BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27963_g1_i1 len=2071 path=[1:0-2070]

Length=2071
                                                                      Score     E

ref|XP_009788488.1|  PREDICTED: pentatricopeptide repeat-containi...    783   0.0      
ref|XP_009594138.1|  PREDICTED: pentatricopeptide repeat-containi...    776   0.0      
ref|XP_004249932.1|  PREDICTED: pentatricopeptide repeat-containi...    759   0.0      
ref|XP_006350932.1|  PREDICTED: pentatricopeptide repeat-containi...    757   0.0      
ref|XP_011077261.1|  PREDICTED: pentatricopeptide repeat-containi...    730   0.0      
ref|XP_002267979.1|  PREDICTED: pentatricopeptide repeat-containi...    706   0.0      Vitis vinifera
ref|XP_002324293.2|  hypothetical protein POPTR_0018s05820g             694   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006381714.1|  pentatricopeptide repeat-containing family p...    693   0.0      
ref|XP_006438303.1|  hypothetical protein CICLE_v10031342mg             692   0.0      
gb|KDO82307.1|  hypothetical protein CISIN_1g011226mg                   690   0.0      
ref|XP_006483923.1|  PREDICTED: pentatricopeptide repeat-containi...    690   0.0      
ref|XP_011043458.1|  PREDICTED: pentatricopeptide repeat-containi...    690   0.0      
ref|XP_004296672.1|  PREDICTED: pentatricopeptide repeat-containi...    686   0.0      
gb|KDP26635.1|  hypothetical protein JCGZ_17793                         683   0.0      
ref|XP_010023484.1|  PREDICTED: pentatricopeptide repeat-containi...    679   0.0      
ref|XP_007044736.1|  Tetratricopeptide repeat (TPR)-like superfam...    679   0.0      
ref|XP_010553613.1|  PREDICTED: pentatricopeptide repeat-containi...    678   0.0      
ref|XP_004508130.1|  PREDICTED: pentatricopeptide repeat-containi...    675   0.0      
gb|EYU39860.1|  hypothetical protein MIMGU_mgv1a005194mg                675   0.0      
ref|XP_008368256.1|  PREDICTED: pentatricopeptide repeat-containi...    674   0.0      
ref|XP_011014138.1|  PREDICTED: pentatricopeptide repeat-containi...    674   0.0      
ref|XP_008389701.1|  PREDICTED: pentatricopeptide repeat-containi...    671   0.0      
ref|XP_002527905.1|  pentatricopeptide repeat-containing protein,...    670   0.0      Ricinus communis
ref|XP_009359185.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    669   0.0      
ref|XP_007222350.1|  hypothetical protein PRUPE_ppa004842mg             667   0.0      
gb|KEH20176.1|  PPR containing plant protein                            667   0.0      
ref|XP_004509657.1|  PREDICTED: pentatricopeptide repeat-containi...    665   0.0      
ref|XP_007153764.1|  hypothetical protein PHAVU_003G063200g             664   0.0      
ref|XP_010245038.1|  PREDICTED: pentatricopeptide repeat-containi...    664   0.0      
ref|XP_010473256.1|  PREDICTED: pentatricopeptide repeat-containi...    659   0.0      
ref|XP_008446176.1|  PREDICTED: pentatricopeptide repeat-containi...    658   0.0      
ref|XP_008221878.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    657   0.0      
ref|XP_002886593.1|  pentatricopeptide repeat-containing protein        655   0.0      
ref|XP_006302183.1|  hypothetical protein CARUB_v10020193mg             655   0.0      
ref|XP_010510912.1|  PREDICTED: pentatricopeptide repeat-containi...    653   0.0      
ref|XP_006392119.1|  hypothetical protein EUTSA_v10023426mg             649   0.0      
gb|KFK40762.1|  hypothetical protein AALP_AA2G037700                    649   0.0      
ref|NP_176276.1|  pentatricopeptide repeat-containing protein           649   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010682416.1|  PREDICTED: pentatricopeptide repeat-containi...    647   0.0      
ref|XP_003531991.1|  PREDICTED: pentatricopeptide repeat-containi...    646   0.0      
ref|XP_010100377.1|  hypothetical protein L484_027687                   642   0.0      
emb|CDX96239.1|  BnaC02g14120D                                          637   0.0      
ref|XP_009103962.1|  PREDICTED: pentatricopeptide repeat-containi...    637   0.0      
ref|XP_004135263.1|  PREDICTED: pentatricopeptide repeat-containi...    636   0.0      
emb|CDY46999.1|  BnaC09g14050D                                          634   0.0      
emb|CDY34141.1|  BnaC01g28810D                                          634   0.0      
ref|XP_009113186.1|  PREDICTED: pentatricopeptide repeat-containi...    633   0.0      
emb|CBI23460.3|  unnamed protein product                                625   0.0      
emb|CDO99769.1|  unnamed protein product                                624   0.0      
ref|XP_008800895.1|  PREDICTED: pentatricopeptide repeat-containi...    606   0.0      
ref|XP_010924205.1|  PREDICTED: pentatricopeptide repeat-containi...    604   0.0      
gb|AIZ68164.1|  pentatricopeptide repeat-containing protein At1g6...    600   0.0      
gb|EPS60636.1|  hypothetical protein M569_14165                         600   0.0      
ref|XP_008801961.1|  PREDICTED: pentatricopeptide repeat-containi...    600   0.0      
ref|XP_010925090.1|  PREDICTED: pentatricopeptide repeat-containi...    596   0.0      
ref|XP_004964414.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    583   0.0      
ref|XP_009400074.1|  PREDICTED: pentatricopeptide repeat-containi...    583   0.0      
ref|XP_002436399.1|  hypothetical protein SORBIDRAFT_10g001830          559   0.0      Sorghum bicolor [broomcorn]
ref|NP_001168600.1|  uncharacterized protein LOC100382384               558   0.0      Zea mays [maize]
gb|AFW86057.1|  hypothetical protein ZEAMMB73_674343                    558   0.0      
ref|NP_001052458.1|  Os04g0320200                                       553   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_003557118.1|  PREDICTED: pentatricopeptide repeat-containi...    553   0.0      
emb|CAH66166.1|  H0107B07.5                                             550   0.0      Oryza sativa [red rice]
gb|AFW86058.1|  hypothetical protein ZEAMMB73_674343                    543   0.0      
ref|XP_008801962.1|  PREDICTED: pentatricopeptide repeat-containi...    528   9e-179   
gb|KDO82308.1|  hypothetical protein CISIN_1g011226mg                   504   2e-170   
ref|XP_006840979.1|  hypothetical protein AMTR_s00085p00059480          502   1e-167   
gb|EMT02140.1|  Pentatricopeptide repeat-containing protein             491   3e-163   
ref|XP_006653269.1|  PREDICTED: pentatricopeptide repeat-containi...    487   2e-162   
emb|CDY24553.1|  BnaA01g22570D                                          399   2e-130   
ref|XP_010249903.1|  PREDICTED: pentatricopeptide repeat-containi...    370   5e-116   
ref|XP_009610168.1|  PREDICTED: pentatricopeptide repeat-containi...    368   2e-115   
ref|XP_010267968.1|  PREDICTED: pentatricopeptide repeat-containi...    359   5e-112   
ref|XP_008227878.1|  PREDICTED: pentatricopeptide repeat-containi...    354   5e-110   
emb|CDP17058.1|  unnamed protein product                                354   7e-110   
ref|XP_006349176.1|  PREDICTED: pentatricopeptide repeat-containi...    353   8e-110   
ref|XP_010921472.1|  PREDICTED: pentatricopeptide repeat-containi...    353   1e-109   
ref|XP_004229380.2|  PREDICTED: pentatricopeptide repeat-containi...    353   1e-109   
ref|XP_008781131.1|  PREDICTED: pentatricopeptide repeat-containi...    353   1e-109   
ref|XP_002301516.2|  pentatricopeptide repeat-containing family p...    348   1e-107   Populus trichocarpa [western balsam poplar]
ref|XP_010249890.1|  PREDICTED: pentatricopeptide repeat-containi...    348   1e-107   
ref|XP_004288536.1|  PREDICTED: pentatricopeptide repeat-containi...    345   3e-107   
ref|XP_007051132.1|  Tetratricopeptide repeat (TPR)-like superfam...    347   3e-107   
ref|XP_011042275.1|  PREDICTED: pentatricopeptide repeat-containi...    347   3e-107   
ref|XP_002515265.1|  pentatricopeptide repeat-containing protein,...    346   5e-107   Ricinus communis
ref|XP_010069830.1|  PREDICTED: pentatricopeptide repeat-containi...    342   4e-105   
ref|XP_002277733.1|  PREDICTED: pentatricopeptide repeat-containi...    341   5e-105   Vitis vinifera
ref|XP_009757638.1|  PREDICTED: pentatricopeptide repeat-containi...    337   2e-104   
emb|CAN71816.1|  hypothetical protein VITISV_023421                     339   2e-104   Vitis vinifera
ref|XP_006840468.1|  hypothetical protein AMTR_s00045p00181820          338   4e-104   
gb|EYU46819.1|  hypothetical protein MIMGU_mgv1a004991mg                338   5e-104   
ref|XP_009349931.1|  PREDICTED: pentatricopeptide repeat-containi...    338   5e-104   
ref|XP_003632411.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    338   6e-104   
ref|XP_008381422.1|  PREDICTED: pentatricopeptide repeat-containi...    338   9e-104   
ref|XP_011079543.1|  PREDICTED: pentatricopeptide repeat-containi...    336   4e-103   
ref|XP_004146883.1|  PREDICTED: pentatricopeptide repeat-containi...    332   9e-102   
ref|XP_007221478.1|  hypothetical protein PRUPE_ppa005037mg             332   1e-101   
gb|KGN53198.1|  Pentatricopeptide repeat-containing protein             331   2e-101   
gb|KDP28274.1|  hypothetical protein JCGZ_14045                         330   8e-101   
ref|XP_010480914.1|  PREDICTED: pentatricopeptide repeat-containi...    330   1e-100   
ref|XP_009589051.1|  PREDICTED: pentatricopeptide repeat-containi...    329   2e-100   
ref|XP_009757637.1|  PREDICTED: pentatricopeptide repeat-containi...    329   2e-100   
ref|XP_008453822.1|  PREDICTED: pentatricopeptide repeat-containi...    327   1e-99    
ref|XP_002889397.1|  pentatricopeptide repeat-containing protein        327   1e-99    
ref|XP_009119640.1|  PREDICTED: pentatricopeptide repeat-containi...    327   1e-99    
ref|XP_008781129.1|  PREDICTED: pentatricopeptide repeat-containi...    325   4e-99    
gb|AAL38889.1|  unknown protein                                         325   2e-98    Arabidopsis thaliana [mouse-ear cress]
gb|AFN53641.1|  pentatricopeptide repeat-containing protein             323   3e-98    
ref|NP_171739.1|  pentatricopeptide repeat-containing protein           323   6e-98    Arabidopsis thaliana [mouse-ear cress]
emb|CDY15237.1|  BnaC05g01160D                                          323   6e-98    
ref|XP_011041046.1|  PREDICTED: pentatricopeptide repeat-containi...    322   1e-97    
ref|XP_006307239.1|  hypothetical protein CARUB_v10008848mg             322   1e-97    
ref|XP_010087220.1|  hypothetical protein L484_009729                   319   1e-97    
ref|XP_010474556.1|  PREDICTED: pentatricopeptide repeat-containi...    312   2e-97    
emb|CBI36964.3|  unnamed protein product                                321   4e-97    
emb|CDX89976.1|  BnaA10g01060D                                          320   4e-97    
ref|XP_010542838.1|  PREDICTED: pentatricopeptide repeat-containi...    319   1e-96    
gb|KHG24281.1|  hypothetical protein F383_04038                         318   3e-96    
ref|XP_010474650.1|  PREDICTED: pentatricopeptide repeat-containi...    319   3e-96    
ref|XP_006418350.1|  hypothetical protein EUTSA_v10007036mg             321   7e-96    
ref|XP_002320971.2|  hypothetical protein POPTR_0014s11420g             311   4e-95    Populus trichocarpa [western balsam poplar]
ref|XP_006480799.1|  PREDICTED: pentatricopeptide repeat-containi...    311   2e-93    
