV  421

Query  1203  YAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPST  1024
             YAMHLMELSER SAI M H AR NG+PFWN + +  D  ++V+AF+ + HLS V++RP T
Sbjct  422   YAMHLMELSERPSAITMVHTARNNGMPFWNKKHDNRD--QVVIAFQAYGHLSSVNVRPMT  479

Query  1023  AISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSV  844
             AISA S++HEDI  SA  KR A+I LPFHKHQ+ DG  E+  N LR +N  VL  APCSV
Sbjct  480   AISAFSNIHEDICTSAHQKRAAIIFLPFHKHQRFDGTMESVGNSLRAMNGLVLSHAPCSV  539

Query  843   GILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDP  664
             GILVDRGLGGTS V AS+V Y + V +FGG DDREALAYG RM EHPG+ + V +F + P
Sbjct  540   GILVDRGLGGTSQVQASDVSYKVVVGFFGGRDDREALAYGMRMAEHPGVSITVVKFVVPP  599

Query  663   E------------TAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNS-SVKYEEK  523
                          TA    K+     G+++  EK  DE F + F      N+ S+ YEE+
Sbjct  600   GMTLAFGAKLIGVTADKDRKVIKVAEGTTTDVEKQEDEHFWSEFLGVCCKNAESIMYEER  659

Query  522   VVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTA  343
             +V+S  + +  +R  N+ NL++VGRMP    V  +    +CPELGP+G+ L+  EFST+A
Sbjct  660   LVESKEDILTTMREMNKSNLILVGRMPP---VVPLVDTSDCPELGPVGSYLASSEFSTSA  716

Query  342   SVLVVQQYR  316
             SV+V QQY 
Sbjct  717   SVIVFQQYN  725



>gb|EEC69681.1| hypothetical protein OsI_39126 [Oryza sativa Indica Group]
Length=802

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/774 (62%), Positives = 593/774 (77%), Gaps = 28/774 (4%)
 Frame = -1

Query  2634  CPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGV  2455
             CPA MKATS G+FQ ++PLD+ALPL+I+QICLVV++TR LAYLLRPLRQPRVIAEIIGG+
Sbjct  8     CPAAMKATSQGAFQKENPLDFALPLIILQICLVVVVTRGLAYLLRPLRQPRVIAEIIGGI  67

Query  2454  LLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSI  2275
             LLGPSA GRS  +L+ +FP KS+TVLDTLA+LGLLFFLFLVGLELD  ++RRTGKKAL+I
Sbjct  68    LLGPSALGRSSKFLHNVFPPKSMTVLDTLANLGLLFFLFLVGLELDISAIRRTGKKALAI  127

Query  2274  ALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTT  2095
             ALAGIS PF LGIGTSF  RATI KG  Q PFLVFMGVALSITAFPVLARILAELKLLTT
Sbjct  128   ALAGISAPFALGIGTSFAFRATIVKGAPQAPFLVFMGVALSITAFPVLARILAELKLLTT  187

Query  2094  DVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFK  1915
             D+G+MAMSAAAVNDVAAWILLALA+ALSG+G SP+ISLWVLL   GFV    L +     
Sbjct  188   DLGRMAMSAAAVNDVAAWILLALAVALSGSG-SPIISLWVLLTAAGFVAAIFLFLRPALA  246

Query  1914  WMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALV  1735
             WMA R  EGEPV E+Y+CA LA VL AGFVTDTIGIHALFGAF++G+ VPKDGP A  L+
Sbjct  247   WMARRSPEGEPVKELYICATLAIVLAAGFVTDTIGIHALFGAFLVGIAVPKDGPFAGVLI  306

Query  1734  EKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCR  1555
             EKVEDL+SGLFLPLYFVSSGLKTNVATI+GA+SWGLLVLVI  AC GKI GT++ S L +
Sbjct  307   EKVEDLISGLFLPLYFVSSGLKTNVATIRGAKSWGLLVLVIVNACLGKIGGTVITSLLVK  366

Query  1554  IPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALY  1375
             IP +EA+TLGFLMNTKGLVELIVLNIGKDR VLND+ FAIMVLMALFTTFITTPIV+A+Y
Sbjct  367   IPVREAVTLGFLMNTKGLVELIVLNIGKDRKVLNDEAFAIMVLMALFTTFITTPIVMAIY  426

Query  1374  KPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAM  1195
             KPA+     YK RT+   +   +LR+L CFH+ RNIP+L+NL+E+SRGT + G   +YAM
Sbjct  427   KPAR-PTAPYKRRTVDGGEADGELRVLACFHTNRNIPTLLNLVESSRGTGR-GRLVMYAM  484

Query  1194  HLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAIS  1015
             HL+ELSERSSAI +  +AR+NG+PF+N+  +   + ++VVAFE F+ LS V +RP TAIS
Sbjct  485   HLVELSERSSAITLVQRARRNGMPFFNSGDK---AEQMVVAFEAFQQLSSVRVRPMTAIS  541

Query  1014  AMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGIL  835
              + ++H D+I SA  KR A++++P+HK  + DG F++  +    +N+RVL  APCSV +L
Sbjct  542   DLDTIHRDVIDSATAKRAAIVVMPYHKMLQHDGTFQSLGSAYHAINKRVLREAPCSVAVL  601

Query  834   VDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETA  655
             VDRGLGG + VSA NV +++  L+FGG DDREALAY  RM EHPG+ + + RF   P  A
Sbjct  602   VDRGLGGHAQVSAKNVAFSVAALFFGGPDDREALAYATRMAEHPGVAVTLERFR--PSRA  659

Query  654   GTsvkldvspsgssspeekSRDEDFLAAFKQRNS--TNSSVKYEEKVVKSAAETMEAIRG  481
                 +     +                AFK +     + SV+++E+  +S AE MEAI  
Sbjct  660   QPDEEDAADEAAV-------------EAFKSKVGMVKDGSVRFDERPAQSKAEVMEAINS  706

Query  480   YNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
              +  ++ VVGRMP     A + +K +  ELGP+G+ L+  EF T+ASVLVV++Y
Sbjct  707   LSMFSVFVVGRMPP---TAPLVEKPD--ELGPVGSYLASPEFRTSASVLVVKRY  755



>ref|XP_006664208.1| PREDICTED: cation/H(+) antiporter 19-like [Oryza brachyantha]
Length=797

 Score =   827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/770 (63%), Positives = 597/770 (78%), Gaps = 27/770 (4%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             M+ATS G+FQG++PLD+ALPL I+QICLVV++TR LAYLLRPLRQPRVIAEIIGG+LLGP
Sbjct  1     MRATSQGAFQGENPLDFALPLAILQICLVVVVTRGLAYLLRPLRQPRVIAEIIGGILLGP  60

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SA GRS  +L  +FP KS+TVLDTLA+LGLLFFLFLVGLELD  ++RRTGKKAL+IALAG
Sbjct  61    SALGRSSKFLQHVFPPKSMTVLDTLANLGLLFFLFLVGLELDISAIRRTGKKALAIALAG  120

Query  2262  ISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQ  2083
             IS PF LGIGTSF  RATI KG  Q PFLVFMGVALSITAFPVLARILAELKLLTTD+G+
Sbjct  121   ISAPFALGIGTSFAFRATIVKGAPQAPFLVFMGVALSITAFPVLARILAELKLLTTDLGR  180

Query  2082  mamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMAS  1903
             MAMSAAAVNDVAAWILLALAIALSG+G SP+ISLWVLL   GFV+   L +  +  WMA 
Sbjct  181   MAMSAAAVNDVAAWILLALAIALSGSG-SPIISLWVLLTAAGFVVAIWLFLRPVLAWMAR  239

Query  1902  RCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVE  1723
             R  +GEPV E+Y+CA LA VL AGFVTDTIGIHALFGAFV+G++VPKDGP A  L+EKVE
Sbjct  240   RSPDGEPVKEVYICATLAIVLAAGFVTDTIGIHALFGAFVVGIVVPKDGPFAGVLIEKVE  299

Query  1722  DLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQ  1543
             DL++GLFLPLYFVSSGLKTNVATI+GA+SWGLLVLVI  AC GKI GT++ S + +IP +
Sbjct  300   DLITGLFLPLYFVSSGLKTNVATIRGAKSWGLLVLVIVNACLGKIGGTVITSLIVKIPVR  359

Query  1542  EAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAK  1363
             EA+TLGFLMNTKGLVELIVLNIGKDR VLND++FAIMVLMALFTTFITTPIV+A+YKPA+
Sbjct  360   EAVTLGFLMNTKGLVELIVLNIGKDRKVLNDESFAIMVLMALFTTFITTPIVMAVYKPAR  419

Query  1362  LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLME  1183
              AV  YK RT+   D   +LR+L CFH+ RNIP+L+NL+E+SRGT + G   +YAMHL+E
Sbjct  420   PAV-PYKRRTVDSGDADGELRVLACFHTNRNIPTLLNLVESSRGTGR-GRLVMYAMHLVE  477

Query  1182  LSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMSS  1003
             LSERSSAI + H+AR+NG PF+N+  + T+  ++VVAF+ F+ LS V +RP TAIS + +
Sbjct  478   LSERSSAISLVHRARRNGRPFFNSGDKQTE--QMVVAFDAFQQLSSVRVRPMTAISDLDT  535

Query  1002  MHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDRG  823
             +H DII SA  KR A++++P+HK    DG F++  +E   +N+RVL  APCSV +LVDRG
Sbjct  536   IHRDIIDSAAAKRAAIVVMPYHKTLHHDGAFQSLGSEYHAINKRVLREAPCSVAVLVDRG  595

Query  822   LGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGTsv  643
             LGG + VSA NV +++ VL+FGG DDREALAY  RM EHPG+ + + RF   P  A +  
Sbjct  596   LGGHAQVSAKNVAFSVAVLFFGGPDDREALAYATRMAEHPGVAVTLERFR--PSRAHSDE  653

Query  642   kldvspsgssspeekSRDEDFLAAFKQRNS--TNSSVKYEEKVVKSAAETMEAIRGYNRC  469
             +                DE  + AFK +     + SV++EE+   +  E ++ I   +  
Sbjct  654   ENAA-------------DEAAVEAFKSKVGIVKDGSVRFEEREATTREELLQTINSMSMF  700

Query  468   NLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             ++ VVGRMP     A + +K +  ELGP+G+ L+  EF T+ASVLV+++Y
Sbjct  701   SVFVVGRMPP---TAPLVEKPD--ELGPVGSYLASPEFKTSASVLVIKRY  745



>gb|KDO76397.1| hypothetical protein CISIN_1g0036452mg, partial [Citrus sinensis]
Length=688

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/734 (63%), Positives = 556/734 (76%), Gaps = 56/734 (8%)
 Frame = -1

Query  2463  GGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKA  2284
             GG+LLGPSA GRSE +L A+FP KS TVLDTLA+LGL+FF+FLVGLELDPKSLR+TGKKA
Sbjct  1     GGILLGPSALGRSERFLQAVFPPKSQTVLDTLANLGLIFFMFLVGLELDPKSLRQTGKKA  60

Query  2283  LSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKL  2104
             L IA+AGISLPF LGIG+SF+LR TI+KGV    FLVFMGVALSITAFPVLARILAELKL
Sbjct  61    LGIAIAGISLPFALGIGSSFLLRETISKGVDSTSFLVFMGVALSITAFPVLARILAELKL  120

Query  2103  LTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPR  1924
             LT DVG+MAMSAAAVNDVAAWILLALA+ALSG+G S L+ +WV L G  FV+   L VP 
Sbjct  121   LTADVGRMAMSAAAVNDVAAWILLALAVALSGSGQSSLVPVWVFLSGCVFVICLTLFVPP  180

Query  1923  IFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLAS  1744
              FKWMA +C EG                                            P A+
Sbjct  181   TFKWMARQCHEG--------------------------------------------PFAN  196

Query  1743  ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVST  1564
             ALVEKVEDLVSG+FLPLYFVSSGLKTN+ATIQG QSWGLL LVI TAC GKI+GT +VS 
Sbjct  197   ALVEKVEDLVSGIFLPLYFVSSGLKTNIATIQGLQSWGLLALVILTACLGKIVGTFVVSL  256

Query  1563  LCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI  1384
               ++P +EA+ LG LMNTKGLVELIVLNIGKDR VLNDQ FAIM+LMA+ TTF+TTP+V+
Sbjct  257   SFKVPLREALALGILMNTKGLVELIVLNIGKDRKVLNDQVFAIMILMAVVTTFMTTPLVM  316

Query  1383  ALYKPAKLA-VTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFK  1207
             A+YKPA+ A V +YK+RT++RK+   Q RIL CFHS RNIPS INL+EA RG +KS G  
Sbjct  317   AVYKPARRARVADYKHRTVERKNSKAQFRILACFHSARNIPSTINLLEALRGIQKSEGLC  376

Query  1206  VYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPS  1027
             VYA+HLMELSERSSAILM HKAR+NGLPFWN RG  ++   IVVAFE F+ LS+VS+RP 
Sbjct  377   VYALHLMELSERSSAILMVHKARRNGLPFWN-RGRQSNPNHIVVAFEAFQQLSRVSVRPM  435

Query  1026  TAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCS  847
             TAIS+MS MHEDI  +AE KR A+IILPFHKHQ++DG  ETTR++ R VN+RVL+ APCS
Sbjct  436   TAISSMSDMHEDICTTAESKRAAIIILPFHKHQRLDGSLETTRSDFRWVNQRVLKHAPCS  495

Query  846   VGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLD  667
             VGIL+DRGLGGT+ VSASNV YTITVL+FGG DDREALA GARM EHPGI  +V RF L 
Sbjct  496   VGILIDRGLGGTTQVSASNVSYTITVLFFGGRDDREALACGARMAEHPGISFIVIRFLLA  555

Query  666   PETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAI  487
              +  G +V +D++ + S        DE+ L+ FK + S N SV+YEE++V++ AET+  I
Sbjct  556   ADAIGNTVSVDMAGNASM-------DEEVLSEFKLKTSRNGSVRYEERLVRNTAETIAVI  608

Query  486   RGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTEL  307
             R  +RCNLL+VGRMP+GE+  A+  + +C ELGP+G+LL+  EFS TASVL++QQY   +
Sbjct  609   REVSRCNLLLVGRMPDGELALALSTRSDCLELGPVGSLLTSLEFS-TASVLIIQQYSDRV  667

Query  306   SKNGLK--EDDSVD  271
               N     E+DS D
Sbjct  668   FMNLASELEEDSPD  681



>ref|XP_002442551.1| hypothetical protein SORBIDRAFT_08g021730 [Sorghum bicolor]
 gb|EES16389.1| hypothetical protein SORBIDRAFT_08g021730 [Sorghum bicolor]
Length=812

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/787 (62%), Positives = 597/787 (76%), Gaps = 33/787 (4%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +NGT  CP PMKATS G+FQG++PLDYALPL IVQICLVV++TR LAYLLRPLRQPRV
Sbjct  1     MAANGT--CPGPMKATSQGAFQGENPLDYALPLAIVQICLVVVVTRGLAYLLRPLRQPRV  58

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEIIGG+LLGPSA GRS  +LNA+FP +S+TVLDTLA++GLLFFLFLVGLELD  ++RR
Sbjct  59    IAEIIGGILLGPSALGRSHKFLNAVFPAQSMTVLDTLANIGLLFFLFLVGLELDISAIRR  118

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGKKAL+IALAGIS PF LGIGTSF  RATI KG  QGPFLVFMGVALSITAFPVLARIL
Sbjct  119   TGKKALAIALAGISAPFALGIGTSFAFRATIVKGTPQGPFLVFMGVALSITAFPVLARIL  178

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AELKLLTTD+G+MAMSAAAVNDVAAWILLALAIALSG G SP+ISLWVLL   GFV+   
Sbjct  179   AELKLLTTDLGRMAMSAAAVNDVAAWILLALAIALSGDG-SPIISLWVLLTAAGFVIAIS  237

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
             L +  +  WMA R  EGEPV E+Y+CA LA VLGAGFVTDTIGIHALFGAF++G++VPKD
Sbjct  238   LFLRPVLAWMARRSPEGEPVKEVYICATLAIVLGAGFVTDTIGIHALFGAFMVGIVVPKD  297

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             GP A  L+EKVEDL+SGLFLPLYFVSSGLKT+VATI+GA+SWGLLVLVI  AC GKI GT
Sbjct  298   GPFAGVLIEKVEDLISGLFLPLYFVSSGLKTDVATIKGAKSWGLLVLVIANACLGKIGGT  357

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             ++ S   +IP +EA+TLGFLMNTKGLVELIVLNIG+DR VLND+ FAI+VLMALFTTFIT
Sbjct  358   VITSLFVKIPVREAVTLGFLMNTKGLVELIVLNIGRDRKVLNDEAFAILVLMALFTTFIT  417

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQ---RKDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             TPIV+A+YKPA+  V  YK RT++     D   +LR+L CFH+ R+IP+L+NL+EASRGT
Sbjct  418   TPIVMAIYKPARRTV-PYKRRTVECVAPGDADSELRVLACFHTSRHIPTLLNLVEASRGT  476

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
              +     +YAMHL+ELSERSSAI +  +AR++G+PF+N + + T+  ++VVAFE F+ LS
Sbjct  477   ARR-RLALYAMHLVELSERSSAISLVQRARRDGMPFFNGKEQRTE--QVVVAFEAFQQLS  533

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
              V +R  TAIS + ++H D+I SA  KR A++++P+HK    DG F +  +    +N+RV
Sbjct  534   SVRVRAMTAISDLDTIHRDVIDSAADKRAAIVVMPYHKALHHDGSFVSLGSAYHAINKRV  593

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             L  APCSV ILVDRGLGG + VSA NV +++  L+FGG DD EALAY  RM EHPG+ + 
Sbjct  594   LREAPCSVAILVDRGLGGHAQVSAKNVSFSVAALFFGGPDDCEALAYATRMAEHPGVAVT  653

Query  687   VARF--TLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNST--NSSVKYEEKV  520
             +ARF  T  P+    +       +                AFK +     + SV++EE  
Sbjct  654   LARFRPTRPPQLVDEAESAADEAAV--------------EAFKAKVGAVKDGSVRFEEPE  699

Query  519   VKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTAS  340
               +  + +E I   +  N+ VVGRMP     A + +K +  ELGP+G+ L   +F T+AS
Sbjct  700   AYTREQVLETIESLSGFNVFVVGRMPPA---APLVEKPD--ELGPVGSYLVSPDFRTSAS  754

Query  339   VLVVQQY  319
             VLV+++Y
Sbjct  755   VLVIKRY  761



>ref|XP_008662071.1| PREDICTED: cation/H(+) antiporter 19-like [Zea mays]
Length=800

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/775 (62%), Positives = 599/775 (77%), Gaps = 22/775 (3%)
 Frame = -1

Query  2637  VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGG  2458
             +CP PMKATS G+FQG++PLDYALPL I+QICLVV++TR LAYLLRPLRQPRVIAEIIGG
Sbjct  6     MCPGPMKATSQGAFQGENPLDYALPLAILQICLVVVVTRGLAYLLRPLRQPRVIAEIIGG  65

Query  2457  VLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALS  2278
             +LLGPSA GRS  +L+A+FP +S+TVLDTLA++GLLFFLFLVGLELD  ++RRTGKKAL+
Sbjct  66    ILLGPSALGRSHRFLHAVFPAQSMTVLDTLANIGLLFFLFLVGLELDISAIRRTGKKALA  125

Query  2277  IALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLT  2098
             IALAGIS PF LGIGTSF  RATI KG  QGPFLVFMGVALSITAFPVLARILAELKLLT
Sbjct  126   IALAGISAPFALGIGTSFAFRATIVKGTPQGPFLVFMGVALSITAFPVLARILAELKLLT  185

Query  2097  TDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIF  1918
             TD+G+MAMSAAAVNDVAAWILLALAIALSG+G SP++SLWVLL   GFV+   L +  + 
Sbjct  186   TDLGRMAMSAAAVNDVAAWILLALAIALSGSG-SPIVSLWVLLTAAGFVVAVSLFLRPVL  244

Query  1917  KWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASAL  1738
              WMA R  EGEPV E+Y+CA LA VL AGFVTDTIGIHALFGAF++G++VPKDGP A  L
Sbjct  245   AWMARRSPEGEPVKEVYICATLAIVLAAGFVTDTIGIHALFGAFMVGIVVPKDGPFAGVL  304

Query  1737  VEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLC  1558
             +EKVEDL+SGL LPLYFVSSGLKT+VATI+GA+SWGLLVLVI  AC GKI GT++ S L 
Sbjct  305   IEKVEDLISGLLLPLYFVSSGLKTDVATIKGAKSWGLLVLVIANACLGKIGGTVITSLLV  364

Query  1557  RIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIAL  1378
             +IP +EA+TLGFLMNTKGLVELIVLNIG+DR VLND+ FAI+VLMALFTTFITTPIV+A+
Sbjct  365   KIPVREAVTLGFLMNTKGLVELIVLNIGRDRKVLNDEAFAILVLMALFTTFITTPIVMAI  424

Query  1377  YKPAKLAVTEYKYRTIQ--RKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKV  1204
             YKPA+ AV  YK RT++    D   +LR+L CFH+ R+IP+L+NL+EASRGT +     +
Sbjct  425   YKPARRAV-PYKRRTVECAAGDADGELRVLACFHTNRHIPTLLNLVEASRGTARR-RLTM  482

Query  1203  YAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPST  1024
             YAMHL+ELSERSSAI +  +AR++G+PF++  G+   + ++VVAFE F+ LS V +R  T
Sbjct  483   YAMHLVELSERSSAISLVQRARRDGMPFFSG-GKEQRAEQVVVAFEAFQQLSSVRVRAMT  541

Query  1023  AISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSV  844
             AIS + ++H D+I SA  KR A++++P+H+    DG F +  +    VN+RVL  APCSV
Sbjct  542   AISDLDTIHRDVIDSAADKRAAIVVMPYHRALGHDGSFASLGSAYHAVNKRVLREAPCSV  601

Query  843   GILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDP  664
              ILVDRGLGG + VSA NV +++ VL+FGG DDREALAY  RM EHPG+ + +AR  L P
Sbjct  602   AILVDRGLGGHAQVSAKNVSFSVAVLFFGGPDDREALAYATRMAEHPGVAVTLAR--LQP  659

Query  663   ETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIR  484
                    + + +   ++    K+R    + A K     + SV++EE    +  + +E I 
Sbjct  660   SRPPLLDEAESAADEAAVEAFKAR----VGAVK-----DGSVRFEEPEACTREQVLETIE  710

Query  483   GYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
               +  N+ VVGRMP    VA + ++ +  ELGP+G+ L   EF T+ASVLV+++Y
Sbjct  711   SLSGFNVFVVGRMPP---VAPLVERPD--ELGPVGSYLVSPEFRTSASVLVIKRY  760



>dbj|BAJ98631.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=771

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/740 (63%), Positives = 567/740 (77%), Gaps = 31/740 (4%)
 Frame = -1

Query  2526  TRVLAYLLRPLRQPRVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllf  2347
             TR LAYLLRPLRQPRVIAEIIGGVLLGPSA GRS  +L+A+FP KSL VLDTLA+LGLLF
Sbjct  8     TRGLAYLLRPLRQPRVIAEIIGGVLLGPSALGRSSKFLHAVFPDKSLPVLDTLANLGLLF  67

Query  2346  flflvgleLDPKSLRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFM  2167
             FLFLVGLELD  ++RRTGKKAL+IALAGISLPF LGIGTSF  RATI KG  Q PFLVFM
Sbjct  68    FLFLVGLELDIAAIRRTGKKALAIALAGISLPFALGIGTSFAFRATIVKGAPQAPFLVFM  127

Query  2166  GVALSITAFPVLARILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLI  1987
             GVALSITAFPVLARILAELKLLTTD+G+MAMSAAAVNDVAAWILLALA+ALSG G SP+I
Sbjct  128   GVALSITAFPVLARILAELKLLTTDIGRMAMSAAAVNDVAAWILLALAVALSGDG-SPII  186

Query  1986  SLWVLLCGTGFVL-LCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIG  1810
             SLWVLL  TGFVL +C+L+ P +  WMA R  EGEPV E+Y+CA LA VL AGFVTD IG
Sbjct  187   SLWVLLTATGFVLAVCLLLRP-LLAWMAHRSPEGEPVKEVYICATLAIVLAAGFVTDVIG  245

Query  1809  IHALFGAFVIGVLVPKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWG  1630
             IHALFGAF++G++VPKDGP A  L+EKVEDL+SGLFLPLYFVSSGLKT+VATI+GA+SWG
Sbjct  246   IHALFGAFMVGIVVPKDGPFAGVLIEKVEDLISGLFLPLYFVSSGLKTDVATIRGAKSWG  305

Query  1629  LLVLVIFTACFGKILGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLND  1450
             LLVLVI  AC GKI GT+L S + +IP +EA+TLGFLMNTKGLVELIVLNIG+DR VLND
Sbjct  306   LLVLVILNACLGKIGGTVLASMVVKIPVREAVTLGFLMNTKGLVELIVLNIGRDRKVLND  365

Query  1449  QTFAIMVLMALFTTFITTPIVIALYKPAKLAVTEYKYRTIQ--RKDPSKQLRILTCFHSR  1276
             ++FAIMVLMALFTTFITTPIV+A+YKPA+ +V  YK RT++    D   +LR+L CFHS 
Sbjct  366   ESFAIMVLMALFTTFITTPIVMAIYKPARPSV-PYKRRTVEGAPADADSELRVLACFHSN  424

Query  1275  RNIPSLINLIEASRGTEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPT  1096
              NIP+L+NL+E+SRGT +     +YAMHL+ELSERSSAI M H+ R+N +PF+N+ G+ T
Sbjct  425   HNIPTLLNLVESSRGTGRQHRLAMYAMHLVELSERSSAISMVHRTRRNAMPFFNS-GDKT  483

Query  1095  DSTEIVVAFETFEHLSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDG  916
             +  ++VVAFETF+ LS V ++P TAIS + ++H D+I SA GKR A++I+P+HK  + DG
Sbjct  484   E--QMVVAFETFQQLSSVRVKPMTAISDLETIHRDVIDSAAGKRAAIVIMPYHKLLQHDG  541

Query  915   HFETTRNELRHVNRRVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREA  736
              F +  ++   VN+RVL GAPCSV ILVDRGLGG S V+A NV++++ +L+FGG DDREA
Sbjct  542   SFHSLGSQYHAVNKRVLRGAPCSVAILVDRGLGGHSQVAAKNVEFSVAMLFFGGADDREA  601

Query  735   LAYGARMVEHPGICLVVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRN  556
             LAY  RM EHPG+ + V RF   P    +    D +   +                K   
Sbjct  602   LAYATRMSEHPGVAVTVTRFR--PSRPPSDDAADEAAIEAFKG-------------KVEG  646

Query  555   STNSSVKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECP-ELGPLG  379
               + S  YE+       E ++AI   ++ N+ VVGRMP  E +       E P ELGP+G
Sbjct  647   LKDGSAMYEDVEASGKEEVVQAINSLSKSNMFVVGRMPPTEPLV------ERPEELGPVG  700

Query  378   NLLSCKEFSTTASVLVVQQY  319
             + L+  EF T+ASVLV+++Y
Sbjct  701   SYLASSEFKTSASVLVIKRY  720



>ref|XP_006664748.1| PREDICTED: cation/H(+) antiporter 19-like, partial [Oryza brachyantha]
Length=781

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/768 (61%), Positives = 582/768 (76%), Gaps = 29/768 (4%)
 Frame = -1

Query  2613  TSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGPSAF  2434
             TS G+FQGDSPLD+ALPL I+QICLVV++TR LAYLLRPLRQPRVIAEIIGG+LLGPS  
Sbjct  5     TSQGAFQGDSPLDFALPLAILQICLVVVVTRGLAYLLRPLRQPRVIAEIIGGMLLGPSVL  64

Query  2433  GRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAGISL  2254
             GRS  ++  +FP KS++VLDTLA++GLLF+LFLVGLELD  ++RR G K L+IALAGIS+
Sbjct  65    GRSSQFMQHVFPPKSMSVLDTLANIGLLFYLFLVGLELDISAIRRAGTKVLAIALAGISV  124

Query  2253  PFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQmam  2074
             PF LGIGTSF  RATI KG  Q PFLVFMGVALSITAFPVL RILAELKLLTTDVG+MAM
Sbjct  125   PFALGIGTSFAFRATIVKGAPQAPFLVFMGVALSITAFPVLDRILAELKLLTTDVGRMAM  184

Query  2073  saaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMASRCS  1894
             SAAAVNDVAAWILLALA+ALSG+G SP+ISLWVLL   GFV+  +L++  +  WMA R  
Sbjct  185   SAAAVNDVAAWILLALAVALSGSG-SPIISLWVLLTAAGFVVAVVLLLRPVLAWMARRSP  243

Query  1893  EGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVEDLV  1714
             EGEP+ E Y+CA LA VL AGFVTDTIGIHALFGAFV+G++VPKDGP A  L+EK+EDLV
Sbjct  244   EGEPIKESYICATLAIVLAAGFVTDTIGIHALFGAFVVGIVVPKDGPFAGVLIEKLEDLV  303

Query  1713  SGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQEAI  1534
             + LFLPLYFVSSGLKTNVATI+GA+SWGLLVLVI  AC GKI GT++ S L +IP +EA+
Sbjct  304   ASLFLPLYFVSSGLKTNVATIRGAKSWGLLVLVIVNACLGKIGGTVITSFLVKIPVREAV  363

Query  1533  TLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAKLAV  1354
             TLGFLMNTKGLVELIVLNIGKDR VLND++FAIMVLMAL TTFITTP+V+A+YKPA+  V
Sbjct  364   TLGFLMNTKGLVELIVLNIGKDRKVLNDESFAIMVLMALVTTFITTPVVMAVYKPAR-PV  422

Query  1353  TEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLMELSE  1174
               YK RT+  +D   +LR+L CFH+ RNIP+L+NL+E+SRGT + G   +YAMHL+ELSE
Sbjct  423   VPYKRRTVDSRDADGELRVLACFHTNRNIPTLLNLVESSRGTGR-GRLVMYAMHLVELSE  481

Query  1173  RSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMSSMHE  994
             RSSAI + H+AR+NG+PF+N+  + T+  ++VV FE F+ LS V +RP TA         
Sbjct  482   RSSAISLVHRARRNGMPFFNSGDKQTE--QMVVVFEAFQQLSSVRVRPMTAPPPPPPPPR  539

Query  993   DIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDRGLGG  814
             D++ SA  KR A++++P+HK  + DG F++  +    +N+RVL  APCSV +LVDRGLGG
Sbjct  540   DVVDSAVSKRAAIVVMPYHKVLQHDGAFQSLGSAYHAINKRVLREAPCSVAVLVDRGLGG  599

Query  813   TSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGTsvkld  634
              + VSA NV +++ +L+FGG DDREALAY ARM EHPG+ + ++ F       G      
Sbjct  600   HAQVSAKNVAFSVAMLFFGGPDDREALAYAARMAEHPGVAVTLSTFRPSRPVPGGDRAT-  658

Query  633   vspsgssspeekSRDEDFLAAFKQR--NSTNSSVKYEEKVVKSAAETMEAIRGYNRCNLL  460
                           DE  +AAFK +   + + SV++EE+   ++ E +E I   +  ++ 
Sbjct  659   --------------DEAAVAAFKSKVGMAKDGSVRFEEQEACTSEEVLETINSLSMFSVF  704

Query  459   VVGRMPE-GEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             VVGRMP    +V   D      ELGP+G+ L+  EF T+ASVLV+++Y
Sbjct  705   VVGRMPPTAPLVENPD------ELGPVGSFLASPEFKTSASVLVIKRY  746



>tpg|DAA47524.1| TPA: hypothetical protein ZEAMMB73_165935 [Zea mays]
Length=813

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/788 (61%), Positives = 599/788 (76%), Gaps = 35/788 (4%)
 Frame = -1

Query  2637  VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIG-  2461
             +CP PMKATS G+FQG++PLDYALPL I+QICLVV++TR LAYLLRPLRQPRVIAEIIG 
Sbjct  6     MCPGPMKATSQGAFQGENPLDYALPLAILQICLVVVVTRGLAYLLRPLRQPRVIAEIIGR  65

Query  2460  ------------GVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLD  2317
                         G+LLGPSA GRS  +L+A+FP +S+TVLDTLA++GLLFFLFLVGLELD
Sbjct  66    EATTRREENEKGGILLGPSALGRSHRFLHAVFPAQSMTVLDTLANIGLLFFLFLVGLELD  125

Query  2316  PKSLRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFP  2137
               ++RRTGKKAL+IALAGIS PF LGIGTSF  RATI KG  QGPFLVFMGVALSITAFP
Sbjct  126   ISAIRRTGKKALAIALAGISAPFALGIGTSFAFRATIVKGTPQGPFLVFMGVALSITAFP  185

Query  2136  VLARILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTG  1957
             VLARILAELKLLTTD+G+MAMSAAAVNDVAAWILLALAIALSG+G SP++SLWVLL   G
Sbjct  186   VLARILAELKLLTTDLGRMAMSAAAVNDVAAWILLALAIALSGSG-SPIVSLWVLLTAAG  244

Query  1956  FVLLCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIG  1777
             FV+   L +  +  WMA R  EGEPV E+Y+CA LA VL AGFVTDTIGIHALFGAF++G
Sbjct  245   FVVAVSLFLRPVLAWMARRSPEGEPVKEVYICATLAIVLAAGFVTDTIGIHALFGAFMVG  304

Query  1776  VLVPKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACF  1597
             ++VPKDGP A  L+EKVEDL+SGL LPLYFVSSGLKT+VATI+GA+SWGLLVLVI  AC 
Sbjct  305   IVVPKDGPFAGVLIEKVEDLISGLLLPLYFVSSGLKTDVATIKGAKSWGLLVLVIANACL  364

Query  1596  GKILGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMAL  1417
             GKI GT++ S L +IP +EA+TLGFLMNTKGLVELIVLNIG+DR VLND+ FAI+VLMAL
Sbjct  365   GKIGGTVITSLLVKIPVREAVTLGFLMNTKGLVELIVLNIGRDRKVLNDEAFAILVLMAL  424

Query  1416  FTTFITTPIVIALYKPAKLAVTEYKYRTIQ--RKDPSKQLRILTCFHSRRNIPSLINLIE  1243
             FTTFITTPIV+A+YKPA+ AV  YK RT++    D   +LR+L CFH+ R+IP+L+NL+E
Sbjct  425   FTTFITTPIVMAIYKPARRAV-PYKRRTVECAAGDADGELRVLACFHTNRHIPTLLNLVE  483