gb|ABR18022.1|  unknown                                                 312   3e-93    Picea sitchensis
gb|KFK42596.1|  hypothetical protein AALP_AA1G016200                    310   4e-93    
ref|XP_008453823.1|  PREDICTED: pentatricopeptide repeat-containi...    306   4e-93    
ref|XP_011041055.1|  PREDICTED: pentatricopeptide repeat-containi...    306   8e-93    
ref|XP_006429067.1|  hypothetical protein CICLE_v10011521mg             307   3e-92    
gb|KFK30785.1|  hypothetical protein AALP_AA6G025600                    305   3e-91    
ref|XP_009382489.1|  PREDICTED: pentatricopeptide repeat-containi...    305   4e-91    
ref|XP_009134458.1|  PREDICTED: pentatricopeptide repeat-containi...    302   4e-90    
gb|KDO35896.1|  hypothetical protein CISIN_1g048394mg                   300   8e-90    
emb|CDX91822.1|  BnaC03g31240D                                          299   3e-89    
emb|CDX90962.1|  BnaA03g26420D                                          299   4e-89    
ref|XP_002872860.1|  hypothetical protein ARALYDRAFT_490379             298   7e-89    
ref|XP_010422661.1|  PREDICTED: pentatricopeptide repeat-containi...    297   2e-88    
ref|XP_007145137.1|  hypothetical protein PHAVU_007G213200g             295   6e-88    
ref|XP_003567580.1|  PREDICTED: pentatricopeptide repeat-containi...    297   9e-88    
ref|XP_010429011.1|  PREDICTED: pentatricopeptide repeat-containi...    293   6e-87    
dbj|BAK06496.1|  predicted protein                                      294   1e-86    
ref|XP_010911077.1|  PREDICTED: pentatricopeptide repeat-containi...    288   2e-86    
emb|CDY50358.1|  BnaA09g13070D                                          282   3e-86    
ref|NP_567220.1|  pentatricopeptide repeat-containing protein           291   7e-86    Arabidopsis thaliana [mouse-ear cress]
gb|AAD22661.1|AC007138_25  hypothetical protein                         290   8e-86    Arabidopsis thaliana [mouse-ear cress]
gb|ACU24296.1|  unknown                                                 288   4e-85    Glycine max [soybeans]
ref|XP_006287578.1|  hypothetical protein CARUB_v10000787mg             287   1e-84    
ref|XP_006396396.1|  hypothetical protein EUTSA_v10029427mg             287   1e-84    
gb|KHN16203.1|  Pentatricopeptide repeat-containing protein, mito...    286   1e-84    
ref|NP_001042820.1|  Os01g0301000                                       287   2e-84    Oryza sativa Japonica Group [Japonica rice]
gb|EAY73658.1|  hypothetical protein OsI_01545                          287   3e-84    Oryza sativa Indica Group [Indian rice]
gb|KHG14992.1|  hypothetical protein F383_17735                         286   1e-83    
emb|CDY50357.1|  BnaA09g13060D                                          273   4e-83    
gb|KHN08626.1|  Pentatricopeptide repeat-containing protein, mito...    281   4e-83    
gb|EMT12044.1|  hypothetical protein F775_21441                         280   4e-83    
ref|XP_009367213.1|  PREDICTED: pentatricopeptide repeat-containi...    283   6e-83    
ref|XP_006849761.1|  hypothetical protein AMTR_s00024p00251490          278   3e-81    
ref|XP_010087222.1|  hypothetical protein L484_009731                   276   3e-81    
ref|XP_004956425.1|  PREDICTED: pentatricopeptide repeat-containi...    278   5e-81    
ref|XP_004967563.1|  PREDICTED: pentatricopeptide repeat-containi...    278   7e-81    
gb|AES61635.2|  PPR containing plant protein                            276   8e-81    
ref|XP_002448264.1|  hypothetical protein SORBIDRAFT_06g024190          277   1e-80    Sorghum bicolor [broomcorn]
ref|XP_003591384.1|  Pentatricopeptide repeat-containing protein        276   3e-80    
ref|XP_007052357.1|  Tetratricopeptide repeat (TPR)-like superfam...    276   4e-80    
ref|XP_007145138.1|  hypothetical protein PHAVU_007G213200g             270   3e-79    
emb|CDP18258.1|  unnamed protein product                                274   4e-79    
ref|XP_010052788.1|  PREDICTED: pentatricopeptide repeat-containi...    273   4e-79    
ref|XP_006644106.1|  PREDICTED: pentatricopeptide repeat-containi...    269   6e-79    
ref|XP_007218971.1|  hypothetical protein PRUPE_ppa003822mg             273   7e-79    
ref|XP_011017395.1|  PREDICTED: pentatricopeptide repeat-containi...    273   9e-79    
ref|XP_008232381.1|  PREDICTED: pentatricopeptide repeat-containi...    273   1e-78    
emb|CAE04345.1|  OSJNBb0038F03.9                                        271   1e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002301239.2|  pentatricopeptide repeat-containing family p...    272   1e-78    Populus trichocarpa [western balsam poplar]
ref|XP_009774058.1|  PREDICTED: pentatricopeptide repeat-containi...    272   2e-78    
ref|XP_010940923.1|  PREDICTED: pentatricopeptide repeat-containi...    268   2e-78    
ref|XP_009338668.1|  PREDICTED: pentatricopeptide repeat-containi...    271   2e-78    
ref|XP_011032472.1|  PREDICTED: pentatricopeptide repeat-containi...    271   3e-78    
ref|NP_001168310.1|  hypothetical protein                               270   3e-78    Zea mays [maize]
ref|XP_011085741.1|  PREDICTED: pentatricopeptide repeat-containi...    271   4e-78    
ref|XP_006652599.1|  PREDICTED: pentatricopeptide repeat-containi...    270   4e-78    
gb|EAY95037.1|  hypothetical protein OsI_16851                          270   4e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_008343713.1|  PREDICTED: pentatricopeptide repeat-containi...    270   6e-78    
ref|XP_009592903.1|  PREDICTED: pentatricopeptide repeat-containi...    270   7e-78    
ref|XP_008810293.1|  PREDICTED: pentatricopeptide repeat-containi...    266   1e-77    
ref|XP_006375170.1|  pentatricopeptide repeat-containing family p...    270   1e-77    
ref|XP_008343638.1|  PREDICTED: pentatricopeptide repeat-containi...    270   1e-77    
ref|XP_002457728.1|  hypothetical protein SORBIDRAFT_03g012450          269   2e-77    Sorghum bicolor [broomcorn]
ref|XP_004307244.1|  PREDICTED: pentatricopeptide repeat-containi...    269   2e-77    
ref|XP_004133941.1|  PREDICTED: pentatricopeptide repeat-containi...    268   5e-77    
ref|NP_001288478.1|  uncharacterized protein LOC103635083               266   1e-76    
ref|XP_009375366.1|  PREDICTED: pentatricopeptide repeat-containi...    266   4e-76    
ref|XP_003536907.1|  PREDICTED: pentatricopeptide repeat-containi...    265   5e-76    
ref|NP_001053460.2|  Os04g0544400                                       266   8e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009390562.1|  PREDICTED: pentatricopeptide repeat-containi...    264   8e-76    
gb|KDP28877.1|  hypothetical protein JCGZ_14648                         264   1e-75    
ref|XP_010556784.1|  PREDICTED: pentatricopeptide repeat-containi...    263   2e-75    
ref|XP_004495896.1|  PREDICTED: pentatricopeptide repeat-containi...    262   2e-75    
ref|XP_004229730.1|  PREDICTED: pentatricopeptide repeat-containi...    263   3e-75    
ref|XP_006347992.1|  PREDICTED: pentatricopeptide repeat-containi...    263   3e-75    
dbj|BAJ85010.1|  predicted protein                                      261   5e-75    
ref|XP_006878583.1|  hypothetical protein AMTR_s00011p00250030          258   7e-75    
ref|XP_002526471.1|  pentatricopeptide repeat-containing protein,...    262   7e-75    Ricinus communis
ref|XP_006444085.1|  hypothetical protein CICLE_v10019771mg             261   7e-75    
ref|XP_006445447.1|  hypothetical protein CICLE_v10019658mg             261   1e-74    
ref|XP_010693618.1|  PREDICTED: pentatricopeptide repeat-containi...    261   1e-74    
dbj|BAK02297.1|  predicted protein                                      260   3e-74    
gb|KDP21467.1|  hypothetical protein JCGZ_21938                         260   3e-74    
ref|XP_010242929.1|  PREDICTED: pentatricopeptide repeat-containi...    259   3e-74    
ref|XP_008438222.1|  PREDICTED: pentatricopeptide repeat-containi...    260   4e-74    
emb|CDP03624.1|  unnamed protein product                                259   5e-74    
gb|KDP27040.1|  hypothetical protein JCGZ_20975                         258   9e-74    
ref|XP_009770415.1|  PREDICTED: pentatricopeptide repeat-containi...    258   1e-73    
ref|XP_010496689.1|  PREDICTED: pentatricopeptide repeat-containi...    256   1e-73    
ref|XP_010662164.1|  PREDICTED: pentatricopeptide repeat-containi...    258   2e-73    
ref|XP_006644107.1|  PREDICTED: pentatricopeptide repeat-containi...    257   2e-73    
ref|XP_008810294.1|  PREDICTED: pentatricopeptide repeat-containi...    254   2e-73    
ref|XP_006827770.1|  hypothetical protein AMTR_s00009p00264540          256   4e-73    
emb|CBI16683.3|  unnamed protein product                                254   5e-73    
ref|XP_010108203.1|  hypothetical protein L484_014529                   256   6e-73    
ref|XP_010496474.1|  PREDICTED: pentatricopeptide repeat-containi...    256   7e-73    
ref|XP_006418504.1|  hypothetical protein EUTSA_v10007383mg             256   8e-73    
ref|XP_007134411.1|  hypothetical protein PHAVU_010G045500g             257   8e-73    
ref|XP_008368855.1|  PREDICTED: pentatricopeptide repeat-containi...    256   1e-72    
gb|EAZ31514.1|  hypothetical protein OsJ_15655                          256   1e-72    Oryza sativa Japonica Group [Japonica rice]
gb|ABA99305.2|  pentatricopeptide, putative, expressed                  256   1e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010255941.1|  PREDICTED: pentatricopeptide repeat-containi...    255   1e-72    
ref|XP_010272479.1|  PREDICTED: pentatricopeptide repeat-containi...    254   2e-72    
ref|XP_010479321.1|  PREDICTED: pentatricopeptide repeat-containi...    256   2e-72    
gb|AAM19786.1|  At1g02150/T7I23.8                                       255   2e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892022.1|  pentatricopeptide repeat-containing protein        255   2e-72    
emb|CDP09418.1|  unnamed protein product                                253   2e-72    
ref|XP_007198989.1|  hypothetical protein PRUPE_ppa004422mg             254   3e-72    
ref|XP_008790994.1|  PREDICTED: pentatricopeptide repeat-containi...    255   3e-72    
ref|XP_010246096.1|  PREDICTED: pentatricopeptide repeat-containi...    254   3e-72    
ref|XP_006306047.1|  hypothetical protein CARUB_v10011354mg             254   3e-72    
ref|XP_010227218.1|  PREDICTED: uncharacterized protein LOC100829762    263   3e-72    
ref|XP_002270492.1|  PREDICTED: pentatricopeptide repeat-containi...    254   4e-72    Vitis vinifera
ref|XP_010919766.1|  PREDICTED: pentatricopeptide repeat-containi...    254   4e-72    
ref|XP_003520417.1|  PREDICTED: pentatricopeptide repeat-containi...    255   5e-72    
ref|XP_010692029.1|  PREDICTED: pentatricopeptide repeat-containi...    254   5e-72    
ref|NP_171717.2|  pentatricopeptide repeat-containing protein           254   5e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003572464.1|  PREDICTED: pentatricopeptide repeat-containi...    254   5e-72    
ref|XP_009612934.1|  PREDICTED: pentatricopeptide repeat-containi...    253   6e-72    
emb|CAN64166.1|  hypothetical protein VITISV_006333                     253   7e-72    Vitis vinifera
gb|EYU40343.1|  hypothetical protein MIMGU_mgv1a004109mg                254   8e-72    
gb|KHN03794.1|  Pentatricopeptide repeat-containing protein, mito...    249   1e-71    