Query  1242  ASRGTEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFET  1063
             ASRGT +     +YAMHL+ELSERSSAI +  +AR++G+PF++  G+   + ++VVAFE 
Sbjct  484   ASRGTARR-RLTMYAMHLVELSERSSAISLVQRARRDGMPFFSG-GKEQRAEQVVVAFEA  541

Query  1062  FEHLSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRH  883
             F+ LS V +R  TAIS + ++H D+I SA  KR A++++P+H+    DG F +  +    
Sbjct  542   FQQLSSVRVRAMTAISDLDTIHRDVIDSAADKRAAIVVMPYHRALGHDGSFASLGSAYHA  601

Query  882   VNRRVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHP  703
             VN+RVL  APCSV ILVDRGLGG + VSA NV +++ VL+FGG DDREALAY  RM EHP
Sbjct  602   VNKRVLREAPCSVAILVDRGLGGHAQVSAKNVSFSVAVLFFGGPDDREALAYATRMAEHP  661

Query  702   GICLVVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEK  523
             G+ + +AR  L P       + + +   ++    K+R    + A K     + SV++EE 
Sbjct  662   GVAVTLAR--LQPSRPPLLDEAESAADEAAVEAFKAR----VGAVK-----DGSVRFEEP  710

Query  522   VVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTA  343
                +  + +E I   +  N+ VVGRMP    VA + ++ +  ELGP+G+ L   EF T+A
Sbjct  711   EACTREQVLETIESLSGFNVFVVGRMPP---VAPLVERPD--ELGPVGSYLVSPEFRTSA  765

Query  342   SVLVVQQY  319
             SVLV+++Y
Sbjct  766   SVLVIKRY  773



>ref|XP_002463597.1| hypothetical protein SORBIDRAFT_01g002640 [Sorghum bicolor]
 gb|EER90595.1| hypothetical protein SORBIDRAFT_01g002640 [Sorghum bicolor]
Length=819

 Score =   799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/811 (60%), Positives = 593/811 (73%), Gaps = 27/811 (3%)
 Frame = -1

Query  2655  GSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVI  2476
             G     +C APMKATS G +QGD+PL ++LPL+I+Q+C+V++LTR LA  LRPLRQPRVI
Sbjct  5     GDEAAALCAAPMKATSEGLWQGDNPLHFSLPLIILQVCVVLVLTRGLALALRPLRQPRVI  64

Query  2475  AEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRT  2296
             AEIIGG+LLGPSA GR++A+LN +FP +SLTVLDTLA++GLL FLFLVGLELDP SLRRT
Sbjct  65    AEIIGGILLGPSALGRNKAFLNHVFPTESLTVLDTLANIGLLLFLFLVGLELDPASLRRT  124

Query  2295  GKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILA  2116
             G +AL+IA+AGISLPF  G+G+S  LRA IA    +GP +VFMGVALSITAFPVLARILA
Sbjct  125   GSRALAIAVAGISLPFAFGVGSSLALRAAIAPDAPRGPLIVFMGVALSITAFPVLARILA  184

Query  2115  ELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCIL  1936
             ELKLLTTD+G+MAMSAAAVNDV AWILLALAIALSG+G SP +S++VLLCG GFV     
Sbjct  185   ELKLLTTDLGRMAMSAAAVNDVTAWILLALAIALSGSG-SPFVSVYVLLCGVGFVAAATF  243

Query  1935  VVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDG  1756
             +V  +  +MA     GEPV E +VCA L  VL AGFVTD IGIHALFGAFVIGVL+PK+G
Sbjct  244   LVRPVLVYMARLSPAGEPVKESFVCATLGIVLAAGFVTDAIGIHALFGAFVIGVLIPKEG  303

Query  1755  PLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTI  1576
               A AL EK+EDLVS LFLPLYFVSSGLKTNV TI GA+SWG LVLVI TAC GKI GT+
Sbjct  304   AYAGALTEKMEDLVSSLFLPLYFVSSGLKTNVGTISGAKSWGFLVLVITTACAGKIGGTV  363

Query  1575  LVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITT  1396
             L S L R+P +EA+ LG LMNTKGLVELIVLNIG+DR VLN++ FAI+VLMAL TTF+TT
Sbjct  364   LASLLMRVPPREALALGLLMNTKGLVELIVLNIGRDRKVLNEEAFAILVLMALTTTFMTT  423

Query  1395  PIVIALYKPAKLAVTEYKYRTIQR----KDPSKQLRILTCFHSRRNIPSLINLIEASRGT  1228
             P V A+YKPA+     YK+RT++R     +   +LR+L CFH+ R IP+LINL+EASRGT
Sbjct  424   PAVTAVYKPARRGAASYKHRTVERGGGGGEADSELRVLACFHASRGIPTLINLVEASRGT  483

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
              +S    +YAMHL+ELSERSSAI M  +AR+NGLPF + R       E+VVAFE F  LS
Sbjct  484   RRS-KLTMYAMHLVELSERSSAISMVQRARRNGLPF-SGRRGRDGGGEVVVAFEAFRRLS  541

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRV  868
              V ++P TAIS +S++HEDI+ASA  KR A+++LPFHK    DG  E       H N RV
Sbjct  542   AVVVKPMTAISDLSTIHEDIVASAVNKRAALVVLPFHKMLCHDGTMEPVDRAYHHANVRV  601

Query  867   LEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLV  688
             L+ APCSV +LVDR LGG + VSA +V Y + VL+FGG DDREALAY ARM EHPGI L 
Sbjct  602   LQSAPCSVAVLVDRVLGGAAQVSAPDVSYAVLVLFFGGPDDREALAYAARMGEHPGIELT  661

Query  687   VARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQR--NSTNSSVKYEEKVVK  514
             VARF        T+     +  G +   E ++DE+ L  +      S + SV+YEE  V 
Sbjct  662   VARFI-------TAAAAKPNADGGNLELELAKDEEALQKYVTWALKSGDGSVRYEE--VT  712

Query  513   SAAETME---AIRGYNRC-NLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTT  346
             +AAE  E   AIR   R  NL+V GR        A+ +K +CPELGP+G+ L+  EFSTT
Sbjct  713   AAAEREELTPAIRTLGRGKNLVVAGRSAPAP---ALVEKSDCPELGPVGSYLATPEFSTT  769

Query  345   ASVLVVQQYRTELSKNGLKEDDSVDGDYESA  253
             ASVLVVQ+Y      +  +E  +++ D E A
Sbjct  770   ASVLVVQRYNPR--SDPTRERPAMERDVEEA  798



>emb|CBI34422.3| unnamed protein product [Vitis vinifera]
Length=666

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/789 (61%), Positives = 558/789 (71%), Gaps = 140/789 (18%)
 Frame = -1

Query  2658  MGSNGTV--VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             M +N +    CP+PMK+ SNG FQGD+PL +ALPL I+QICLV+++TR LAYL RPLRQP
Sbjct  1     MATNSSAGHACPSPMKSVSNGIFQGDNPLHFALPLAILQICLVLVVTRGLAYLFRPLRQP  60

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RVIAEI+GG+LLGPSA GRSE+YL+A+FP +SLTVLDTLA+LGLLFFLFL GLELDPKSL
Sbjct  61    RVIAEIVGGILLGPSALGRSESYLHAVFPSQSLTVLDTLANLGLLFFLFLAGLELDPKSL  120

Query  2304  RRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLAR  2125
             RRTGKKAL IA+AGISLPF LGIGTSF+LR TIAKGV+   FLVFMGVALSITAFPVLAR
Sbjct  121   RRTGKKALGIAIAGISLPFALGIGTSFVLRETIAKGVNGTSFLVFMGVALSITAFPVLAR  180

Query  2124  ILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLL  1945
             ILAELKLLTTDVG+MAMSAAAVNDVAAWILLALAI+LSG+  SP++  WVLLCG GFV+ 
Sbjct  181   ILAELKLLTTDVGRMAMSAAAVNDVAAWILLALAISLSGSKQSPIVPFWVLLCGCGFVIC  240

Query  1944  CILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVP  1765
               L++P IFKWMA RC EGEPVDE+Y+C+ LA VL AG VTD IGIHA+FGAFV+G+LVP
Sbjct  241   ASLILPPIFKWMARRCHEGEPVDEMYICSTLAVVLAAGVVTDAIGIHAMFGAFVVGILVP  300

Query  1764  KDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKIL  1585
             K+GP ASAL+EKVEDLVSGLFLPLYFVSSGLKTNVATIQG QSW LLVLVIFTAC GKI+
Sbjct  301   KEGPFASALLEKVEDLVSGLFLPLYFVSSGLKTNVATIQGLQSWALLVLVIFTACIGKIV  360

Query  1584  GTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTF  1405
             GT++VS   ++P +EA+ LGFLMN+KGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTF
Sbjct  361   GTVVVSLSFKMPLREALALGFLMNSKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTF  420

Query  1404  ITTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTE  1225
             ITTP          L V  YK        P+K+                       R T+
Sbjct  421   ITTP----------LVVAVYK--------PAKR----------------------ERNTD  440

Query  1224  KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK  1045
                                      HK R          G  ++S +IVVAFE F+ LS+
Sbjct  441   -------------------------HKQRT---------GVRSESNQIVVAFEAFQQLSQ  466

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             VS+RP T+IS++S MHEDI  +A+ KRVA+IILPFHKHQ++DG  ETTR + R VNRRVL
Sbjct  467   VSVRPMTSISSISDMHEDICTTADRKRVAIIILPFHKHQRVDGSLETTRTDFRWVNRRVL  526

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
             E A CSVGILVDRGLGGT+HVSASNV Y ITVL+FGGHDDREALAYG RM EHPGI L+V
Sbjct  527   EHAACSVGILVDRGLGGTTHVSASNVSYFITVLFFGGHDDREALAYGIRMAEHPGINLMV  586

Query  684   ARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAA  505
              RF ++ ET                                                  A
Sbjct  587   IRFLVEHET--------------------------------------------------A  596

Query  504   ETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQ  325
             E +E + G ++         P+ E      ++ ECPELGPLG+LL+  +FST ASVLV+Q
Sbjct  597   EGIELVDGNSK---------PDEEY-----RRSECPELGPLGSLLASTDFSTAASVLVIQ  642

Query  324   QYRTELSKN  298
             QY   +S N
Sbjct  643   QYHGSVSPN  651



>ref|XP_006846157.1| hypothetical protein AMTR_s00012p00187890 [Amborella trichopoda]
 gb|ERN07832.1| hypothetical protein AMTR_s00012p00187890 [Amborella trichopoda]
Length=744

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/709 (63%), Positives = 541/709 (76%), Gaps = 11/709 (2%)
 Frame = -1

Query  2445  PSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALA  2266
             PSA GR++ Y++ IFP +S+TVLD+LA++GLL FLFLVGLELD  S+RRTG+KAL IAL+
Sbjct  21    PSALGRNKDYMHRIFPPRSMTVLDSLANMGLLLFLFLVGLELDVNSIRRTGRKALGIALS  80

Query  2265  GISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVG  2086
             GI+LPF LG+GTSF+L++T+AKGV   PFLVFMGVA SITAFPVLARILAELKLLTTD+G
Sbjct  81    GITLPFLLGVGTSFVLKSTVAKGVDTAPFLVFMGVAFSITAFPVLARILAELKLLTTDIG  140

Query  2085  QmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMA  1906
             ++AMSAAAVNDVAAWILLALA+ALSGTG SPL+SLWVLL G  FV+  +L V  +  WMA
Sbjct  141   RIAMSAAAVNDVAAWILLALAVALSGTGRSPLVSLWVLLSGVTFVIFAVLAVRPVLAWMA  200

Query  1905  SRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKV  1726
              R  + EPV E Y+C +LA VL AGF TD IGIH LFG FV+G+L+PK+G  A +L EK+
Sbjct  201   RRSDDSEPVHEGYMCVVLAVVLAAGFATDAIGIHVLFGGFVMGLLMPKEGAFAVSLTEKI  260

Query  1725  EDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPF  1546
             EDLVSGLFLPLYFVSSGLKT+VATI+GAQSWG+L LVI TAC GK LGT+ VS   ++P 
Sbjct  261   EDLVSGLFLPLYFVSSGLKTDVATIRGAQSWGMLGLVILTACVGKFLGTVGVSKAFKMPC  320

Query  1545  QEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPA  1366
             +EA+ LGFLMNTKGLVELIVLNIGKDR VLNDQTFAIMVLMALFTTFITTP+V A+YKPA
Sbjct  321   REALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFITTPLVTAVYKPA  380

Query  1365  KLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLM  1186
             + A   YK+RTIQRK+P  +LR+L C H+ R+IP+LI+LIEASRGT +     VYAMHLM
Sbjct  381   RKA-PPYKHRTIQRKNPDSELRMLACLHNARSIPALIHLIEASRGTRRR-LLCVYAMHLM  438

Query  1185  ELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMS  1006
             ELSER SAILM +K R NGLPFWN +  P +S  IVVAF+ +  LS VS+RP TAIS+++
Sbjct  439   ELSERPSAILMANKVRHNGLPFWN-KSHP-NSDHIVVAFDAYHSLSSVSVRPMTAISSLT  496

Query  1005  SMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDR  826
             +MHEDI +SAE KR A+I+LPFHK  +IDG+FE TR   R VN RVLE APCSV I VDR
Sbjct  497   TMHEDICSSAEHKRAALIVLPFHKQARIDGNFELTRPGFRQVNLRVLENAPCSVAIFVDR  556

Query  825   GLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGTs  646
             GLG  + +  S+   +I +L+FGG DDREALAY ARM EHPG+ L+V  F   P+T    
Sbjct  557   GLGAPARIPTSDFASSIAMLFFGGQDDREALAYAARMAEHPGVSLIVHHFLPVPQTNQPD  616

Query  645   vkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGYNRCN  466
                    +GS        D+ FL  F+   +TN S++YEE  V++  ET+ AIR   RCN
Sbjct  617   GVRINMDAGSREA-----DKKFLVDFQAMETTNQSIRYEELEVRNREETVAAIRNVARCN  671

Query  465   LLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             L++VGR  E        +  +C ELG +G+ L+ +EF+  ASVLVV QY
Sbjct  672   LVLVGRRAEAPGFEM--RSTDCTELGLVGSFLASQEFTGGASVLVVGQY  718



>ref|NP_176599.2| cation/H(+) antiporter 16 [Arabidopsis thaliana]
 sp|Q1HDT3.1|CHX16_ARATH RecName: Full=Cation/H(+) antiporter 16; AltName: Full=Protein 
CATION/H+ EXCHANGER 16; Short=AtCHX16 [Arabidopsis thaliana]
 gb|ABF54931.1| cation/H+ exchanger [Arabidopsis thaliana]
 gb|AEE34204.1| cation/H(+) antiporter 16 [Arabidopsis thaliana]
Length=811

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/800 (58%), Positives = 589/800 (74%), Gaps = 36/800 (5%)
 Frame = -1

Query  2649  NGTV---VCP---APMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQ  2488
             NGT+    CP   A MK TSNG F G+SPLD+A PL+I+QICLVV +TR LA+LLRP+RQ
Sbjct  6     NGTIPAMKCPKNVAMMKTTSNGVFDGESPLDFAFPLVILQICLVVAVTRSLAFLLRPMRQ  65

Query  2487  PRVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKS  2308
             PRV+AEIIGG+LLGPSA GR  +Y N+IFP +SLTVLDTLA+LGLL FLFLVGLE+D  S
Sbjct  66    PRVVAEIIGGILLGPSALGRITSYKNSIFPARSLTVLDTLANLGLLLFLFLVGLEIDLTS  125

Query  2307  LRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQG--PFLVFMGVALSITAFPV  2134
             LRRTGKKA+SIA AG+ LPFG+GI TSF      + G +    PF++FMGVALSITAF V
Sbjct  126   LRRTGKKAISIAAAGMLLPFGMGIVTSFAFPEASSSGDNSKVLPFIIFMGVALSITAFGV  185

Query  2133  LARILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGF  1954
             LARILAELKLLTTD+G+++M+AAA+NDVAAW+LLALA++LSG  +SPL+ LWVLL G  F
Sbjct  186   LARILAELKLLTTDLGRISMNAAAINDVAAWVLLALAVSLSGDRNSPLVPLWVLLSGIAF  245

Query  1953  VLLCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGV  1774
             V+ C L+VPRIFK+++ RC EGEP+ E+YVC  L AVL AGF TD IGIHA+FGAFV+GV
Sbjct  246   VIACFLIVPRIFKFISRRCPEGEPIGEMYVCVALCAVLLAGFATDAIGIHAIFGAFVMGV  305

Query  1773  LVPKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFG  1594
             L PK G  + A+VEK+EDLV GL LPLYFV SGLKT++ TIQG +SWG L LVI TACFG
Sbjct  306   LFPK-GHFSDAIVEKIEDLVMGLLLPLYFVMSGLKTDITTIQGVKSWGRLALVIVTACFG  364

Query  1593  KILGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALF  1414
             KI+GT+ V+ LC++  +E++ LG LMNTKGLVELIVLNIGKDR VL+DQTFAIMVLMA+F
Sbjct  365   KIVGTVSVALLCKVRLRESVVLGVLMNTKGLVELIVLNIGKDRKVLSDQTFAIMVLMAIF  424

Query  1413  TTFITTPIVIALYKPAKLAVTE----YKYRTIQRK-------DPSKQLRILTCFHSRRNI  1267
             TTFITTPIV+ALYKP++   T     YK R  +RK       +  +QL++L C  S ++I
Sbjct  425   TTFITTPIVLALYKPSETTQTHSSVSYKNRKHRRKIENDEEGEKMQQLKVLVCLQSSKDI  484

Query  1266  PSLINLIEASRGT-EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDS  1090
               ++ ++EA+RG+ E    F VY MHL +LSER S+I M  K R NGLPFWN + E  +S
Sbjct  485   DPMMKIMEATRGSNETKERFCVYVMHLTQLSERPSSIRMVQKVRSNGLPFWNKKRE--NS  542

Query  1089  TEIVVAFETFEHLSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQK-IDGH  913
             + + VAFE    LS VS+R  TAIS +S++HEDI +SA+ K  A +ILPFHK  + ++  
Sbjct  543   SAVTVAFEASSKLSSVSVRSVTAISPLSTIHEDICSSADSKCTAFVILPFHKQWRSLEKE  602

Query  912   FETTRNELRHVNRRVLEGAPCSVGILVDRGLG-GTSHVSASNVDYTITVLYFGGHDDREA  736
             FET R+E + +N+RVLE +PCSVGILVDRGLG   S V++SN   ++ VL+FGG DDREA
Sbjct  603   FETVRSEYQGINKRVLENSPCSVGILVDRGLGDNNSPVASSNFSLSVNVLFFGGCDDREA  662

Query  735   LAYGARMVEHPGICLVVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRN  556
             L YG RM EHPG+ L V   +  PE+A            +      S DE FLAA K+R 
Sbjct  663   LVYGLRMAEHPGVNLTVVVIS-GPESA------RFDRLEAQETSLCSLDEQFLAAIKKR-  714

Query  555   STNSSVKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLG  379
                ++ ++EE+ V S  E +E IR +  C++L+VG+  +G +V+ +   K ECPELGP+G
Sbjct  715   --ANAARFEERTVNSTEEVVEIIRQFYECDILLVGKSSKGPMVSRLPVMKIECPELGPVG  772

Query  378   NLLSCKEFSTTASVLVVQQY  319
             NL+   E ST+ SVLVVQQY
Sbjct  773   NLIVSNEISTSVSVLVVQQY  792



>gb|EMS54712.1| Cation/H(+) antiporter 19 [Triticum urartu]
Length=815

 Score =   782 bits (2019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/805 (60%), Positives = 587/805 (73%), Gaps = 79/805 (10%)
 Frame = -1

Query  2637  VCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEII--  2464
             VC APM+ATS+G+FQGD+PLDYALPL I+QICLVV++TR LAYLLRPLRQPRVIAEII  
Sbjct  9     VCAAPMQATSHGAFQGDNPLDYALPLAILQICLVVVVTRGLAYLLRPLRQPRVIAEIICS  68

Query  2463  -----------------------GGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgl  2353
                                    GGVLLGPSA GRS  +L+A+FP KSL VLDTLA+LGL
Sbjct  69    QPADADSGVVVKDTSSEKCGTSKGGVLLGPSALGRSSKFLHAVFPAKSLPVLDTLANLGL  128

Query  2352  lfflflvgleLDPKSLRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLV  2173
             LFFLFLVGLELD  ++RRTGKKAL+IALAGIS+PF LGIGTSF  RATI KG  Q PFLV
Sbjct  129   LFFLFLVGLELDIAAIRRTGKKALAIALAGISVPFALGIGTSFAFRATIVKGAPQAPFLV  188

Query  2172  FMGVALSITAFPVLARILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSP  1993
             FMGVALSITAFPVLARILAELKLLTTD+G+MAMSAAAVNDVAAWILLALA+ALSG G SP
Sbjct  189   FMGVALSITAFPVLARILAELKLLTTDIGRMAMSAAAVNDVAAWILLALAVALSGDG-SP  247

Query  1992  LISLWVLLCGTGFVL-LCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDT  1816
             +ISLWVLL  TGFV+ +C+L+ P +  WMA R  EGEPV E+Y+CA LA VL AGFVTD 
Sbjct  248   IISLWVLLTATGFVIAVCVLLRP-LLAWMAHRSPEGEPVKEVYICATLAIVLAAGFVTDV  306

Query  1815  IGIHALFGAFVIGVLVPKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQS  1636
             IGIHALFGAF++G++VPKDGP A  L+EKVEDL+SGLFLPLYFVSSGLKT+VATI+GA+S
Sbjct  307   IGIHALFGAFMVGIVVPKDGPFAGVLIEKVEDLISGLFLPLYFVSSGLKTDVATIRGAKS  366

Query  1635  WGLLVLVIFTACFGKILGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVL  1456
             WGLLVLVI  AC GKI GT+L S + +IP +EA+ LGFLMNTKGLVELIVLNIG+DR VL
Sbjct  367   WGLLVLVILNACLGKIGGTVLASLIVKIPVREAVALGFLMNTKGLVELIVLNIGRDRKVL  426

Query  1455  NDQTFAIMVLMALFTTFITTPIVIALYKPAKLAVTEYKYRTIQ---RKDPSKQLRILTCF  1285
             ND++FAIMVLMALFTTFITTPIV+A+YKPA+ +   YK RT++     D   +LR+L CF
Sbjct  427   NDESFAIMVLMALFTTFITTPIVMAIYKPARPS-APYKRRTVEGGAPADADSELRVLACF  485

Query  1284  HSRRNIPSLINLIEASRGTEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRG  1105
             HS RNIP+L+NL+E++RGT +     +YAMHL+ELSERSSAI M H+ R+N +PF+N+ G
Sbjct  486   HSNRNIPTLLNLVESTRGTGRH-RLAMYAMHLVELSERSSAISMVHRTRRNAMPFFNS-G  543

Query  1104  EPTDSTEIVVAFETFEHLSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQK  925
             + T+  ++VVAFE F+ LS V ++P TAIS + ++H D+I SA  +R A           
Sbjct  544   DKTE--QMVVAFEAFQQLSAVRVKPMTAISDLETIHRDVIDSAAQQRDAA----------  591

Query  924   IDGHFETTRNELRHVNRRVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDD  745
                    +R+    V  R   GAPCSV ILVDRGLGG S V+A NV++++ +L+FGG DD
Sbjct  592   -----RPSRSP--AVTSRGPRGAPCSVAILVDRGLGGHSQVAAKNVEFSVAMLFFGGADD  644

Query  744   REALAYGARMVEHPGICLVVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFK  565
             REALAY  RM EHPG+ + V RF     ++G +                      + AFK
Sbjct  645   REALAYATRMSEHPGVAVTVTRFRPSRPSSGDAADEAA-----------------MEAFK  687

Query  564   QRNST--NSSVKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECP-E  394
              +     + S  YE+    +  E ++AI   ++ N+ VVGRMP  E +       E P E
Sbjct  688   GKVEAVKDGSAMYEDVEASAKEEVLQAINSLSKSNMFVVGRMPPTEPLV------ERPEE  741

Query  393   LGPLGNLLSCKEFSTTASVLVVQQY  319
             LGP+G+ L+  EF T+ASVLV+++Y
Sbjct  742   LGPVGSYLASSEFKTSASVLVIKRY  766



>ref|XP_004981194.1| PREDICTED: cation/H(+) antiporter 19-like [Setaria italica]
Length=797

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/792 (59%), Positives = 581/792 (73%), Gaps = 24/792 (3%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             MKATS G++QG +PL ++LPL+I+Q+CLV++LTR LA+ LRPLRQPRVIAEIIGG+LLGP
Sbjct  1     MKATSEGAWQGGNPLHFSLPLIILQVCLVLVLTRGLAFALRPLRQPRVIAEIIGGILLGP  60

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SA GRS+ +L+ +FP +SLTVLDTLA++GLLFFLFLVGLELDP SLRRTG++A +IA+AG
Sbjct  61    SALGRSKVFLDHVFPPESLTVLDTLANIGLLFFLFLVGLELDPASLRRTGRRAFAIAVAG  120

Query  2262  ISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQ  2083
             ISLPF  G+G+S  LRA I  G  +GP +VFMGVALSITAFPVLARILAELKLLTTD+G+
Sbjct  121   ISLPFAFGVGSSLALRAAIDPGAPRGPLVVFMGVALSITAFPVLARILAELKLLTTDLGR  180

Query  2082  mamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMAS  1903
             MAMSAAAVND+ AWILLALAIALSG+G SP +S++VLLCG GFV+  I +V     +MA 
Sbjct  181   MAMSAAAVNDITAWILLALAIALSGSG-SPFVSIYVLLCGIGFVVAAIFLVRPALVYMAR  239

Query  1902  RCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVE  1723
             R   GEP+ E +VC+ +A VL AGFVTD IGIHALFGAF+IGVL+PK+G  A AL EK+E
Sbjct  240   RSPAGEPIKESFVCSTVAIVLAAGFVTDAIGIHALFGAFLIGVLIPKEGAYAGALTEKME  299

Query  1722  DLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQ  1543
             DLVS LFLPLYFVSSGLKTNVATI GA SWG L LVI T+C GKI GT++ S L R+P +
Sbjct  300   DLVSSLFLPLYFVSSGLKTNVATISGATSWGFLALVITTSCAGKIGGTVVASQLMRVPPR  359

Query  1542  EAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAK  1363
             EA+ LG LMNTKGLVELIVLNIG+DR VLN++ FAI+VLMAL TTF+TTP V A+Y PA+
Sbjct  360   EALALGLLMNTKGLVELIVLNIGRDRRVLNEEAFAILVLMALITTFMTTPAVTAVYTPAR  419

Query  1362  LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLME  1183
              A   Y +RT++R D   +LR+L CFH+ R IP+L+NL+EASRGT +S    VYAMHL+E
Sbjct  420   RA-APYMHRTVERGDADSELRVLACFHASRTIPTLLNLVEASRGTRRS-KLTVYAMHLVE  477

Query  1182  LSERSSAILMCHKARKNGLPFWNTR-GEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMS  1006
              SERSSAI M  +AR+NGLPF + R G      E+VVAFE F+ LS V++RP TAIS + 
Sbjct  478   HSERSSAISMVQRARRNGLPFSSRRGGGGGCGGEVVVAFEAFQRLSAVTVRPMTAISDLG  537

Query  1005  SMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDR  826
             ++HEDI+ASA  KR A+++LPFHK    DG  E        VN RVL  APCSV +LVDR
Sbjct  538   TIHEDIVASAVNKRAALLVLPFHKTLSHDGAMEPVDRAFHQVNVRVLRSAPCSVAVLVDR  597

Query  825   GLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGTs  646
              LGG + V A +V Y + VL+FGG DDREALAY A M EHPGI L VARF+         
Sbjct  598   VLGGAAQVPAPDVSYAVLVLFFGGPDDREALAYAACMGEHPGIELTVARFS---------  648

Query  645   vkldvspsgssspeekSRDEDFLAAF--KQRNSTNSSVKYEEKVVKSAAETMEAIRGYNR  472
                  +   ++      +DE+ L  +   +  S N SVKYEE       +   AI+   R
Sbjct  649   ---SAAAKPNADDGGAIKDEEALQRYVTGRLKSGNGSVKYEEVTGAERQDVTSAIKTLGR  705

Query  471   C-NLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY--RTELS-  304
               NL+V GR         + +K +CPELGP+G+ L+  EFSTTASVLVVQ+Y  R++ + 
Sbjct  706   GKNLVVAGR--SAPTTTPLVEKSDCPELGPVGSYLATPEFSTTASVLVVQRYNPRSDPTC  763

Query  303   KNGLKEDDSVDG  268
             +    E+D+ D 
Sbjct  764   RRPAGEEDTEDA  775



>gb|EAY92425.1| hypothetical protein OsI_14159 [Oryza sativa Indica Group]
Length=780

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/774 (60%), Positives = 569/774 (74%), Gaps = 24/774 (3%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             MKATS G++QGD+PL ++LPLLIVQICLVV+ TR LAY LRPLRQPRVIAEIIGG+LLGP
Sbjct  1     MKATSEGAWQGDNPLRFSLPLLIVQICLVVVFTRGLAYALRPLRQPRVIAEIIGGILLGP  60

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SA GR++ +L+ +FPK SLTVLDTLA++GLLFFLFLVGLELDP SLRRTG+ AL++A AG
Sbjct  61    SALGRNKRFLDNVFPKDSLTVLDTLANVGLLFFLFLVGLELDPASLRRTGRTALAVAAAG  120

Query  2262  ISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQ  2083
             ISLPF LG+G S +LRA IA    +GP +VFMGVALSITAFPVLARILAELKLLTTD+G+
Sbjct  121   ISLPFALGVGASLVLRAAIAPDAPRGPLIVFMGVALSITAFPVLARILAELKLLTTDIGR  180

Query  2082  mamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMAS  1903
             MAMSAAAVND+ AW+LLALAIALSG+G SPL+S++VLLCG  FV    + V  +  +MA 
Sbjct  181   MAMSAAAVNDITAWVLLALAIALSGSG-SPLVSIYVLLCGVAFVGFATVAVRPVLVFMAR  239

Query  1902  RCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVE  1723
             R  EGEPV E +VCAIL  VL AGF TD IGIHALFGAFVIGVLVPK+G  A AL EKVE
Sbjct  240   RSPEGEPVKESFVCAILVIVLAAGFATDAIGIHALFGAFVIGVLVPKEGACAGALTEKVE  299

Query  1722  DLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQ  1543
             DLVS LFLPLYFVSSGLKT+V TI GA+SWGLLVLV+ TAC GKI GT+  S L R+P +
Sbjct  300   DLVSSLFLPLYFVSSGLKTDVTTISGAKSWGLLVLVMTTACAGKIGGTVAASLLMRVPLR  359

Query  1542  EAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAK  1363
             EA+ LG LMNTKGLVELIVLNIG+DR VLN++ FAI+VLMAL TTF+TTP V A+YKPA+
Sbjct  360   EALALGMLMNTKGLVELIVLNIGRDRKVLNEEAFAILVLMALVTTFMTTPAVTAVYKPAR  419

Query  1362  LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLME  1183
                + YK+RT++R D   +LR+L CFH+ R IP+LINL+EASRGT +S    +YAMHL+E
Sbjct  420   RQAS-YKHRTVERADADSELRVLACFHASRGIPTLINLVEASRGTRRS-KLTMYAMHLVE  477

Query  1182  LSERSSAILMCHKARKNGLPFWNTR--GEPTDSTEIVVAFETFEHLSKVSIRPSTAISAM  1009
             LSERSSAI M  +AR+NGLPF + R         E+VVAFE F+ L+ V+++P TAIS +
Sbjct  478   LSERSSAISMVQRARRNGLPFASRRGHEGGGGGGEVVVAFEAFQRLTAVTVKPMTAISDL  537

Query  1008  SSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVD  829
              ++H+DI+ASA  KR A+I+LPFHK    DG  E        VN RVL  APCSV +LVD
Sbjct  538   DTIHDDIVASALDKRAAIILLPFHKMLCHDGTLEPVDRAFHQVNVRVLRDAPCSVAVLVD  597

Query  828   RGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGT  649
             R LGG + VSA +V Y++ +L+FGG DDREALAY +RM EHPGI L VARFT   + A  
Sbjct  598   RALGGAAQVSAPDVSYSVLLLFFGGADDREALAYASRMGEHPGIALTVARFTAAADDAAE  657

Query  648   svkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGYNRC  469
                       +                 ++   + + KY+E       E   AI+   R 
Sbjct  658   DDDAIQKHISNV----------------RKAGNDGAFKYDEVSAHGRQEVAFAIKTLGRG  701

Query  468   -NLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTE  310
              NL+V GR     +   +  K +CPELG +G+ L+  EFSTT+SVLVVQ+Y + 
Sbjct  702   KNLVVAGR--SAAVATPLVDKTDCPELGHVGSYLATPEFSTTSSVLVVQKYDSR  753



>ref|NP_001173696.1| Os03g0828600 [Oryza sativa Japonica Group]
 gb|AAL79755.1|AC096687_19 putative ion antiporter [Oryza sativa Japonica Group]
 gb|ABF99678.1| cation/hydrogen exchanger, putative [Oryza sativa Japonica Group]
 dbj|BAH92424.1| Os03g0828600 [Oryza sativa Japonica Group]
Length=780

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/774 (60%), Positives = 569/774 (74%), Gaps = 24/774 (3%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             MKATS G++QGD+PL ++LPLLIVQICLVV+ TR LAY LRPLRQPRVIAEIIGG+LLGP
Sbjct  1     MKATSEGAWQGDNPLRFSLPLLIVQICLVVVFTRGLAYALRPLRQPRVIAEIIGGILLGP  60

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SA GR++ +L+ +FPK SLTVLDTLA++GLLFFLFLVGLELDP SLRRTG+ AL++A AG
Sbjct  61    SALGRNKRFLDNVFPKDSLTVLDTLANVGLLFFLFLVGLELDPASLRRTGRTALAVAAAG  120

Query  2262  ISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQ  2083
             ISLPF LG+G S +LRA IA    +GP +VFMGVALSITAFPVLARILAELKLLTTD+G+
Sbjct  121   ISLPFALGVGASLVLRAAIAPDAPRGPLIVFMGVALSITAFPVLARILAELKLLTTDIGR  180

Query  2082  mamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMAS  1903
             MAMSAAAVND+ AW+LLALAIALSG+G SPL+S++VLLCG  FV    + V  +  +MA 
Sbjct  181   MAMSAAAVNDITAWVLLALAIALSGSG-SPLVSIYVLLCGVAFVGFATVAVRPVLVFMAR  239

Query  1902  RCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVE  1723
             R  EGEPV E +VCAIL  VL AGF TD IGIHALFGAFVIGVLVPK+G  A AL EKVE
Sbjct  240   RSPEGEPVKESFVCAILVIVLAAGFATDAIGIHALFGAFVIGVLVPKEGACAGALTEKVE  299