ref|XP_010921943.1|  PREDICTED: pentatricopeptide repeat-containi...    253   1e-71    
ref|XP_003632962.1|  PREDICTED: pentatricopeptide repeat-containi...    252   3e-71    
ref|XP_004495206.1|  PREDICTED: pentatricopeptide repeat-containi...    251   3e-71    
ref|XP_008655858.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    251   4e-71    
ref|XP_007144631.1|  hypothetical protein PHAVU_007G171700g             251   5e-71    
ref|XP_004155477.1|  PREDICTED: pentatricopeptide repeat-containi...    250   6e-71    
gb|EEC77735.1|  hypothetical protein OsI_16848                          261   7e-71    Oryza sativa Indica Group [Indian rice]
ref|XP_010089787.1|  hypothetical protein L484_008037                   252   7e-71    
gb|KCW49953.1|  hypothetical protein EUGRSUZ_K03412                     249   7e-71    
gb|KGN43610.1|  hypothetical protein Csa_7G047450                       249   1e-70    
ref|NP_001042824.1|  Os01g0301700                                       249   1e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010038139.1|  PREDICTED: pentatricopeptide repeat-containi...    249   2e-70    
ref|XP_008794909.1|  PREDICTED: pentatricopeptide repeat-containi...    249   2e-70    
ref|XP_007052358.1|  Tetratricopeptide repeat (TPR)-like superfam...    246   2e-70    
ref|XP_006664068.1|  PREDICTED: pentatricopeptide repeat-containi...    249   3e-70    
ref|XP_004515320.1|  PREDICTED: pentatricopeptide repeat-containi...    249   3e-70    
ref|XP_009398991.1|  PREDICTED: pentatricopeptide repeat-containi...    249   4e-70    
ref|XP_010237220.1|  PREDICTED: pentatricopeptide repeat-containi...    249   4e-70    
gb|EPS72236.1|  hypothetical protein M569_02523                         247   4e-70    
ref|XP_011032725.1|  PREDICTED: pentatricopeptide repeat-containi...    249   4e-70    
ref|XP_008235277.1|  PREDICTED: pentatricopeptide repeat-containi...    248   6e-70    
gb|KHG24373.1|  hypothetical protein F383_30483                         248   8e-70    
ref|XP_010910082.1|  PREDICTED: pentatricopeptide repeat-containi...    248   9e-70    
ref|XP_002307578.1|  pentatricopeptide repeat-containing family p...    248   1e-69    Populus trichocarpa [western balsam poplar]
dbj|BAK02972.1|  predicted protein                                      248   1e-69    
emb|CAN64701.1|  hypothetical protein VITISV_037299                     256   1e-69    Vitis vinifera
ref|XP_007050629.1|  Pentatricopeptide repeat (PPR) superfamily p...    247   1e-69    
ref|XP_003530115.1|  PREDICTED: pentatricopeptide repeat-containi...    248   2e-69    
ref|XP_009387580.1|  PREDICTED: pentatricopeptide repeat-containi...    243   2e-69    
gb|EMT17732.1|  hypothetical protein F775_09007                         246   2e-69    
ref|XP_010918492.1|  PREDICTED: pentatricopeptide repeat-containi...    246   3e-69    
emb|CDX90079.1|  BnaA10g00030D                                          246   3e-69    
gb|EMT11631.1|  Pentatricopeptide repeat-containing protein             255   3e-69    
ref|XP_008455539.1|  PREDICTED: uncharacterized protein LOC103495690    255   3e-69    
gb|AES60905.2|  PPR containing plant protein                            246   3e-69    
ref|XP_004240342.1|  PREDICTED: pentatricopeptide repeat-containi...    246   3e-69    
ref|XP_009119759.1|  PREDICTED: pentatricopeptide repeat-containi...    246   3e-69    
ref|XP_004230314.1|  PREDICTED: pentatricopeptide repeat-containi...    245   4e-69    
ref|XP_006366127.1|  PREDICTED: pentatricopeptide repeat-containi...    246   5e-69    
ref|XP_003590654.1|  WD repeat-containing protein                       247   6e-69    
ref|XP_009144540.1|  PREDICTED: pentatricopeptide repeat-containi...    245   6e-69    
ref|XP_010933566.1|  PREDICTED: pentatricopeptide repeat-containi...    245   9e-69    
ref|XP_006344770.1|  PREDICTED: pentatricopeptide repeat-containi...    244   1e-68    
ref|XP_010662166.1|  PREDICTED: pentatricopeptide repeat-containi...    243   1e-68    
ref|XP_002527601.1|  pentatricopeptide repeat-containing protein,...    244   2e-68    
emb|CDX97288.1|  BnaA02g20790D                                          244   2e-68    
gb|KFK30887.1|  hypothetical protein AALP_AA6G038700                    244   2e-68    
ref|XP_010540211.1|  PREDICTED: pentatricopeptide repeat-containi...    245   2e-68    
ref|XP_002874893.1|  pentatricopeptide repeat-containing protein        244   3e-68    
gb|KHF99488.1|  hypothetical protein F383_17053                         243   3e-68    
ref|XP_003545936.1|  PREDICTED: pentatricopeptide repeat-containi...    243   3e-68    
ref|XP_008345197.1|  PREDICTED: pentatricopeptide repeat-containi...    241   3e-68    
gb|KHG13694.1|  hypothetical protein F383_19313                         243   5e-68    
gb|EAY83341.1|  hypothetical protein OsI_38557                          241   6e-68    
gb|EYU46589.1|  hypothetical protein MIMGU_mgv1a004554mg                243   9e-68    
emb|CDY15126.1|  BnaC05g00050D                                          242   9e-68    
ref|XP_008442422.1|  PREDICTED: pentatricopeptide repeat-containi...    242   1e-67    
ref|XP_004485772.1|  PREDICTED: pentatricopeptide repeat-containi...    241   2e-67    
ref|XP_004295631.1|  PREDICTED: pentatricopeptide repeat-containi...    241   2e-67    
ref|XP_006396507.1|  hypothetical protein EUTSA_v10028573mg             242   2e-67    
ref|XP_008786192.1|  PREDICTED: pentatricopeptide repeat-containi...    241   2e-67    
ref|XP_008344410.1|  PREDICTED: pentatricopeptide repeat-containi...    241   3e-67    
ref|XP_004290659.1|  PREDICTED: pentatricopeptide repeat-containi...    241   3e-67    
ref|XP_002305141.1|  pentatricopeptide repeat-containing family p...    240   4e-67    
ref|XP_006827771.1|  hypothetical protein AMTR_s00009p00264580          238   4e-67    
ref|XP_006347052.1|  PREDICTED: pentatricopeptide repeat-containi...    240   4e-67    
ref|XP_011079842.1|  PREDICTED: pentatricopeptide repeat-containi...    241   5e-67    
gb|EPS66397.1|  hypothetical protein M569_08380                         238   7e-67    
emb|CDX91277.1|  BnaC02g26880D                                          240   7e-67    
ref|XP_011027841.1|  PREDICTED: pentatricopeptide repeat-containi...    239   9e-67    
ref|NP_001168643.1|  uncharacterized protein LOC100382430               239   1e-66    
ref|XP_004136821.1|  PREDICTED: pentatricopeptide repeat-containi...    238   1e-66    
ref|NP_192191.1|  pentatricopeptide repeat-containing protein           239   1e-66    
ref|XP_010241951.1|  PREDICTED: pentatricopeptide repeat-containi...    239   1e-66    
gb|AAL32523.1|  Unknown protein                                         239   2e-66    
gb|KHN31110.1|  Pentatricopeptide repeat-containing protein             236   2e-66    
ref|XP_009628193.1|  PREDICTED: pentatricopeptide repeat-containi...    238   2e-66    
ref|XP_011029462.1|  PREDICTED: pentatricopeptide repeat-containi...    238   2e-66    
ref|XP_006449328.1|  hypothetical protein CICLE_v10015002mg             238   2e-66    
ref|XP_011043365.1|  PREDICTED: pentatricopeptide repeat-containi...    239   2e-66    
ref|XP_006467809.1|  PREDICTED: pentatricopeptide repeat-containi...    238   2e-66    
ref|XP_010422532.1|  PREDICTED: pentatricopeptide repeat-containi...    239   2e-66    
ref|XP_010430409.1|  PREDICTED: pentatricopeptide repeat-containi...    239   2e-66    
ref|XP_004233831.1|  PREDICTED: pentatricopeptide repeat-containi...    238   3e-66    
ref|XP_002316903.2|  hypothetical protein POPTR_0011s12150g             238   3e-66    
gb|KGN43609.1|  hypothetical protein Csa_7G047440                       238   3e-66    
ref|XP_010455929.1|  PREDICTED: pentatricopeptide repeat-containi...    239   3e-66    
ref|XP_006355517.1|  PREDICTED: pentatricopeptide repeat-containi...    238   4e-66    
ref|XP_010538678.1|  PREDICTED: pentatricopeptide repeat-containi...    237   5e-66    
ref|XP_009615280.1|  PREDICTED: pentatricopeptide repeat-containi...    238   6e-66    
ref|XP_002464423.1|  hypothetical protein SORBIDRAFT_01g017970          237   6e-66    
ref|XP_002438963.1|  hypothetical protein SORBIDRAFT_10g029040          236   1e-65    
ref|XP_002282230.1|  PREDICTED: pentatricopeptide repeat-containi...    236   2e-65    
ref|XP_002442234.1|  hypothetical protein SORBIDRAFT_08g016710          236   2e-65    
ref|XP_007212982.1|  hypothetical protein PRUPE_ppa022486mg             236   2e-65    
ref|NP_001060183.1|  Os07g0598500                                       236   2e-65    
gb|EMS62788.1|  hypothetical protein TRIUR3_25805                       236   2e-65    
ref|XP_006413744.1|  hypothetical protein EUTSA_v10024998mg             235   3e-65    
ref|XP_006287476.1|  hypothetical protein CARUB_v10000687mg             236   3e-65    
ref|XP_006377346.1|  pentatricopeptide repeat-containing family p...    234   5e-65    
ref|XP_008796719.1|  PREDICTED: pentatricopeptide repeat-containi...    234   1e-64    
gb|EMT05670.1|  Pentatricopeptide repeat-containing protein             230   1e-64    
ref|XP_007025640.1|  Tetratricopeptide repeat-like superfamily pr...    238   1e-64    
ref|XP_003574143.1|  PREDICTED: pentatricopeptide repeat-containi...    234   1e-64    
ref|XP_006348243.1|  PREDICTED: pentatricopeptide repeat-containi...    234   1e-64    
ref|XP_004148903.1|  PREDICTED: pentatricopeptide repeat-containi...    234   1e-64    
gb|EAZ20702.1|  hypothetical protein OsJ_36321                          233   2e-64    
ref|XP_002519054.1|  pentatricopeptide repeat-containing protein,...    232   2e-64    
ref|XP_009768016.1|  PREDICTED: pentatricopeptide repeat-containi...    233   3e-64    
gb|KEH17920.1|  PPR containing plant-like protein                       230   3e-64    
ref|XP_002438962.1|  hypothetical protein SORBIDRAFT_10g029030          233   3e-64    
ref|XP_004244223.1|  PREDICTED: pentatricopeptide repeat-containi...    232   4e-64    
gb|EYU27966.1|  hypothetical protein MIMGU_mgv1a004933mg                232   4e-64    
gb|EMT27370.1|  Pentatricopeptide repeat-containing protein             239   5e-64    
ref|XP_010538697.1|  PREDICTED: pentatricopeptide repeat-containi...    231   6e-64    
gb|EPS60165.1|  hypothetical protein M569_14638                         231   6e-64    
ref|XP_010091037.1|  hypothetical protein L484_006401                   230   6e-64    
emb|CBI20322.3|  unnamed protein product                                236   7e-64    
ref|XP_004962880.1|  PREDICTED: pentatricopeptide repeat-containi...    231   7e-64    
ref|XP_009354430.1|  PREDICTED: pentatricopeptide repeat-containi...    231   8e-64    
ref|XP_008778524.1|  PREDICTED: pentatricopeptide repeat-containi...    229   8e-64    
ref|NP_001151760.1|  tetratricopeptide-like helical                     231   9e-64    
ref|XP_008225086.1|  PREDICTED: pentatricopeptide repeat-containi...    231   1e-63    
ref|XP_008349216.1|  PREDICTED: pentatricopeptide repeat-containi...    231   1e-63    
ref|XP_006283610.1|  hypothetical protein CARUB_v10004666mg             231   1e-63    
ref|XP_007211848.1|  hypothetical protein PRUPE_ppa004720mg             230   1e-63    
gb|KGN64671.1|  hypothetical protein Csa_1G073780                       231   2e-63    