Query  1722  DLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQ  1543
             DLVS LFLPLYFVSSGLKT+V TI GA+SWGLLVLV+ TAC GKI GT+  S L R+P +
Sbjct  300   DLVSSLFLPLYFVSSGLKTDVTTISGAKSWGLLVLVMTTACAGKIGGTVAASLLMRVPLR  359

Query  1542  EAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAK  1363
             EA+ LG LMNTKGLVELIVLNIG+DR VLN++ FAI+VLMAL TTF+TTP V A+YKPA+
Sbjct  360   EALALGMLMNTKGLVELIVLNIGRDRKVLNEEAFAILVLMALVTTFMTTPAVTAVYKPAR  419

Query  1362  LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLME  1183
                + YK+RT++R D   +LR+L CFH+ R IP+LINL+EASRGT +S    +YAMHL+E
Sbjct  420   RQAS-YKHRTVERADADSELRVLACFHASRGIPTLINLVEASRGTRRS-KLTMYAMHLVE  477

Query  1182  LSERSSAILMCHKARKNGLPFWNTR--GEPTDSTEIVVAFETFEHLSKVSIRPSTAISAM  1009
             LSERSSAI M  +AR+NGLPF + R         E+VVAFE F+ L+ V+++P TAIS +
Sbjct  478   LSERSSAISMVQRARRNGLPFASRRGHEGGGGGGEVVVAFEAFQRLTAVTVKPMTAISDL  537

Query  1008  SSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVD  829
              ++H+DI+ASA  KR A+I+LPFHK    DG  E        VN RVL  APCSV +LVD
Sbjct  538   DTIHDDIVASALDKRSAIILLPFHKMLCHDGTLEPVDRAFHQVNVRVLRDAPCSVAVLVD  597

Query  828   RGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGT  649
             R LGG + VSA +V Y++ +L+FGG DDREALAY +RM EHPGI L VARFT   + A  
Sbjct  598   RALGGAAQVSAPDVSYSVLLLFFGGADDREALAYASRMGEHPGIALTVARFTAAADDAAE  657

Query  648   svkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGYNRC  469
                       +                 ++   + + KY+E       E   AI+   R 
Sbjct  658   DDDAIQKHISNV----------------RKAGNDGAFKYDEVSAHGRQEVAFAIKTLGRG  701

Query  468   -NLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTE  310
              NL+V GR     +   +  K +CPELG +G+ L+  EFSTT+SVLVVQ+Y + 
Sbjct  702   KNLVVAGR--SAAVATPLVDKTDCPELGHVGSYLATPEFSTTSSVLVVQKYDSR  753



>gb|EMT05569.1| K(+)/H(+) antiporter 13 [Aegilops tauschii]
Length=741

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/722 (61%), Positives = 549/722 (76%), Gaps = 37/722 (5%)
 Frame = -1

Query  2463  GGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKA  2284
             GGVLLGPSA GRS  +L+A+FP KSL VLDTLA+LGLLFFLFLVGLELD  ++RRTGKKA
Sbjct  5     GGVLLGPSALGRSSKFLHAVFPAKSLPVLDTLANLGLLFFLFLVGLELDIAAIRRTGKKA  64

Query  2283  LSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKL  2104
             L+IALAGISLPF LGIGTSF  RATI KG  QGPFLVFMGVALSITAFPVLARILAELKL
Sbjct  65    LAIALAGISLPFALGIGTSFAFRATIVKGAPQGPFLVFMGVALSITAFPVLARILAELKL  124

Query  2103  LTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVL-LCILVVP  1927
             LTTD+G+MAMSAAAVNDVAAWILLALA+ALSG G SP+ISLWVLL  TGFV+ +C+L+ P
Sbjct  125   LTTDIGRMAMSAAAVNDVAAWILLALAVALSGDG-SPIISLWVLLTATGFVIAVCVLLRP  183

Query  1926  RIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLA  1747
              +  WMA R  EGEPV E+Y+CA LA VL AGFVTD IGIHALFGAF++G++VPKDGP A
Sbjct  184   -LLAWMAHRSPEGEPVKEVYICATLAIVLAAGFVTDVIGIHALFGAFMVGIVVPKDGPFA  242

Query  1746  SALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVS  1567
               L+EKVEDL+SGLFLPLYFVSSGLKT+VATI+GA+SWGLLVLVI  AC GKI GT++ S
Sbjct  243   GVLIEKVEDLISGLFLPLYFVSSGLKTDVATIRGAKSWGLLVLVIINACLGKIGGTVIAS  302

Query  1566  TLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIV  1387
                +IP +EA+TLGFLMNTKGLVELIVLNIG+DR VLND++FAIMVLMALFTTFITTPIV
Sbjct  303   LCVKIPVREAVTLGFLMNTKGLVELIVLNIGRDRKVLNDESFAIMVLMALFTTFITTPIV  362

Query  1386  IALYKPAKLAVTEYKYRTIQ---RKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSG  1216
             +A+YKPA+ +   YK RT++     D   +LR+L CFHS RNIP+L+NL+E++RGT +  
Sbjct  363   MAIYKPARPS-APYKRRTVEGGAPADADSELRVLACFHSNRNIPTLLNLVESTRGTGRR-  420

Query  1215  GFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSI  1036
                +YAMHL+ELSERSSAI M H+ R+N +PF+N+ G+ T+  ++VVAFE F+ LS V +
Sbjct  421   CLAMYAMHLVELSERSSAISMVHRTRRNAMPFFNS-GDKTE--QMVVAFEAFQQLSAVRV  477

Query  1035  RPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGA  856
             +P TAIS + ++H D+I SA  KR A++I+P+HK  + DG F +  ++   VN+RVL GA
Sbjct  478   KPMTAISDLETIHRDVIDSAAEKRAAIVIMPYHKLLQHDGSFHSLGSQYHAVNKRVLRGA  537

Query  855   PCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF  676
             PCSV ILVDRGLGG S V+A NV++++ +L+FGG DDREALAY  RM EHPG+ + V RF
Sbjct  538   PCSVAILVDRGLGGHSQVAAKNVEFSVAMLFFGGADDREALAYATRMSEHPGVAVTVTRF  597

Query  675   TLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNST--NSSVKYEEKVVKSAAE  502
                P  + +                   DE  + AFK +     + S  YE     +  +
Sbjct  598   R--PSRSSSDDAA---------------DEVAIEAFKGKVEAVKDGSAMYENVEASAKED  640

Query  501   TMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECP-ELGPLGNLLSCKEFSTTASVLVVQ  325
              ++AI   ++ N+ VVGRMP  E +       E P ELGP+G+ L+  EF T+ASVLV++
Sbjct  641   VLQAINSLSKSNMFVVGRMPPTEPLV------ERPEELGPVGSYLASSEFKTSASVLVIK  694

Query  324   QY  319
             +Y
Sbjct  695   RY  696



>ref|XP_003607446.1| K(+)/H(+) antiporter [Medicago truncatula]
Length=706

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/678 (62%), Positives = 510/678 (75%), Gaps = 18/678 (3%)
 Frame = -1

Query  2313  KSLRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPV  2134
             +S+R+TG KAL IALAGI++PF LGIGTS +LRATI K  +   FLVFMGVALSITAFPV
Sbjct  2     RSIRKTGSKALCIALAGITVPFVLGIGTSLVLRATINKDANPTSFLVFMGVALSITAFPV  61

Query  2133  LARILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGF  1954
             LARILAELKLLTTDVG+MAMSAAAVNDVAAWILLALA+ALSG   SPL+SLWVLLCG GF
Sbjct  62    LARILAELKLLTTDVGRMAMSAAAVNDVAAWILLALAVALSGANTSPLVSLWVLLCGVGF  121

Query  1953  VLLCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGV  1774
             +L  I  +  +   MA RC EGEPV EIY+C  L  VLG  F+TDTIGIHALFGAFV G+
Sbjct  122   ILFVIFAIKPLLAIMAKRCPEGEPVKEIYICITLTLVLGCSFLTDTIGIHALFGAFVAGI  181

Query  1773  LVPKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFG  1594
             +VPK+GP AS L EK+EDLV  L LPLYFVSSGLKTNVATI GA SWGLL+LVIFTACFG
Sbjct  182   VVPKEGPFASILTEKIEDLVMSLLLPLYFVSSGLKTNVATISGALSWGLLILVIFTACFG  241

Query  1593  KILGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALF  1414
             K++GT++VS LC+IPF+EA+TLGFLMNTKGLVELIVLNIGKDR VL+DQ FAI V+MAL 
Sbjct  242   KVVGTLVVSLLCKIPFREALTLGFLMNTKGLVELIVLNIGKDRKVLSDQAFAICVVMALV  301

Query  1413  TTFITTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASR  1234
             TTFITTPIV+A+YKPA+   + Y ++TIQRKDP  +LRIL CFHS  NIP+LINLIE+SR
Sbjct  302   TTFITTPIVMAVYKPARRG-SPYMHKTIQRKDPDTELRILACFHSTYNIPTLINLIESSR  360

Query  1233  GTEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEH  1054
             GT K G   +YAMHLMELSER SAI M HKAR NGLPFWN + +  +  ++V+AF+ + H
Sbjct  361   GTRKRGKLCIYAMHLMELSERPSAITMVHKARNNGLPFWNKK-QHDNKDQMVIAFQAYGH  419

Query  1053  LSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNR  874
             LS V++R  TAIS+++++HEDI +SA  KRVAMI+LPFHKHQ++DG  E+  +  R +N 
Sbjct  420   LSSVNVRSMTAISSLNNIHEDICSSAHQKRVAMILLPFHKHQRVDGTMESLGHSFRVMNG  479

Query  873   RVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGIC  694
              VL  APCSVGILVDRGLGGT+ V AS+V Y + V +FGG DDREALAYG R+ EHPGI 
Sbjct  480   LVLSHAPCSVGILVDRGLGGTTQVHASDVSYNVVVAFFGGCDDREALAYGMRIAEHPGIS  539

Query  693   LVVARFTLDPE------------TAGTsvkldvspsgssspeekSRDEDFLAAFKQR-NS  553
             L V +F   P             TA    K+     G++  E+K  D+ F + F      
Sbjct  540   LTVLKFITPPGKTLAFGAKLIGITADRDRKVIKVSDGNTPDEDKQEDDQFWSEFLGVCCK  599

Query  552   TNSSVKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNL  373
             +  S+ YEE++V+S  + +  +   N+ NL++ GRMP    VA +    +C ELGP+G+ 
Sbjct  600   SEESIVYEERLVESKEDIVTVLSERNKSNLILAGRMPP---VAPLLDGSDCAELGPVGSY  656

Query  372   LSCKEFSTTASVLVVQQY  319
             L+  EFST ASV++ QQY
Sbjct  657   LASSEFSTFASVIIFQQY  674



>ref|XP_002442550.1| hypothetical protein SORBIDRAFT_08g021720 [Sorghum bicolor]
 gb|EES16388.1| hypothetical protein SORBIDRAFT_08g021720 [Sorghum bicolor]
Length=793

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/785 (59%), Positives = 583/785 (74%), Gaps = 32/785 (4%)
 Frame = -1

Query  2619  KATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGPS  2440
             K  SNG+FQG++PLD+ALPL+I+QICLV+++TR LAYLLRPLRQPRVIAEIIGG+LLGPS
Sbjct  3     KVASNGAFQGENPLDFALPLIILQICLVLVVTRGLAYLLRPLRQPRVIAEIIGGILLGPS  62

Query  2439  AFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAGI  2260
             A GRS  +L+ +FP  S+TVLDTLA+LGLLFFLFLVGLELD  ++RRTG+KAL+I+L+GI
Sbjct  63    ALGRSTKFLHTVFPPASMTVLDTLANLGLLFFLFLVGLELDISAIRRTGRKALAISLSGI  122

Query  2259  SLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQm  2080
             +LPF LG+GTSF  RAT+ K     PFLVFMGVALSITAFPVLARIL ELKLLTTD+G+M
Sbjct  123   ALPFALGVGTSFAFRATVVKDAPHAPFLVFMGVALSITAFPVLARILTELKLLTTDLGRM  182

Query  2079  amsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMASR  1900
             A+SAAAV+DV AWILLALAIALSG+  SP+ISLWVLL  + FV    L++  +  WM+ +
Sbjct  183   ALSAAAVDDVMAWILLALAIALSGSS-SPIISLWVLLTASAFVAAAFLLLKPVLAWMSRQ  241

Query  1899  CSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVED  1720
             C +GEP+ E++VCA L  VL AGF TD IGIHALFG FV+GV+VPKDGP A  L+EKVED
Sbjct  242   CRDGEPIKELHVCATLGIVLAAGFTTDVIGIHALFGGFVVGVVVPKDGPFAGMLIEKVED  301

Query  1719  LVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQE  1540
             LVSGLFLPLYFVSSGLKTNVATI GA+SWGLLVLVI  AC GKI G +  + L +IP +E
Sbjct  302   LVSGLFLPLYFVSSGLKTNVATISGAKSWGLLVLVIANACLGKIGGAVTTALLVKIPVRE  361

Query  1539  AITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAKL  1360
             A+TLGFLMNTKGLVEL+VLNIG+DR VLND+ FAIMVLMALFTTFITTPIV+A+YKPA+ 
Sbjct  362   AVTLGFLMNTKGLVELVVLNIGRDRKVLNDEAFAIMVLMALFTTFITTPIVMAVYKPARP  421

Query  1359  AVTEYKYRTIQ--RKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLM  1186
             A   YK RT++    D + +LR+L CFH+ R+IP+L+NL+EASRGT +     +YAMHL+
Sbjct  422   A-APYKRRTVECAPGDDTSELRVLACFHASRSIPTLLNLVEASRGTGRR-RLVMYAMHLV  479

Query  1185  ELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMS  1006
             ELSERSS+I M  +AR+NG PF+N+   P    ++VVAFE F+ LS V +R  TAIS M 
Sbjct  480   ELSERSSSITMVQRARRNGAPFFNSADRP--EGQMVVAFEAFQQLSSVRVRAMTAISDMD  537

Query  1005  SMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDR  826
             + H D+I SA GKR A++++P+HK  + DG   +  +    +N+RVL  APCSV +LVDR
Sbjct  538   T-HRDVIDSAAGKRAAIVVMPYHKALQQDGSLVSLGSAYHAINKRVLREAPCSVAVLVDR  596

Query  825   GLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGTs  646
             GLGG + VSA NV +++  L+FGG DDREALAY  RM EHPG+ + +ARF   P ++G  
Sbjct  597   GLGGPAQVSAKNVSFSVATLFFGGPDDREALAYTTRMAEHPGVAVTLARFR--PHSSGEE  654

Query  645   vkldvspsgssspeekSRDEDFLAAFKQR--NSTNSSVKYEEKVVKSAAETMEAIRGYNR  472
                               DE  + AFK +     + SV +EE+   +  E +E I   ++
Sbjct  655   SAD---------------DEAAVEAFKSKLGMVKDGSVHFEERQGYTKEEVLETINALSK  699

Query  471   CNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTELSKNGL  292
              N+ VVGRMP     AA+ +  +  ELGP+G+ L+  EF T+ASVLV+++Y    +    
Sbjct  700   FNVFVVGRMPP---TAALVENPD--ELGPVGSYLASPEFRTSASVLVIKRYDPATNPKSK  754

Query  291   KEDDS  277
             + D S
Sbjct  755   RFDPS  759



>ref|XP_010237010.1| PREDICTED: cation/H(+) antiporter 19-like [Brachypodium distachyon]
Length=748

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/720 (61%), Positives = 549/720 (76%), Gaps = 28/720 (4%)
 Frame = -1

Query  2463  GGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKA  2284
             GGVLLGPSA GRS  +LNA+FPKKSL VLDTLA+LGLLFFLFLVGLELD  ++RRTGKKA
Sbjct  3     GGVLLGPSALGRSNKFLNAVFPKKSLPVLDTLANLGLLFFLFLVGLELDISAIRRTGKKA  62

Query  2283  LSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKL  2104
             L+IALAGISLPF LGIGTSF  RATI KG  QGPFLVFMGVALSITAFPVLARILAELKL
Sbjct  63    LAIALAGISLPFALGIGTSFAFRATIVKGAPQGPFLVFMGVALSITAFPVLARILAELKL  122

Query  2103  LTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPR  1924
             LTTD+G+MAMSAAAVNDVAAWILLALA+ALSG+G SP++SLWVLL  TGFV+   +++  
Sbjct  123   LTTDLGRMAMSAAAVNDVAAWILLALAVALSGSG-SPIVSLWVLLTATGFVIAVSVLLRP  181

Query  1923  IFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLAS  1744
             +  WMA+R  EGEPV EIY+CA LA VL AGF TD IGIHALFGAF++G++VPK+GP A 
Sbjct  182   VLAWMANRSPEGEPVKEIYICATLAIVLAAGFATDAIGIHALFGAFIVGIVVPKEGPFAG  241

Query  1743  ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVST  1564
              L+EK EDL+SGLFLPLYFVSSGLKTNVATIQGA+SWGLLVLVI  AC GKI GT++ S 
Sbjct  242   VLIEKTEDLISGLFLPLYFVSSGLKTNVATIQGAKSWGLLVLVIANACIGKIGGTVIASL  301

Query  1563  LCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI  1384
             + +IP +EA+TLGFLMNTKGLVELIVLNIGKDR VLND++FAIMVLMALFTTF+TTP+V+
Sbjct  302   VVKIPVREAVTLGFLMNTKGLVELIVLNIGKDRKVLNDESFAIMVLMALFTTFVTTPVVM  361

Query  1383  ALYKPAKLAVTEYKYRTIQ--RKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGF  1210
             A+YKPA+ +   YK RT++    D   +LR+L CFHS RNIP+L+NL+E+SRGT +S   
Sbjct  362   AIYKPARPS-APYKRRTVECGSADADSELRVLACFHSSRNIPTLLNLVESSRGTGRS-RL  419

Query  1209  KVYAMHLMELSERSSAILMCHKARKNGLPFW-NTRGEPTDSTEIVVAFETFEHLSKVSIR  1033
              +YAMHL+ELSERSSAI +  +AR+NG+PF+ N+ G      ++VVAFE F+ LS V + 
Sbjct  420   AMYAMHLVELSERSSAITLVQRARRNGMPFFSNSTGGSGKEEQMVVAFEAFQQLSAVRVN  479

Query  1032  PSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAP  853
             P TAIS + ++H D+I SA  KR A++I+P+HK  + DG F +  +    VN+RVL  AP
Sbjct  480   PMTAISDLDTIHRDVIDSAAEKRAAIVIMPYHKMLQHDGSFHSLGSAYHAVNKRVLREAP  539

Query  852   CSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFT  673
             CSV ILVDRGLGG + VSA NV ++++VL+FGG DDREALAY  RM EHPG+ + + RF+
Sbjct  540   CSVAILVDRGLGGHAQVSAKNVAFSVSVLFFGGADDREALAYATRMAEHPGVAVTLTRFS  599

Query  672   LD-PETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNS-SVKYEEKVVKSAAET  499
                P++   +   + +             E F +  +   + +  SV++EE     + + 
Sbjct  600   RSRPQSEEETAADEAAV------------EQFKSKLRAHGANDDGSVRFEE---PESGDA  644

Query  498   MEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
              EAI   ++CN+ VVGRMP  E    + ++ E  ELGP+G+ L+  E  T+ASVLV+++Y
Sbjct  645   KEAINALSKCNMFVVGRMPPTE---PLVERAE--ELGPVGSYLASPELKTSASVLVIKRY  699



>ref|XP_004963207.1| PREDICTED: cation/H(+) antiporter 19-like isoform X1 [Setaria 
italica]
Length=798

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/773 (60%), Positives = 579/773 (75%), Gaps = 34/773 (4%)
 Frame = -1

Query  2619  KATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGPS  2440
             K  S+G+FQG++PLDYALPL+I+QICLV+++TR LAYLLRPLRQPRVIAEIIGG+LLGPS
Sbjct  3     KVASHGAFQGENPLDYALPLIILQICLVLVVTRGLAYLLRPLRQPRVIAEIIGGILLGPS  62

Query  2439  AFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAGI  2260
             A GRS  +L+ +FP +S+TVLDTLA+LGLLFFLFLVGLELD  ++RRTG+KAL+I+L+GI
Sbjct  63    ALGRSTKFLHTVFPPESMTVLDTLANLGLLFFLFLVGLELDISAIRRTGRKALAISLSGI  122

Query  2259  SLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQm  2080
             +LPF LG+GTSF  RATI K     PFLVFMGVALSITAFPVLARIL ELKLLTTD+G+M
Sbjct  123   ALPFALGVGTSFAFRATIVKDAPHAPFLVFMGVALSITAFPVLARILTELKLLTTDLGRM  182

Query  2079  amsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMASR  1900
             A+SAAAV+DV AWILLALAIALSG+  SP+ISLWVLL    FV    L+V  +  WMA +
Sbjct  183   ALSAAAVDDVMAWILLALAIALSGSS-SPIISLWVLLTAAAFVAAAFLLVRPVLAWMARQ  241

Query  1899  CSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVED  1720
             C EGEPV E+YVCA LA VL  GF+TD IGIHALFG FV+GV+VPKDGP A  L+EKVED
Sbjct  242   CREGEPVKELYVCATLAIVLAGGFLTDVIGIHALFGGFVVGVVVPKDGPFAGMLIEKVED  301

Query  1719  LVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQE  1540
             LVSGLFLPLYFVSSGLKTNVATI GA+SWGLLVLVI  AC GKI G +  + L +IP +E
Sbjct  302   LVSGLFLPLYFVSSGLKTNVATISGAKSWGLLVLVIANACIGKIGGAVATALLVKIPVRE  361

Query  1539  AITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAKL  1360
             A+TLGFLMNTKGLVEL+VLNIG+DR VLND+ FAIMVLMALFTTFITTPIV+A+YKPA+ 
Sbjct  362   AVTLGFLMNTKGLVELVVLNIGRDRKVLNDEAFAIMVLMALFTTFITTPIVMAVYKPARP  421

Query  1359  AVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLMEL  1180
             +   YK RT+   D + +LR+L CFHS R++P+L+NL EASRGT +     VYAMHL+EL
Sbjct  422   S-APYKRRTVAGGDDADELRVLACFHSSRDVPTLLNLGEASRGTGRR-RLAVYAMHLVEL  479

Query  1179  SERSSAILMCHKARKNGLPFWNT--RGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMS  1006
             SERSSAI M  +AR+NG+PF+N+  RG+     ++VVAFE F+ LS V +R  TAIS + 
Sbjct  480   SERSSAITMVQRARRNGVPFFNSADRGD----GQLVVAFEAFQRLSSVRVRAMTAISDLD  535

Query  1005  SMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDR  826
             ++H D+I SA GKR A++++P+HK  + DG  ++  +    +N+RVL  APCSV ILVDR
Sbjct  536   TIHRDVIDSAAGKRAAIVVMPYHKALQPDGSLQSLGSVYHAINKRVLREAPCSVAILVDR  595

Query  825   GLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF-TLDPETAGT  649
             GLGG + VSA NV  ++  L+FGG DD EALAY  RM EHPG+ + +ARF T  P  +  
Sbjct  596   GLGGPAQVSAQNVSLSVAALFFGGPDDCEALAYATRMAEHPGVAVTLARFRTSRPPHSDE  655

Query  648   svkldvspsgssspeekSRDEDFLAAFKQR--NSTNSSVKYEEKVVKSAAETMEAIRGYN  475
                                DE  + AFK +     + SV++EE+   S  E +E+I    
Sbjct  656   EFAD---------------DEAAVEAFKSKVGGVKDGSVRFEEREGCSKEEVLESIGSLA  700

Query  474   RCNLLVVGRMPEGEIVAAMDKKGECP-ELGPLGNLLSCKEFSTTASVLVVQQY  319
             + N+ VVGRMP    +       E P ELGP+G+ L+  EF T+ASVLV+++Y
Sbjct  701   KSNVFVVGRMPPAPALV------ENPDELGPVGSYLASPEFRTSASVLVIKRY  747



>ref|XP_002886359.1| hypothetical protein ARALYDRAFT_315017 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62618.1| hypothetical protein ARALYDRAFT_315017 [Arabidopsis lyrata subsp. 
lyrata]
Length=836

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/836 (56%), Positives = 585/836 (70%), Gaps = 83/836 (10%)
 Frame = -1

Query  2649  NGTV---VCP---APMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQ  2488
             NGT+    CP   A MKATSNG F G+SPLD+A PL+I+QICLVV +TR LA+LLRP+RQ
Sbjct  6     NGTIPAMKCPKNVAMMKATSNGVFDGESPLDFAFPLVILQICLVVAVTRSLAFLLRPMRQ  65

Query  2487  PRVIAEII---------------------------GGVLLGPSAFGRSEAYLNAIFPKKS  2389
             PRV+AEII                           GG+LLGPSA GR  +Y N+IFP +S
Sbjct  66    PRVVAEIIVSLPSTGLGQSYSFRCTGIPFGLCPFLGGILLGPSALGRITSYKNSIFPARS  125

Query  2388  LTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAGISLPFGLGIGTSFILRAT  2209
             LTVLDTLA+LGLL FLFLVGLE+D  SLRRTGKKA+SIA AG+ LPFG+GI TSF     
Sbjct  126   LTVLDTLANLGLLLFLFLVGLEIDLTSLRRTGKKAISIAAAGMLLPFGMGIVTSFAFPEA  185

Query  2208  IAKGVSQG--PFLVFMGVALSITAFPVLARILAELKLLTTDVGQmamsaaavndvaawil  2035
              + G +    PF++FMGVALSITAF VLARILAELKLLTTD+G+++MSAAA+NDVAAW+L
Sbjct  186   SSSGDNSKVVPFIIFMGVALSITAFGVLARILAELKLLTTDLGRISMSAAAINDVAAWVL  245

Query  2034  lalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMASRCSEGEPVDEIYVCAI  1855
             LALA++LSG  +SPL+ LWVLL G  FV+ C L+VPRIFK +A RC EGEP+ E+YVC  
Sbjct  246   LALAVSLSGDRNSPLVPLWVLLSGIAFVIACFLIVPRIFKLIARRCPEGEPIGEMYVCVA  305

Query  1854  LAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVEDLVSGLFLPLYFVSSG  1675
             L +VL AGF TD IGIHA+FGAFV+GVL PK G  A A+VEK+EDLV GL LPLYFV SG
Sbjct  306   LCSVLIAGFATDAIGIHAIFGAFVMGVLFPK-GHFADAIVEKIEDLVMGLLLPLYFVMSG  364

Query  1674  LKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQEAITLGFLMNTKGLVE  1495
             LKT++ TIQG +SWG L LVI TACFGKI+GT+  + +C++  +E++ LG LMNTKGLVE
Sbjct  365   LKTDITTIQGVKSWGRLALVIVTACFGKIVGTVSAALVCKVGLRESVVLGVLMNTKGLVE  424

Query  1494  LIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAKLAVT------EYKYRT  1333
             LIVLNIGKDR VL+DQTFAIMVLMA+FTTFITTPIV+ LYKP++           YK R 
Sbjct  425   LIVLNIGKDRKVLSDQTFAIMVLMAIFTTFITTPIVLGLYKPSEATQMHSSVSYNYKNRK  484

Query  1332  IQRK-------DPSKQLRILTCFHSRRNIPSLINLIEASRGT-EKSGGFKVYAMHLMELS  1177
              +RK       + ++QL++L C  S ++I  ++ +IEA+RG+ E    F VY MHL +LS
Sbjct  485   YRRKIENDDEGEKTQQLKVLVCLQSSKDIDPMMKVIEATRGSNETKERFCVYVMHLTQLS  544

Query  1176  ERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMSSMH  997
             ER S+I M  KAR+NGLPFWN + E   S+ + VAFE    LS VS+R  TAIS +S++H
Sbjct  545   ERPSSIRMVQKARRNGLPFWNKKRE--TSSAVTVAFEASSKLSSVSVRSVTAISPLSTIH  602

Query  996   EDIIASAEGKRVAMIILPFHKHQK-IDGHFETTRNELRHVNRRVLEGAPCSVGILVDRGL  820
             EDI +SA+ KR   +ILPFHK  + ++  FET R+E + +N+RVLE +PCSVGILVDRGL
Sbjct  603   EDICSSADSKRATFVILPFHKQWRSLEREFETVRSEYQGINKRVLENSPCSVGILVDRGL  662

Query  819   GGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV--------ARFTLDP  664
             G     ++SN   ++ VL+FGG DDREAL YG RM EHPGI L V        +RF +  
Sbjct  663   GDN---NSSNFSLSVNVLFFGGCDDREALVYGLRMAEHPGINLTVVVISGLERSRFDILE  719

Query  663   ETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIR  484
                 +   +               DE FLAA K+R    ++ ++EE+ V+S  E +E IR
Sbjct  720   AQETSIYSV---------------DEQFLAAIKKR---ANATRFEERTVESTEEVVEIIR  761

Query  483   GYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
              +  C+LL+VGR  +G +V+ +   K ECPELG +GNL+   E ST+ SVLVVQQY
Sbjct  762   KFCECDLLLVGRSSKGTMVSRLTVMKIECPELGSVGNLIVSNEISTSVSVLVVQQY  817



>ref|NP_001159300.1| uncharacterized protein LOC100304392 [Zea mays]
 gb|ACN25719.1| unknown [Zea mays]
 tpg|DAA47523.1| TPA: hypothetical protein ZEAMMB73_566840 [Zea mays]
Length=795

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/791 (59%), Positives = 583/791 (74%), Gaps = 42/791 (5%)
 Frame = -1

Query  2619  KATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGPS  2440
             K  SNG+FQGD+PLD+ALPL+I+QICLV+++TR LAYLLRPLRQPRVIAEIIGG+LLGPS
Sbjct  3     KVASNGAFQGDNPLDFALPLIILQICLVLVVTRGLAYLLRPLRQPRVIAEIIGGILLGPS  62

Query  2439  AFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAGI  2260
             A GRS  +L+ +FP  S+TVLDTLA+LGLLFFLFLVGLELD  ++RRTG+KAL+I+L+GI
Sbjct  63    ALGRSTKFLHTVFPPASMTVLDTLANLGLLFFLFLVGLELDIAAIRRTGRKALAISLSGI  122

Query  2259  SLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQm  2080
             +LPF LG+GTSF  RAT+ K     PFLVFMGVALSITAFPVLARIL ELKLLTTD+G++
Sbjct  123   ALPFALGVGTSFAFRATVVKDARHAPFLVFMGVALSITAFPVLARILTELKLLTTDLGRL  182

Query  2079  amsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMASR  1900
             A+SAAAV+DV AWILLALAIALSG+G SP++SLWVLL    FV    L++     WMA R
Sbjct  183   ALSAAAVDDVMAWILLALAIALSGSG-SPIVSLWVLLTAAAFVAAAFLLLKPALAWMARR  241

Query  1899  CSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVED  1720
             C +GEP+ E++VCA LA VL AGFVTD IGIHALFG FV+GV+VPKDGP A  L+EKVED
Sbjct  242   CRDGEPIKELHVCATLAIVLAAGFVTDVIGIHALFGGFVVGVVVPKDGPFAGMLIEKVED  301

Query  1719  LVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQE  1540
             LVSGLFLPLYFVSSGLKTNVATI GA+SWGLLVLVI  AC GKI G +  + L +IP +E
Sbjct  302   LVSGLFLPLYFVSSGLKTNVATISGAKSWGLLVLVIANACIGKIGGAVATALLVKIPVRE  361

Query  1539  AITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAKL  1360
             A+TLGFLMNTKGLVEL+VLNIG+DR VLND+ FAIMVLMALFTTFITTPIV+A+YKPA+ 
Sbjct  362   AVTLGFLMNTKGLVELVVLNIGRDRKVLNDEAFAIMVLMALFTTFITTPIVMAVYKPARP  421

Query  1359  AVTEYKYRTIQ----RKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMH  1192
             +V  YK RT+           +LR+L CFH+ R+IP+L+NL+EASRGT +     +YAMH
Sbjct  422   SV-PYKRRTVDCAPGDAAADGELRVLACFHTSRSIPTLLNLVEASRGTGRR-RLVMYAMH  479

Query  1191  LMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISA  1012
             L+ELSERSSA+ M  +AR+NGLPF+N+        ++VVAFE F+ LS V +R  TAIS 
Sbjct  480   LVELSERSSAVTMVQRARRNGLPFFNSADR---EGQMVVAFEAFQQLSSVRVRAMTAISD  536

Query  1011  MSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILV  832
             + ++H D+I SA GKR A++++P+HK  + DG F++  +    VN+RVL  APCSV +LV
Sbjct  537   LDTIHRDVIDSAAGKRAAIVVMPYHKALQQDGSFQSLGSAYHAVNKRVLREAPCSVAVLV  596

Query  831   DRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFT--LDPET  658
             DRGLGG + VSA NV +++ +L+FGG DDREALAY  RM EHPG+ + +ARF    D E+
Sbjct  597   DRGLGGPAQVSAKNVSFSVAMLFFGGPDDREALAYVTRMAEHPGVAVTLARFRPHSDEES  656

Query  657   AGTsvkldvspsgssspeekSRDEDFLAAFKQRNS---TNSSVKYEEKVVKSAAETMEAI  487
             A                     DE  + AFK +      + SV +EE+   +  E +E I
Sbjct  657   AD--------------------DEAAVDAFKSKVDGMVKDGSVHFEERQGYTKEEVVETI  696

Query  486   RGYNRCNLLVVGRMPE-GEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQYRTE  310
                ++ N+ VVGRMP    +V   D      ELGP+G+ L+  E  T+ASVLV+++Y   
Sbjct  697   DSLSKVNVFVVGRMPPTAPLVENPD------ELGPVGSYLASPESRTSASVLVIKRYDPA  750

Query  309   LSKNGLKEDDS  277
              +    + D S
Sbjct  751   TNPKSKRFDPS  761



>ref|XP_003607437.1| Cation proton exchanger [Medicago truncatula]
Length=1198

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/680 (62%), Positives = 511/680 (75%), Gaps = 18/680 (3%)
 Frame = -1

Query  2319  DPKSLRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAF  2140
             D +S+R+TG KAL IALAGI++PF LGIGTS +LRATI K  +   FLVFMGVALSITAF
Sbjct  492   DMRSIRKTGSKALCIALAGITVPFVLGIGTSLVLRATINKDANPTSFLVFMGVALSITAF  551

Query  2139  PVLARILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGT  1960
             PVLARILAELKLLTTDVG+MAMSAAAVNDVAAWILLALA+ALSG   SPL+SLWVLLCG 
Sbjct  552   PVLARILAELKLLTTDVGRMAMSAAAVNDVAAWILLALAVALSGANTSPLVSLWVLLCGV  611

Query  1959  GFVLLCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVI  1780
             GF+L  I  +  +   MA RC EGEPV EIY+C  L  VLG  F+TDTIGIHALFGAFV 
Sbjct  612   GFILFVIFAIKPLLAIMAKRCPEGEPVKEIYICITLTLVLGCSFLTDTIGIHALFGAFVA  671

Query  1779  GVLVPKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTAC  1600
             G++VPK+GP AS L EK+EDLV  L LPLYFVSSGLKTNVATI GA SWGLL+LVIFTAC
Sbjct  672   GIVVPKEGPFASILTEKIEDLVMSLLLPLYFVSSGLKTNVATISGALSWGLLILVIFTAC  731

Query  1599  FGKILGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMA  1420
             FGK++GT++VS LC+IPF+EA+TLGFLMNTKGLVELIVLNIGKDR VL+DQ FAI V+MA
Sbjct  732   FGKVVGTLVVSLLCKIPFREALTLGFLMNTKGLVELIVLNIGKDRKVLSDQAFAICVVMA  791

Query  1419  LFTTFITTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEA  1240
             L TTFITTPIV+A+YKPA+   + Y ++TIQRKDP  +LRIL CFHS  NIP+LINLIE+
Sbjct  792   LVTTFITTPIVMAVYKPARRG-SPYMHKTIQRKDPDTELRILACFHSTYNIPTLINLIES  850

Query  1239  SRGTEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETF  1060
             SRGT K G   +YAMHLMELSER SAI M HKAR NGLPFWN + +  +  ++V+AF+ +
Sbjct  851   SRGTRKRGKLCIYAMHLMELSERPSAITMVHKARNNGLPFWNKK-QHDNKDQMVIAFQAY  909

Query  1059  EHLSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHV  880
              HLS V++R  TAIS+++++HEDI +SA  KRVAMI+LPFHKHQ++DG  E+  +  R +
Sbjct  910   GHLSSVNVRSMTAISSLNNIHEDICSSAHQKRVAMILLPFHKHQRVDGTMESLGHSFRVM  969

Query  879   NRRVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPG  700
             N  VL  APCSVGILVDRGLGGT+ V AS+V Y + V +FGG DDREALAYG R+ EHPG
Sbjct  970   NGLVLSHAPCSVGILVDRGLGGTTQVHASDVSYNVVVAFFGGCDDREALAYGMRIAEHPG  1029

Query  699   ICLVVARFTLDPE------------TAGTsvkldvspsgssspeekSRDEDFLAAFKQR-  559
             I L V +F   P             TA    K+     G++  E+K  D+ F + F    
Sbjct  1030  ISLTVLKFITPPGKTLAFGAKLIGITADRDRKVIKVSDGNTPDEDKQEDDQFWSEFLGVC  1089

Query  558   NSTNSSVKYEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMDKKGECPELGPLG  379
               +  S+ YEE++V+S  + +  +   N+ NL++ GRMP    VA +    +C ELGP+G
Sbjct  1090  CKSEESIVYEERLVESKEDIVTVLSERNKSNLILAGRMPP---VAPLLDGSDCAELGPVG  1146

Query  378   NLLSCKEFSTTASVLVVQQY  319
             + L+  EFST ASV++ QQY
Sbjct  1147  SYLASSEFSTFASVIIFQQY  1166



>gb|EMT05571.1| K(+)/H(+) antiporter 1 [Aegilops tauschii]
Length=739

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/651 (66%), Positives = 517/651 (79%), Gaps = 8/651 (1%)
 Frame = -1

Query  2619  KATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGPS  2440
             K  S+G+FQG+SPLDYALPL+I+QICLV+++TR LAYLLRPLRQPRVIAEIIGG+LLGPS
Sbjct  7     KVASHGAFQGESPLDYALPLIILQICLVIVVTRGLAYLLRPLRQPRVIAEIIGGILLGPS  66

Query  2439  AFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAGI  2260
             A GRS  +L+A+FP +S+ VLDTLA+LGLLFFLFLVGLELD  ++RRTGKKAL+I+L+GI
Sbjct  67    ALGRSTTFLDAVFPARSMVVLDTLANLGLLFFLFLVGLELDLNAIRRTGKKALAISLSGI  126

Query  2259  SLPFGLGIGTSFILRATIA--KGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVG  2086
             ++PF +GIGTSF  RAT+   +   + PFLVFMGVALSITAFP LARIL ELKLLTT +G
Sbjct  127   AVPFAIGIGTSFAFRATLPGLQDSPKAPFLVFMGVALSITAFPALARILTELKLLTTGLG  186

Query  2085  QmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMA  1906
             +MAMSAAAV+DV AWILLALAIALSGTG SP+ISLWVLL   GFV    +++  +  WMA
Sbjct  187   RMAMSAAAVDDVTAWILLALAIALSGTG-SPIISLWVLLTAVGFVAAVFVLLRPLLAWMA  245

Query  1905  SRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKV  1726
              R  EGEPV E+Y+ A LA VL AGFVTD IGIHALFGAF++G++VPKDG  A  L+EKV
Sbjct  246   RRSPEGEPVKEVYIVATLALVLAAGFVTDVIGIHALFGAFMVGIVVPKDGQFAGVLIEKV  305

Query  1725  EDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPF  1546
             E+L+SGLFLPLYFVSSGLKTNVATI+GA+SWGLLVLVI  AC GKI G +    L +IPF
Sbjct  306   EELISGLFLPLYFVSSGLKTNVATIRGAKSWGLLVLVILNACVGKIGGAVGTCLLVKIPF  365

Query  1545  QEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPA  1366
             +EAIT+GFLMNTKGLVEL+VLNIG+DR VLND+ FAIMVLMALFTTFITTPIV+A+YKPA
Sbjct  366   REAITIGFLMNTKGLVELVVLNIGRDRKVLNDEAFAIMVLMALFTTFITTPIVMAVYKPA  425

Query  1365  K-LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHL  1189
             +  A   YK RT+   D    LR+L CFH  RNIP+L+NL+E SRGT +     VYAMHL
Sbjct  426   RPSASVPYKRRTVGGGDEDGDLRVLACFHGYRNIPTLLNLVELSRGTRRR--LVVYAMHL  483

Query  1188  MELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAM  1009
             +ELSERSSAI M H+ R+N LPF++       +TE  VAFE F+ LS V +RP TAIS M
Sbjct  484   VELSERSSAISMVHRTRRNALPFFSNASSSETTTE--VAFEAFQQLSTVRVRPMTAISVM  541

Query  1008  SSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVD  829
              ++H DII SA  KR A++I+P+HK  + DG F +  +    VN+RVL  APCSV ILVD
Sbjct  542   DTIHRDIIDSAASKRAAVVIVPYHKTLQADGSFHSLGSAYHAVNKRVLREAPCSVAILVD  601

Query  828   RGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF  676
             RGLGG S V+A NV +T+ VL+FGG DDREALAY  RM EHPG+ + ++RF
Sbjct  602   RGLGGHSQVAAQNVAFTVAVLFFGGPDDREALAYATRMAEHPGVAVTMSRF  652



>ref|XP_010533612.1| PREDICTED: cation/H(+) antiporter 16 [Tarenaya hassleriana]
Length=847

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/806 (56%), Positives = 578/806 (72%), Gaps = 27/806 (3%)
 Frame = -1

Query  2664  EIMGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQP  2485
             E MGS     CP  MKATSNG F G+SPL++ALPL+I+QICLV+ LTR+L++LLRP RQP
Sbjct  38    EKMGS-----CPPAMKATSNGVFGGESPLEFALPLVILQICLVLFLTRLLSFLLRPFRQP  92

Query  2484  RVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSL  2305
             RV+AEI+ G+LLGPSA GR  AY  A+FP +S+TVL+T+A++GL+FFLFL GLE+D  SL
Sbjct  93    RVVAEILSGILLGPSALGRIAAYKVAVFPARSITVLETIANIGLIFFLFLTGLEIDLPSL  152

Query  2304  RRTGKKALSIALAGISLPFGLGIGTS--FILRATIAKGVSQGPFLVFMGVALSITAFPVL  2131
             RRTGK + +IA  G+ LPF +G+ +S  F   ++   G ++  F+VFMGVA+SITAF VL
Sbjct  153   RRTGKISSAIAAVGMILPFAIGVASSLAFPEYSSGGDGGNRVAFVVFMGVAVSITAFGVL  212

Query  2130  ARILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFV  1951
             ARILAELKLLTTD+G++AMSAAA+NDVAAW++LALA+AL+G   SP + +WVLL G  FV
Sbjct  213   ARILAELKLLTTDLGRIAMSAAALNDVAAWVVLALAVALAGDKSSPFVPVWVLLSGFAFV  272

Query  1950  LLCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVL  1771
             + C+L+VP  F +++ RC EG+ VDE YVC  LA VL AGF TD IG+HA+FGAFVIGVL
Sbjct  273   IACVLIVPPFFSFVSRRCEEGQSVDETYVCGALAVVLIAGFTTDAIGVHAIFGAFVIGVL  332

Query  1770  VPKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGK  1591
              PK G  A A+VEK+ED+V+GL LPLYFV SGLKT++ TI+G +SWG L+L I TAC GK
Sbjct  333   FPK-GYFADAIVEKMEDIVTGLLLPLYFVLSGLKTDITTIRGLESWGRLLLAIATACIGK  391

Query  1590  ILGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFT  1411
             ++GT+ VS LC++PF E++ LG LMNTKGL ELIVLNIGKDR VL DQTFAIMVLMA+FT
Sbjct  392   VVGTVGVSLLCKLPFGESLALGVLMNTKGLTELIVLNIGKDRKVLGDQTFAIMVLMAIFT  451

Query  1410  TFITTPIVIALYKPAKLAVTEYK-------YRTIQRKDPSK-QLRILTCFHSRRNIPSLI  1255
             TFITTPIV+A YKPA+   T+          R ++R D  K QLR++ C H  R+I  +I
Sbjct  452   TFITTPIVLAFYKPARTTQTQESDVSGSACERKMERDDGVKTQLRLMLCLHGTRDINPMI  511

Query  1254  NLIEASRGTE-KSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWN-TRGEPTDSTEI  1081
             N+IEASRGTE KS G  VYAMH+ ELSER S+I M HKAR+NG   WN T G  +D+  +
Sbjct  512   NIIEASRGTEVKSRGLCVYAMHITELSERPSSIRMVHKARRNGFLSWNKTSGSNSDT--V  569

Query  1080  VVAFETFEHLSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQK-IDGHFET  904
              +AFE F  LS+VS+R  TAIS +S++HEDI +SA  KRVAM+ILPF KH K ++  FE 
Sbjct  570   AIAFEAFGRLSRVSVRSVTAISPLSTIHEDICSSAARKRVAMVILPFSKHWKPLEKAFEM  629

Query  903   TRNELRHVNRRVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYG  724
              R E + +N RVLE +PCSVGIL DRGLG  S  +AS    +I VL+FGG DDREALAYG
Sbjct  630   VRPEFQTINMRVLENSPCSVGILADRGLGIDSPATASKFSSSIAVLFFGGCDDREALAYG  689

Query  723   ARMVEHPGICLVVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNS  544
              RMVEHPG+ L V   T D     + + +       S  +    D   +A   +   T +
Sbjct  690   LRMVEHPGVSLTVVTITGDFRLENSRIDILEEQETMSRSQS---DSQVIAGVDKMAMTGT  746

Query  543   -SVKYEEKVVKSAAETMEAIRGYNR-CNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNL  373
              SVK  +K VKS+ E +E  R   R  +++ VGR PE  +V+++  KK ECPELGP+GNL
Sbjct  747   KSVKLVKKSVKSSDEAVEIFRESCRSVDIVFVGRSPESSVVSSLPVKKMECPELGPVGNL  806

Query  372   LSCKEFSTTASVLVVQQYRTELSKNG  295
             +   E S + SVL VQQ+  + S  G
Sbjct  807   MLSNEISNSVSVLAVQQFTGKASSGG  832



>gb|EMS54713.1| Cation/H(+) antiporter 19 [Triticum urartu]
Length=808

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/705 (62%), Positives = 530/705 (75%), Gaps = 45/705 (6%)
 Frame = -1

Query  2691  SAGFLRFSAEIMGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLA  2512
             S G+     E M   G        K  S+G+FQG++PLDYALPL+I+QICLV+++TR LA
Sbjct  14    SGGYTFTGGEKMAGGGA-------KVASHGAFQGENPLDYALPLIILQICLVIVVTRGLA  66

Query  2511  YLLRPLRQPRVIAEIIG-----------------------------GVLLGPSAFGRSEA  2419
             YLLRPLRQPRVIAEIIG                             G+LLGPSA GRS  
Sbjct  67    YLLRPLRQPRVIAEIIGRRHRIRGWVVRGWAPKDGLTQEAAWGDEGGILLGPSALGRSTT  126

Query  2418  YLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAGISLPFGLG  2239
             +L+A+FP +S+ VLDTLA+LGLLFFLFLVGLELD  ++RRTGKKAL+I+L+GI++PF +G
Sbjct  127   FLDAVFPARSMVVLDTLANLGLLFFLFLVGLELDLNAIRRTGKKALAISLSGIAVPFAIG  186

Query  2238  IGTSFILRATIA--KGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQmamsaa  2065
             IGTSF  RAT+   +   + PFLVFMGVALSITAFPVLARIL ELKLLTTD+G+MAMSAA
Sbjct  187   IGTSFAFRATLPGLQDSPKAPFLVFMGVALSITAFPVLARILTELKLLTTDLGRMAMSAA  246

Query  2064  avndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMASRCSEGE  1885
             AV+DV AWILLALAIALSGTG SP+ISLWVLL   GFV    +++  +  WMA R  EGE
Sbjct  247   AVDDVTAWILLALAIALSGTG-SPIISLWVLLTAVGFVAAVFVLLRPLLAWMARRSPEGE  305

Query  1884  PVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVEDLVSGL  1705
             PV E+Y+ A LA VL AGFVTD IGIHALFGAF++G++VPKDGP A  L+EKVE+L+SGL
Sbjct  306   PVKEVYIVATLALVLAAGFVTDVIGIHALFGAFMVGIVVPKDGPFAGVLLEKVEELISGL  365

Query  1704  FLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQEAITLG  1525
             FLPLYFVSSGLKTNVATI+GA+SWGLLVLVI  AC GKI G +    L +IPF+EAIT+G
Sbjct  366   FLPLYFVSSGLKTNVATIRGAKSWGLLVLVILNACVGKIGGAVGTCLLVKIPFREAITIG  425

Query  1524  FLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAKLAVT-E  1348
             FLMNTKGLVEL+VLNIG+DR VLND+ FAIMVLMALFTTFITTPIV+A+YKPA+ + +  
Sbjct  426   FLMNTKGLVELVVLNIGRDRKVLNDEAFAIMVLMALFTTFITTPIVMAVYKPARPSASLP  485

Query  1347  YKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLMELSERS  1168
             YK RT+   D   +LR+L CFH  RNIP+L+NL+E SRGT +     VYAMHL+ELSERS
Sbjct  486   YKRRTVGGDDVDGELRVLACFHGYRNIPTLLNLVELSRGTRRR--LVVYAMHLVELSERS  543

Query  1167  SAILMCHKARKNGLPFW-NTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMSSMHED  991
             SAI M H+ R+N LPF+ N R     +TE  VAFE F+ LS V +RP TAIS + ++H D
Sbjct  544   SAISMVHRTRRNALPFFSNNRSSSETTTE--VAFEAFQQLSTVRVRPMTAISVLDTIHRD  601

Query  990   IIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDRGLGGT  811
             II SA  KR A++I+P+HK  + DG F +  +    VN+RVL  APCSV ILVDRGLGG 
Sbjct  602   IIDSAASKRAAVVIVPYHKTLQADGSFHSLGSAYHAVNKRVLREAPCSVAILVDRGLGGH  661

Query  810   SHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF  676
             S V+A NV +T++VL+FGG DDREALAY  RM EHPG+ + ++RF
Sbjct  662   SQVAAQNVAFTVSVLFFGGPDDREALAYATRMAEHPGVAVTMSRF  706



>ref|XP_001773370.1| predicted protein [Physcomitrella patens]
 gb|EDQ61743.1| predicted protein [Physcomitrella patens]
Length=798

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/781 (55%), Positives = 553/781 (71%), Gaps = 12/781 (2%)
 Frame = -1

Query  2649  NGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAE  2470
             N TV     M A+SNG +QGD P+ +ALPLLI+QIC+V+ +TRVLA L +PL+QPRVIAE
Sbjct  5     NATVTTCKTMPASSNGVWQGDIPIHFALPLLIIQICIVLTITRVLAALFKPLKQPRVIAE  64

Query  2469  IIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGK  2290
             ++GG+LLGPSA G++ AY+  IFPK+S+ +L+  A +GL+FFLF+VGLELD + +RRTG 
Sbjct  65    VVGGILLGPSALGKNTAYIANIFPKQSVIILEVFAQMGLIFFLFMVGLELDIRQIRRTGF  124

Query  2289  KALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAEL  2110
             +AL I+ AGI++PF  G+G SF+L  TIA  V  GPF+VFMGVA+SITAFPVLARILAE 
Sbjct  125   QALVISAAGIAVPFSTGVGVSFVLLNTIAGDVKFGPFVVFMGVAMSITAFPVLARILAER  184

Query  2109  KLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVV  1930
             KLLTT+VGQ+AMS AAV+DV AW LLALA+AL+GT   P +  WVLL G  F++   +VV
Sbjct  185   KLLTTEVGQLAMSVAAVDDVVAWCLLALAVALTGTNTKPSVVAWVLLTGIAFIITMFVVV  244

Query  1929  PRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPL  1750
               + +W+A+R ++ EPV EI VC   A VL A F TD IGIHA+FGAF+ G++VPKDGP 
Sbjct  245   QPVMRWVATRSADNEPVKEILVCLTFAGVLIAAFTTDLIGIHAIFGAFLFGLIVPKDGPF  304

Query  1749  ASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILV  1570
             A ALVEK+ED +S L LPLYF SSGLKTN+  I+  QS+GLLVLVI  ACFGK+ G  L 
Sbjct  305   AVALVEKIEDFISILMLPLYFASSGLKTNIGAIKTGQSFGLLVLVIAVACFGKMCGVFLA  364

Query  1569  STLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPI  1390
             +T  ++  ++A+TLG LMNTKGLVELIVLNIGKDRGVLN++TFAIMVLMAL TTF+TTP+
Sbjct  365   ATASKVNPRKALTLGVLMNTKGLVELIVLNIGKDRGVLNEETFAIMVLMALVTTFMTTPL  424

Query  1389  VIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGF  1210
             V+ALYKPA+  +  Y  R +  +D    LRIL+C H  +N+P++INL E +RG  K    
Sbjct  425   VMALYKPARNPI-PYNRRKLAMEDSKDDLRILSCVHGMKNVPAMINLTEGTRGIRKR-AL  482

Query  1209  KVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRP  1030
             ++Y +HLMELSER+SAI++  +ARK+G PF+N R       +IV AFET+ HLSKV++RP
Sbjct  483   RLYILHLMELSERTSAIMIVQRARKDGRPFFNQRKSAESRDQIVAAFETYGHLSKVTVRP  542

Query  1029  STAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPC  850
              TAIS    MHEDI A+A  KR AMIILPFHK Q++DG F+TT    R VN++VL+ APC
Sbjct  543   MTAISNFEDMHEDICATATDKRAAMIILPFHKTQRLDGQFDTTAPGFRLVNQKVLQHAPC  602

Query  849   SVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTL  670
             SV IL+DRG+GG++ V+ +NVD+ + V +FGG DDREALAYG RM EHPGI L V RF  
Sbjct  603   SVAILIDRGVGGSAQVAPNNVDHKVVVYFFGGQDDREALAYGLRMAEHPGIQLHVIRFLN  662

Query  669   DPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETM--  496
                 A  ++  D       +  +  R  +        +  +S V +EE  V    E +  
Sbjct  663   RYHIATGALDQDQERKLDEAALDGIRKGE--KGKVDADEVHSKVSWEECRVADPFEAVVQ  720

Query  495   EAIRGYNRCNLLVVG--RMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQ  322
              AI G +  N+++VG  R P   + + + +  E  ELGPLG  L   E    ASVLV QQ
Sbjct  721   AAIAGDH--NIILVGRSRRPTAFVGSMVHRHPEYTELGPLGEALMAPE--VRASVLVFQQ  776

Query  321   Y  319
             Y
Sbjct  777   Y  777



>gb|AAF24561.1|AC007764_3 F22C12.7 [Arabidopsis thaliana]
Length=868

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/732 (58%), Positives = 535/732 (73%), Gaps = 30/732 (4%)
 Frame = -1

Query  2463  GGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKA  2284
             GG+LLGPSA GR  +Y N+IFP +SLTVLDTLA+LGLL FLFLVGLE+D  SLRRTGKKA
Sbjct  131   GGILLGPSALGRITSYKNSIFPARSLTVLDTLANLGLLLFLFLVGLEIDLTSLRRTGKKA  190

Query  2283  LSIALAGISLPFGLGIGTSFILRATIAKGVSQG--PFLVFMGVALSITAFPVLARILAEL  2110
             +SIA AG+ LPFG+GI TSF      + G +    PF++FMGVALSITAF VLARILAEL
Sbjct  191   ISIAAAGMLLPFGMGIVTSFAFPEASSSGDNSKVLPFIIFMGVALSITAFGVLARILAEL  250

Query  2109  KLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVV  1930
             KLLTTD+G+++M+AAA+NDVAAW+LLALA++LSG  +SPL+ LWVLL G  FV+ C L+V
Sbjct  251   KLLTTDLGRISMNAAAINDVAAWVLLALAVSLSGDRNSPLVPLWVLLSGIAFVIACFLIV  310

Query  1929  PRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPL  1750
             PRIFK+++ RC EGEP+ E+YVC  L AVL AGF TD IGIHA+FGAFV+GVL PK G  
Sbjct  311   PRIFKFISRRCPEGEPIGEMYVCVALCAVLLAGFATDAIGIHAIFGAFVMGVLFPK-GHF  369

Query  1749  ASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILV  1570
             + A+VEK+EDLV GL LPLYFV SGLKT++ TIQG +SWG L LVI TACFGKI+GT+ V
Sbjct  370   SDAIVEKIEDLVMGLLLPLYFVMSGLKTDITTIQGVKSWGRLALVIVTACFGKIVGTVSV  429

Query  1569  STLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPI  1390
             + LC++  +E++ LG LMNTKGLVELIVLNIGKDR VL+DQTFAIMVLMA+FTTFITTPI
Sbjct  430   ALLCKVRLRESVVLGVLMNTKGLVELIVLNIGKDRKVLSDQTFAIMVLMAIFTTFITTPI  489

Query  1389  VIALYKPAKLAVTE----YKYRTIQRK-------DPSKQLRILTCFHSRRNIPSLINLIE  1243
             V+ALYKP++   T     YK R  +RK       +  +QL++L C  S ++I  ++ ++E
Sbjct  490   VLALYKPSETTQTHSSVSYKNRKHRRKIENDEEGEKMQQLKVLVCLQSSKDIDPMMKIME  549

Query  1242  ASRGT-EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFE  1066
             A+RG+ E    F VY MHL +LSER S+I M  K R NGLPFWN + E  +S+ + VAFE
Sbjct  550   ATRGSNETKERFCVYVMHLTQLSERPSSIRMVQKVRSNGLPFWNKKRE--NSSAVTVAFE  607

Query  1065  TFEHLSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQK-IDGHFETTRNEL  889
                 LS VS+R  TAIS +S++HEDI +SA+ K  A +ILPFHK  + ++  FET R+E 
Sbjct  608   ASSKLSSVSVRSVTAISPLSTIHEDICSSADSKCTAFVILPFHKQWRSLEKEFETVRSEY  667

Query  888   RHVNRRVLEGAPCSVGILVDRGLG-GTSHVSASNVDYTITVLYFGGHDDREALAYGARMV  712
             + +N+RVLE +PCSVGILVDRGLG   S V++SN   ++ VL+FGG DDREAL YG RM 
Sbjct  668   QGINKRVLENSPCSVGILVDRGLGDNNSPVASSNFSLSVNVLFFGGCDDREALVYGLRMA  727

Query  711   EHPGICLVVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKY  532
             EHPG+ L V   +  PE+A            +      S DE FLAA K+R    ++ ++
Sbjct  728   EHPGVNLTVVVIS-GPESA------RFDRLEAQETSLCSLDEQFLAAIKKR---ANAARF  777

Query  531   EEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLLSCKEF  355
             EE+ V S  E +E IR +  C++L+VG+  +G +V+ +   K ECPELGP+GNL+   E 
Sbjct  778   EERTVNSTEEVVEIIRQFYECDILLVGKSSKGPMVSRLPVMKIECPELGPVGNLIVSNEI  837

Query  354   STTASVLVVQQY  319
             ST+ SVLVVQQY
Sbjct  838   STSVSVLVVQQY  849


 Score = 68.2 bits (165),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 61/84 (73%), Gaps = 10/84 (12%)
 Frame = -1

Query  2649  NGTV---VCP---APMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQ  2488
             NGT+    CP   A MK TSNG F G+SPLD+A PL+I+QICLVV +TR LA+LLRP+RQ
Sbjct  6     NGTIPAMKCPKNVAMMKTTSNGVFDGESPLDFAFPLVILQICLVVAVTRSLAFLLRPMRQ  65

Query  2487  PRVIAEIIGGVLLGPSAFGRSEAY  2416
             PRV+AEII    + P + G  ++Y
Sbjct  66    PRVVAEII----VSPPSTGLGQSY  85



>ref|XP_001770267.1| predicted protein [Physcomitrella patens]
 gb|EDQ64942.1| predicted protein [Physcomitrella patens]
Length=700

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/649 (62%), Positives = 503/649 (78%), Gaps = 3/649 (0%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             M ATSNG +QGD P+ +ALPLLIVQI LV+ +TR LA++L+PL+QPRV+AEIIGG+LLGP
Sbjct  1     MSATSNGVWQGDVPVHFALPLLIVQIVLVLAITRALAFVLKPLKQPRVVAEIIGGILLGP  60

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SAFGR++ YL+ IFP +S+ +L+  A +GLLFFLF+VGLELD   +R+TGK+A+SIA AG
Sbjct  61    SAFGRNKDYLHTIFPHESVIILEVFADMGLLFFLFMVGLELDMTQIRKTGKQAMSIAAAG  120

Query  2262  ISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQ  2083
             I+LPF  G+G SF+L  TIA   + GPFLVFMGVA+SITAFPVLARILAE KLLTT+VGQ
Sbjct  121   ITLPFVAGVGVSFVLHLTIAPEGAFGPFLVFMGVAMSITAFPVLARILAERKLLTTEVGQ  180

Query  2082  mamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMAS  1903
             +AMSAAAVNDV AW+LLALA+ALSG+G SP I  WVLLCG  F L   LVV    +W+A 
Sbjct  181   LAMSAAAVNDVVAWVLLALAVALSGSGRSPAIVAWVLLCGIAFCLAIFLVVQPCMQWVAH  240

Query  1902  RCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVE  1723
             R  + EPV E  V   L  VL AGF TD IG+H++FGAF+ G+++PK+GP A+ALVEK+E
Sbjct  241   RSPDNEPVKEYIVALTLLCVLVAGFCTDAIGVHSIFGAFLFGLVIPKEGPFAAALVEKLE  300

Query  1722  DLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQ  1543
             D VS L LPLYF SSGLKTN+  I  AQS+GLLVLVI  AC GKILGT   +  CR+  +
Sbjct  301   DFVSILLLPLYFASSGLKTNIGAIHSAQSFGLLVLVISVACLGKILGTFAAAKACRVDAR  360

Query  1542  EAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAK  1363
             +A+TLG LMNTKGLVELIVLNIG DRGVLN +TFAIMVLMALFTTF+TTP+V+A+YKPA+
Sbjct  361   KALTLGILMNTKGLVELIVLNIGLDRGVLNSETFAIMVLMALFTTFMTTPLVMAIYKPAR  420

Query  1362  LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLME  1183
                T Y  RT++ +D    LRIL+C H  +N+ ++INL EA+RG  K    ++Y +HLME
Sbjct  421   -NPTPYTRRTLEMEDSKDDLRILSCVHGMKNVAAMINLTEATRGMRKR-TLRLYILHLME  478

Query  1182  LSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMSS  1003
             LSER+SAI++  +AR+NG PF+N      +  +IV AFET+E LSKV++RP TAIS    
Sbjct  479   LSERTSAIMIVQRARRNGRPFFNQSKHSDNKDQIVAAFETYEQLSKVTVRPMTAISGFDD  538

Query  1002  MHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDRG  823
             MHEDI A+A  KR A+I+LPFHK  ++DGHF++T    R VN++VL+ APCSV IL+DRG
Sbjct  539   MHEDICATAADKRTALIMLPFHKSPRLDGHFDSTPG-FRTVNQKVLKHAPCSVAILIDRG  597

Query  822   LGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF  676
             +GG++ V +SNVD+ + V +FGG DDREALAYG RM EHPG+ L V RF
Sbjct  598   VGGSAQVPSSNVDHNVVVYFFGGPDDREALAYGFRMAEHPGVKLHVIRF  646



>ref|XP_010227421.1| PREDICTED: cation/H(+) antiporter 19-like [Brachypodium distachyon]
Length=760

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/722 (60%), Positives = 534/722 (74%), Gaps = 21/722 (3%)
 Frame = -1

Query  2463  GGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKA  2284
             GG+LLGPSA GRS+ +L+ +FP++SLTVLDTLA++GLLFFLFLVGLELDP SL+RTG+ A
Sbjct  3     GGMLLGPSALGRSKMFLDNVFPRESLTVLDTLANIGLLFFLFLVGLELDPASLKRTGRSA  62

Query  2283  LSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKL  2104
             L+IA+AGISLPF LG+G+S +LR  +A    +GPF+VFMGVALSITAFPVLARILAELKL
Sbjct  63    LAIAVAGISLPFSLGVGSSLVLRDAVAPDAPRGPFIVFMGVALSITAFPVLARILAELKL  122

Query  2103  LTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPR  1924
             LTT++G+MAMSAAAVNDV AWILLALAIALSG+G SPL S++VLL G  FV   +L+V  
Sbjct  123   LTTELGRMAMSAAAVNDVTAWILLALAIALSGSG-SPLASVYVLLSGAAFVAAAVLLVRP  181

Query  1923  IFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLAS  1744
             +   MA R  +GEPV E +VCA +  VL AG  TDTIGIHALFGAFVIGVLVPK+G  A 
Sbjct  182   LLVHMARRSPDGEPVKESFVCAAMTIVLAAGLTTDTIGIHALFGAFVIGVLVPKEGAFAG  241

Query  1743  ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVST  1564
             AL EK+EDLVS L LPLYFVSSGLKTNV TI GA+SWGLL+LVI TAC GKI GT+L S 
Sbjct  242   ALTEKIEDLVSSLLLPLYFVSSGLKTNVGTISGAKSWGLLLLVITTACVGKIGGTVLTSL  301

Query  1563  LCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI  1384
             L R+P +EA+ LG +MNTKGLVELIVLNIG+DR VLN++ FAI+VLMAL TTF+TTP V 
Sbjct  302   LMRVPVREAVALGLMMNTKGLVELIVLNIGRDRKVLNEEAFAILVLMALVTTFLTTPAVT  361

Query  1383  ALYKPAKLAVTEYKYRTIQRK--DPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGF  1210
             A+YKPA+     Y +RT++R   D   +LR+L CFH+ R IP+LINL+EASRGT +S   
Sbjct  362   AVYKPARRQAC-YTHRTVERDDADADSELRVLACFHASRGIPTLINLVEASRGTRRS-KL  419

Query  1209  KVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEP--TDSTEIV-VAFETFEHLSKVS  1039
              +YAMHL+ELSERSSAI M  +AR+NGLPF ++RG+       E+V VAFE F+ LS V 
Sbjct  420   TMYAMHLVELSERSSAISMVQRARRNGLPF-SSRGKQGGGGGGEVVQVAFEAFQRLSAVK  478

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDG-HFETTRNELRHVNRRVLE  862
             ++P TAIS ++++HEDI+ASA  KR A+I+LPFHK    DG   E       HVN RVL 
Sbjct  479   VKPMTAISDLATIHEDIVASAVHKRAALIVLPFHKMLSHDGTALEPLDRAYHHVNVRVLR  538

Query  861   GAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVA  682
              APCSV +LVDR LGG + VSA  V Y++ +L+FGG DDREALAY +RM EHPGI L VA
Sbjct  539   KAPCSVAVLVDRALGGMAQVSAPEVSYSVLLLFFGGPDDREALAYASRMAEHPGIALTVA  598

Query  681   RFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAE  502
             RF     T  T+      P+ +++ E    DE+   A ++    + SV+YEE   +   E
Sbjct  599   RF-----TGSTAPGDHDKPAAAAAAEVVPMDEE---AIRKYVVVSGSVRYEEVAAEGRQE  650

Query  501   TMEAIRGYNRC-NLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQ  325
                AI+   R  NL+V GR      V  + +K +CPELGP+G+ L+  EFS TASVLVVQ
Sbjct  651   VAAAIKAMGRGKNLVVTGRSARAAPV--LVEKSDCPELGPVGSYLATAEFSATASVLVVQ  708

Query  324   QY  319
             +Y
Sbjct  709   RY  710



>gb|EEE53617.1| hypothetical protein OsJ_36882 [Oryza sativa Japonica Group]
Length=771

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/771 (58%), Positives = 551/771 (71%), Gaps = 50/771 (6%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             MKATS G+FQ ++PLD+ALPL+I+QICLVV++TRVLAYLLRPLRQPRVIAEIIGG+LLGP
Sbjct  1     MKATSQGAFQKENPLDFALPLIILQICLVVVVTRVLAYLLRPLRQPRVIAEIIGGILLGP  60

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SA GRS  +L+ +FP KS+TVLDTLA+LGLLFFLFLVGLELD  ++RRTGKKAL+IALAG
Sbjct  61    SALGRSSKFLHNVFPPKSMTVLDTLANLGLLFFLFLVGLELDISAIRRTGKKALAIALAG  120

Query  2262  ISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQ  2083
             IS P GLGIGTS    ATI KG  Q PFLVFMGVALSITAFPVLARILAELKLLTTD+G+
Sbjct  121   ISAPLGLGIGTSLAFGATIVKGAPQAPFLVFMGVALSITAFPVLARILAELKLLTTDLGR  180

Query  2082  mamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMAS  1903
             MAMSAAAVNDVAAWILLALA+ALSG+G SP+ISLWVLL   GFV    L +     WMA 
Sbjct  181   MAMSAAAVNDVAAWILLALAVALSGSG-SPIISLWVLLTAAGFVAAIFLFLRPALAWMAR  239