gb|EMT15886.1|  hypothetical protein F775_07739                         231   2e-63    
gb|KDP20961.1|  hypothetical protein JCGZ_21432                         228   2e-63    
ref|XP_010538695.1|  PREDICTED: pentatricopeptide repeat-containi...    231   2e-63    
ref|XP_010434142.1|  PREDICTED: pentatricopeptide repeat-containi...    230   2e-63    
dbj|BAK01251.1|  predicted protein                                      230   3e-63    
ref|XP_009770972.1|  PREDICTED: pentatricopeptide repeat-containi...    229   4e-63    
ref|XP_009789509.1|  PREDICTED: pentatricopeptide repeat-containi...    229   4e-63    
ref|XP_002520753.1|  pentatricopeptide repeat-containing protein,...    231   4e-63    
ref|XP_008383746.1|  PREDICTED: pentatricopeptide repeat-containi...    229   5e-63    
ref|XP_008451368.1|  PREDICTED: pentatricopeptide repeat-containi...    229   6e-63    
gb|KDP24141.1|  hypothetical protein JCGZ_25798                         226   9e-63    
ref|XP_009595568.1|  PREDICTED: pentatricopeptide repeat-containi...    228   1e-62    
emb|CAN75355.1|  hypothetical protein VITISV_002476                     233   1e-62    
gb|ACN28586.1|  unknown                                                 224   2e-62    
ref|XP_008386165.1|  PREDICTED: pentatricopeptide repeat-containi...    227   2e-62    
ref|XP_008226646.1|  PREDICTED: pentatricopeptide repeat-containi...    227   3e-62    
ref|XP_010449016.1|  PREDICTED: pentatricopeptide repeat-containi...    227   3e-62    
ref|NP_680735.1|  pentatricopeptide repeat-containing protein           226   3e-62    
gb|KDO74080.1|  hypothetical protein CISIN_1g011236mg                   226   4e-62    
gb|KDO68752.1|  hypothetical protein CISIN_1g010458mg                   224   5e-62    
ref|XP_007148172.1|  hypothetical protein PHAVU_006G186200g             226   7e-62    
ref|XP_008371361.1|  PREDICTED: pentatricopeptide repeat-containi...    226   7e-62    
ref|XP_007198902.1|  hypothetical protein PRUPE_ppa005316mg             225   8e-62    
dbj|BAJ86699.1|  predicted protein                                      226   8e-62    
ref|XP_009357845.1|  PREDICTED: pentatricopeptide repeat-containi...    226   8e-62    
ref|XP_010439441.1|  PREDICTED: pentatricopeptide repeat-containi...    226   8e-62    
ref|XP_011027842.1|  PREDICTED: pentatricopeptide repeat-containi...    223   1e-61    
ref|XP_010052319.1|  PREDICTED: pentatricopeptide repeat-containi...    224   2e-61    
emb|CAN73453.1|  hypothetical protein VITISV_024964                     224   2e-61    
emb|CBI21839.3|  unnamed protein product                                224   2e-61    
ref|XP_009770977.1|  PREDICTED: pentatricopeptide repeat-containi...    223   3e-61    
ref|XP_009338632.1|  PREDICTED: pentatricopeptide repeat-containi...    224   3e-61    
ref|XP_003593564.1|  Pentatricopeptide repeat-containing protein        224   4e-61    
ref|XP_011029463.1|  PREDICTED: pentatricopeptide repeat-containi...    221   4e-61    
ref|XP_010266573.1|  PREDICTED: pentatricopeptide repeat-containi...    224   4e-61    
gb|KFK28751.1|  hypothetical protein AALP_AA7G042000                    224   4e-61    
ref|XP_008343643.1|  PREDICTED: pentatricopeptide repeat-containi...    221   4e-61    
ref|XP_002517926.1|  pentatricopeptide repeat-containing protein,...    224   5e-61    
ref|XP_006658770.1|  PREDICTED: pentatricopeptide repeat-containi...    223   5e-61    
gb|EAZ04592.1|  hypothetical protein OsI_26742                          220   8e-61    
ref|XP_002867830.1|  pentatricopeptide repeat-containing protein        223   9e-61    
gb|KDP21918.1|  hypothetical protein JCGZ_03056                         223   1e-60    
gb|EEE67529.1|  hypothetical protein OsJ_24995                          223   1e-60    
ref|XP_002273904.2|  PREDICTED: pentatricopeptide repeat-containi...    229   1e-60    
ref|XP_011014826.1|  PREDICTED: pentatricopeptide repeat-containi...    223   1e-60    
gb|EMT03814.1|  hypothetical protein F775_18970                         220   1e-60    
ref|XP_004137019.1|  PREDICTED: pentatricopeptide repeat-containi...    222   2e-60    
ref|XP_008229146.1|  PREDICTED: pentatricopeptide repeat-containi...    222   2e-60    
ref|XP_008229148.1|  PREDICTED: pentatricopeptide repeat-containi...    221   2e-60    
ref|XP_002322749.2|  hypothetical protein POPTR_0016s06320g             222   3e-60    
gb|KDP24140.1|  hypothetical protein JCGZ_25797                         221   4e-60    
ref|XP_010266564.1|  PREDICTED: pentatricopeptide repeat-containi...    222   6e-60    
ref|XP_002517927.1|  pentatricopeptide repeat-containing protein,...    221   6e-60    
ref|XP_011098322.1|  PREDICTED: pentatricopeptide repeat-containi...    221   6e-60    
ref|XP_010062875.1|  PREDICTED: pentatricopeptide repeat-containi...    219   1e-59    
gb|EYU26391.1|  hypothetical protein MIMGU_mgv1a004262mg                221   1e-59    
ref|XP_004303401.1|  PREDICTED: pentatricopeptide repeat-containi...    220   1e-59    
ref|XP_009357846.1|  PREDICTED: pentatricopeptide repeat-containi...    220   1e-59    
ref|XP_011092153.1|  PREDICTED: pentatricopeptide repeat-containi...    218   2e-59    
ref|XP_006451898.1|  hypothetical protein CICLE_v10007647mg             223   2e-59    
ref|XP_008381253.1|  PREDICTED: pentatricopeptide repeat-containi...    219   3e-59    
ref|XP_004982703.1|  PREDICTED: pentatricopeptide repeat-containi...    218   3e-59    
ref|XP_006481674.1|  PREDICTED: pentatricopeptide repeat-containi...    219   4e-59    
gb|KGN43608.1|  hypothetical protein Csa_7G047430                       215   6e-59    
ref|XP_010679402.1|  PREDICTED: pentatricopeptide repeat-containi...    218   8e-59    
dbj|BAJ93740.1|  predicted protein                                      217   9e-59    
ref|XP_006661923.1|  PREDICTED: pentatricopeptide repeat-containi...    218   9e-59    
ref|XP_004514343.1|  PREDICTED: pentatricopeptide repeat-containi...    217   1e-58    
ref|XP_006481675.1|  PREDICTED: pentatricopeptide repeat-containi...    216   2e-58    
ref|XP_008383747.1|  PREDICTED: pentatricopeptide repeat-containi...    215   2e-58    
gb|KEH37793.1|  PPR containing plant protein                            216   3e-58    
gb|KDO70776.1|  hypothetical protein CISIN_1g011472mg                   215   4e-58    
ref|XP_011037318.1|  PREDICTED: pentatricopeptide repeat-containi...    214   4e-58    
ref|XP_009137206.1|  PREDICTED: pentatricopeptide repeat-containi...    214   9e-58    
ref|XP_010039256.1|  PREDICTED: pentatricopeptide repeat-containi...    216   1e-57    
gb|KCW49905.1|  hypothetical protein EUGRSUZ_K03371                     213   1e-57    
ref|XP_006354566.1|  PREDICTED: pentatricopeptide repeat-containi...    214   1e-57    
ref|XP_006376504.1|  pentatricopeptide repeat-containing family p...    213   1e-57    
gb|KHN25154.1|  Pentatricopeptide repeat-containing protein             208   1e-57    
ref|XP_004514446.1|  PREDICTED: pentatricopeptide repeat-containi...    214   2e-57    
gb|KDP24137.1|  hypothetical protein JCGZ_25794                         213   2e-57    
gb|KDP21919.1|  hypothetical protein JCGZ_03057                         208   2e-57    
emb|CDP11458.1|  unnamed protein product                                214   3e-57    
ref|XP_006429968.1|  hypothetical protein CICLE_v10011545mg             213   3e-57    
ref|XP_009379667.1|  PREDICTED: pentatricopeptide repeat-containi...    213   4e-57    
ref|XP_002884218.1|  pentatricopeptide repeat-containing protein        212   5e-57    
ref|XP_010686505.1|  PREDICTED: pentatricopeptide repeat-containi...    213   5e-57    
gb|KDP35619.1|  hypothetical protein JCGZ_09057                         212   6e-57    
ref|XP_008337472.1|  PREDICTED: pentatricopeptide repeat-containi...    212   7e-57    
emb|CDX94049.1|  BnaC07g36830D                                          216   9e-57    
ref|XP_006841257.1|  hypothetical protein AMTR_s00135p00094680          209   1e-56    
ref|XP_003526072.1|  PREDICTED: pentatricopeptide repeat-containi...    211   1e-56    
emb|CDX98698.1|  BnaA03g44830D                                          211   1e-56    
emb|CDO99551.1|  unnamed protein product                                209   2e-56    
ref|XP_008353787.1|  PREDICTED: pentatricopeptide repeat-containi...    211   3e-56    
ref|XP_011096298.1|  PREDICTED: pentatricopeptide repeat-containi...    210   3e-56    
ref|XP_004133705.1|  PREDICTED: pentatricopeptide repeat-containi...    210   3e-56    
ref|XP_007203456.1|  hypothetical protein PRUPE_ppa022158mg             209   6e-56    
ref|XP_011039574.1|  PREDICTED: uncharacterized protein LOC105136086    216   7e-56    
ref|XP_008806388.1|  PREDICTED: pentatricopeptide repeat-containi...    209   7e-56    
ref|NP_179663.1|  pentatricopeptide repeat-containing protein           209   8e-56    
gb|AGN52922.1|  hypothetical protein                                    202   8e-56    
ref|XP_009593035.1|  PREDICTED: pentatricopeptide repeat-containi...    209   1e-55    
ref|XP_009401682.1|  PREDICTED: pentatricopeptide repeat-containi...    209   1e-55    
ref|XP_010522989.1|  PREDICTED: pentatricopeptide repeat-containi...    208   2e-55    
gb|EMT09275.1|  Pentatricopeptide repeat-containing protein             208   2e-55    
ref|XP_007198830.1|  hypothetical protein PRUPE_ppa006648mg             205   2e-55    
gb|KDP24136.1|  hypothetical protein JCGZ_25793                         207   2e-55    
ref|XP_008342918.1|  PREDICTED: pentatricopeptide repeat-containi...    208   3e-55    
gb|KEH19654.1|  PPR containing plant protein                            207   3e-55    
ref|XP_008366628.1|  PREDICTED: pentatricopeptide repeat-containi...    207   3e-55    
ref|XP_003636175.1|  ATP-dependent DNA helicase PIF1                    212   4e-55    
ref|XP_010489001.1|  PREDICTED: pentatricopeptide repeat-containi...    207   4e-55    
ref|XP_011037316.1|  PREDICTED: pentatricopeptide repeat-containi...    206   5e-55    
gb|EYU40494.1|  hypothetical protein MIMGU_mgv1a008156mg                204   5e-55    
ref|XP_002283946.2|  PREDICTED: pentatricopeptide repeat-containi...    206   7e-55    
ref|XP_010323363.1|  PREDICTED: pentatricopeptide repeat-containi...    207   7e-55    
emb|CDP14775.1|  unnamed protein product                                207   7e-55    
emb|CDP05907.1|  unnamed protein product                                210   8e-55    
ref|XP_008452263.1|  PREDICTED: pentatricopeptide repeat-containi...    206   1e-54    
ref|XP_006376509.1|  hypothetical protein POPTR_0013s13650g             205   1e-54    
ref|XP_010099567.1|  hypothetical protein L484_011573                   206   1e-54    
gb|EAY79104.1|  hypothetical protein OsI_34210                          206   2e-54    
ref|XP_010942641.1|  PREDICTED: pentatricopeptide repeat-containi...    206   2e-54    
ref|XP_009778648.1|  PREDICTED: pentatricopeptide repeat-containi...    205   2e-54    
ref|XP_008343277.1|  PREDICTED: pentatricopeptide repeat-containi...    197   3e-54    
ref|XP_008442434.1|  PREDICTED: pentatricopeptide repeat-containi...    203   4e-54    
ref|XP_009800693.1|  PREDICTED: pentatricopeptide repeat-containi...    204   4e-54    
ref|XP_011037319.1|  PREDICTED: pentatricopeptide repeat-containi...    200   7e-54    