Query  1902  RCSEGEPVDE-IYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKV  1726
             R  EG P     +V    ++   A      I  HALFGAF++G+ VPKDGP A  L+EKV
Sbjct  240   RSPEGSPSRSCTFVPPSPSSSPPACHRHHRI--HALFGAFLVGIAVPKDGPFAGVLIEKV  297

Query  1725  EDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPF  1546
             EDL+SGLFLPLYFVSSGLKTNVATI+GA+SWGLLVLVI  AC GKI GT++ S L +IP 
Sbjct  298   EDLISGLFLPLYFVSSGLKTNVATIRGAKSWGLLVLVIVNACLGKIGGTVITSLLVKIPV  357

Query  1545  QEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPA  1366
             +EA+TLGFLMNTKGLVELIVLNIGKDR VLND+ FAIMVLMALFTTFITTPIV+A+YKPA
Sbjct  358   REAVTLGFLMNTKGLVELIVLNIGKDRKVLNDEAFAIMVLMALFTTFITTPIVMAIYKPA  417

Query  1365  KLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLM  1186
             +     YK RT+   +   +LR+L CFH+ RNIP+L+NL+E+SRGT +  G  V A    
Sbjct  418   R-PTAPYKRRTVDGGEADGELRVLACFHTNRNIPTLLNLVESSRGTGR--GRLVIA----  470

Query  1185  ELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMS  1006
                    A   C           +T G+  +  ++VVAFE F+ LS V +RP TAIS + 
Sbjct  471   ------PAATACRS---------STSGDKAE--QMVVAFEAFQQLSSVRVRPMTAISDLD  513

Query  1005  SMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDR  826
             ++H D+I SA  KR A++++P+HK  + DG F++  +    +N+RVL  APCSV +LVDR
Sbjct  514   TIHRDVIDSATAKRAAIVVMPYHKMLQHDGTFQSLGSAYHAINKRVLREAPCSVAVLVDR  573

Query  825   GLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARFTLDPETAGTs  646
             GLGG + VSA NV +++  L+FGG DDREALAY  RM EHPG+ + + RF   P  A   
Sbjct  574   GLGGHAQVSAKNVAFSVAALFFGGPDDREALAYATRMAEHPGVAVTLERFR--PSRAQPD  631

Query  645   vkldvspsgssspeekSRDEDFLAAFKQRNS--TNSSVKYEEKVVKSAAETMEAIRGYNR  472
              +     +                AFK +     + SV+++E+  +S AE MEAI   + 
Sbjct  632   EEDAADEAAV-------------EAFKSKVGMVKDGSVRFDERPAQSKAEVMEAINSLSM  678

Query  471   CNLLVVGRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
              ++ VVGRMP     A + +K +  ELGP+G+ L+  EF T+ASVLVV++Y
Sbjct  679   FSVFVVGRMPP---TAPLVEKPD--ELGPVGSYLASPEFRTSASVLVVKRY  724



>gb|KFK36591.1| hypothetical protein AALP_AA4G143600 [Arabis alpina]
Length=767

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/798 (54%), Positives = 555/798 (70%), Gaps = 57/798 (7%)
 Frame = -1

Query  2673  FSAEIMGSNGTVVCPAP-MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRP  2497
              S+ + G+   + CPA  MK TSNG F G+SPLD+A PLLI+Q+CLVV +TR LA+LLRP
Sbjct  1     MSSLVNGTTPAMKCPATVMKVTSNGVFNGESPLDFAFPLLILQVCLVVAVTRSLAFLLRP  60

Query  2496  LRQPRVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLD  2317
             +RQPRV+AEIIGG+LLGPSA GR  AY N++FP +SLTVLDT+A+LGLL FLFL+GLE+D
Sbjct  61    MRQPRVVAEIIGGILLGPSALGRIPAYKNSVFPARSLTVLDTIANLGLLLFLFLIGLEID  120

Query  2316  PKSLRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFP  2137
              KSLRRTGK+++SIA AG+ LPF +G+ TSF      A G    PF++FMGVA+SITAF 
Sbjct  121   LKSLRRTGKQSISIAAAGMLLPFAMGVVTSFAFPEASADGKKVIPFIIFMGVAVSITAFG  180

Query  2136  VLARILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTG  1957
             VLARILAELKLLTTD+G+++MSAAA+NDV+AWILLALA++LSG  +SP + LWVLL G  
Sbjct  181   VLARILAELKLLTTDLGRISMSAAAINDVSAWILLALAVSLSGDRNSPFVPLWVLLSGIA  240

Query  1956  FVLLCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIG  1777
             FV+ C L+ PRIFK ++ R +EGEP+DE +VC  L  VL AGF TD IGIHA+FGAFVIG
Sbjct  241   FVIACFLIAPRIFKLISRRYTEGEPIDEKHVCVALCVVLIAGFATDAIGIHAIFGAFVIG  300

Query  1776  VLVPKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACF  1597
             VL PK G  A  +VEK+EDLV  L LPLYFV SGLKT++ TI G +SWG L LVI TACF
Sbjct  301   VLFPK-GRFADGIVEKIEDLVMSLLLPLYFVMSGLKTDITTIHGVESWGRLALVIVTACF  359

Query  1596  GKILGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMAL  1417
             GKI+GT+ V+ L ++ F++++ LG LMNTKGLVELIVLNIGKDR VL+DQTFAIMVLMA+
Sbjct  360   GKIVGTVSVALLNKVGFRDSLVLGVLMNTKGLVELIVLNIGKDRKVLSDQTFAIMVLMAI  419

Query  1416  FTTFITTPIVIALYKPAKLAVTE-----YKYRTIQRKDPSKQLRILTCFHSRRNIPSLIN  1252
             FTTFITTPIV+ALYKP++   T       + R I+  +  ++L++L C  S R+I  ++ 
Sbjct  420   FTTFITTPIVLALYKPSRTRQTHDNKNRKRRRKIESDNEDEELKVLVCVQSNRDINPMMK  479

Query  1251  LIEASRGT-EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVV  1075
             +IEASRG+ E    F VY MHL +LSER S+I M  KA +NGLPFWN + +  +S+ ++V
Sbjct  480   IIEASRGSNETKESFDVYVMHLTQLSERPSSIRMVQKAGRNGLPFWNKKRD--NSSAVMV  537

Query  1074  AFETFEHLSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRN  895
             AFE  + LS+V +R  TAIS +S++HEDI                               
Sbjct  538   AFEASDKLSRVWVRSVTAISPLSTIHEDI-------------------------------  566

Query  894   ELRHVNRRVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARM  715
                 +N+RVLE +PCS+GILVDRGL  + + S S+   ++ VL+FGG DDREAL YG RM
Sbjct  567   ---WINKRVLENSPCSIGILVDRGL--SDNDSLSSFSLSVNVLFFGGCDDREALVYGLRM  621

Query  714   VEHPGICLVVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVK  535
              EHP + L V      PE +   +      S          DE FL   K+R   N + +
Sbjct  622   AEHPSVSLTVVVVISGPEISRYDILETQETSRFLL------DEQFLVDIKKR--ANIATR  673

Query  534   YEEKVVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD-KKGECPELGPLGNLL--SC  364
             +EE++V  A E +E IR Y+RC+LL+VG+  +G +V+ +   K ECPELGP+GNL+    
Sbjct  674   FEERMVNLAEEAVEIIREYSRCDLLLVGKSSKGSVVSRLPVVKIECPELGPVGNLILTLS  733

Query  363   KEFSTTASVLVVQQYRTE  310
                S   SVLVVQQY  E
Sbjct  734   NASSPPPSVLVVQQYTVE  751



>emb|CBI34426.3| unnamed protein product [Vitis vinifera]
Length=618

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/517 (79%), Positives = 456/517 (88%), Gaps = 2/517 (0%)
 Frame = -1

Query  2640  VVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIG  2461
             V CP P KATSNG FQGD+P+ +ALPL IVQICLVV++TR LA+LL+PLRQPRVIAEI+G
Sbjct  5     VTCPPPTKATSNGVFQGDNPVHFALPLAIVQICLVVVVTRCLAFLLKPLRQPRVIAEIVG  64

Query  2460  GVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKAL  2281
             G+LLGPSA GR++ YL++IFP KSLTVLDTLA+LGLLFFLF+VGLELD KSL R GKKAL
Sbjct  65    GILLGPSALGRNKHYLHSIFPPKSLTVLDTLANLGLLFFLFIVGLELDLKSLHRAGKKAL  124

Query  2280  SIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLL  2101
             SIA+AGISLPF LG+GTSF+LRATI+KGV  GPF+VFMGVALSITAFPVLARILAELKLL
Sbjct  125   SIAVAGISLPFALGVGTSFVLRATISKGVDAGPFVVFMGVALSITAFPVLARILAELKLL  184

Query  2100  TTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRI  1921
             TTDVGQMAMSAAAVNDVAAWILLALAIALSGTG SP+ISLWV LCG GFVL C L+ PRI
Sbjct  185   TTDVGQMAMSAAAVNDVAAWILLALAIALSGTGRSPIISLWVFLCGFGFVLCCSLIAPRI  244

Query  1920  FKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASA  1741
             F+WMA RC EGEPVDE+Y+CA LAAVL AGFVTD IGIHALFG+FV+G+LVPK+GP ASA
Sbjct  245   FRWMAQRCPEGEPVDEMYICATLAAVLAAGFVTDAIGIHALFGSFVMGILVPKEGPFASA  304

Query  1740  LVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTL  1561
             LVEKVEDLVSGL LPLYFVSSGLKT+V+TI+G QSW LLVLVIFTAC GKI GTI VS  
Sbjct  305   LVEKVEDLVSGLLLPLYFVSSGLKTDVSTIRGLQSWSLLVLVIFTACLGKIAGTIAVSVC  364

Query  1560  CRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIA  1381
             CR+P +EA+ LGFLMN+KGLVELIVLNIGK+R VLNDQTFAIMVLMALFTTFITTP+VI+
Sbjct  365   CRMPVREALALGFLMNSKGLVELIVLNIGKERKVLNDQTFAIMVLMALFTTFITTPLVIS  424

Query  1380  LYKPAKL-AVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKV  1204
             +YKPAK  +  +YK+RTI RK+P+ +LRIL CF S  NIP++INLIE SRGT K  G  V
Sbjct  425   VYKPAKRPSKADYKHRTIDRKNPNGELRILVCFRSTNNIPTMINLIETSRGTGKREGLCV  484

Query  1203  YAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTD  1093
             YAMHLMELSERSS I M HKARKNGLPFWN +G P +
Sbjct  485   YAMHLMELSERSSVISMVHKARKNGLPFWN-KGLPPE  520



>ref|XP_006432183.1| hypothetical protein CICLE_v10000276mg [Citrus clementina]
 ref|XP_006465118.1| PREDICTED: cation/H(+) antiporter 15-like [Citrus sinensis]
 gb|ESR45423.1| hypothetical protein CICLE_v10000276mg [Citrus clementina]
Length=832

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/785 (51%), Positives = 554/785 (71%), Gaps = 13/785 (2%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
             ++ T+VC +P   T+NG +QGD+PLDY+LPL I+Q+ LVV+ TR+L  +L+P RQPRVI+
Sbjct  12    TDETIVCYSPNMITTNGVWQGDNPLDYSLPLFILQLTLVVVTTRLLVLVLKPFRQPRVIS  71

Query  2472  EIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTG  2293
             EIIGGVLLGPS  GR+ A+ N IFP +S+ VL+T+A++GLL+FLFLVG+E+D  ++RRTG
Sbjct  72    EIIGGVLLGPSVLGRNTAFANTIFPLRSVMVLETMANVGLLYFLFLVGVEMDISAIRRTG  131

Query  2292  KKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAE  2113
             KKAL+IA+ G++LPF +G   SFIL     +G++QG F++F+GVALS+TAFPVLARILAE
Sbjct  132   KKALAIAVGGMTLPFVIGGCFSFILHKK-NQGMNQGTFVLFLGVALSVTAFPVLARILAE  190

Query  2112  LKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILV  1933
             LKL+ T++G++AMS+A +ND+ AW+LLA AIAL     S L SLWV+L G  FV+ C+ V
Sbjct  191   LKLINTELGRIAMSSALINDMCAWVLLAFAIALGENDTSTLASLWVILSGAAFVIFCVFV  250

Query  1932  VPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
             V     WM  R  EGE   E YVC IL  V+ +GF+TD IG H++FGAFV G+++P +GP
Sbjct  251   VRPAICWMIRRTPEGESFSEFYVCLILTGVMISGFITDAIGTHSVFGAFVFGLVIP-NGP  309

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
             L   L+EK+ED VSGL LPL+F  SGLKT++++I G  +W + +LVI  AC GKI GT+L
Sbjct  310   LGLTLIEKLEDFVSGLLLPLFFAISGLKTDISSIHGTSTWMITLLVIVLACAGKIAGTLL  369

Query  1572  VSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTP  1393
             VS + ++P +E +TLG LMNTKGLVE+IVLN+GKD+ VL+D++FAIMV++A+  T I TP
Sbjct  370   VSLMYQMPIREGVTLGLLMNTKGLVEMIVLNVGKDQKVLDDESFAIMVIVAVVMTGIITP  429

Query  1392  IVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGG  1213
             IV ++YKPA+     YK RTIQ+  P  + R L C H+ RN+P++INL+EAS  T++S  
Sbjct  430   IVTSIYKPAR-RFLPYKRRTIQKSKPDSEFRALVCVHTPRNVPTIINLLEASHPTKRS-P  487

Query  1212  FKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFE-HLSKVSI  1036
               VY +HL+EL+ R+SA+L+ H  RK+G P  N     +D   I+ AFE +E H   V++
Sbjct  488   ICVYVLHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSD--HIINAFENYEQHTGCVTV  545

Query  1035  RPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGA  856
             +P TAIS  SSMHEDI   AE KRVA+II+PFHKHQ +DG  E T    R VN+ +L  A
Sbjct  546   QPLTAISPYSSMHEDICNLAEDKRVALIIIPFHKHQTVDGGMEATNPAFRMVNQNLLANA  605

Query  855   PCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF  676
             PCSVGILVDRGL G++ ++A+ V + I VL+FGG DDREALAY  RM EHPG  L V RF
Sbjct  606   PCSVGILVDRGLNGSTRLAANQVTHNIAVLFFGGPDDREALAYAWRMSEHPGNNLTVMRF  665

Query  675   TLDPET---AGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAA  505
                 E    A  S   +     + +  ++  DE+++  F+ + + + SV Y EK+  +  
Sbjct  666   IAAEEVEPAARQSPDQNGLTVETENDNQRQLDEEYINEFRMKIANDESVVYTEKLANNGE  725

Query  504   ETMEAIRGYNRC-NLLVVGRMP--EGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVL  334
             ET+ AIR  ++  +L +VGR       +   +    ECPELG +G+LL+  +F++T SVL
Sbjct  726   ETLAAIRSMDQAHDLFIVGRGQGVTSPLTDGLTDWSECPELGAIGDLLASSDFASTVSVL  785

Query  333   VVQQY  319
             VVQQY
Sbjct  786   VVQQY  790



>gb|KDO50743.1| hypothetical protein CISIN_1g043446mg, partial [Citrus sinensis]
Length=784

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/783 (51%), Positives = 550/783 (70%), Gaps = 13/783 (2%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
             ++ T+VC +P   T+NG +QGD+PLDY+LPL I+Q+ LVV+ TR+L  +L+P RQPRVI+
Sbjct  8     TDETIVCYSPNMITTNGVWQGDNPLDYSLPLFILQLTLVVVTTRLLVLVLKPFRQPRVIS  67

Query  2472  EIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTG  2293
             EIIGGVLLGPS  GR+ A+ N IFP +S+ VL+T+A++GLL+FLFLVG+E+D  ++RRTG
Sbjct  68    EIIGGVLLGPSVLGRNTAFANTIFPLRSVMVLETMANVGLLYFLFLVGVEMDISAIRRTG  127

Query  2292  KKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAE  2113
             KKAL+IA+ G++LPF +G   SFIL     +G++QG F++F+GVALS+TAFPVLARILAE
Sbjct  128   KKALAIAVGGMTLPFVIGGCFSFILHKK-NQGMNQGTFVLFLGVALSVTAFPVLARILAE  186

Query  2112  LKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILV  1933
             LKL+ T++G++AMS+A +ND+ AW+LLA AIAL     S L SLWV+L G  FV+ C+ V
Sbjct  187   LKLINTELGRIAMSSALINDMCAWVLLAFAIALGENDTSTLASLWVILSGAAFVIFCVFV  246

Query  1932  VPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
             V     WM  R  EGE   E YVC IL  V+ +GF+TD IG H++FGAFV G+++P +GP
Sbjct  247   VRPAICWMIRRTPEGESFSEFYVCLILTGVMISGFITDAIGTHSVFGAFVFGLVIP-NGP  305

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
             L   L+EK+ED VSGL LPL+F  SGLKT++++I G  +W + +LVI  AC GKI GT+L
Sbjct  306   LGLTLIEKLEDFVSGLLLPLFFAISGLKTDISSIHGTSTWMITLLVIILACAGKIAGTLL  365

Query  1572  VSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTP  1393
             VS + ++P +E +TLG LMNTKGLVE+IVLN+GKD+ VL+D++FAIMV++A+  T I TP
Sbjct  366   VSLMYQMPIREGVTLGLLMNTKGLVEMIVLNVGKDQKVLDDESFAIMVIVAVVMTGIITP  425

Query  1392  IVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGG  1213
             IV ++YKPA+     YK RTIQ+  P  + R+L C H+ RN+P++INL+EAS  T++S  
Sbjct  426   IVTSIYKPAR-RFLPYKRRTIQKSKPDSEFRVLVCVHTPRNVPTIINLLEASHPTKRS-P  483

Query  1212  FKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFE-HLSKVSI  1036
               VY +HL+EL+ R+SA+L+ H  RK+G P  N     +D   I+ AFE +E H   V++
Sbjct  484   ICVYVLHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSD--HIINAFENYEQHTGCVTV  541

Query  1035  RPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGA  856
             +P TAIS  SSMHEDI   AE KRVA+II+PFHKHQ +DG  E T    R VN+ +L  A
Sbjct  542   QPLTAISPYSSMHEDICNLAEDKRVALIIIPFHKHQTVDGGMEATNPAFRMVNQNLLANA  601

Query  855   PCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF  676
             PCSVGILVDRGL G++ ++A+ V + I VL+FGG DDREALAY  RM EHPG  L V RF
Sbjct  602   PCSVGILVDRGLNGSTRLAANQVTHNIAVLFFGGPDDREALAYAWRMSEHPGNNLTVMRF  661

Query  675   TLDPETAGTsvkldvspsgssspeekSR---DEDFLAAFKQRNSTNSSVKYEEKVVKSAA  505
                 E      +       +   E  ++   DE+++  F+ + + + SV Y EK+  +  
Sbjct  662   IAAEEVEPAERQSPDQNGLTVETENDNQRQLDEEYINEFRMKIANDESVVYTEKLANNGE  721

Query  504   ETMEAIRGYNRC-NLLVVGRMP--EGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVL  334
             ET+ AIR  +   +L +VGR       +   +    ECPELG +G+LL+  +F++T SVL
Sbjct  722   ETLAAIRSMDHSHDLFIVGRGQGVTSPLTDGLTDWSECPELGAIGDLLASSDFASTVSVL  781

Query  333   VVQ  325
             VVQ
Sbjct  782   VVQ  784



>emb|CDP09934.1| unnamed protein product [Coffea canephora]
Length=841

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/792 (50%), Positives = 554/792 (70%), Gaps = 21/792 (3%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
             ++ T+VC AP   T+NG +QGD+PLDY+LPL I+Q+ LVV++TR+L Y+L+PLRQPRVI+
Sbjct  12    TDETIVCYAPTMITTNGIWQGDNPLDYSLPLFILQLTLVVVVTRILVYILKPLRQPRVIS  71

Query  2472  EIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTG  2293
             EI+GG++LGPS  G+S  + NA+FP +S+ VL+T+A++GLL+FLFLVG+E+D   +RRTG
Sbjct  72    EILGGIILGPSVLGQSAKFANAVFPLRSVMVLETMANIGLLYFLFLVGVEMDLAVIRRTG  131

Query  2292  KKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAE  2113
             KKA +IA+AG+ +PF +G   S +L    ++ + QG F++F+GVALS+TAFPVLAR+LAE
Sbjct  132   KKAFAIAVAGMIIPFLIGTSFSLMLHQK-SQYMKQGTFILFLGVALSVTAFPVLARVLAE  190

Query  2112  LKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILV  1933
             LKLL T++G++AMS+A VND+ AWILLA AIAL+      L S+WV+L  + FVL CI  
Sbjct  191   LKLLNTEIGRIAMSSALVNDMCAWILLAFAIALAENASVSLASVWVILSSSAFVLFCIFA  250

Query  1932  VPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
             V  +  WM  R  EGE + + Y+C IL  V+  GF+TD +G H++FGAFV G+++P +GP
Sbjct  251   VRPLISWMIRRTPEGETISDFYICLILTGVMICGFITDALGTHSVFGAFVFGLIIP-NGP  309

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
             +   L+E++ED VSGL LPL+F  SGLKT ++TI+G  +W +L LVI  +C GKI GT+L
Sbjct  310   IGLTLIERLEDFVSGLLLPLFFAISGLKTEISTIKGVGTWCILFLVIVLSCAGKIAGTLL  369

Query  1572  VSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTP  1393
             V+   ++PF E +TLGFLMNTKGLVE+I+LN+GKD+ VL+DQ+FAIMV++++  T I  P
Sbjct  370   VALYYKMPFYEGLTLGFLMNTKGLVEIIILNVGKDQKVLDDQSFAIMVIISVVKTSIIIP  429

Query  1392  IVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGG  1213
             IV  +YKPA+     YK RT+QR  P  + R+L C H+ RN+P++INL+EAS  T+KS  
Sbjct  430   IVTLIYKPAR-KFAPYKKRTVQRSKPDSEFRVLVCVHTPRNVPTIINLLEASHPTKKS-P  487

Query  1212  FKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFE-HLSKVSI  1036
               +Y +HL+ELS R+SA+L+ H +RK+G P  N     +D   I+ AFE FE H   VS+
Sbjct  488   ICIYVLHLVELSGRASAMLIVHNSRKSGRPALNRAQAQSD--HIINAFENFEQHAGCVSV  545

Query  1035  RPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGA  856
             +P TAIS  S+MHEDI   AE KR A II+PFHK Q +DG  E+T    R +N+ VL  A
Sbjct  546   QPLTAISPYSTMHEDICNLAEDKRAAFIIIPFHKQQTVDGGMESTNPAFRTINQNVLVNA  605

Query  855   PCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF  676
             PCSVGILVDRGL  ++ ++A  V + + +L+FGG DDREALAY  RM EHPGI L V RF
Sbjct  606   PCSVGILVDRGLSSSTRLAAGQVSHHVAILFFGGPDDREALAYAWRMSEHPGINLTVMRF  665

Query  675   -----TLDPETAGTsvkldvspsgssspeekSR----DEDFLAAFKQRNSTNSSVKYEEK  523
                    +P ++        +P   +   +  R    DED++  F+ R   + S+ Y E+
Sbjct  666   IPGEAAAEPSSSSGRRAEASAPGILTVVTDDDREKQLDEDYINQFRSRTMHDDSIVYTER  725

Query  522   VVKSAAETMEAIRGYNRC-NLLVVGRMPEGEI---VAAMDKKGECPELGPLGNLLSCKEF  355
             VV++  ET+ AIR  +   +L +VGR  +G +    A +    ECPELG +G+LL+  +F
Sbjct  726   VVRNGEETVAAIRSIDSIHDLFIVGR-GQGTVSPLTAGLTDWSECPELGAIGDLLASSDF  784

Query  354   STTASVLVVQQY  319
             +TT SVLVVQQY
Sbjct  785   ATTVSVLVVQQY  796



>gb|EYU30300.1| hypothetical protein MIMGU_mgv1a026576mg, partial [Erythranthe 
guttata]
Length=772

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/777 (51%), Positives = 544/777 (70%), Gaps = 19/777 (2%)
 Frame = -1

Query  2613  TSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGPSAF  2434
             T+NG +QGD+PLDY+LPL I+Q+ LVV  TR+L ++L+PLRQPRVI+EI+GG++LGPS  
Sbjct  3     TTNGIWQGDNPLDYSLPLFILQLTLVVTTTRLLVFVLKPLRQPRVISEILGGIILGPSVL  62

Query  2433  GRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAGISL  2254
             GRS  + + IFP +S+ VL+T+A++GLL+FLFLVG+E+D   ++RTGK+AL+IA+AG+ L
Sbjct  63    GRSTKFADTIFPLRSVMVLETMANVGLLYFLFLVGVEMDIGVIKRTGKRALAIAIAGMIL  122

Query  2253  PFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQmam  2074
             PF +G+  +F+L  T  + ++ G F++F+GVALS+TAFPVLARILAELKLL TD+G++AM
Sbjct  123   PFLIGVSFAFMLHQT-TELIALGTFILFLGVALSVTAFPVLARILAELKLLNTDIGRIAM  181

Query  2073  saaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMASRCS  1894
             S+A +ND+ AWILLA AIAL+      L S+WV+L    FVL C+ +V  I  WM  R  
Sbjct  182   SSALINDMCAWILLAFAIALAENESMSLASIWVILSSVVFVLFCVYIVRPIVSWMVRRTP  241

Query  1893  EGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVEDLV  1714
             EGE + E Y+C IL  V+ +GF+TD IG H++FGAFV G+++P +GPL   L+E++ED V
Sbjct  242   EGESISEFYICLILTGVMISGFITDAIGTHSVFGAFVFGLVIP-NGPLGVTLIERLEDFV  300

Query  1713  SGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQEAI  1534
             SGL LPL+F  SGLKT++  I G  +W +L +VI  AC GKI GT+LVS   +IPF E +
Sbjct  301   SGLLLPLFFAISGLKTDITAIHGFTTWAILGVVIILACAGKIAGTLLVSLYYKIPFNEGL  360

Query  1533  TLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAKLAV  1354
             TLG LMNTKGLVE+IVLN+GKD+ VL+D++FAIMV++A+  T I +PIV  +Y+PA+   
Sbjct  361   TLGLLMNTKGLVEMIVLNVGKDQKVLDDKSFAIMVIVAVVMTAIISPIVTTIYRPAR-KF  419

Query  1353  TEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLMELSE  1174
             T YK RTIQR  P  + R+L C H+ RN+P++INL++AS  T+KS     Y +HL+EL+ 
Sbjct  420   TPYKRRTIQRTKPEGEFRVLVCIHTPRNVPTIINLLDASHPTKKS-PICTYVLHLVELTG  478

Query  1173  RSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFE-HLSKVSIRPSTAISAMSSMH  997
             R+SA+L+ H  RK+G P  N     +D   I+ AFE FE H   VS+ P TA+S  S+MH
Sbjct  479   RASAMLIVHNTRKSGRPALNRTQAQSD--HIINAFENFEQHSGFVSVNPLTAVSPYSTMH  536

Query  996   EDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDRGLG  817
             EDI   AE KRVA II+PFHK Q +DG  E T    R +N+ VL  APCSVGILVDRGL 
Sbjct  537   EDICNVAEDKRVAFIIVPFHKQQTVDGGMEATNPAFRTINQNVLANAPCSVGILVDRGLS  596

Query  816   GTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF-----TLDPETAG  652
             G++ ++A+ + + + VL+FGG DDREALAYG RM EH G+ L V RF      ++P    
Sbjct  597   GSTRLAANQIAHHVAVLFFGGPDDREALAYGWRMCEHSGVNLTVLRFIVGENAVEPVAEA  656

Query  651   TsvkldvspsgssspeekSR--DEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGY  478
                         ++  ++ R  DED++ AF+ R   +SSV Y+EKVV    ET+ AIR  
Sbjct  657   RRNPSQREMLTVATETDRERQLDEDYINAFRARTMDDSSVVYDEKVVNHGEETVAAIRSV  716

Query  477   NRC-NLLVVGRMPEGEI---VAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY  319
             +   +L +VGR  +G I    A +    ECPELG +G+LL+  +F+ T SVLVVQQY
Sbjct  717   DPVHDLFIVGR-GQGLISPVTAGLTDWSECPELGAIGDLLASSDFAATYSVLVVQQY  772



>ref|XP_010034375.1| PREDICTED: cation/H(+) antiporter 15 [Eucalyptus grandis]
 gb|KCW51840.1| hypothetical protein EUGRSUZ_J01292 [Eucalyptus grandis]
Length=829

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/790 (51%), Positives = 557/790 (71%), Gaps = 19/790 (2%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
             S  +++C AP   T+NG +QGD+PLDY+LPL I+Q+  VV++TRV+ Y+L+P RQPRVI+
Sbjct  7     SEDSIICYAPTMITTNGIWQGDNPLDYSLPLFILQLTFVVVVTRVMVYVLKPFRQPRVIS  66

Query  2472  EIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTG  2293
             EI+GG+LLGPS  GRSE + N IFP +S+ VL+T+A++GLL+FLFLVG+E+D   ++RTG
Sbjct  67    EILGGILLGPSVLGRSETFANTIFPLRSVMVLETMANVGLLYFLFLVGVEMDISVIKRTG  126

Query  2292  KKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAE  2113
             +K+L+IA+AG+ LPF  G+G SF+L  T    +SQG +++F+GVALS+TAFPVLAR+LAE
Sbjct  127   RKSLAIAIAGMILPFLFGLGFSFLLN-TKNGSMSQGTYILFLGVALSVTAFPVLARVLAE  185

Query  2112  LKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILV  1933
             LKL+ T++G++AMS+A +ND+ AW+LLALAIAL+    + L SLWV+L    FVL+CI V
Sbjct  186   LKLINTELGRIAMSSALINDMCAWVLLALAIALAENEKASLASLWVVLSSVAFVLVCIFV  245

Query  1932  VPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
             V     WM  R  EGE   E Y+C IL  V+ +GF+TD IG H++FGAFV G+++P +GP
Sbjct  246   VRPAIAWMIRRTPEGETYSEFYICLILTGVMISGFITDAIGTHSVFGAFVFGLIIP-NGP  304

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
             L   L+EK+ED VSGL LPLYF  SGL+T++  I GA+SWG+L L+I  +  GKI GT++
Sbjct  305   LGVTLIEKLEDFVSGLLLPLYFAISGLRTDIRKIAGARSWGILGLIIILSSLGKIFGTLM  364

Query  1572  VSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTP  1393
             VS   ++  +E ITLG LMNTKGLVE+I+LN+GKD+ VL+D++FA MV++A+F T I TP
Sbjct  365   VSVFYQMTVREGITLGLLMNTKGLVEMIILNVGKDQKVLDDKSFAAMVIVAVFITAIITP  424

Query  1392  IVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGG  1213
             IV  +Y+PA+     YK RTIQR  P  + R+L C H+ RN+P++INL+EAS  T+KS  
Sbjct  425   IVTVIYRPAR-RFMPYKRRTIQRSKPDVEFRVLVCVHTPRNVPTIINLLEASNATKKS-P  482

Query  1212  FKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFE-HLSKVSI  1036
               VY +HL+EL+ R+SA+L+ H  RK+G P  N     +D   I+ AFE +E H   V++
Sbjct  483   ICVYVLHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSD--HIINAFENYEQHTGCVTV  540

Query  1035  RPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGA  856
             +P TAIS  S+MHEDI   AE KR A II+PFHK Q +DG  E T    R +N+ VL  +
Sbjct  541   QPLTAISPYSTMHEDICNLAEDKRSAFIIIPFHKQQTVDGGMEATNPAFRMINQNVLANS  600

Query  855   PCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF  676
             PCSVGILVDRGL G++ ++A+ V + + VL+FGG DDREALAYG RM EHPGI L V RF
Sbjct  601   PCSVGILVDRGLNGSTRLAANQVAHHVAVLFFGGPDDREALAYGWRMCEHPGINLTVMRF  660

Query  675   -----TLDPETAGTsvkldvspsgssspeekSR--DEDFLAAFKQRNSTNSSVKYEEKVV  517
                   +D   A T+   D       +  +K R  DE+++  F+ RN+ N S+ Y EK+V
Sbjct  661   MPGEEAIDTAVASTNEFGDSRILSVVTDRDKDRQLDEEYVKEFRMRNANNESIVYIEKIV  720

Query  516   KSAAETMEAIRGYNRC-NLLVVGRMPEGEI---VAAMDKKGECPELGPLGNLLSCKEFST  349
              +  ET+ AI+  +   +L +VGR  +G I    A +    ECPELG +G+LL+  +F+ 
Sbjct  721   NNGEETVTAIQSIDSSHDLFIVGR-GQGMISPLTAGLTDWSECPELGAIGDLLASSDFAA  779

Query  348   TASVLVVQQY  319
             T SVLVVQQY
Sbjct  780   TVSVLVVQQY  789



>ref|XP_002269591.1| PREDICTED: cation/H(+) antiporter 20 [Vitis vinifera]
Length=839

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/824 (52%), Positives = 557/824 (68%), Gaps = 44/824 (5%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             +  +SNG +QGD+PLD+A PLLIVQ  L++ L+R LA+LL+PLRQP+VIAEIIGG+LLGP
Sbjct  8     ISTSSNGVWQGDNPLDFAFPLLIVQTTLILALSRFLAFLLKPLRQPKVIAEIIGGILLGP  67

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SA GR++ YL+ IFP  S  +L+++AS+GLLFFLFLVGLELD  S+RR+G+KALSIA  G
Sbjct  68    SALGRNQNYLHRIFPSWSTPILESVASIGLLFFLFLVGLELDLSSIRRSGRKALSIATVG  127

Query  2262  ISLPFGLGIGTSFILRATI--AKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDV  2089
             I+LPF  G+G +F+LR ++  A     G FLVFMGVALSITAFPVLARILAELKLLTT V
Sbjct  128   ITLPFVCGVGVAFVLRKSVDGADKAGYGTFLVFMGVALSITAFPVLARILAELKLLTTRV  187

Query  2088  GQmamsaaavndvaawillalaiaLSGTGH-----SPLISLWVLLCGTGFVLLCILVVPR  1924
             G+ AM+AAA NDV AWILLALA+AL+G G      SPLIS+WVLL G  FV+  ++V+  
Sbjct  188   GETAMAAAAFNDVVAWILLALAVALAGDGEGGEHKSPLISVWVLLSGVAFVIFMMVVIKP  247

Query  1923  IFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLAS  1744
                W+A R  +   VDE Y+C  LA V+ +GFVTD IGIH++FGAFV G+ +PK G  + 
Sbjct  248   AMSWVARRSPDSHSVDEAYICLTLAGVMVSGFVTDLIGIHSIFGAFVFGLTIPKGGGFSE  307

Query  1743  ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVST  1564
              L+E++ED V+GL LPLYF SSGLKTNVA I+G ++WGLLVLVI TAC GKI+GT +V+ 
Sbjct  308   RLIERIEDFVTGLLLPLYFASSGLKTNVAKIRGLEAWGLLVLVITTACAGKIVGTFVVAM  367

Query  1563  LCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI  1384
             +C IP +E++TLG LMNTKGLVELIVLNIGK++ VLND+ FAI+VLMALFTTF+TTPIV+
Sbjct  368   MCMIPARESLTLGVLMNTKGLVELIVLNIGKEKKVLNDEIFAILVLMALFTTFMTTPIVM  427

Query  1383  ALYKPAK--LAVTEYKYRTIQRKDPSK-QLRILTCFHSRRNIPSLINLIEASRGTEKSGG  1213
              +YKP +   A T  + R     D SK  LRIL C H   N+PSLI+LIEA+R  +KS  
Sbjct  428   TIYKPVRGGPARTHRRLRDFSSVDSSKYDLRILACVHGPGNVPSLISLIEATRSAKKS-Q  486

Query  1212  FKVYAMHLMELSERSSAILMCHKARKNGLPFWN--TRGEPTDSTEIVVAFETFEHLSKVS  1039
              K+Y M L+EL+ERSS+I+M  +ARKNG PF N   RG+  D  E  VAFE +  L +VS
Sbjct  487   LKLYVMRLVELTERSSSIIMVQRARKNGFPFINRFRRGQSDDRVE--VAFEAYGQLGRVS  544

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGH--FETTRNELRHVNRRVL  865
             +RP+TAIS++S+MHEDI   AE KR  M+ILPFHK  K +G+   E   N  R VN+RVL
Sbjct  545   VRPTTAISSLSTMHEDICHVAEEKRATMVILPFHKQWKGEGYESMENMGNGWRGVNQRVL  604

Query  864   EGAPCSVGILVDRGLGGTSHVS---ASNVDYTITVLYFGGHDDREALAYGARMVEHPGIC  694
             + +PCSV +LVDRG G     +    S V   I +L+FGG DDREAL  GARM EHP + 
Sbjct  605   KNSPCSVAVLVDRGFGSGPQQTRGPTSTVTQRICILFFGGPDDREALELGARMAEHPAVK  664

Query  693   LVVARFTL-------------DPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNS  553
             + V RF                PE          + +     E++  DE   A FK R  
Sbjct  665   VTVIRFVEKDGSDSKDIILRPSPEKCDEQSYSFSTAAMDRQKEKEL-DEIATAEFKSR--  721

Query  552   TNSSVKYEEKVVKSAAETMEAIRGYNRCNLLVV--GRMPEGEIVAAMDKKGECPELGPLG  379
                 V+Y EKV  +  E + AI      +L+VV  GR P   +    +++ E  ELGP+G
Sbjct  722   WGGLVEYVEKVASNVVEGVLAIGKSGDYDLVVVGKGRFPSTMVAELAERQAEHAELGPIG  781

Query  378   NLLSCKEFSTTASVLVVQQY------RTELSKNGLKEDDSVDGD  265
             ++L+       +SVLV+QQ+         +SK    +D + +GD
Sbjct  782   DILASSGQGIVSSVLVIQQHDIAHAEEVPVSKVVNSKDATSNGD  825



>ref|XP_010090834.1| Cation/H(+) antiporter 15 [Morus notabilis]
 gb|EXB40959.1| Cation/H(+) antiporter 15 [Morus notabilis]
Length=836

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/807 (50%), Positives = 556/807 (69%), Gaps = 19/807 (2%)
 Frame = -1

Query  2661  IMGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPR  2482
             I  +  T+VC AP   T+NG +QGD+PLDY+LPL I+Q+ +VV+ TR L ++L+P RQPR
Sbjct  9     INKTEDTIVCYAPNMITTNGVWQGDNPLDYSLPLFILQLTMVVVTTRFLVFILKPFRQPR  68

Query  2481  VIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLR  2302
             VIAEI+GGV+LGPS  GR+  + N +FP +S+ VL+T+A++GLL+FLFLVG+E+D   +R
Sbjct  69    VIAEILGGVILGPSVLGRNSRFANTLFPLRSVMVLETMANVGLLYFLFLVGVEMDISVIR  128

Query  2301  RTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARI  2122
             RTGKKAL+IA+AG+ LPF +G   SFIL     + ++QG F++F+GVALS+TAFPVLARI
Sbjct  129   RTGKKALAIAIAGMVLPFIIGACFSFILHKK-DETMTQGTFILFLGVALSVTAFPVLARI  187

Query  2121  LAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLC  1942
             LAELKL+ T++G++A+S+A VND++AWILLALAIAL+    + L SLWV+L  T FV  C
Sbjct  188   LAELKLINTEIGRIALSSALVNDMSAWILLALAIALAENHATSLASLWVILSSTAFVAFC  247

Query  1941  ILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPK  1762
             IL+V     WM  R  EGE   E ++C +L  V+ +GF+TD IG H++FGAFV G+++P 
Sbjct  248   ILIVRPAVSWMIRRTPEGESFSEFHICLVLTGVMLSGFITDAIGTHSVFGAFVFGLVIP-  306

Query  1761  DGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILG  1582
             +GPL   L+EK+ED VSGL LPL+F  SGLKT+V +I    +WG L+L+I  AC GK+ G
Sbjct  307   NGPLGVTLIEKLEDFVSGLLLPLFFAISGLKTDVTSITSVGTWGFLMLIIVLACAGKVAG  366

Query  1581  TILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFI  1402
             T+LV    ++P  E ITLG LMNTKGLVE+I+LN+G+D+ VL+D++FAIMV++A+  T I
Sbjct  367   TLLVCIYYQMPVHEGITLGLLMNTKGLVEMIILNVGRDQKVLDDESFAIMVIVAVVMTAI  426

Query  1401  TTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEK  1222
              TPIV ++YKPA+  +  YK RTIQR  P  +LR+L C H+ RN+P++INL+EAS  +++
Sbjct  427   ITPIVTSIYKPARKFI-PYKRRTIQRLKPDAELRMLVCIHTPRNVPTIINLLEASHPSKR  485

Query  1221  SGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFE-HLSK  1045
             S    VY +HL+EL+ R+SA+L+ H  RK+G P  N     +D   I+ AFE +E H   
Sbjct  486   S-PLCVYVLHLVELTGRASAMLIVHNTRKSGRPPLNRTQAQSD--HIINAFENYEQHAGC  542

Query  1044  VSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVL  865
             VS++P TAIS  S+MHEDI   AE KRVA II+PFHK Q +DG  E T    R +N+ VL
Sbjct  543   VSVQPLTAISPYSTMHEDICNLAEDKRVAFIIIPFHKQQTVDGGMEATNPAFRMINQNVL  602

Query  864   EGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
               APCSVGI+VDRGL G++ ++A+ V + I V++FGG DDREAL Y  RM +HPG  L V
Sbjct  603   ANAPCSVGIIVDRGLNGSTRLAANQVTHHIAVIFFGGPDDREALTYALRMSDHPGTSLTV  662

Query  684   ARFTLDPETAGTsvkl-------dvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEE  526
              RF    + A T+ +         +    +    E+  D+D +  F+ +   + S+ Y E
Sbjct  663   LRFISGDDAADTTEQSRGNPNDPRMLTVETDDTMERQLDDDLVNDFRMKTMNDESIVYNE  722

Query  525   KVVKSAAETMEAIRGY-NRCNLLVVGRMPEGEI---VAAMDKKGECPELGPLGNLLSCKE  358
             KVV +  ET+ AIR   N  +L +VGR  +G I    A +    ECPELG +G+LL+  +
Sbjct  723   KVVHNGEETVAAIRSMDNVHDLFIVGR-GQGMISPLTAGLTDWSECPELGAIGDLLASSD  781

Query  357   FSTTASVLVVQQYRTELSKNGLKEDDS  277
             F+ T SVLVVQQY       G+ + DS
Sbjct  782   FAATVSVLVVQQYVGMGPNEGVGQPDS  808



>ref|XP_010037849.1| PREDICTED: cation/H(+) antiporter 20 [Eucalyptus grandis]
 gb|KCW49630.1| hypothetical protein EUGRSUZ_K03152 [Eucalyptus grandis]
Length=833

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/802 (54%), Positives = 551/802 (69%), Gaps = 39/802 (5%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             ++ +SNG++QGD+PLD+A PLLI+Q  L++ ++R LA+LL+PLRQP+VIAEI+GG+LLGP
Sbjct  8     IQTSSNGAWQGDNPLDFAFPLLIIQTTLILAVSRFLAFLLKPLRQPKVIAEIVGGILLGP  67

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SA GR+ AYL+ IFP  S  +L+++AS+GLLFFLFLVGLELD  S+RR+G++AL IALAG
Sbjct  68    SALGRNAAYLHRIFPSWSTPILESVASIGLLFFLFLVGLELDLGSVRRSGRRALGIALAG  127

Query  2262  ISLPFGLGIGTSFILRATI--AKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDV  2089
             ISLPF  GIG +F+LR T+  A  V  G FLVFMGVALSITAFPVLARILAELKLLTT V
Sbjct  128   ISLPFLCGIGVAFVLRKTVDGADKVGYGQFLVFMGVALSITAFPVLARILAELKLLTTQV  187

Query  2088  GQmamsaaavndvaawillalaiaLSGTG------HSPLISLWVLLCGTGFVLLCILVVP  1927
             GQ AM+AAA NDVAAWILLALA+AL+G G       SPLISLWVLL G  FV+  ++ V 
Sbjct  188   GQTAMAAAAFNDVAAWILLALAVALAGNGAEGGPHKSPLISLWVLLSGFAFVVFMMVAVR  247

Query  1926  RIFKWMASRCS-EGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPL  1750
                +W+A RCS E + VDE Y+   LA VL +GF+TD IGIH++FGAFV G+ +PK G  
Sbjct  248   PAMRWVARRCSSEHDVVDEAYIVLTLAGVLVSGFMTDLIGIHSIFGAFVFGLTIPKGGEF  307

Query  1749  ASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILV  1570
             A  L+E++ED V+GL LPLYF SSGLKT+V  IQGA++WGLL LVI TAC GKI GT + 
Sbjct  308   AERLIERIEDFVTGLLLPLYFASSGLKTDVTKIQGAKAWGLLTLVITTACAGKIFGTFVA  367

Query  1569  STLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPI  1390
             + +  IP +EAITLG LMNTKGLVELIVLNIGK++ VLND+ FAI+VLMALFTTFITTP 
Sbjct  368   ALMFAIPAREAITLGVLMNTKGLVELIVLNIGKEKQVLNDEMFAILVLMALFTTFITTPT  427

Query  1389  VIALYKPAKL--AVTEYKYRTIQRKDPS--KQLRILTCFHSRRNIPSLINLIEASRGTEK  1222
             V+A+YKPA+   A T  K R +   D S   +LRIL C H   N+PSLI+LIE+ R T K
Sbjct  428   VMAIYKPARANGAPTHRKLRDLSNNDDSSKNELRILACLHGPGNVPSLISLIESIRST-K  486

Query  1221  SGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWN--TRGEPTDSTEIVVAFETFEHLS  1048
             +   K++ MHL+EL+ERSS+I+M  +ARKNG PF+N   RGE  D   +  AF+ +  L 
Sbjct  487   NSMLKLFVMHLVELTERSSSIVMVQRARKNGFPFFNLPRRGEGHD--RVAGAFQAYSQLG  544

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRN---ELRHVN  877
             +V++RP+TAISA+SSMHEDI   AE KRVAMI LPFH+  + +G      N     R VN
Sbjct  545   RVTVRPTTAISALSSMHEDICHVAEEKRVAMIALPFHRSWRGEGDEAVEDNVGHGWRGVN  604

Query  876   RRVLEGAPCSVGILVDRGLGGTSHVSASNVDYT--ITVLYFGGHDDREALAYGARMVEHP  703
             +RVL+ APCSV +LVDRG  G S     ++     + VL+F G DDREAL  G RM EHP
Sbjct  605   QRVLKHAPCSVAVLVDRGFWGGSETPGPDMSTVQRVCVLFFSGPDDREALELGGRMAEHP  664

Query  702   GICLVVARFTLDPETAGT------------svkldvspsgssspeekSRDEDFLAAFKQR  559
              + + V RF   P+  G                   S +  +  +EK  D+  +  F+ R
Sbjct  665   VVKVTVMRFVERPDAGGNEITLRPSLSKSREKSYSFSIAQMNREKEKELDDRVVEEFQAR  724

Query  558   NSTNSSVKYEEKVVKSAAETMEAIRGYNRCNLLVV--GRMPEGEIVAAMDKKGECPELGP  385
                + +  Y E VV +  E + AI      +L+VV  GR P   +    D+  E PELGP
Sbjct  725   --WDGTAGYTETVVGNVVEQVLAIGRSKDFDLMVVGKGRFPSPMLADLADRPAEHPELGP  782

Query  384   LGNLLSCKEFSTTASVLVVQQY  319
             +G++L+        SVLV+QQ+
Sbjct  783   VGDVLASSSHGVACSVLVIQQH  804



>emb|CBI37527.3| unnamed protein product [Vitis vinifera]
Length=820

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/789 (51%), Positives = 551/789 (70%), Gaps = 22/789 (3%)
 Frame = -1

Query  2670  SAEIMGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLR  2491
             +A +  ++  +VC +P   T+NG +QGD+PLDY+LPL I+Q+ LVV+ TR+L ++L+PLR
Sbjct  5     TATVNRTDDMIVCYSPTMITTNGIWQGDNPLDYSLPLFILQLTLVVVTTRLLVFILKPLR  64

Query  2490  QPRVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPK  2311
             QPRVI+EI+GGVLLGPS  G++    N IFP +S+ VL+T+A++GLL+FLFLVG+E+D  
Sbjct  65    QPRVISEILGGVLLGPSVLGQNLHLANLIFPLRSVMVLETMANVGLLYFLFLVGVEMDLT  124

Query  2310  SLRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVL  2131
              +RRTGKKA++IA+ G+ LPF +G   S IL     + +++  F++F+GVALS+TAFPVL
Sbjct  125   VIRRTGKKAIAIAIIGMILPFIIGCAFSLILHHE-DRQMNRSTFVLFLGVALSVTAFPVL  183

Query  2130  ARILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFV  1951
             ARILAELKL+ T++G+MAMS+A +ND+ AW+LLA+AIAL+    S L SLWV+L    FV
Sbjct  184   ARILAELKLINTELGRMAMSSALINDMCAWVLLAVAIALAENESSSLASLWVILSSVFFV  243

Query  1950  LLCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVL  1771
             ++CI +V  +  WM  R  EGE   E Y+C IL  V+ +GFVTD IG H++FGAFV G++
Sbjct  244   VVCIFIVRPVISWMIRRTPEGESFSEFYICLILTGVMISGFVTDAIGTHSVFGAFVFGLV  303

Query  1770  VPKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGK  1591
             +P +G L   L+EK+ED VSGL LPL+F  SGLKT+V  I GA +WG L LVI  AC GK
Sbjct  304   IP-NGQLGVTLIEKLEDFVSGLLLPLFFAISGLKTDVTKIHGALTWGFLFLVIILACAGK  362

Query  1590  ILGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFT  1411
             I GT++V+   ++P +E I LG LMNTKGLVE+IVLN+G+D+ VL+D+TFAIMV +A+  
Sbjct  363   IAGTLIVALFYQMPLREGIVLGLLMNTKGLVEMIVLNVGRDQHVLDDETFAIMVTVAVIM  422

Query  1410  TFITTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRG  1231
             T I  PIV  +YKPA+     YK RTIQR  P  +LRIL C H+ RN+P++INL+EAS  
Sbjct  423   TSIIAPIVTHIYKPAR-KFIPYKRRTIQRSKPDGELRILVCIHTPRNVPTIINLLEASHP  481

Query  1230  TEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFE-H  1054
             ++KS    VY +HL+EL+ R+SA+L+ H  RK+G P  N     +D   I+ AFE +E H
Sbjct  482   SKKS-PICVYVLHLVELTGRASAMLIVHNTRKSGCPALNRTQAQSD--HIINAFENYEQH  538

Query  1053  LSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNR  874
              S VS++P TAIS  S+MHEDI   AE KRVA II+PFHK Q +DG  E T    R VN+
Sbjct  539   SSCVSVQPLTAISPYSTMHEDICNLAEDKRVAFIIIPFHKQQTVDGGMEATNPAFRAVNQ  598

Query  873   RVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGIC  694
              VL  APCSVGILVDRGL G++ ++AS V + I VL+FGG DDREAL+Y  RM EHPGI 
Sbjct  599   NVLANAPCSVGILVDRGLNGSTRLAASQVSHHIAVLFFGGPDDREALSYAERMSEHPGIS  658

Query  693   LVVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVK  514
             L V RF    ET  ++V+                DE+++  F+ +NS + S+ Y EK+V 
Sbjct  659   LTVMRFIAGDETVESTVEPSKKQL----------DEEYINDFRMKNSNDESIVYTEKIVN  708

Query  513   SAAETMEAIRGYNRC-NLLVVGRMPEGEI---VAAMDKKGECPELGPLGNLLSCKEFSTT  346
             +  ET+ A+R  +   +L +VGR  +G I    A +    ECPELG +G++L+  +F++T
Sbjct  709   NGEETVAAVRSIDSIHDLFIVGR-GQGMISPLTAGLTDWSECPELGAIGDMLASSDFAST  767

Query  345   ASVLVVQQY  319
              SVLVVQQY
Sbjct  768   VSVLVVQQY  776



>ref|XP_002974580.1| hypothetical protein SELMODRAFT_102077 [Selaginella moellendorffii]
 gb|EFJ24100.1| hypothetical protein SELMODRAFT_102077 [Selaginella moellendorffii]
Length=797

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/788 (53%), Positives = 552/788 (70%), Gaps = 26/788 (3%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             M  TS+G++Q D+P+D+ALPLL+VQ+C+V+ LTR LA +++PLRQPRV+AEIIGG+LLGP
Sbjct  1     MGITSHGAYQDDNPIDFALPLLMVQMCIVLALTRSLAIVMKPLRQPRVVAEIIGGILLGP  60

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SAFGR ++Y+N IFP KS+TVL+T A+LGL+FFLF+VGLELD  ++ RTG++AL IA AG
Sbjct  61    SAFGRKQSYINKIFPSKSITVLETFANLGLIFFLFMVGLELDLTAVMRTGRQALVIAAAG  120

Query  2262  ISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQ  2083
             I+ PF  G+G S +LR TI+K      FLVFMGVA+SITAFPVLARILAE KLLTTDVGQ
Sbjct  121   ITTPFATGVGVSVVLRNTISKEGKFSAFLVFMGVAMSITAFPVLARILAERKLLTTDVGQ  180

Query  2082  mamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMAS  1903
             +AMSAAAVNDV AWILLALA+ALSGT  SP +++WVLL G  ++++   VV R   W+A 
Sbjct  181   IAMSAAAVNDVVAWILLALAVALSGTDTSPTVAIWVLLTGLAYLVIMFTVVRRFMTWVAH  240

Query  1902  RCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVE  1723
               +E EPV E+YVC   A VL + F TD IGIH++FGAFV G+++PKDGPLA  ++EKVE
Sbjct  241   HVTENEPVKELYVCITFAGVLASAFATDVIGIHSIFGAFVFGLIIPKDGPLAKIVIEKVE  300

Query  1722  DLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQ  1543
             D V  L LPLYFVSSGLKTN+ +I GA+S GL VLVI +AC GKI+GT + + +  I  +
Sbjct  301   DFVIVLMLPLYFVSSGLKTNIQSIHGAKSGGLTVLVIASACLGKIVGTFVPAVVYGINPR  360

Query  1542  EAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAK  1363
             +A+TLGFLMNTKGLVELIVLNIGK+RGVLN++TFAIMV+MALFTTFITTPIV+ALYKPA+
Sbjct  361   KAMTLGFLMNTKGLVELIVLNIGKERGVLNEETFAIMVIMALFTTFITTPIVMALYKPAR  420

Query  1362  LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLME  1183
               +  Y  R ++    + +LR++ C H  +N+P +I+L++ +RG  +    ++Y +HL+E
Sbjct  421   TPI-PYTLRKLEMCTVNDELRVVACVHGIKNVPGIISLVDQARGRSRH-SMRLYILHLVE  478

Query  1182  LSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMSS  1003
             LSERSSAI+M H ARKNG    + RGE      I VAFE F HLS+V +RP T +S  S 
Sbjct  479   LSERSSAIVMVHTARKNGRLTKSARGE----NHIYVAFEAFGHLSEVKVRPMTVVSNFSD  534

Query  1002  MHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDRG  823
             MH+DI A+A  KR A++ILPFHK ++ DG  ET     + VN +VL+ APCSVGI +DRG
Sbjct  535   MHDDICATAADKRAAVLILPFHKIRRADGVLETLNTGFQFVNDQVLQHAPCSVGIFIDRG  594

Query  822   LGGTSHVSAS----NVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF--TLDPE  661
             L    H        +V +++ V +FGG DDREALA G RM EHPG+ + V  F    D E
Sbjct  595   LSDVYHAPVQLVPKSVSHSVAVFFFGGPDDREALAMGCRMAEHPGVKVKVIHFLSCSDGE  654

Query  660   TA--------GTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAA  505
                       G      V   G    +EK  D D +AA ++ +     + YE+  V    
Sbjct  655   VVTRRKSIREGEQHHYHVDLEGVDLEKEKQIDIDTIAALREED--KQGILYEQVPVGDPI  712

Query  504   E-TMEAIRGYNRCNLLVVG--RMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVL  334
             +  M+ +R     NL++VG  R+P   I +  +   E  ELGP+G++L+  + S  ASVL
Sbjct  713   DAVMDTVRNCEY-NLVIVGRARVPCRLIASLNNLALEYEELGPIGSVLASSDPSIKASVL  771

Query  333   VVQQYRTE  310
             V+QQY  +
Sbjct  772   VMQQYTNK  779



>gb|KFK34621.1| hypothetical protein AALP_AA5G169800 [Arabis alpina]
Length=835

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/804 (52%), Positives = 557/804 (69%), Gaps = 39/804 (5%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             +K +SNG +QGD+PL++A PLLIVQ  L++ ++R LA   +PLRQP+VIAEI+GG+LLGP
Sbjct  8     VKTSSNGVWQGDNPLNFAFPLLIVQTALIIAVSRSLAVFFKPLRQPKVIAEIVGGILLGP  67

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SA GR+ AY+++IFPK S+ +L+++AS+GLLFFLFLVGLELD  S+RR+GK+A  IA+AG
Sbjct  68    SALGRNTAYMDSIFPKWSMPILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIAVAG  127

Query  2262  ISLPFGLGIGTSFILRATIAKGVSQ---GPFLVFMGVALSITAFPVLARILAELKLLTTD  2092
             I+LPF  G+G SF++R T+     +     FLVFMGVALSITAFPVLARILAELKLLTT 
Sbjct  128   ITLPFIAGVGVSFVIRNTLYTAADKPGYAEFLVFMGVALSITAFPVLARILAELKLLTTQ  187

Query  2091  VGQmamsaaavndvaawillalaiaLSGTG------HSPLISLWVLLCGTGFVLLCILVV  1930
             +G+ AM+AAA NDVAAWILLALA+AL+G G       SPL+S+WVLL G GFV+  ++V+
Sbjct  188   IGETAMAAAAFNDVAAWILLALAVALAGNGGESGEKKSPLVSVWVLLSGVGFVVFMLVVI  247

Query  1929  PRIFKWMASRCS-EGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
                 KW+A R S E + V E YVC  LA V+ +GFVTD IGIH++FGAFV G+ +PKDG 
Sbjct  248   RPGMKWVAKRGSPENDVVRESYVCLTLAGVMVSGFVTDLIGIHSIFGAFVFGLTIPKDGE  307

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
                 L+E++ED VSGL LPLYF +SGLKT+VA I+G ++WG+L LV+ TAC GKI+GT +
Sbjct  308   FGQRLIERIEDFVSGLLLPLYFATSGLKTDVAKIRGGEAWGMLGLVVVTACVGKIVGTFV  367

Query  1572  VSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTP  1393
             V+ + ++P +EA+TLGFLMNTKGLVELIVLNIGK++ VLND+TFAI+VLMALFTTFITTP
Sbjct  368   VAVMVKVPAREALTLGFLMNTKGLVELIVLNIGKEKKVLNDETFAILVLMALFTTFITTP  427

Query  1392  IVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGG  1213
              V+A+YKPA+    + K  +  +    ++LRIL C H   N+ SLI+LIE+ R T K   
Sbjct  428   SVMAIYKPARGTHRKLKDLSASQDSSKEELRILACLHGPANVSSLISLIESIR-TTKILQ  486

Query  1212  FKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIR  1033
              K++ MHLMEL+ERSS+I+M  +ARKNGLPF +        + I+  FE +  L +V++R
Sbjct  487   LKLFVMHLMELTERSSSIIMVQRARKNGLPFVHRYRHGECHSSIIGGFEAYRQLGRVAVR  546

Query  1032  PSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKID-GHFETTRNE-------LRHVN  877
             P TAIS + +MHEDI   AE KRV M+ILPFHK   +D GH +   NE        R VN
Sbjct  547   PITAISPLPTMHEDICHMAETKRVTMVILPFHKRWNVDHGHQDGEGNEPENVGHGWRLVN  606

Query  876   RRVLEGAPCSVGILVDRGLGG----TSHVSASNVDYTITVLYFGGHDDREALAYGARMVE  709
              +VL+ APCSV +LVDRGLG      S +  SNV   + V++FGG DDREAL  G RM E
Sbjct  607   LKVLKNAPCSVAVLVDRGLGSIESQNSSIDGSNVVERVCVVFFGGPDDREALELGGRMAE  666

Query  708   HPGICLVVARF-----------TLDPETAGTsvkldvspsgssspeekSR-DEDFLAAFK  565
             HP + + V RF           TL P  + +  K     + +  PE++   DE  L  FK
Sbjct  667   HPAVKVTVIRFLVRETFRSNAVTLRPAPSKSKEKNYAILTTNVDPEKEKESDEGALEDFK  726

Query  564   QRNSTNSSVKYEEKVVKSAAETMEAIRGYNRCNLLVV--GRMPEGEIVAAMDKKGECPEL  391
              R      V Y+EK   +  E + AI   +  +L+VV  GR+P  E+ A  +++ E PEL
Sbjct  727   SR--WKDMVDYKEKEPNNIIEEVLAIGQCHDFDLIVVGRGRLPSAEVAALAERQAEHPEL  784

Query  390   GPLGNLLSCKEFSTTASVLVVQQY  319
             GP+G++L+       AS+LVVQQ+
Sbjct  785   GPIGDVLASSVNHIIASILVVQQH  808



>ref|XP_008342861.1| PREDICTED: cation/H(+) antiporter 15 [Malus domestica]
Length=857

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/818 (50%), Positives = 560/818 (68%), Gaps = 35/818 (4%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
             S+G++VC AP   T+NG +QGD+PLDY+LPL I+Q+ +VV+ TR+L  +L+P RQPRVI+
Sbjct  16    SDGSIVCYAPTMITTNGIWQGDNPLDYSLPLFILQLTMVVVTTRILVLILKPFRQPRVIS  75

Query  2472  EIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTG  2293
             EI+GGVLLGPS  G+S+ + N IFP +S+ VL+T+A++GLL+FLFLVGLE+D   +RR G
Sbjct  76    EILGGVLLGPSVLGKSDKFANTIFPLRSVMVLETMANVGLLYFLFLVGLEMDISVIRRMG  135

Query  2292  KKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAE  2113
             K+A+ IA++G+ LPF +G   SF+L     + ++QG F++F+GVALS+TAFPVLAR+LAE
Sbjct  136   KRAVVIAISGMILPFLIGAAFSFLLHKR-EQSMNQGTFILFLGVALSVTAFPVLARVLAE  194

Query  2112  LKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILV  1933
             LKL+ T++G++A+S+A VND+ AW LLA+AIAL+    + L SL+V+L    FVL+CI +
Sbjct  195   LKLINTELGRIALSSALVNDMCAWALLAIAIALAENDSTSLASLYVVLSSGAFVLVCIFI  254

Query  1932  VPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
             V     W+  R  EGE   E Y+C IL  V+ +GFVTD IG H++FGAFV G+++P +GP
Sbjct  255   VRPAICWLIRRTPEGETFSEFYICLILTGVMISGFVTDAIGTHSVFGAFVFGLVIP-NGP  313

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
             L + L+EK+ED VSGL LPL+F  SGL+TN+ +I G  +WG+L+LVIF AC GKI GT++
Sbjct  314   LGATLIEKLEDFVSGLLLPLFFAISGLRTNITSITGPGTWGILLLVIFLACIGKIAGTVI  373

Query  1572  VSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTP  1393
             V    ++PF E  TLG LMN KGLVELIVLN+GKD+ VL+D+ FAIMV++A+  T I TP
Sbjct  374   VCLFYQMPFDEGFTLGLLMNCKGLVELIVLNVGKDQKVLDDEAFAIMVIVAVVMTGIITP  433

Query  1392  IVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGG  1213
             IV  +YKPA+  +  YK R+IQR  P  +LRIL C H+ RN+P++INL+EAS  T++S  
Sbjct  434   IVTTVYKPARRFI-PYKRRSIQRSKPDAELRILVCVHTPRNVPTMINLLEASHPTKRS-P  491

Query  1212  FKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSK---V  1042
               VY +HL+ELS R+SA+L+ H  RK+G P  N     +D   I+ AFE +E  +    V
Sbjct  492   LCVYILHLVELSGRASAMLIVHNTRKSGRPALNRTQAQSD--HIINAFENYEQHAPGNCV  549

Query  1041  SIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLE  862
             S++P TAIS  S+MHEDI   AE KRVA +I+PFHK Q +DG  E      R +N+ VL 
Sbjct  550   SVQPLTAISPYSTMHEDICNLAEDKRVAFLIIPFHKQQTVDGGMEAMNPAFRTMNQNVLT  609

Query  861   GAPCSVGILVDRGLGGTSHVSASN-VDYTITVLYFGGHDDREALAYGARMVEHPGICLVV  685
              APCSVGILVDRGL G+S ++A+N + + + +L+FGG DDREAL+Y  RM EHPGI L V
Sbjct  610   NAPCSVGILVDRGLNGSSRLAAANQISHHVVILFFGGPDDREALSYAWRMSEHPGINLTV  669

Query  684   ARFTLDPETAGTsvkldvspsgssspeekSR--------------DEDFLAAFKQRNSTN  547
              RF +  E AG       S S        SR              DE+ +  F+ +N+  
Sbjct  670   MRF-VPGEEAGLERAASTSTSNVDGIGNNSRILSVEMDIGWEKQLDEELINDFRMKNANE  728

Query  546   SSVKYEEKVVKSAAETMEAIRGYNRC-NLLVVGRMPEGE-----IVAAMDKKGECPELGP  385
              SV Y EKVV +  ET+ AIR  +   +L +VGR   G+     + A +    ECPELG 
Sbjct  729   ESVVYTEKVVNNGEETVAAIRSMDNVHDLFIVGR---GQGMVSPLTAGLTDWSECPELGA  785

Query  384   LGNLLSCKEFSTTASVLVVQQYRTELSKNGLKEDDSVD  271
             +G+LL+  +F+ TASVLV+QQY  +    G  E D++D
Sbjct  786   IGDLLASSDFAATASVLVMQQYVGD-HDQGPAEVDTLD  822



>ref|XP_002963280.1| hypothetical protein SELMODRAFT_80221 [Selaginella moellendorffii]
 gb|EFJ35151.1| hypothetical protein SELMODRAFT_80221 [Selaginella moellendorffii]
Length=797

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/788 (53%), Positives = 553/788 (70%), Gaps = 26/788 (3%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             M  TS+G++Q D+P+D+ALPLL+VQ+C+V+ LTR LA +++PLRQPRV+AEIIGG+LLGP
Sbjct  1     MGITSHGAYQDDNPIDFALPLLMVQMCIVLALTRSLAIVMKPLRQPRVVAEIIGGILLGP  60

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SAFGR+++Y+N IFP +S+TVL+T A+LGL+FFLF+VGLELD  ++ RTG++AL IA AG
Sbjct  61    SAFGRNQSYINKIFPSRSITVLETFANLGLIFFLFMVGLELDLTAVMRTGRQALVIAAAG  120

Query  2262  ISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGQ  2083
             I+ PF  G+G S +LR TI+K      FLVFMGVA+SITAFPVLARILAE KLLTTDVGQ
Sbjct  121   ITTPFATGVGVSVVLRNTISKEGKFSAFLVFMGVAMSITAFPVLARILAERKLLTTDVGQ  180

Query  2082  mamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWMAS  1903
             +AMSAAAVNDV AWILLALA+ALSGT  SP +++WVLL G  ++++   VV R   W+A 
Sbjct  181   IAMSAAAVNDVVAWILLALAVALSGTDTSPTVAIWVLLTGLAYLVIMFTVVRRFMTWVAH  240

Query  1902  RCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEKVE  1723
               +E EPV E+YVC   A VL + F TD IGIH++FGAFV G+++PKDGPLA  ++EKVE
Sbjct  241   HVTENEPVKELYVCITFAGVLASAFATDVIGIHSIFGAFVFGLIIPKDGPLAKIVIEKVE  300

Query  1722  DLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIPFQ  1543
             D V  L LPLYFVSSGLKTN+ +I GA+S GL VLVI +AC GKI+GT + + +  I  +
Sbjct  301   DFVIVLMLPLYFVSSGLKTNIQSIHGAKSGGLTVLVIASACLGKIVGTFVPAVVYGINAR  360

Query  1542  EAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKPAK  1363
             +A+TLGFLMNTKGLVELIVLNIGK+RGVLN++TFAIMV+MALFTTFITTPIV+ALYKPA+
Sbjct  361   KAMTLGFLMNTKGLVELIVLNIGKERGVLNEETFAIMVIMALFTTFITTPIVMALYKPAR  420

Query  1362  LAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKVYAMHLME  1183
               +  Y  R ++    + +LR++ C H  +N+P +I+L++ +RG  +    ++Y +HL+E
Sbjct  421   TPI-PYTLRKLEMCTVNDELRVVACVHGIKNVPGIISLVDQARGRSRH-SMRLYILHLVE  478

Query  1182  LSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLSKVSIRPSTAISAMSS  1003
             LSERSSAI+M H AR+NG    + RGE      I VAFE F HLS+V +RP T +S  S 
Sbjct  479   LSERSSAIVMVHTARRNGRLTKSARGE----NHIYVAFEAFGHLSEVKVRPMTVVSNFSD  534