>ref|XP_009788488.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Nicotiana sylvestris]
Length=493

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/493 (79%), Positives = 438/493 (89%), Gaps = 0/493 (0%)
 Frame = -2

Query  1956  MASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWE  1777
             MASFIQ+FS KTKNIGKR+TKKYLE+ALY+ L KEGG EN   KNLN+FLKSHKSAYKWE
Sbjct  1     MASFIQKFSLKTKNIGKRATKKYLEDALYKNLFKEGGEENHVRKNLNQFLKSHKSAYKWE  60

Query  1776  VGRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLP  1597
             VG+S+K+LRQRKLY+PA+KLSETMEKRGMNKT SDQ IH+DLVAKSKGI AAE YF NLP
Sbjct  61    VGKSLKVLRQRKLYTPALKLSETMEKRGMNKTISDQAIHLDLVAKSKGIEAAETYFSNLP  120

Query  1596  ETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKI  1417
             E SKN  TY ALLNCYCKELMTEKAEALIEKMKELNL L+SMPYNSLMTLYT+TG PEKI
Sbjct  121   EASKNLVTYSALLNCYCKELMTEKAEALIEKMKELNLGLSSMPYNSLMTLYTKTGHPEKI  180

Query  1416  PAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLAS  1237
             PAIIQE+K  D+MPDS+TYN+WMRAL+++ DISGVERVIDEMKRDGRVA+DWTTYSNLAS
Sbjct  181   PAIIQEMKAYDVMPDSYTYNVWMRALSSMNDISGVERVIDEMKRDGRVADDWTTYSNLAS  240

Query  1236  IYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKT  1057
             IYADAGL+DKA KALKELEKKN  RN+TAYQFLITLYGR+GNL+EVYR+W SLRLAFP+T
Sbjct  241   IYADAGLTDKAVKALKELEKKNACRNVTAYQFLITLYGRVGNLLEVYRVWHSLRLAFPRT  300

Query  1056  ANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelr  877
             ANISYLNMIQVLVNLND+PGAEKCFKEWESG  TYDIRVAN LIGAY KQG L+KA++L+
Sbjct  301   ANISYLNMIQVLVNLNDLPGAEKCFKEWESGCPTYDIRVANVLIGAYTKQGSLEKAEKLK  360

Query  876   krAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELM  697
             + A+RSGAKPNAKTWEIF DYYL+NG+I SAVDC++KAI+TGRGDG KWVPS  IV + M
Sbjct  361   EWARRSGAKPNAKTWEIFGDYYLQNGDIKSAVDCVDKAISTGRGDGGKWVPSSAIVRKFM  420

Query  696   RHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELS  517
              HFE  KDV+GAE     LKK++D LG ++ ESLIRTY A+GKTS +MRRR+KMEN ELS
Sbjct  421   SHFEQNKDVDGAEHFTEILKKAKDELGVDIFESLIRTYVASGKTSPIMRRRIKMENIELS  480

Query  516   EEAKKLLDVISAE  478
             EE K+LLD IS E
Sbjct  481   EEGKRLLDSISVE  493



>ref|XP_009594138.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Nicotiana tomentosiformis]
Length=493

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/493 (78%), Positives = 439/493 (89%), Gaps = 0/493 (0%)
 Frame = -2

Query  1956  MASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWE  1777
             MASFIQ+FS KTKNIGKR+TKKYLE+ALY+ L KEGG EN   KNLN+FLKSHKSAYKWE
Sbjct  1     MASFIQKFSLKTKNIGKRATKKYLEDALYKNLFKEGGEENHVRKNLNQFLKSHKSAYKWE  60

Query  1776  VGRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLP  1597
             VG+S+K+LRQRKLY+PA+KLSETMEKRGMNKT SDQ IH+DLVAKSKGI AAE YF +LP
Sbjct  61    VGKSLKVLRQRKLYAPALKLSETMEKRGMNKTISDQAIHLDLVAKSKGIEAAETYFSDLP  120

Query  1596  ETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKI  1417
             E SKN  TY ALLNCYCKELMTEKAEAL+EKMKELNL L+SMPYNSLMTLY++TG PEKI
Sbjct  121   EASKNLLTYSALLNCYCKELMTEKAEALMEKMKELNLGLSSMPYNSLMTLYSKTGHPEKI  180

Query  1416  PAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLAS  1237
             PAIIQE+K  D+MPDS+TYN+WMRAL+++ DISGVERVIDEMKRDGRVA+DWTTYSNLAS
Sbjct  181   PAIIQEMKAYDVMPDSYTYNVWMRALSSMNDISGVERVIDEMKRDGRVADDWTTYSNLAS  240

Query  1236  IYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKT  1057
             IYADAGL+DKA KALKELEKKN  RN+TAYQFLITL+GR+GNL+EVYR+WRSLRLAFP+T
Sbjct  241   IYADAGLTDKAVKALKELEKKNACRNVTAYQFLITLHGRVGNLLEVYRVWRSLRLAFPRT  300

Query  1056  ANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelr  877
             ANISYLNMIQVLVNLND+PGAEKCFKEWESG  TYDIRVAN LIGAY KQG L+KA+EL+
Sbjct  301   ANISYLNMIQVLVNLNDLPGAEKCFKEWESGCPTYDIRVANVLIGAYTKQGSLEKAEELK  360

Query  876   krAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELM  697
             +RA+RSGAKPNAKTWEIF DYYL+NG+I SAVDC++KAI+TGRGDG KWVPS  IV + M
Sbjct  361   ERARRSGAKPNAKTWEIFGDYYLQNGDIKSAVDCVDKAISTGRGDGGKWVPSSAIVRKFM  420

Query  696   RHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELS  517
              HFE  KDV+GAE  +  LKK++D LG ++ ES IRTY A+GKTS +MRR +KMEN ELS
Sbjct  421   SHFEQNKDVDGAEHFMEILKKAKDELGVDIFESFIRTYVASGKTSPIMRRWIKMENIELS  480

Query  516   EEAKKLLDVISAE  478
             EE K+LLD IS E
Sbjct  481   EEGKRLLDSISVE  493



>ref|XP_004249932.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Solanum lycopersicum]
Length=492

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/493 (75%), Positives = 437/493 (89%), Gaps = 1/493 (0%)
 Frame = -2

Query  1956  MASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWE  1777
             MASF+Q+ + +TKNIGKRS KKYLEEALY+ L KEG  EN   KNLN+FLKSHKSA+KWE
Sbjct  1     MASFMQKLA-RTKNIGKRSKKKYLEEALYKNLFKEGSEENHVRKNLNQFLKSHKSAFKWE  59

Query  1776  VGRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLP  1597
             VG+S+K+LRQRKLY+PA+KLSETMEKRGMN+T SDQ IH+D+VAKSKGI AAE+YF+NLP
Sbjct  60    VGKSIKVLRQRKLYAPALKLSETMEKRGMNRTISDQAIHIDIVAKSKGIEAAESYFLNLP  119

Query  1596  ETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKI  1417
             ETSK+  TY ALLNCYCKELMTEKAEAL+EK+KELNL+L+SMPYNSLMTLYT+TG PEKI
Sbjct  120   ETSKDLLTYCALLNCYCKELMTEKAEALMEKVKELNLSLSSMPYNSLMTLYTKTGHPEKI  179

Query  1416  PAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLAS  1237
             PAIIQE+K  D+MPDS+TYN+WMRAL+++ DISGVERV+DEMKRDGRVAEDWTTYSNLAS
Sbjct  180   PAIIQEMKANDVMPDSYTYNVWMRALSSMNDISGVERVVDEMKRDGRVAEDWTTYSNLAS  239

Query  1236  IYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKT  1057
             IYADAGL+DKA KALKELEKKN  RN+TAYQFLITLYGR+G L+EVYR+WRSLRLAFP+T
Sbjct  240   IYADAGLTDKAVKALKELEKKNACRNITAYQFLITLYGRVGTLLEVYRVWRSLRLAFPRT  299

Query  1056  ANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelr  877
             ANISYLNMIQVLVNLND+PGAEKCFKEWESG  TYDIR+AN LIGAY KQ  L+KA++L+
Sbjct  300   ANISYLNMIQVLVNLNDLPGAEKCFKEWESGCPTYDIRIANVLIGAYTKQSSLEKAEQLK  359

Query  876   krAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELM  697
             +RA+RSGAKPNAKTWEIF+DYYL++G+I SA+DC++KA++ GRGDG KW PS  IV + M
Sbjct  360   ERARRSGAKPNAKTWEIFMDYYLQSGDIKSAIDCVDKAVSIGRGDGSKWFPSSAIVTKFM  419

Query  696   RHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELS  517
              HF+  KDV GAE  +  LKK++D LG ++ ESL+RTY A+ KTS +MRRR+KMEN EL+
Sbjct  420   SHFKQHKDVAGAEHFVEMLKKAKDELGVDIFESLLRTYIASEKTSPIMRRRIKMENIELT  479

Query  516   EEAKKLLDVISAE  478
             +E K+LLD +S E
Sbjct  480   DEGKRLLDAVSVE  492



>ref|XP_006350932.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Solanum tuberosum]
Length=492

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/493 (75%), Positives = 435/493 (88%), Gaps = 1/493 (0%)
 Frame = -2

Query  1956  MASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWE  1777
             MASF+Q  + +TKNIGKRS KKYLE+ALY+ L KEGG EN   KNLN+FLKSHKSA+KWE
Sbjct  1     MASFMQNLA-RTKNIGKRSKKKYLEDALYKNLFKEGGEENHVRKNLNQFLKSHKSAFKWE  59

Query  1776  VGRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLP  1597
             VG+S+K+LRQRKLY+PA+KLSETMEKRGMNKT SDQ IH+D+VAKSKGI A E+YF+NLP
Sbjct  60    VGKSLKVLRQRKLYAPALKLSETMEKRGMNKTVSDQAIHIDIVAKSKGIEAGESYFLNLP  119

Query  1596  ETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKI  1417
             ETSK+  TY ALLNCYCKELMTEKAEAL+EK+KELNL+L+SMPYNSLMTLYT+TG PEKI
Sbjct  120   ETSKDLLTYCALLNCYCKELMTEKAEALMEKVKELNLSLSSMPYNSLMTLYTKTGHPEKI  179

Query  1416  PAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLAS  1237
             PAIIQE+K  D+MPD +TYN+WMRAL+++ DISGVERVIDEMKRDGRVAEDWTTYSNLAS
Sbjct  180   PAIIQEMKANDVMPDCYTYNVWMRALSSVNDISGVERVIDEMKRDGRVAEDWTTYSNLAS  239

Query  1236  IYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKT  1057
             IYADAGL+DKA KALKELEKKN  RN+TAYQFLITLYGR+GNL+EVYR+WRSLRLAFP+T
Sbjct  240   IYADAGLTDKAVKALKELEKKNACRNITAYQFLITLYGRVGNLLEVYRVWRSLRLAFPRT  299

Query  1056  ANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelr  877
             ANISYLNMIQVLVNLND+PGAEKCFKEWESG  TYDIR+AN LIG Y KQ  L+KA++L+
Sbjct  300   ANISYLNMIQVLVNLNDIPGAEKCFKEWESGCPTYDIRIANVLIGVYTKQSSLEKAEQLK  359

Query  876   krAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELM  697
             +RA+RSGAKPNAKTWEIF+DYYL+NG+I SA+DC++KA++ GRGDG KW PS  IV + M
Sbjct  360   ERARRSGAKPNAKTWEIFMDYYLQNGDIKSAIDCVDKAVSIGRGDGSKWFPSSAIVTKFM  419

Query  696   RHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELS  517
              HFE  KDV GAE  +  LKK++D LG ++ ESL+RTY A+ KTS +MRRR+KME+ EL+
Sbjct  420   SHFEQNKDVAGAEHFVEILKKAKDELGVDIFESLLRTYIASEKTSPIMRRRIKMESIELT  479

Query  516   EEAKKLLDVISAE  478
             +E K+LLD +S E
Sbjct  480   DEGKRLLDAVSVE  492



>ref|XP_011077261.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Sesamum indicum]
Length=493

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/492 (72%), Positives = 421/492 (86%), Gaps = 1/492 (0%)
 Frame = -2

Query  1953  ASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEV  1774
             +SF+Q+F+ K K++ KRS+KKYLEEALY+KL ++GG E S   NLN+FLKSHKSAYKWEV
Sbjct  3     SSFMQQFAKK-KSVLKRSSKKYLEEALYKKLFRDGGEEQSVRGNLNQFLKSHKSAYKWEV  61