Query  1002  MHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCSVGILVDRG  823
             MH+DI A+A  KR A++ILPFHK ++ DG  ET     + VN +VL+ APCSVGI +DRG
Sbjct  535   MHDDICATAADKRAAVLILPFHKIRRADGVLETLNTGFQFVNDQVLQHAPCSVGIFIDRG  594

Query  822   LGGTSHVSAS----NVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF--TLDPE  661
             L    H        +V +++ V +FGG DDREALA G RM EHPG+ + V  F    D E
Sbjct  595   LSDVYHAPVQLVPKSVSHSVAVFFFGGPDDREALAMGCRMAEHPGVKVKVIHFLSCSDGE  654

Query  660   TA--------GTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAA  505
                       G      V   G    +EK  D D +AA ++ +     + YE+  V    
Sbjct  655   LVTHRKSIREGEQHHYHVDLEGVDFEKEKQIDIDTIAALREED--KQGILYEQVPVGDPI  712

Query  504   E-TMEAIRGYNRCNLLVVG--RMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVL  334
             +  M+ +R     NL++VG  R+P   I +  +   E  ELGP+G++L+  + S  ASVL
Sbjct  713   DAVMDTVRNCEY-NLVIVGRARVPCRLIASLNNLALEYEELGPIGSVLASSDPSIKASVL  771

Query  333   VVQQYRTE  310
             V+QQY  +
Sbjct  772   VMQQYTNK  779



>ref|XP_007048418.1| Cation/hydrogen exchanger 15 [Theobroma cacao]
 gb|EOX92575.1| Cation/hydrogen exchanger 15 [Theobroma cacao]
Length=830

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/805 (50%), Positives = 558/805 (69%), Gaps = 20/805 (2%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
             S  T+VC AP   T+NG +QGD+PLDY+LPL I+Q+ LVV+ TR+L ++L+PLRQPRVIA
Sbjct  11    SEDTIVCYAPTMITTNGVWQGDNPLDYSLPLFILQLTLVVVSTRILVFILKPLRQPRVIA  70

Query  2472  EIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTG  2293
             EI+GG+LLGPS  GRS+ + N +FP +S+ VL+T+A++GLL+FLFLVG+E+D   +RRTG
Sbjct  71    EILGGILLGPSVLGRSQGFANTLFPLRSVMVLETMANVGLLYFLFLVGVEMDLSVIRRTG  130

Query  2292  KKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAE  2113
             KKAL+IA++G+ LPF +G   +FIL    ++ + QG F++F+GVALS+TAFPVLARILA+
Sbjct  131   KKALAIAVSGMILPFLIGACFTFILHDQNSEALGQGTFILFLGVALSVTAFPVLARILAD  190

Query  2112  LKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILV  1933
             LKL+ +++G+MAMS+A +ND+ AW+LLA+AIAL+    S L S WV+L    FV+ CI V
Sbjct  191   LKLINSELGRMAMSSALINDMCAWVLLAIAIALAENDSSSLASFWVILSSVAFVVFCIFV  250

Query  1932  VPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
             V     W+  R  EGE   E Y+C IL  V+ +GF+TD IG H++FGAFV G+++P +GP
Sbjct  251   VRPAITWIIRRTPEGESFSEFYICLILTGVMISGFITDAIGTHSVFGAFVFGLIIP-NGP  309

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
             L   L+EK+ED VSGL LPL+F  SGLKT++  I+G Q+WG+L LVIF +C GKI GT+L
Sbjct  310   LGVTLIEKLEDFVSGLLLPLFFAISGLKTDIGAIKGGQTWGVLALVIFLSCAGKIAGTLL  369

Query  1572  VSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTP  1393
             V+T  ++P  E  TLG LMNTKGL+E++VLN+GKDR VL+D++FAIMV++A+  T I +P
Sbjct  370   VTTFYQMPLSEGFTLGLLMNTKGLIEMLVLNVGKDRKVLDDESFAIMVVVAVVMTGIISP  429

Query  1392  IVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGG  1213
             IV  +Y+P++  V  YK RTIQ      +LR+L C H+ RN+P++INL+EAS  T+KS  
Sbjct  430   IVSTIYRPSRRFV-PYKRRTIQTSKLDGELRVLVCIHNPRNVPTMINLLEASHPTKKS-P  487

Query  1212  FKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFE-HLSKVSI  1036
               +YA+HL+EL+ R+SA+L+ H  RK+G P  N     +D   I+ AFE FE H   VS+
Sbjct  488   ICIYALHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSD--HIINAFENFEQHAGCVSV  545

Query  1035  RPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGA  856
             +P TAIS  SSMHEDI + AE KRVA++I+PFHK Q +DG  E T    R VN+ +L  A
Sbjct  546   QPLTAISPYSSMHEDICSLAEDKRVALVIIPFHKQQTVDGGMEATNPAFRMVNQNLLANA  605

Query  855   PCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF  676
             PCSVGILVDRGL G+S ++A+ + + + VL+ GG DDREAL Y  RM EHPG  L V RF
Sbjct  606   PCSVGILVDRGLSGSSRLAANEMSHHVAVLFLGGPDDREALVYAWRMCEHPGTRLTVLRF  665

Query  675   ---------TLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEK  523
                      T+ P +     ++    + +S  ++   D++ +  F+ + + + SV Y EK
Sbjct  666   VPGEDAVESTMQPTSDQNDPRILTVETDNSKEKQL--DDECINDFRIKIANDESVTYTEK  723

Query  522   VVKSAAETMEAIRGYNRC-NLLVVGRMP--EGEIVAAMDKKGECPELGPLGNLLSCKEFS  352
             VV +  ET+ AIR  +   +L +VGR       +   +    ECPELG +G++L+  +F+
Sbjct  724   VVNNGEETVAAIRTLDSSHDLFIVGRGQGMMSPLTTGLTDWSECPELGAIGDILASSDFA  783

Query  351   TTASVLVVQQYRTELSKNGLKEDDS  277
             +T SVLV+QQY   L    +   DS
Sbjct  784   STVSVLVIQQYVGVLPLESIGTPDS  808



>ref|XP_010260095.1| PREDICTED: cation/H(+) antiporter 20 [Nelumbo nucifera]
Length=842

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/808 (53%), Positives = 561/808 (69%), Gaps = 46/808 (6%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             +K +S+G++QG++PL+YA PLLIVQ  LV++++R LA+LL+PLRQP+VIAEI+GG++LGP
Sbjct  8     IKTSSDGAWQGENPLNYAFPLLIVQTTLVIVISRCLAFLLKPLRQPKVIAEIVGGIILGP  67

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             S  GR++ YL+ IFP  S  +L+++AS+GLLFFLFLVGLELD  S+RR+G++AL IA AG
Sbjct  68    SVLGRNKTYLHRIFPSWSTPILESVASIGLLFFLFLVGLELDLNSIRRSGRRALGIAAAG  127

Query  2262  ISLPFGLGIGTSFILRATI--AKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDV  2089
             ISLPF  GIG +F+LR TI  A  V    F VFMGVALSITAFPVLARILAELKLLTT V
Sbjct  128   ISLPFVSGIGVAFVLRKTIDGADEVGYSQFFVFMGVALSITAFPVLARILAELKLLTTQV  187

Query  2088  GQmamsaaavndvaawillalaiaLSGTG-----HSPLISLWVLLCGTGFVLLCILVVPR  1924
             G+ AM+AAA NDVAAW+LLALA+AL+G G      SPL+S+WVLL G  FV+  ++V+  
Sbjct  188   GETAMAAAAFNDVAAWVLLALAVALAGNGTGGEHKSPLVSVWVLLSGVAFVVFMVVVIRP  247

Query  1923  IFKWMASRCS-EGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLA  1747
               +W+A RCS E E VDE Y+C  LA V+ +GF+TD IGIH++FGAFV G+++PK+G  A
Sbjct  248   AMRWVARRCSPEHEAVDEAYICLTLAGVMVSGFMTDLIGIHSIFGAFVFGLMIPKEGEFA  307

Query  1746  SALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVS  1567
               L+E++ED VSGL LPLYF SSGLKT+VATI+GAQSWGLL LVI TAC GKILGT LV+
Sbjct  308   ERLIERIEDFVSGLLLPLYFASSGLKTDVATIRGAQSWGLLALVISTACAGKILGTFLVA  367

Query  1566  TLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIV  1387
              L ++P +E++TLG LMNTKGLVELIVLNIGK++ VLN++TFAI+VLMAL TTFITTPIV
Sbjct  368   MLNKMPARESLTLGVLMNTKGLVELIVLNIGKEKKVLNEETFAILVLMALLTTFITTPIV  427

Query  1386  IALYKPAKLAVTEYKYRTIQRKDPS--------KQLRILTCFHSRRNIPSLINLIEASRG  1231
             +A+YKPA+ +      +  +   PS         +LRIL C H   N+PSLINLIE++RG
Sbjct  428   MAIYKPARRSSLRIPRKLQRDYSPSGASATKGGDELRILACVHGPANVPSLINLIESTRG  487

Query  1230  TEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFW------NTRGEPTDSTEIVVAF  1069
              +KS   K+Y MHL+EL+ERSS+I++  +AR NGLPF       N  GE  D   + VAF
Sbjct  488   PKKS-PLKLYIMHLVELTERSSSIVLARRARMNGLPFGGGHHLRNRGGEFHD--RVAVAF  544

Query  1068  ETFEHLSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNEL  889
             E +  L +V +RP TAISAM +MHED+   AE K V+MIILPFHKH + D   +   +  
Sbjct  545   EAYGQLGRVKVRPMTAISAMPTMHEDVCHVAEDKGVSMIILPFHKHGRGDAAMDNVGSGW  604

Query  888   RHVNRRVLEGAPCSVGILVDRGLGGTSH---VSASNVDYTITVLYFGGHDDREALAYGAR  718
             R VN+RVL  APCSV +LVDRGLGG +    V ++ V   + V++FGG DDREAL  G R
Sbjct  605   RGVNQRVLRNAPCSVAVLVDRGLGGQAQQTPVPSATVAQGVCVVFFGGPDDREALELGGR  664

Query  717   MVEHPGICLVVARFTLD-------------PETAGTsvkldvspsgssspeekSRDEDFL  577
             M EHPG+ + V RF  +             PE + +      S +      EK  DE  +
Sbjct  665   MAEHPGVKVTVLRFIENNGAESNGVLLRPTPEKS-SEKNYSFSTAVMDREREKEMDESAV  723

Query  576   AAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGYNRCNLLVV--GRMPEGEIVAAMDKKGE  403
             A F++R   +   +Y E+V  +  E + AI       L+VV  GR P   +    ++  +
Sbjct  724   AQFRRR--WDGLAEYTERVASNIVEGVLAIGRSGEFELIVVGRGRFPSKMVAELAERTAD  781

Query  402   CPELGPLGNLLSCKEFSTTASVLVVQQY  319
               ELGP+G++L+       +SVLV+QQ+
Sbjct  782   HAELGPIGDILASPGHGVVSSVLVIQQH  809



>ref|XP_009112897.1| PREDICTED: cation/H(+) antiporter 16 [Brassica rapa]
Length=786

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/790 (54%), Positives = 560/790 (71%), Gaps = 60/790 (8%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             MKATSNG FQG+SPLD+ALPL+I+QICLVV +TR LA+LLRP+RQPRV+AEIIGG+LLGP
Sbjct  16    MKATSNGVFQGESPLDFALPLVILQICLVVAVTRSLAFLLRPMRQPRVVAEIIGGILLGP  75

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SA GR  AY N++FP KSLTVLDTLA+LGLL FLFLVGLE+D KSLRRTGKKA+SIA AG
Sbjct  76    SALGRVTAYKNSLFPAKSLTVLDTLANLGLLLFLFLVGLEIDLKSLRRTGKKAISIAAAG  135

Query  2262  ISLPFGLGIGTSFILR--ATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDV  2089
             + LPF +G+ TSF     ++ +   ++ PF++FMGVALS+TAF VLARILAELKLLTTD+
Sbjct  136   MLLPFAMGVVTSFAFPEISSTSGDDNRAPFIIFMGVALSLTAFGVLARILAELKLLTTDL  195

Query  2088  GQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPRIFKWM  1909
             G++++S+AA+NDV AWILLALAI+LSG   S L+ LWVLL GT FV+ C ++ P IFK +
Sbjct  196   GRISISSAAINDVFAWILLALAISLSGDRSSLLVPLWVLLSGTAFVIACFIIAPLIFKLI  255

Query  1908  ASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLASALVEK  1729
             + RC EGEP+ E YVC  L AVL AGF TD IGIHA+FGAFVIGVL PK G  A A+VEK
Sbjct  256   SRRCPEGEPISEKYVCLALCAVLVAGFATDAIGIHAIFGAFVIGVLFPK-GHFADAIVEK  314

Query  1728  VEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVSTLCRIP  1549
             +EDLV GL LPLYFV SGL+T++ TI G +SWG L LVI TACFGKI+GT+  + L ++ 
Sbjct  315   IEDLVMGLLLPLYFVMSGLETDITTIHGLKSWGRLALVIVTACFGKIVGTVSAALLSKVG  374

Query  1548  FQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVIALYKP  1369
              ++++ LG LMNT+GLVELIVLNIGKDR VL+DQTFAIMVLMA+FTTFITTP+V+ALYKP
Sbjct  375   LRDSLVLGVLMNTRGLVELIVLNIGKDRKVLSDQTFAIMVLMAIFTTFITTPLVMALYKP  434

Query  1368  AKLAVTE----YKYRTIQRK-------DPSKQLRILTCFHSRRNIPSLINLIEASRG--T  1228
             ++   T+    YK R  +RK       + ++QL++L C  S R+I  ++ LIEASRG   
Sbjct  435   SETTQTQDNDSYKNRKRRRKIESDREEEQTQQLKVLICLQSGRDINPMVKLIEASRGGRN  494

Query  1227  EKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFEHLS  1048
             +    F VY MH  +            KAR+NGL FWN + +      +VVAFE   ++ 
Sbjct  495   QTKESFCVYVMHYTQ------------KARRNGLCFWNKKRD-----NVVVAFEASCNVR  537

Query  1047  KVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKH-QKIDGHFETTRNELRHVNRR  871
              VS+R  TAIS + ++HEDI +SA+ K  A +ILPFH+    ++  FE  R+E + +N+R
Sbjct  538   NVSVRSVTAISPLLAVHEDICSSADSKHAAFVILPFHRQWSSLEQEFERVRSEFQGINKR  597

Query  870   VLEGAPCSVGILVDRGLGGTSH----VSASNVDYTITVLYFGGHDDREALAYGARMVEHP  703
             VLE +PCSVGILVDR  GG S     V++S+   +++VL+FGG DDREALAYG RM EHP
Sbjct  598   VLENSPCSVGILVDR--GGLSDNGSAVASSSFSLSVSVLFFGGGDDREALAYGLRMAEHP  655

Query  702   GICLVVARFTLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEK  523
              + L +   +  PE + +            +  E      FLAA K + +  +  ++EE+
Sbjct  656   EVKLTIVAIS-GPEISKS------------NILEAQETSRFLAAIKNKGAVPT--RFEER  700

Query  522   VVKSAAETMEAIRGYNRCNLLVVGRMPEGEIVAAMD--KKGECPELGPLGNLLSCKEFST  349
             +V S  E ++ I+ +  C++L+VG+  E   V+ +    K + PELGP+GNL+     ST
Sbjct  701   IVNSTGEAVKIIQEFCECDILLVGKSSERPFVSKLPVMMKMDYPELGPVGNLIL---MST  757

Query  348   TASVLVVQQY  319
             + SVLVVQQY
Sbjct  758   SVSVLVVQQY  767



>ref|XP_004147368.1| PREDICTED: cation/H(+) antiporter 15-like [Cucumis sativus]
 ref|XP_004164295.1| PREDICTED: cation/H(+) antiporter 15-like [Cucumis sativus]
 gb|KGN62161.1| hypothetical protein Csa_2G302270 [Cucumis sativus]
Length=837

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/805 (48%), Positives = 556/805 (69%), Gaps = 24/805 (3%)
 Frame = -1

Query  2655  GSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVI  2476
             G++ T+VC AP   T+NG +QGD+PLDY+LPL I+Q+ +VV++TR+L +LL+P RQPRVI
Sbjct  10    GTDDTIVCYAPTMITTNGVWQGDNPLDYSLPLFILQLTMVVVMTRILVFLLKPFRQPRVI  69

Query  2475  AEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRT  2296
             +EI+GGV+LGPS  GRS  + N +FP +S+ VL+T+A++GLL+FLFLVG+E+D   +RRT
Sbjct  70    SEILGGVILGPSVLGRSSKFANTVFPLRSVMVLETMANVGLLYFLFLVGVEMDLSVIRRT  129

Query  2295  GKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILA  2116
             GKKA++IA+AG+ LPFG+G   SF L    ++ ++   +++F+G+ALS+TAFPVLARILA
Sbjct  130   GKKAMAIAVAGMILPFGIGAAFSFQLHKE-SQKLNYNTYIMFLGIALSVTAFPVLARILA  188

Query  2115  ELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCIL  1936
             ELKL+ +++G+MAM++A  ND+ AW+LLALAIALS    S   SLWV+L    FVL CI 
Sbjct  189   ELKLINSELGRMAMASALFNDMCAWVLLALAIALSENDSSSFASLWVVLSSAAFVLFCIF  248

Query  1935  VVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDG  1756
             +V  +  WM  +  EGE V E Y+C IL  V+ +GFVTD IG H++FGAFV G+++P +G
Sbjct  249   IVRPMISWMIRKTPEGESVSEFYICLILTGVMISGFVTDAIGTHSVFGAFVFGLVIP-NG  307

Query  1755  PLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTI  1576
              L  AL+EK+ED VSGL LPL+F  SGLKTN+++I+G  +W  ++ +   A  GK++GT+
Sbjct  308   SLGVALIEKLEDFVSGLLLPLFFAISGLKTNISSIEGIFAWISILCITLLAFLGKVIGTL  367

Query  1575  LVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITT  1396
             L S   ++ ++E +TLG LMNTKGL+E+I+LN+GKD+ VL+DQTF +MV++AL  T I T
Sbjct  368   LASICYQMSYREGVTLGLLMNTKGLIEMIILNVGKDQKVLDDQTFTVMVIVALIMTGIIT  427

Query  1395  PIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSG  1216
             P+V  +Y+P +     YK RTIQ   P  + R+L C H+ RN+P++INL++AS  T++S 
Sbjct  428   PVVTIIYRPTR-RFLPYKKRTIQASKPDSEFRVLVCIHTPRNVPTIINLLDASHPTKRS-  485

Query  1215  GFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFE-HLSKVS  1039
                +Y +HL+EL+ R+SA+L+ H  RK+G P  N     +D   I+ AFE +E H+  VS
Sbjct  486   PICIYVLHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSD--HIINAFENYEQHVDCVS  543

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             ++P TAIS  S+MHEDI   AE KRVA II+PFHK Q +DG  E +    R VN+ VL  
Sbjct  544   VQPLTAISPYSTMHEDICNLAEDKRVAFIIIPFHKQQTVDGGMEASNPAFRLVNQNVLAN  603

Query  858   APCSVGILVDRGLGGTSHVSASN-VDYTITVLYFGGHDDREALAYGARMVEHPGICLVVA  682
             APCSVGILVDRGL G +  +++    Y I VL+FGG DDREAL+Y  RM EHPG+ L V 
Sbjct  604   APCSVGILVDRGLNGANRATSNKGTHYNIIVLFFGGQDDREALSYAWRMSEHPGVNLTVM  663

Query  681   RF-----TLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVV  517
             RF      ++P+    + ++    +  +   +   DED ++ F+ RN  + S+ Y EKV+
Sbjct  664   RFIAAQEIMEPKLEENTSRISTMETEMNRDRKL--DEDHISEFRARNPNSESITYTEKVL  721

Query  516   KSAAETMEAIRGYNRC-NLLVVGRMPEGE-----IVAAMDKKGECPELGPLGNLLSCKEF  355
              +  ET+ AIR  N   +L +VGR   GE     + A +    ECPELG +G+LL+  +F
Sbjct  722   NNGEETVAAIRSMNDAHDLFIVGR---GESHISPLTAGLTDWSECPELGAIGDLLASSDF  778

Query  354   STTASVLVVQQYRTELSKNGLKEDD  280
             + T SVLVVQQ+ T ++    +E++
Sbjct  779   AATTSVLVVQQFGTTMAGEHGEEEE  803



>ref|XP_002262677.2| PREDICTED: cation/H(+) antiporter 15 [Vitis vinifera]
Length=837

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/796 (51%), Positives = 556/796 (70%), Gaps = 19/796 (2%)
 Frame = -1

Query  2670  SAEIMGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLR  2491
             +A +  ++  +VC +P   T+NG +QGD+PLDY+LPL I+Q+ LVV+ TR+L ++L+PLR
Sbjct  5     TATVNRTDDMIVCYSPTMITTNGIWQGDNPLDYSLPLFILQLTLVVVTTRLLVFILKPLR  64

Query  2490  QPRVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPK  2311
             QPRVI+EI+GGVLLGPS  G++    N IFP +S+ VL+T+A++GLL+FLFLVG+E+D  
Sbjct  65    QPRVISEILGGVLLGPSVLGQNLHLANLIFPLRSVMVLETMANVGLLYFLFLVGVEMDLT  124

Query  2310  SLRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVL  2131
              +RRTGKKA++IA+ G+ LPF +G   S IL     + +++  F++F+GVALS+TAFPVL
Sbjct  125   VIRRTGKKAIAIAIIGMILPFIIGCAFSLILHHE-DRQMNRSTFVLFLGVALSVTAFPVL  183

Query  2130  ARILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFV  1951
             ARILAELKL+ T++G+MAMS+A +ND+ AW+LLA+AIAL+    S L SLWV+L    FV
Sbjct  184   ARILAELKLINTELGRMAMSSALINDMCAWVLLAVAIALAENESSSLASLWVILSSVFFV  243

Query  1950  LLCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVL  1771
             ++CI +V  +  WM  R  EGE   E Y+C IL  V+ +GFVTD IG H++FGAFV G++
Sbjct  244   VVCIFIVRPVISWMIRRTPEGESFSEFYICLILTGVMISGFVTDAIGTHSVFGAFVFGLV  303

Query  1770  VPKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGK  1591
             +P +G L   L+EK+ED VSGL LPL+F  SGLKT+V  I GA +WG L LVI  AC GK
Sbjct  304   IP-NGQLGVTLIEKLEDFVSGLLLPLFFAISGLKTDVTKIHGALTWGFLFLVIILACAGK  362

Query  1590  ILGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFT  1411
             I GT++V+   ++P +E I LG LMNTKGLVE+IVLN+G+D+ VL+D+TFAIMV +A+  
Sbjct  363   IAGTLIVALFYQMPLREGIVLGLLMNTKGLVEMIVLNVGRDQHVLDDETFAIMVTVAVIM  422

Query  1410  TFITTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRG  1231
             T I  PIV  +YKPA+  +  YK RTIQR  P  +LRIL C H+ RN+P++INL+EAS  
Sbjct  423   TSIIAPIVTHIYKPARKFI-PYKRRTIQRSKPDGELRILVCIHTPRNVPTIINLLEASHP  481

Query  1230  TEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFE-H  1054
             ++KS    VY +HL+EL+ R+SA+L+ H  RK+G P  N     +D   I+ AFE +E H
Sbjct  482   SKKS-PICVYVLHLVELTGRASAMLIVHNTRKSGCPALNRTQAQSD--HIINAFENYEQH  538

Query  1053  LSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNR  874
              S VS++P TAIS  S+MHEDI   AE KRVA II+PFHK Q +DG  E T    R VN+
Sbjct  539   SSCVSVQPLTAISPYSTMHEDICNLAEDKRVAFIIIPFHKQQTVDGGMEATNPAFRAVNQ  598

Query  873   RVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGIC  694
              VL  APCSVGILVDRGL G++ ++AS V + I VL+FGG DDREAL+Y  RM EHPGI 
Sbjct  599   NVLANAPCSVGILVDRGLNGSTRLAASQVSHHIAVLFFGGPDDREALSYAERMSEHPGIS  658

Query  693   LVVARFTLDPETAGTsvkldv-------spsgssspeekSRDEDFLAAFKQRNSTNSSVK  535
             L V RF    ET  ++V+              + S  EK  DE+++  F+ +NS + S+ 
Sbjct  659   LTVMRFIAGDETVESTVEPSSDPNDPRILTVITDSDREKQLDEEYINDFRMKNSNDESIV  718

Query  534   YEEKVVKSAAETMEAIRGYNRC-NLLVVGRMPEGEI---VAAMDKKGECPELGPLGNLLS  367
             Y EK+V +  ET+ A+R  +   +L +VGR  +G I    A +    ECPELG +G++L+
Sbjct  719   YTEKIVNNGEETVAAVRSIDSIHDLFIVGR-GQGMISPLTAGLTDWSECPELGAIGDMLA  777

Query  366   CKEFSTTASVLVVQQY  319
               +F++T SVLVVQQY
Sbjct  778   SSDFASTVSVLVVQQY  793



>ref|XP_006409680.1| hypothetical protein EUTSA_v10023201mg [Eutrema salsugineum]
 gb|ESQ51133.1| hypothetical protein EUTSA_v10023201mg [Eutrema salsugineum]
Length=810

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/785 (49%), Positives = 549/785 (70%), Gaps = 22/785 (3%)
 Frame = -1

Query  2652  SNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIA  2473
             ++ +++C AP   T+NG +QGD+PLD++LPL ++Q+ LVV++TR   ++L+P RQPRVI+
Sbjct  8     TDTSIICYAPSMITTNGVWQGDNPLDFSLPLFVLQLTLVVVITRFFVFILKPFRQPRVIS  67

Query  2472  EIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTG  2293
             EI+GG++LGPS  GR   + N IFP++S+ VL+T+A++GLL+FLFLVG+E+D   +R+TG
Sbjct  68    EILGGIVLGPSLLGRYTKFANTIFPQRSVMVLETMANVGLLYFLFLVGVEMDIMVVRKTG  127

Query  2292  KKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAE  2113
             K+AL+IA+ G+ LPF +G   SF +  +    + QG +++F+GVALS+TAFPVLARILAE
Sbjct  128   KRALTIAIGGMVLPFLIGAAFSFSMHRS-DDHLGQGTYILFLGVALSVTAFPVLARILAE  186

Query  2112  LKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILV  1933
             LKL+ T++G+++MSAA VND+ AWILLALAIAL+ +  +   SLWV++    F+ +C+ V
Sbjct  187   LKLINTEIGRISMSAALVNDMFAWILLALAIALAESDKTSFASLWVMISSAAFIAICVFV  246

Query  1932  VPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGP  1753
             V     W+  +  EGE   E Y+C IL  V+ +GF+TD IG H++FGAFV G+++P +GP
Sbjct  247   VRPGISWIIRKTPEGENFSEFYICLILTGVMISGFITDAIGTHSVFGAFVFGLVIP-NGP  305

Query  1752  LASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTIL  1573
             L   L+EK+ED VSGL LPL+F  SGLKTN+A+IQG  +W  L+LVIF AC GK++GT++
Sbjct  306   LGLTLIEKLEDFVSGLLLPLFFAISGLKTNIASIQGPATWLTLMLVIFLACAGKVIGTVI  365

Query  1572  VSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTP  1393
             V+    +P +E ITLG L+NTKGLVE+IVLN+GKD+ VL+D+TFA MVL+AL  T + TP
Sbjct  366   VAFFHGMPVREGITLGLLLNTKGLVEMIVLNVGKDQKVLDDETFATMVLVALVMTGVITP  425

Query  1392  IVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGG  1213
             IV  LY+P K +V+ YK RTIQ+  P  +LR+L C H+ RN+P++INL+EAS  T++S  
Sbjct  426   IVTILYRPVKRSVS-YKRRTIQQTKPDSELRVLVCVHTPRNVPTIINLLEASHPTKRS-P  483

Query  1212  FKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFE-HLSKVSI  1036
               +Y +HL+EL+ R+SA+L+ H  RK+G P  N     +D   I+ AFE +E H + V++
Sbjct  484   ICIYILHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSD--HIINAFENYEQHAAFVAV  541

Query  1035  RPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGA  856
             +P TAIS  S+MHED+ + AE KRV+ II+PFHK Q +DG  E T    R VN+ +LE +
Sbjct  542   QPLTAISPYSTMHEDVCSLAEDKRVSFIIIPFHKQQTVDGGMEATNPAYRLVNQNLLENS  601

Query  855   PCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF  676
             PCSVGILVDRGL G + ++++ +   + VLYFGG DDREALAY  RM EHPGI L V RF
Sbjct  602   PCSVGILVDRGLNGATRLTSNTISLQVAVLYFGGPDDREALAYAWRMAEHPGITLTVLRF  661

Query  675   TLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETM  496
               D +    +                  D++++ AF+  N+   S+ Y EK+V +  ET+
Sbjct  662   IPDEDVTSDTNLKVDLKKQRQL------DDEYINAFRVENADQESIVYIEKIVSNGEETV  715

Query  495   EAIRGYNRC-NLLVVGRMPEGE-----IVAAMDKKGECPELGPLGNLLSCKEFSTTASVL  334
              A+R  +   +L +VGR   GE     + A +    ECPELG +G+LL+  +F+ T SVL
Sbjct  716   AAVRSMDSSHDLFIVGR---GEGMSSPLTAGLTDWSECPELGAIGDLLASSDFAATVSVL  772

Query  333   VVQQY  319
             VVQQY
Sbjct  773   VVQQY  777



>emb|CAN66285.1| hypothetical protein VITISV_011183 [Vitis vinifera]
Length=837

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/796 (51%), Positives = 555/796 (70%), Gaps = 19/796 (2%)
 Frame = -1

Query  2670  SAEIMGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLR  2491
             +A +  ++  +VC +P   T+NG +QGD+PLDY+LPL I+Q+ LVV+ TR+L ++L+PLR
Sbjct  5     TATVNRTDDMIVCYSPTMITTNGIWQGDNPLDYSLPLFILQLTLVVVTTRLLVFILKPLR  64

Query  2490  QPRVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPK  2311
             QPRVI+EI+GGVLLGPS  G++    N IFP +S+ VL+T+A++GLL+FLFLVG+E+D  
Sbjct  65    QPRVISEILGGVLLGPSVLGQNLHLANLIFPLRSVMVLETMANVGLLYFLFLVGVEMDLT  124

Query  2310  SLRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVL  2131
              +RRTGKKA++IA+ G+ LPF +G   S IL     + +++  F++F+GVALS+TAFPVL
Sbjct  125   VIRRTGKKAIAIAIIGMILPFIIGCAFSLILHHE-DRQMNRSTFVLFLGVALSVTAFPVL  183

Query  2130  ARILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFV  1951
             ARILAELKL+ T++G+MAMS+A +ND+ AW+LLA+AIAL+    S L SLWV+L    FV
Sbjct  184   ARILAELKLINTELGRMAMSSALINDMCAWVLLAVAIALAENESSSLASLWVILSSVFFV  243

Query  1950  LLCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVL  1771
             ++CI +V  +  WM  R  EGE   E Y+C IL  V+ +GFVTD IG H++FGAFV G++
Sbjct  244   VVCIFIVRPVISWMIRRTPEGESFSEFYICLILTGVMISGFVTDAIGTHSVFGAFVFGLV  303

Query  1770  VPKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGK  1591
             +P +G L   L+EK+ED VSGL LPL+F  SGLKT+V  I GA +WG L LVI  AC GK
Sbjct  304   IP-NGQLGVTLIEKLEDFVSGLLLPLFFAISGLKTDVTKIHGALTWGFLFLVIILACAGK  362

Query  1590  ILGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFT  1411
             I GT++V+   ++P +E I LG LMNTKGLVE+IVLN+G+D+ VL+D+TFAIMV +A+  
Sbjct  363   IAGTLIVALFYQMPLREGIVLGLLMNTKGLVEMIVLNVGRDQHVLDDETFAIMVTVAVIM  422

Query  1410  TFITTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRG  1231
             T I  PIV  +YKPA+  +  YK RTIQR  P  +LRIL C H+ RN+P++INL+EAS  
Sbjct  423   TSIIAPIVTHIYKPARKFI-PYKRRTIQRSKPDGELRILVCIHTPRNVPTIINLLEASHP  481

Query  1230  TEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFE-H  1054
             ++KS     Y +HL+EL+ R+SA+L+ H  RK+G P  N     +D   I+ AFE +E H
Sbjct  482   SKKS-PICXYVLHLVELTGRASAMLIVHNTRKSGCPALNRTQAQSD--HIINAFENYEQH  538

Query  1053  LSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNR  874
              S VS++P TAIS  S+MHEDI   AE KRVA II+PFHK Q +DG  E T    R VN+
Sbjct  539   SSCVSVQPLTAISPYSTMHEDICNLAEDKRVAFIIIPFHKQQTVDGGMEATNPAFRAVNQ  598

Query  873   RVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGIC  694
              VL  APCSVGILVDRGL G++ ++AS V + I VL+FGG DDREAL+Y  RM EHPGI 
Sbjct  599   NVLANAPCSVGILVDRGLNGSTRLAASQVSHHIAVLFFGGPDDREALSYAERMSEHPGIS  658

Query  693   LVVARFTLDPETAGTsvkldv-------spsgssspeekSRDEDFLAAFKQRNSTNSSVK  535
             L V RF    ET  ++V+              + S  EK  DE+++  F+ +NS + S+ 
Sbjct  659   LTVMRFIAGDETVESTVEPSSDPNDPRILTVITDSDREKQLDEEYINDFRMKNSNDESIV  718

Query  534   YEEKVVKSAAETMEAIRGYNRC-NLLVVGRMPEGEI---VAAMDKKGECPELGPLGNLLS  367
             Y EK+V +  ET+ A+R  +   +L +VGR  +G I    A +    ECPELG +G++L+
Sbjct  719   YTEKIVNNGEETVAAVRSIDSIHDLFIVGR-GQGMISPLTAGLTDWSECPELGAIGDMLA  777

Query  366   CKEFSTTASVLVVQQY  319
               +F++T SVLVVQQY
Sbjct  778   SSDFASTVSVLVVQQY  793



>ref|XP_008461025.1| PREDICTED: cation/H(+) antiporter 15 [Cucumis melo]
Length=837

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/792 (49%), Positives = 550/792 (69%), Gaps = 24/792 (3%)
 Frame = -1

Query  2655  GSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVI  2476
             G++ T+VC AP   T+NG +QGD+PLDY+LPL I+Q+ +VV++TR+L +LL+P RQPRVI
Sbjct  10    GTDDTIVCYAPTMITTNGVWQGDNPLDYSLPLFILQLTMVVVMTRILVFLLKPFRQPRVI  69