Query  1773  GRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPE  1594
             GR++K+LR RKLY PA+K+SETMEKRGMNKT SDQ IH+DLVAKS+GI AAEAYF+ LPE
Sbjct  62    GRTLKILRGRKLYGPAVKVSETMEKRGMNKTVSDQAIHLDLVAKSRGITAAEAYFVTLPE  121

Query  1593  TSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIP  1414
             +SK H TYGALLNCYCK+LMTEKAEAL EKMKE NL L+SMPYNSLMT+Y ++G P+K+P
Sbjct  122   SSKTHLTYGALLNCYCKDLMTEKAEALFEKMKEHNLELSSMPYNSLMTMYLKSGLPQKVP  181

Query  1413  AIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASI  1234
             A IQE+K  DIMPD++TYN+WMRALAA+ DISGVERVIDEMKRDGRVA DWTTYSNLASI
Sbjct  182   AFIQEMKASDIMPDTYTYNVWMRALAAVNDISGVERVIDEMKRDGRVAGDWTTYSNLASI  241

Query  1233  YADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTA  1054
             YA AGL DKAEKALKELE +N PR+L+AYQFLITLYGR GNL+EVYR+WRSL+LAF KTA
Sbjct  242   YAGAGLFDKAEKALKELESRNVPRDLSAYQFLITLYGRTGNLLEVYRVWRSLKLAFTKTA  301

Query  1053  NISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrk  874
             N+SYLNMIQVLVNLND+PGAEKCF+EW S  +TYDIR+AN LIGAY ++   +KA+ L+ 
Sbjct  302   NLSYLNMIQVLVNLNDLPGAEKCFREWSSACSTYDIRIANVLIGAYLREDSFEKAQNLKD  361

Query  873   rAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMR  694
             + +R G KPNAKTWE++LDYYLK GEI SAV+C++KA    RGDG KW PSP ++ +LM+
Sbjct  362   QVRRRGIKPNAKTWELYLDYYLKKGEIKSAVNCVDKATAASRGDGGKWTPSPAVIEKLMQ  421

Query  693   HFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSE  514
             HFE  KDV+GAE  L  LKKS+D LG E+LESLIRTY AAGK S +MR R+KMEN ELSE
Sbjct  422   HFEQNKDVKGAEGFLDILKKSKDELGLEVLESLIRTYVAAGKKSPIMRHRIKMENVELSE  481

Query  513   EAKKLLDVISAE  478
             E KKLLDV+S E
Sbjct  482   EGKKLLDVVSEE  493



>ref|XP_002267979.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Vitis vinifera]
Length=489

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/484 (74%), Positives = 414/484 (86%), Gaps = 1/484 (0%)
 Frame = -2

Query  1929  SKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLR  1750
             S+TKNI KRS KKYLEEALY +L K+G  E S  + LN FLKS K  +KWEVG +VK LR
Sbjct  7     SRTKNIAKRS-KKYLEEALYDRLFKDGSSEVSVRQQLNHFLKSSKRVFKWEVGDTVKKLR  65

Query  1749  QRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTY  1570
              RK + PA+KLSETM KRGMN T SDQ I++DL+ K++G+AAAE YFI+LPETSKNH TY
Sbjct  66    DRKRFYPALKLSETMAKRGMNMTISDQAIYLDLITKTRGVAAAENYFIDLPETSKNHLTY  125

Query  1569  GALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKE  1390
             GALLNCYCKEL+TEKAEAL+E+MKEL L L+SMPYNSLMTLYT+ GQPEKIP IIQE+K 
Sbjct  126   GALLNCYCKELLTEKAEALMERMKELKLGLSSMPYNSLMTLYTKIGQPEKIPTIIQELKS  185

Query  1389  CDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSD  1210
              DIMPDS+TYNIWMRALAA+ DISGVERVI+EMKRDGRVA DWTTYSNLASIY DAG+ +
Sbjct  186   LDIMPDSYTYNIWMRALAAVNDISGVERVIEEMKRDGRVASDWTTYSNLASIYVDAGVFE  245

Query  1209  kaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMI  1030
             KAEKALKELEK+N  R+LTA+QFLITLYGRIGNL+EVYR+WRSLRLAFPKTAN+SYLNMI
Sbjct  246   KAEKALKELEKRNACRDLTAFQFLITLYGRIGNLLEVYRVWRSLRLAFPKTANVSYLNMI  305

Query  1029  QVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAK  850
             QVLVNL D+PGAEKCF+EWESG + YDIRVANALIGAYAK GLL+KA+EL++ A+R GAK
Sbjct  306   QVLVNLKDLPGAEKCFREWESGCSIYDIRVANALIGAYAKDGLLEKAEELKEHARRRGAK  365

Query  849   PNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDV  670
             PNAKTWEIFL Y+LKN E+  AVDC+  AI+TGRGDGQKWVPSP I+G  M+HFE +KDV
Sbjct  366   PNAKTWEIFLAYHLKNREMKQAVDCVANAISTGRGDGQKWVPSPEIIGVFMQHFEQEKDV  425

Query  669   EGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDV  490
             +GAE  L  LK + + LG E+ ESLIR YAAAG+TS VMRRR+KMEN E+S+  KKLL+ 
Sbjct  426   DGAEGFLEILKSTVEDLGVEVFESLIRIYAAAGRTSPVMRRRLKMENVEVSDSCKKLLEE  485

Query  489   ISAE  478
             +S E
Sbjct  486   VSVE  489



>ref|XP_002324293.2| hypothetical protein POPTR_0018s05820g [Populus trichocarpa]
 gb|EEF02858.2| hypothetical protein POPTR_0018s05820g [Populus trichocarpa]
Length=490

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/489 (71%), Positives = 413/489 (84%), Gaps = 1/489 (0%)
 Frame = -2

Query  1944  IQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRS  1765
             I +   +TKN+ KRS KKYLEEALY +L +EG  E S  + LN+FLKS K  +KWEV  +
Sbjct  3     IPQLYGRTKNVTKRS-KKYLEEALYVRLFREGSSEVSVRQQLNQFLKSSKLVFKWEVSDT  61

Query  1764  VKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSK  1585
             +K LR R LY PA+KLSETM KRGMNKT S+Q IH+DLVAK++GI AAE YFI+LPETSK
Sbjct  62    IKKLRSRNLYHPALKLSETMSKRGMNKTVSEQAIHLDLVAKTRGIPAAENYFIDLPETSK  121

Query  1584  NHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAII  1405
             N  TYGALLNCYCKELMTE+AEALIEKMKELNL L+SM YNS MTLYT+ GQPE++P II
Sbjct  122   NLLTYGALLNCYCKELMTEEAEALIEKMKELNLGLSSMSYNSFMTLYTKVGQPERVPEII  181

Query  1404  QEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYAD  1225
             QE+K  ++MPDS+TYN+WMRALAA+ DISGVERV++EMKRDGRVA DWTTYSNLASIY D
Sbjct  182   QEMKANNVMPDSYTYNVWMRALAAVNDISGVERVMEEMKRDGRVAADWTTYSNLASIYVD  241

Query  1224  AGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANIS  1045
             AG  +KAE ALKELEK+N  ++L+A+QFLITLYGR GNL+EVYRIWRSLRLAFPKTANIS
Sbjct  242   AGYFEKAETALKELEKRNANKDLSAFQFLITLYGRTGNLLEVYRIWRSLRLAFPKTANIS  301

Query  1044  YLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQ  865
             YLNMIQVLVNL D+PGAEKCF+EWESG +TYDIRVAN LI AYAK+G+L KA+EL++RA 
Sbjct  302   YLNMIQVLVNLKDVPGAEKCFREWESGCSTYDIRVANVLISAYAKEGMLDKAEELKERAC  361

Query  864   RSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFE  685
             R GAKPNAKTWEIFLDYYLKN +I  AVDC+ KA++TGRG+GQKWVPSPVIVG LM HFE
Sbjct  362   RRGAKPNAKTWEIFLDYYLKNEDIKVAVDCLAKAVSTGRGNGQKWVPSPVIVGSLMAHFE  421

Query  684   TKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAK  505
              +KDV+GAE ++  LKK+ D +  E+ ESLIRTYA AG+ S +MRRR+KMEN E+S++ +
Sbjct  422   QQKDVDGAEGLIEILKKAVDDVAVEVFESLIRTYAVAGRKSQMMRRRLKMENVEVSDDCE  481

Query  504   KLLDVISAE  478
             KLL+ I  E
Sbjct  482   KLLEAICVE  490



>ref|XP_006381714.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|ABK95769.1| unknown [Populus trichocarpa]
 gb|ERP59511.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=490

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/483 (72%), Positives = 410/483 (85%), Gaps = 1/483 (0%)
 Frame = -2

Query  1926  KTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQ  1747
             +TK++ KRS KKYLEEALY +L KEG  E S  + LN+FLKS K  +KWEVG ++K LR 
Sbjct  9     RTKSVTKRS-KKYLEEALYVRLFKEGSSEVSVRQQLNQFLKSSKRVFKWEVGDTIKKLRS  67

Query  1746  RKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYG  1567
             R LY PA+KLSETM  RGMNKT SDQ IH+DLVAK++GI AAE YFI+LPETSKN  TYG
Sbjct  68    RNLYYPAVKLSETMSSRGMNKTVSDQAIHLDLVAKTRGIPAAENYFIDLPETSKNLRTYG  127

Query  1566  ALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKEC  1387
             ALLNCYCKELMTE+AEALIEKMKELNL L+SM YNSLMTLYT+ GQPE+IPAIIQE+K  
Sbjct  128   ALLNCYCKELMTEEAEALIEKMKELNLGLSSMSYNSLMTLYTKVGQPERIPAIIQEMKAD  187

Query  1386  DIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDk  1207
             ++MPDS+TYN+WMRALAA+ DISGVERVI+EMKRDGRVA +WTTYSNLASIY DAG  DK
Sbjct  188   NVMPDSYTYNVWMRALAAVNDISGVERVIEEMKRDGRVAANWTTYSNLASIYVDAGYFDK  247

Query  1206  aekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQ  1027
             AEKALKELEK N  ++L A+QFLITLYGR G L+EVYRIWRSLRLAFPKTANISYLNMIQ
Sbjct  248   AEKALKELEKINANKDLFAFQFLITLYGRTGKLIEVYRIWRSLRLAFPKTANISYLNMIQ  307