Query  2475  AEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRT  2296
             +EI+GGV+LGPS  GRS  + N +FP +S+ VL+T+A++GLL+FLFLVG+E+D   +RRT
Sbjct  70    SEILGGVILGPSVLGRSSRFANTVFPLRSVMVLETMANVGLLYFLFLVGVEMDLSVIRRT  129

Query  2295  GKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILA  2116
             GKKA++IA+AG+ LPFG+G   SF L     + ++   +++F+G+ALS+TAFPVLARILA
Sbjct  130   GKKAMAIAVAGMILPFGIGAAFSFQLHKE-GQKLNYNTYIMFLGIALSVTAFPVLARILA  188

Query  2115  ELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCIL  1936
             ELKL+ +++G+MAM++A  ND+ AW+LLALAIALS    S L SLWV+L   GFVL CI 
Sbjct  189   ELKLINSELGRMAMASALFNDMCAWVLLALAIALSENDSSSLASLWVVLSSAGFVLFCIF  248

Query  1935  VVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDG  1756
             +V  +  WM  +  EGE V E Y+C IL  V+ +GFVTD IG H++FGAFV G+++P +G
Sbjct  249   IVRPMISWMIRKTPEGESVSEFYICLILTGVMISGFVTDAIGTHSVFGAFVFGLVIP-NG  307

Query  1755  PLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTI  1576
              L  AL+EK+ED VSGL LPL+F  SGLKTNV+++ G  +W  ++ +   A  GK++GT+
Sbjct  308   SLGVALIEKLEDFVSGLLLPLFFAISGLKTNVSSVDGLFAWISILCITLLAFVGKVIGTL  367

Query  1575  LVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITT  1396
             L S   ++ ++E +TLG LMNTKGL+E+I+LN+GKD+ VL+DQTF +MV++AL  T I T
Sbjct  368   LASICYQMSYREGVTLGLLMNTKGLIEMIILNVGKDQKVLDDQTFTVMVIVALIMTGIIT  427

Query  1395  PIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSG  1216
             P+V  +Y+P +     YK RTIQ   P  + R+L C H+ RN+P++I+L++AS  T++S 
Sbjct  428   PVVTIIYRPTR-RFLPYKKRTIQASKPDSEFRVLVCVHTPRNVPTIISLLDASHPTKRS-  485

Query  1215  GFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFE-HLSKVS  1039
                +Y +HL+EL+ R+SA+L+ H  RK+G P  N     +D   I+ AFE +E H+  VS
Sbjct  486   PICIYVLHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSD--HIINAFENYEQHVDCVS  543

Query  1038  IRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEG  859
             ++P TAIS  S+MHEDI   AE KRVA II+PFHK Q +DG  E T    R VN+ VL  
Sbjct  544   VQPLTAISPYSTMHEDICNLAEDKRVAFIIIPFHKQQTVDGGMEATNPAFRLVNQNVLAN  603

Query  858   APCSVGILVDRGLGGTSHVSASN-VDYTITVLYFGGHDDREALAYGARMVEHPGICLVVA  682
             APCSVGILVDRGL G + V+++    Y I VL+FGG DDREAL+Y  RM EHPG+ L V 
Sbjct  604   APCSVGILVDRGLNGANRVASNKATHYNIIVLFFGGQDDREALSYAWRMSEHPGVNLTVM  663

Query  681   RF-----TLDPETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVV  517
             RF      ++P+   ++ ++    +      +   DED++  F+ RN  + S+ Y EKV+
Sbjct  664   RFIAAQEIMEPKPEESTPRISTMETEIKRDRKL--DEDYINEFRARNPNSESITYTEKVL  721

Query  516   KSAAETMEAIRGYNRC-NLLVVGRMPEGE-----IVAAMDKKGECPELGPLGNLLSCKEF  355
              +  ET+ AIR  +   +L +VGR   GE     + A +    ECPELG +G+LL+  +F
Sbjct  722   NNGEETVAAIRSMDDAHDLFIVGR---GESHISPLTAGLTDWSECPELGAIGDLLASSDF  778

Query  354   STTASVLVVQQY  319
             + T SVLVVQQ+
Sbjct  779   AATTSVLVVQQF  790



>ref|XP_002970274.1| hypothetical protein SELMODRAFT_231581 [Selaginella moellendorffii]
 gb|EFJ28404.1| hypothetical protein SELMODRAFT_231581 [Selaginella moellendorffii]
Length=795

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/789 (53%), Positives = 539/789 (68%), Gaps = 29/789 (4%)
 Frame = -1

Query  2658  MGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRV  2479
             M +N    C      TS+G +QGD+P++++L LLIVQI LV+ +TRVL  LL+PLRQPRV
Sbjct  1     MAANSNSTCKLA-STTSHGIWQGDNPIEFSLSLLIVQIILVLTVTRVLGLLLKPLRQPRV  59

Query  2478  IAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRR  2299
             IAEIIGGVLLGPSA GR+  YL  IF K+SL++L T A++GL+FFLF+VGLELD  SL+R
Sbjct  60    IAEIIGGVLLGPSALGRNSDYLAKIFTKQSLSILTTFANMGLMFFLFMVGLELDLASLKR  119

Query  2298  TGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARIL  2119
             TGK+A +I++AGISLPF  G+G SF+L  T+       PFLVFMGVALSITAFPVLARIL
Sbjct  120   TGKQAAAISIAGISLPFAAGVGVSFVLHNTVNPDTKLIPFLVFMGVALSITAFPVLARIL  179

Query  2118  AELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCI  1939
             AE +LLTTDVG+MA++AAA NDV AWI LALA+ALSGTG SP ++ W+LLCG  FVL   
Sbjct  180   AERRLLTTDVGKMAIAAAAANDVVAWIFLALAVALSGTGRSPAVAAWILLCGVAFVLAMF  239

Query  1938  LVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKD  1759
             L V  +  W+ASR    +PV E+YVC  L  VL +GFVTD IGIH +FGAFV G+++P +
Sbjct  240   LFVKPLMAWIASRSPADQPVKELYVCIALGGVLVSGFVTDFIGIHGIFGAFVFGLIIP-E  298

Query  1758  GPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGT  1579
             G  A AL+EK+ED V+ L LPLYF +SGL+T++ +I GA+S+GLLVLVI TAC GKILGT
Sbjct  299   GHFAHALIEKIEDFVNILMLPLYFAASGLQTDIGSISGARSFGLLVLVIVTACGGKILGT  358

Query  1578  ILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFIT  1399
             + VS      F++A+TLGFLMNTKGLVELIVLNIGK+R VLN++ FAIMV+MALFTTFIT
Sbjct  359   LAVSMAYGENFRKALTLGFLMNTKGLVELIVLNIGKERKVLNEEMFAIMVIMALFTTFIT  418

Query  1398  TPIVIALYKPAKLAVTEYKYRTIQRKDP-----SKQLRILTCFHSRRNIPSLINLIEASR  1234
             TP+V+ALYKPA+  V  YK R + R  P     +KQLR+L C H  +N+P+++NLIE+ R
Sbjct  419   TPVVMALYKPARDQV-PYKRRKLSRLSPIDEQGNKQLRVLACVHGMKNVPTVMNLIESIR  477

Query  1233  GTEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTE-IVVAFETFE  1057
             G+ +   F++Y + L+EL+ERSSAI+M  + R++GLP     G        I VAF  F 
Sbjct  478   GSNRKELFRLYILQLVELTERSSAIMMVQRVRQDGLPVSRAGGSSFAVVNGIAVAFGAFA  537

Query  1056  HLSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVN  877
              L+KV++R  TAI+A+  MH+DI  +A  KR A+IILPFHK+ + DG  ET     + VN
Sbjct  538   QLNKVTLRSLTAITALPDMHDDICTTAANKRAAVIILPFHKYARADGLLETMHPGFQTVN  597

Query  876   RRVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGI  697
             +RVL  APCSVGIL+DRG      +S+ NV++++ V +FGG DDREALA G RM EHPGI
Sbjct  598   QRVLVHAPCSVGILIDRG-ASAHQISSMNVNHSVAVFFFGGPDDREALAVGMRMAEHPGI  656

Query  696   CLVVARFTLDPETAGTsvkldvspsgssspe-ekSRDEDFLAAFKQRNSTNSSVKYEEKV  520
              L V +F +D +      +       S         D+  L    +R+S  +S       
Sbjct  657   KLSVVKFMVDHQQHQQQEQQQQQHVVSIDAAGSGLHDQHHLGHSGRRSSDFAS-------  709

Query  519   VKSAAETMEAIRGYNRCNLLVV--GRMPEGEIVAAMDKKGECPELGPLGNLLSCKEFSTT  346
                    M      N   LL+V  GR P   + +   ++    ELGP+G+ L+    +  
Sbjct  710   -------MIPRLTSNEHGLLIVGRGRRPIAGMASLSRRQATYAELGPVGDALAVA--NED  760

Query  345   ASVLVVQQY  319
             ASVLVVQQY
Sbjct  761   ASVLVVQQY  769



>ref|XP_006366744.1| PREDICTED: cation/H(+) antiporter 15-like [Solanum tuberosum]
Length=841

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/789 (50%), Positives = 542/789 (69%), Gaps = 21/789 (3%)
 Frame = -1

Query  2643  TVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEII  2464
              +VC +P   T+NG +QG++PLDYALPL I+Q+ LVV+ TR+L ++L+P RQPRVIAEI+
Sbjct  15    NIVCYSPSMITTNGVWQGENPLDYALPLFILQLTLVVIFTRILVFILKPFRQPRVIAEIL  74

Query  2463  GGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKA  2284
             GGV+LGPS  GRS+ + + +FP +S+ VL+T+A++GLL+F+FLVG+E+D   +RRTGKKA
Sbjct  75    GGVILGPSVLGRSKRFTDTVFPLRSVMVLETMANIGLLYFIFLVGVEMDIAVIRRTGKKA  134

Query  2283  LSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKL  2104
             + IALAG+ +PF +G+  SF+L  +  +    G F++F+GVALS+TAFPVLARILAELKL
Sbjct  135   IPIALAGMVVPFLIGVSFSFMLHKS-TQETKHGTFVLFLGVALSVTAFPVLARILAELKL  193

Query  2103  LTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPR  1924
             + +++G++AMSAA +ND+ AWILLA AIA S      L S+WVLL    FV+ C++++  
Sbjct  194   INSEIGRIAMSAALINDIFAWILLAFAIAFSENKTMALTSVWVLLSTAAFVVFCVIIIRP  253

Query  1923  IFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLAS  1744
             +  WM  R  EGE + E  +C IL+ V+  GF+TD IG+H++FGAF+ G+++P +GPL  
Sbjct  254   LIGWMIKRTPEGESISEFSICIILSGVMICGFITDAIGMHSIFGAFMFGLVIP-NGPLGL  312

Query  1743  ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVST  1564
              L EK+ED VSGL LPL+FV SGLKT +  I G  SW +L L I  AC GKI GT+L++ 
Sbjct  313   TLNEKLEDFVSGLLLPLFFVISGLKTEINAIDGVGSWAILALAIVLACVGKIAGTVLITL  372

Query  1563  LCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI  1384
               RIP  E ITLG LMN KGL+E+IV+N+GKD+ VL+D++FAIMV+  +  T I  P V 
Sbjct  373   YYRIPIHEGITLGLLMNAKGLIEMIVINVGKDQKVLDDKSFAIMVVATVLMTAIIIPFVT  432

Query  1383  ALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKV  1204
              +YKPA+     YK RT+Q   P  + R+L C H+ RN+P++INL+EAS  T+KS    V
Sbjct  433   LIYKPAR-KFAPYKRRTVQSTKPDSEFRVLACIHTPRNVPTIINLLEASCPTKKSP-ICV  490

Query  1203  YAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFE-HLSKVSIRPS  1027
             Y +HL+EL+ RSSA+L+ H  RK+G P  N     +D   I+ AFE FE H+  VS++P 
Sbjct  491   YVLHLVELTGRSSAMLIVHNTRKSGRPALNRTQAQSD--HIINAFENFEQHVGSVSVQPL  548

Query  1026  TAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCS  847
             TAIS  S+MHEDI   AE KRVA +I+PFHK Q +DG  E T    R +N+ VL  APCS
Sbjct  549   TAISPYSTMHEDICTVAEDKRVAFLIIPFHKQQTVDGGMEITNPNFRTINQNVLANAPCS  608

Query  846   VGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF---  676
             VGILVDRGL G++ ++A+ V + + VL+FGG DDREAL+YG RM EHPGI L V RF   
Sbjct  609   VGILVDRGLSGSTRLAANQVSHHVAVLFFGGPDDREALSYGLRMREHPGINLTVMRFLPG  668

Query  675   --TLDPETAGTsvkldvspsgssspeekSR----DEDFLAAFKQRNSTNSSVKYEEKVVK  514
                L+   +G+       P+  +   +  +    DED+++AF+ R + + SV Y E+VV 
Sbjct  669   VSALEEARSGSRRSNMNDPNVLTIVTDDDKEKQLDEDYVSAFRLRTANDDSVVYIERVVN  728

Query  513   SAAETMEAIRGYNRC-NLLVVGRMPEGEI---VAAMDKKGECPELGPLGNLLSCKEFSTT  346
                ET+ AIR  ++  +L +VGR  +G I    A +    ECPELG +G+LL+  + +  
Sbjct  729   HGEETVAAIRTIDQSHDLFIVGR-GQGTISPLTAGLTDWSECPELGAIGDLLASSDNAAI  787

Query  345   ASVLVVQQY  319
              SVLVVQQY
Sbjct  788   VSVLVVQQY  796



>ref|XP_010273345.1| PREDICTED: cation/H(+) antiporter 15-like [Nelumbo nucifera]
Length=837

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/810 (50%), Positives = 559/810 (69%), Gaps = 23/810 (3%)
 Frame = -1

Query  2640  VVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIG  2461
             +VC +P   T++G +QGD+PLDY+LPL I+Q+ LVV+ TRVL ++LRP RQPRVI+EI+G
Sbjct  22    IVCYSPTMITTSGIWQGDNPLDYSLPLFILQLTLVVITTRVLVFILRPFRQPRVISEILG  81

Query  2460  GVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKAL  2281
             GVLLGPS  GRS  + NA+FP +S+ VL+T+A++GLL+FLFLVG+E+D   +RRTGKKAL
Sbjct  82    GVLLGPSVLGRSSKFANAVFPLRSVMVLETMANVGLLYFLFLVGVEMDLTVIRRTGKKAL  141

Query  2280  SIALAGISLPFGLGIGTSF-ILRATIAKGVSQGPFLVFMGVALSITAFPVLARILAELKL  2104
              IALAG+ LPF +G   SF +L       V+   +L+F+GVALS+TAFPVLAR+LAELKL
Sbjct  142   FIALAGMILPFIIGAAFSFFLLEIKEQTTVNHVTYLLFLGVALSVTAFPVLARVLAELKL  201

Query  2103  LTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFVLLCILVVPR  1924
             L T++G++AMSAA +ND++AWILLA+AIA++ T  + L SLWV++    +VL+CI +V  
Sbjct  202   LNTEIGRIAMSAAIINDISAWILLAVAIAVAETDAASLASLWVIVSTAMYVLVCIFLVRP  261

Query  1923  IFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLAS  1744
                W+  R  EGE  +++Y+C IL  V+  GF+TD IG H++FGAFV G+++P +GPL +
Sbjct  262   AISWIIRRTPEGENFNDVYICLILTGVMICGFITDAIGTHSIFGAFVFGLVIP-NGPLGA  320

Query  1743  ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVST  1564
             AL+EK+ED VSGL LPL+F  SGL+T++A+I G+ +W +L+++I   C GK+ GT LV+ 
Sbjct  321   ALIEKLEDFVSGLLLPLFFAISGLRTDIASIHGSSTWAVLMVIIALGCAGKVFGTALVAF  380

Query  1563  LCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVI  1384
                +P ++ I LG LMN KGLVE+IVLN+GKD+ V++DQ+FA+MV++A+  T + TP+V 
Sbjct  381   FYDMPIRDGIALGLLMNAKGLVEMIVLNVGKDQKVIDDQSFALMVVVAVLMTSVITPVVT  440

Query  1383  ALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRGTEKSGGFKV  1204
              +YKPA+  V  YK RTIQR     + RIL+C H+ RN+P++INL+EAS  +++S    V
Sbjct  441   MIYKPARRFV-PYKRRTIQRSKLDGEFRILSCIHTPRNVPTMINLLEASHPSKRS-PICV  498

Query  1203  YAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFE-HLSKVSIRPS  1027
             YA+HL+EL+ R+SA+L+ H  RK G P  N     +D   I+ AFE +E H   VS++P 
Sbjct  499   YALHLVELTGRASAMLIVHNTRKTGHPALNRTQAQSD--HIINAFENYEQHSGSVSVQPL  556

Query  1026  TAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNRRVLEGAPCS  847
             TAIS  S+MHEDI   AE KRVA IILPFHK Q +DG  E      R+VN+ VL  APC+
Sbjct  557   TAISPYSTMHEDICNLAEDKRVAFIILPFHKQQTVDGGMEAINPACRNVNQNVLANAPCT  616

Query  846   VGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGICLVVARF---  676
             VGILVDRGLGG S  +A    + I +L+FGG DDREALAY  RM EHPGI L V RF   
Sbjct  617   VGILVDRGLGGASRAAAGQTSHHIAILFFGGPDDREALAYAWRMSEHPGIILTVIRFIPG  676

Query  675   --TLDP--ETAGTsvkldvspsgssspeekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSA  508
                +DP  E A  +  + +    + S +E+  D++++  F+ +N  N S+ Y EK+  + 
Sbjct  677   ENAVDPLVEPASDTHDIKILTVITDSEKERHLDDEYVNEFRMKNMHNESITYTEKICNNG  736

Query  507   AETMEAIRGY-NRCNLLVVGRMPEGEI---VAAMDKKGECPELGPLGNLLSCKEFSTTAS  340
              ET+  IR   N  +L +VGR  +G +    A +    ECPELG +G+LL+  +F+ T S
Sbjct  737   EETVAVIRSMDNMHDLYIVGR-GQGMVSPLTAGLTDWSECPELGAIGDLLASSDFALTVS  795

Query  339   VLVVQQYRTELSKN---GLKEDDSVD-GDY  262
             VLV+QQY      N   G+ +  +   GDY
Sbjct  796   VLVMQQYAGASHHNEGAGIPDSPATQSGDY  825



>emb|CBI30584.3| unnamed protein product [Vitis vinifera]
Length=858

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/843 (51%), Positives = 557/843 (66%), Gaps = 63/843 (7%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             +  +SNG +QGD+PLD+A PLLIVQ  L++ L+R LA+LL+PLRQP+VIAEIIGG+LLGP
Sbjct  8     ISTSSNGVWQGDNPLDFAFPLLIVQTTLILALSRFLAFLLKPLRQPKVIAEIIGGILLGP  67

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SA GR++ YL+ IFP  S  +L+++AS+GLLFFLFLVGLELD  S+RR+G+KALSIA  G
Sbjct  68    SALGRNQNYLHRIFPSWSTPILESVASIGLLFFLFLVGLELDLSSIRRSGRKALSIATVG  127

Query  2262  ISLPFGLGIGTSFILRATI--AKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDV  2089
             I+LPF  G+G +F+LR ++  A     G FLVFMGVALSITAFPVLARILAELKLLTT V
Sbjct  128   ITLPFVCGVGVAFVLRKSVDGADKAGYGTFLVFMGVALSITAFPVLARILAELKLLTTRV  187

Query  2088  GQmamsaaavndvaawillalaiaLSGTGH-----SPLISLWVLLCGTGFVLLCILVVPR  1924
             G+ AM+AAA NDV AWILLALA+AL+G G      SPLIS+WVLL G  FV+  ++V+  
Sbjct  188   GETAMAAAAFNDVVAWILLALAVALAGDGEGGEHKSPLISVWVLLSGVAFVIFMMVVIKP  247

Query  1923  IFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLAS  1744
                W+A R  +   VDE Y+C  LA V+ +GFVTD IGIH++FGAFV G+ +PK G  + 
Sbjct  248   AMSWVARRSPDSHSVDEAYICLTLAGVMVSGFVTDLIGIHSIFGAFVFGLTIPKGGGFSE  307

Query  1743  ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVST  1564
              L+E++ED V+GL LPLYF SSGLKTNVA I+G ++WGLLVLVI TAC GKI+GT +V+ 
Sbjct  308   RLIERIEDFVTGLLLPLYFASSGLKTNVAKIRGLEAWGLLVLVITTACAGKIVGTFVVAM  367

Query  1563  LCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRG-------------------VLNDQTF  1441
             +C IP +E++TLG LMNTKGLVELIVLNIGK++                    VLND+ F
Sbjct  368   MCMIPARESLTLGVLMNTKGLVELIVLNIGKEKKAKFSSKRGIRLHLQIEWDQVLNDEIF  427

Query  1440  AIMVLMALFTTFITTPIVIALYKPAK--LAVTEYKYRTIQRKDPSK-QLRILTCFHSRRN  1270
             AI+VLMALFTTF+TTPIV+ +YKP +   A T  + R     D SK  LRIL C H   N
Sbjct  428   AILVLMALFTTFMTTPIVMTIYKPVRGGPARTHRRLRDFSSVDSSKYDLRILACVHGPGN  487

Query  1269  IPSLINLIEASRGTEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWN--TRGEPT  1096
             +PSLI+LIEA+R  +KS   K+Y M L+EL+ERSS+I+M  +ARKNG PF N   RG+  
Sbjct  488   VPSLISLIEATRSAKKS-QLKLYVMRLVELTERSSSIIMVQRARKNGFPFINRFRRGQSD  546

Query  1095  DSTEIVVAFETFEHLSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDG  916
             D  E  VAFE +  L +VS+RP+TAIS++S+MHEDI   AE KR  M+ILPFHK  K +G
Sbjct  547   DRVE--VAFEAYGQLGRVSVRPTTAISSLSTMHEDICHVAEEKRATMVILPFHKQWKGEG  604

Query  915   H--FETTRNELRHVNRRVLEGAPCSVGILVDRGLGGTSHVS---ASNVDYTITVLYFGGH  751
             +   E   N  R VN+RVL+ +PCSV +LVDRG G     +    S V   I +L+FGG 
Sbjct  605   YESMENMGNGWRGVNQRVLKNSPCSVAVLVDRGFGSGPQQTRGPTSTVTQRICILFFGGP  664

Query  750   DDREALAYGARMVEHPGICLVVARFTL-------------DPETAGTsvkldvspsgsss  610
             DDREAL  GARM EHP + + V RF                PE          + +    
Sbjct  665   DDREALELGARMAEHPAVKVTVIRFVEKDGSDSKDIILRPSPEKCDEQSYSFSTAAMDRQ  724

Query  609   peekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGYNRCNLLVV--GRMPEG  436
              E++  DE   A FK R      V+Y EKV  +  E + AI      +L+VV  GR P  
Sbjct  725   KEKEL-DEIATAEFKSR--WGGLVEYVEKVASNVVEGVLAIGKSGDYDLVVVGKGRFPST  781

Query  435   EIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY------RTELSKNGLKEDDSV  274
              +    +++ E  ELGP+G++L+       +SVLV+QQ+         +SK    +D + 
Sbjct  782   MVAELAERQAEHAELGPIGDILASSGQGIVSSVLVIQQHDIAHAEEVPVSKVVNSKDATS  841

Query  273   DGD  265
             +GD
Sbjct  842   NGD  844



>emb|CAN63422.1| hypothetical protein VITISV_023524 [Vitis vinifera]
Length=859

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/844 (51%), Positives = 557/844 (66%), Gaps = 64/844 (8%)
 Frame = -1

Query  2622  MKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLRQPRVIAEIIGGVLLGP  2443
             +  +SNG +QGD+PLD+A PLLIVQ  L++ L+R LA+LL+PLRQP+VIAEIIGG+LLGP
Sbjct  8     ISTSSNGVWQGDNPLDFAFPLLIVQTTLILALSRFLAFLLKPLRQPKVIAEIIGGILLGP  67

Query  2442  SAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPKSLRRTGKKALSIALAG  2263
             SA GR++ YL+ IFP  S  +L+++AS+GLLFFLFLVGLELD  S+RR+G+KALSIA  G
Sbjct  68    SALGRNQNYLHRIFPSWSTPILESVASIGLLFFLFLVGLELDLSSIRRSGRKALSIATVG  127

Query  2262  ISLPFGLGIGTSFILRATI--AKGVSQGPFLVFMGVALSITAFPVLARILAELKLLTTDV  2089
             I+LPF  G+G +F+LR ++  A     G FLVFMGVALSITAFPVLARILAELKLLTT V
Sbjct  128   ITLPFVCGVGVAFVLRKSVDGADKAGYGTFLVFMGVALSITAFPVLARILAELKLLTTRV  187

Query  2088  GQmamsaaavndvaawillalaiaLSGTGH-----SPLISLWVLLCGTGFVLLCILVVPR  1924
             G+ AM+AAA NDV AWILLALA+AL+G G      SPLIS+WVLL G  FV+  ++V+  
Sbjct  188   GETAMAAAAFNDVVAWILLALAVALAGDGEGGEHKSPLISVWVLLSGVAFVIFMMVVIKP  247

Query  1923  IFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVLVPKDGPLAS  1744
                W+A R  +   VDE Y+C  LA V+ +GFVTD IGIH++FGAFV G+ +PK G  + 
Sbjct  248   AMSWVARRSPDSHSVDEAYICLTLAGVMVSGFVTDLIGIHSIFGAFVFGLTIPKGGGFSE  307

Query  1743  ALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGKILGTILVST  1564
              L+E++ED V+GL LPLYF SSGLKTNVA I+G ++WGLLVLVI TAC GKI+GT +V+ 
Sbjct  308   RLIERIEDFVTGLLLPLYFASSGLKTNVAKIRGLEAWGLLVLVITTACAGKIVGTFVVAM  367

Query  1563  LCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRG--------------------VLNDQT  1444
             +C IP +E++TLG LMNTKGLVELIVLNIGK++                     VLND+ 
Sbjct  368   MCMIPARESLTLGVLMNTKGLVELIVLNIGKEKKASESMAPVFLPKTSKAFKYLVLNDEI  427

Query  1443  FAIMVLMALFTTFITTPIVIALYKPAK--LAVTEYKYRTIQRKDPSK-QLRILTCFHSRR  1273
             FAI+VLMALFTTF+TTPIV+ +YKP +   A T  + R     D SK  LRIL C H   
Sbjct  428   FAILVLMALFTTFMTTPIVMTIYKPVRGGPARTHRRLRDFSSVDSSKYDLRILACVHGPG  487

Query  1272  NIPSLINLIEASRGTEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWN--TRGEP  1099
             N+PSLI+LIEA+R  +KS   K+Y M L+EL+ERSS+I+M  +ARKNG PF N   RG+ 
Sbjct  488   NVPSLISLIEATRSAKKS-QLKLYVMRLVELTERSSSIIMVQRARKNGFPFINRFRRGQS  546

Query  1098  TDSTEIVVAFETFEHLSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKID  919
              D  E  VAFE +  L +VS+RP+TAIS++S+MHEDI   AE KR  M+ILPFHK  K +
Sbjct  547   DDRVE--VAFEAYGQLGRVSVRPTTAISSLSTMHEDICHVAEEKRATMVILPFHKQWKGE  604

Query  918   GH--FETTRNELRHVNRRVLEGAPCSVGILVDRGLGGTSHVS---ASNVDYTITVLYFGG  754
             G+   E   N  R VN+RVL+ +PCSV +LVDRG G     +    S V   I +L+FGG
Sbjct  605   GYESMENMGNGWRGVNQRVLKNSPCSVAVLVDRGFGSGPQQTRGPTSTVTQRICILFFGG  664

Query  753   HDDREALAYGARMVEHPGICLVVARFTL-------------DPETAGTsvkldvspsgss  613
              DDREAL  GARM EHP + + V RF                PE          + +   
Sbjct  665   PDDREALELGARMAEHPAVKVTVIRFVEKDGSDSKDIILRPSPEKCDEQSYSFSTAAMDR  724

Query  612   speekSRDEDFLAAFKQRNSTNSSVKYEEKVVKSAAETMEAIRGYNRCNLLVV--GRMPE  439
               E++  DE   A FK R      V+Y EKV  +  E + AI      +L+VV  GR P 
Sbjct  725   QKEKEL-DEIATAEFKSR--WGGLVEYVEKVASNVVEGVLAIGKSGDYDLVVVGKGRFPS  781

Query  438   GEIVAAMDKKGECPELGPLGNLLSCKEFSTTASVLVVQQY------RTELSKNGLKEDDS  277
               +    +++ E  ELGP+G++L+       +SVLV+QQ+         +SK    +D +
Sbjct  782   TMVAELAERQAEHAELGPIGDILASSGQGIVSSVLVIQQHDIAHAEEVPVSKVVNSKDAT  841

Query  276   VDGD  265
              +GD
Sbjct  842   SNGD  845



>ref|XP_006299510.1| hypothetical protein CARUB_v10015680mg [Capsella rubella]
 gb|EOA32408.1| hypothetical protein CARUB_v10015680mg [Capsella rubella]
Length=823

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/811 (48%), Positives = 562/811 (69%), Gaps = 27/811 (3%)
 Frame = -1

Query  2670  SAEIMGSNGTVVCPAPMKATSNGSFQGDSPLDYAlpllivqiclvvlLTRVLAYLLRPLR  2491
             ++E  G+  +++C AP   T+NG +QGD+PLD++LPL ++Q+ LVV++TR   ++L+P R
Sbjct  3     TSEENGAEASIICYAPSMITTNGVWQGDNPLDFSLPLFVLQLTLVVVVTRFFVFILKPFR  62

Query  2490  QPRVIAEIIGGVLLGPSAFGRSEAYLNAIFPKKSLTVldtlaslgllfflflvgleLDPK  2311
             QPRVI+EI+GG++LGPS FGRS+ + + IFP++S+ VL+T+A++GLL+FLFLVG+E+D  
Sbjct  63    QPRVISEILGGIVLGPSVFGRSQKFAHTIFPQRSVMVLETMANVGLLYFLFLVGVEMDIM  122

Query  2310  SLRRTGKKALSIALAGISLPFGLGIGTSFILRATIAKGVSQGPFLVFMGVALSITAFPVL  2131
              +R+TGK+AL+IA+ G+ LPF +G   SF +  +    + QG +++F+GVALS+TAFPVL
Sbjct  123   VVRKTGKRALTIAIGGMVLPFLIGAAFSFSMHRS-EDHLGQGTYILFLGVALSVTAFPVL  181

Query  2130  ARILAELKLLTTDVGQmamsaaavndvaawillalaiaLSGTGHSPLISLWVLLCGTGFV  1951
             ARILAELKL+ T++G+++MSAA VND+ AWILLALAIAL+ +  +   SLWV++   GF+
Sbjct  182   ARILAELKLINTEIGRISMSAALVNDMFAWILLALAIALAESDKTSFASLWVMISSAGFI  241

Query  1950  LLCILVVPRIFKWMASRCSEGEPVDEIYVCAILAAVLGAGFVTDTIGIHALFGAFVIGVL  1771
              +C+ VV     W+  +  EGE   E Y+C IL  V+ +GF+TD IG H++FGAFV G++
Sbjct  242   AICVFVVRPGITWIIRKTPEGENFSEFYICLILTGVMISGFITDAIGTHSVFGAFVFGLV  301

Query  1770  VPKDGPLASALVEKVEDLVSGLFLPLYFVSSGLKTNVATIQGAQSWGLLVLVIFTACFGK  1591
             +P +GPL   L+EK+ED VSGL LPL+F  SGLKTN+A+IQG  +W  L  VIF AC GK
Sbjct  302   IP-NGPLGLTLIEKLEDFVSGLLLPLFFAISGLKTNIASIQGPATWATLFFVIFLACAGK  360

Query  1590  ILGTILVSTLCRIPFQEAITLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFT  1411
             ++GT++V+    +P +E ITLG L+NTKGLVE+IVLN+GKD+ VL+D+TFA MVL+AL  
Sbjct  361   VIGTVIVAFFHGMPVREGITLGLLLNTKGLVEMIVLNVGKDQKVLDDETFATMVLVALVM  420

Query  1410  TFITTPIVIALYKPAKLAVTEYKYRTIQRKDPSKQLRILTCFHSRRNIPSLINLIEASRG  1231
             T + TPIV  LY+P K +V+ YK RT+Q+  P  + R+L C H+ RN+P++INL+EAS  
Sbjct  421   TGVITPIVTVLYRPVKKSVS-YKRRTVQQTKPDSEFRVLVCVHTPRNVPTIINLLEASHP  479

Query  1230  TEKSGGFKVYAMHLMELSERSSAILMCHKARKNGLPFWNTRGEPTDSTEIVVAFETFE-H  1054
             T++S    +Y +HL+EL+ R+SA+L+ H  RK+G P  N     +D   I+ AFE +E H
Sbjct  480   TKRS-PICIYVLHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSD--HIINAFENYEQH  536

Query  1053  LSKVSIRPSTAISAMSSMHEDIIASAEGKRVAMIILPFHKHQKIDGHFETTRNELRHVNR  874
              + V+++P TAIS  S+MHED+ + AE KRV+ II+PFHK Q +DG  E T    R VN+
Sbjct  537   AAFVAVQPLTAISPYSTMHEDVCSLAEDKRVSFIIIPFHKQQTVDGGMEATNPAYRLVNQ  596

Query  873   RVLEGAPCSVGILVDRGLGGTSHVSASNVDYTITVLYFGGHDDREALAYGARMVEHPGIC  694
              +LE +PCSVGILVDRGL G + ++ + V   + VL+FGG DDREALAY  RM +HPGI 
Sbjct  597   NLLENSPCSVGILVDRGLNGATRLNTNTVSLQVAVLFFGGPDDREALAYAWRMAQHPGIS  656

Query  693   LVVARFTLDP---ETAGTsvkldvspsgssspeekSR----DEDFLAAFKQRNSTNSSVK  535
             L V RF  D    ETA      D          +  +    D++++ AF+  N+   SV 
Sbjct  657   LTVLRFIHDQDELETASMRATNDTDLKIPKMNMDHKKQRQFDDEYINAFRTSNADFESVV  716

Query  534   YEEKVVKSAAETMEAIRGYNRC-NLLVVGRMPEGE-----IVAAMDKKGECPELGPLGNL  373
             Y EK+V +  ET+ A+R  +   +L +VGR   GE     ++A +    ECPELG +G+L
Sbjct  717   YIEKLVANGEETVAAVRSMDSSHDLFIVGR---GEGMSSPLLAGLTDWSECPELGAIGDL  773

Query  372   LSCKEFSTTASVLVVQQYRTELSKNGLKEDD  280
             L+  +F+ T SVLVVQQY    +    +EDD
Sbjct  774   LASSDFAATVSVLVVQQYVGSWT----QEDD  800



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9011982859579