Query  1026  VLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKP  847
             VLVNL D+PGAEKCF+EWESG +TYDIRVAN +I AYAK+GL+ KA+EL++RA+R GAKP
Sbjct  308   VLVNLKDVPGAEKCFREWESGCSTYDIRVANVVISAYAKEGLVDKAEELKERARRRGAKP  367

Query  846   NAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVE  667
             N+KTWEIF DYYLKNG++   VDCI  A++ GRG+GQKWVPSPVIVG LM HFE +KDV+
Sbjct  368   NSKTWEIFCDYYLKNGDVKLGVDCIANAVSAGRGNGQKWVPSPVIVGSLMAHFEQQKDVD  427

Query  666   GAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
             GAE ++  LKK+ D +  E+ ESLIRTYAAAG+ S +MRRR+KMEN E+S++ +KLL+ I
Sbjct  428   GAEDLIEILKKAVDDVAVEVFESLIRTYAAAGRKSQLMRRRLKMENVEVSDDCQKLLEAI  487

Query  486   SAE  478
               E
Sbjct  488   CVE  490



>ref|XP_006438303.1| hypothetical protein CICLE_v10031342mg [Citrus clementina]
 gb|ESR51543.1| hypothetical protein CICLE_v10031342mg [Citrus clementina]
Length=490

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/488 (72%), Positives = 407/488 (83%), Gaps = 2/488 (0%)
 Frame = -2

Query  1941  QRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSV  1762
             QRF  +TKNI KRS KK+LEEALY +L K+GG + S  + LN+FLKS K  +KWEVG ++
Sbjct  5     QRFG-RTKNIAKRS-KKHLEEALYDRLFKKGGSDVSVRQQLNQFLKSKKRVFKWEVGDTL  62

Query  1761  KLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKN  1582
             K LR RKLY PA+KLSE MEKRGMNKT SDQ IH+DLVAK +GI AAE YF++LPETSKN
Sbjct  63    KKLRDRKLYYPALKLSENMEKRGMNKTVSDQAIHLDLVAKVQGIDAAENYFVDLPETSKN  122

Query  1581  HFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQ  1402
             H TYG+LLNCYCKELMTEKAEAL+EKMKELNL  +SMP+NSLMTLY +TG PEKIPAIIQ
Sbjct  123   HLTYGSLLNCYCKELMTEKAEALLEKMKELNLGFSSMPFNSLMTLYAKTGHPEKIPAIIQ  182

Query  1401  EIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADA  1222
             E+K   IMPDS+TYN+WMRALAA+ DISG ERVI+EMKRDGRVA DWTT+SNLASIY +A
Sbjct  183   EMKASSIMPDSYTYNVWMRALAAVNDISGAERVIEEMKRDGRVAADWTTFSNLASIYVEA  242

Query  1221  GLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISY  1042
             GL +KAE+ALKELE +N  R+L+AYQFLITLYG+ GNL EVYRIWRSLRLAFPKTANISY
Sbjct  243   GLFEKAERALKELENRNAHRDLSAYQFLITLYGQTGNLSEVYRIWRSLRLAFPKTANISY  302

Query  1041  LNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQR  862
             LNMIQVLVNL D+PGAEKCFKEWESG  TYDIRV N +IGAYAK+  L+ A+EL++RA+R
Sbjct  303   LNMIQVLVNLKDLPGAEKCFKEWESGCATYDIRVTNVMIGAYAKESRLENAEELKERARR  362

Query  861   SGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFET  682
              GA PNAKTWEIF DYYL+NG++  AVDC+EKAI TGRGDG KWVPS   +   MRHFE 
Sbjct  363   RGANPNAKTWEIFSDYYLRNGDMKLAVDCLEKAIDTGRGDGGKWVPSSETIRTFMRHFEQ  422

Query  681   KKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKK  502
             +KDV+GAE  L  LKK+ D LG E+ E LIRTYAAAG+TS VM RR+KME  E+SE +KK
Sbjct  423   EKDVDGAEGFLEILKKAVDDLGVEVFEPLIRTYAAAGRTSPVMLRRLKMEKVEVSEASKK  482

Query  501   LLDVISAE  478
             LL+ I  E
Sbjct  483   LLEAICVE  490



>gb|KDO82307.1| hypothetical protein CISIN_1g011226mg [Citrus sinensis]
Length=490

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/488 (72%), Positives = 406/488 (83%), Gaps = 2/488 (0%)
 Frame = -2

Query  1941  QRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSV  1762
             QRF  +TKNI KRS KK+LEEALY +L K+G  + S  + LN+FLKS K  +KWEVG ++
Sbjct  5     QRFG-RTKNIAKRS-KKHLEEALYDRLFKKGSSDVSVRQQLNQFLKSKKRVFKWEVGDTL  62

Query  1761  KLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKN  1582
             K LR RKLY PA+KLSE MEKRGMNKT SDQ IH+DLVAK +GI AAE YF++LPETSKN
Sbjct  63    KKLRDRKLYYPALKLSENMEKRGMNKTVSDQAIHLDLVAKVQGIDAAENYFVDLPETSKN  122

Query  1581  HFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQ  1402
             H TYG+LLNCYCKELMTEKAEAL+EKMKELNL  +SMP+NSLMTLY +TG PEKIPAIIQ
Sbjct  123   HLTYGSLLNCYCKELMTEKAEALLEKMKELNLGFSSMPFNSLMTLYAKTGHPEKIPAIIQ  182

Query  1401  EIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADA  1222
             E+K   IMPDS+TYN+WMRALAA+ DISG ERVI+EMKRDGRVA DWTT+SNLASIY +A
Sbjct  183   EMKASSIMPDSYTYNVWMRALAAVNDISGAERVIEEMKRDGRVAADWTTFSNLASIYVEA  242

Query  1221  GLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISY  1042
             GL +KAE+ALKELE +N  R+L+AYQFLITLYG+ GNL EVYRIWRSLRLAFP TANISY
Sbjct  243   GLFEKAERALKELENRNAHRDLSAYQFLITLYGQTGNLSEVYRIWRSLRLAFPNTANISY  302

Query  1041  LNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQR  862
             LNMIQVLVNL D+PGAEKCFKEWESG  TYDIRV N +IGAYAK+G L+ A+EL++RA+R
Sbjct  303   LNMIQVLVNLKDLPGAEKCFKEWESGCATYDIRVTNVMIGAYAKEGRLENAEELKERARR  362

Query  861   SGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFET  682
              GA PNAKTWEIF DYYL+NG++  AVDC+EKAI TGRGDG KWVPS   +   MRHFE 
Sbjct  363   RGADPNAKTWEIFSDYYLRNGDMKLAVDCLEKAIDTGRGDGGKWVPSSETIRTFMRHFEQ  422

Query  681   KKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKK  502
             +KDV+GAE  L  LKK+ D LG E+ E LIRTYAAAG+TS VM RR+KME  E+SE +KK
Sbjct  423   EKDVDGAEGFLEILKKAVDDLGVEVFEPLIRTYAAAGRTSPVMLRRLKMEKVEVSEASKK  482

Query  501   LLDVISAE  478
             LL+ I  E
Sbjct  483   LLEAICVE  490



>ref|XP_006483923.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Citrus sinensis]
Length=490

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/488 (72%), Positives = 406/488 (83%), Gaps = 2/488 (0%)
 Frame = -2

Query  1941  QRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSV  1762
             QRF  +TKNI KRS KK+LEEALY +L K+G  + S  + LN+FLKS K  +KWEVG ++
Sbjct  5     QRFG-RTKNIAKRS-KKHLEEALYDRLFKKGSSDVSVRQQLNQFLKSKKRVFKWEVGDTL  62

Query  1761  KLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKN  1582
             K LR RKLY PA+KLSE MEKRGMNKT SDQ IH+DLVAK +GI AAE YF++LPETSKN
Sbjct  63    KKLRDRKLYYPALKLSENMEKRGMNKTVSDQAIHLDLVAKVQGIDAAENYFVDLPETSKN  122

Query  1581  HFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQ  1402
             H TYG+LLNCYCKELMTEKAEAL+EKMKELNL  +SMP+NSLMTLY +TG PEKIPAIIQ
Sbjct  123   HLTYGSLLNCYCKELMTEKAEALLEKMKELNLGFSSMPFNSLMTLYAKTGHPEKIPAIIQ  182

Query  1401  EIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADA  1222
             E+K   IMPDS+TYN+WMRALAA+ DISG ERVI+EMKRDGRVA DWTT+SNLASIY +A
Sbjct  183   EMKASSIMPDSYTYNVWMRALAAVNDISGAERVIEEMKRDGRVAADWTTFSNLASIYVEA  242

Query  1221  GLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISY  1042
             GL +KAE+ALKELE +N  R+L+AYQFLITLYG+ GNL EVYRIWRSLRLAFPKTANISY
Sbjct  243   GLFEKAERALKELENRNAHRDLSAYQFLITLYGQTGNLSEVYRIWRSLRLAFPKTANISY  302

Query  1041  LNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQR  862
             LNMIQVLVNL D+PGAEKCFKEWESG  TYDIRV N +IGAYAK+  L+ A+EL++RA+R
Sbjct  303   LNMIQVLVNLKDLPGAEKCFKEWESGCATYDIRVTNVMIGAYAKESRLENAEELKERARR  362

Query  861   SGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFET  682
              GA PNAKTWEIF DYYL+NG++  AVDC+EKAI TGRGDG KWVPS   +   MRHFE 
Sbjct  363   RGANPNAKTWEIFSDYYLRNGDMKLAVDCLEKAIDTGRGDGGKWVPSSETIRTFMRHFEQ  422

Query  681   KKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKK  502
             +KDV+GAE  L  LKK+ D LG E+ E LIRTYAAAG+TS VM RR+KME  E+SE +KK
Sbjct  423   EKDVDGAEGFLEILKKAVDDLGVEVFEPLIRTYAAAGRTSPVMLRRLKMEKVEVSEASKK  482

Query  501   LLDVISAE  478
             LL+ I  E
Sbjct  483   LLEAICVE  490



>ref|XP_011043458.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Populus euphratica]
 ref|XP_011043459.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Populus euphratica]
 ref|XP_011043460.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Populus euphratica]
Length=490

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/489 (71%), Positives = 411/489 (84%), Gaps = 1/489 (0%)
 Frame = -2

Query  1944  IQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRS  1765
             I +   +TKN+ KRS KKYLEEALY +L +EG  E S  + LN+FLKS K  +KWEV  +
Sbjct  3     IPQLYGRTKNVTKRS-KKYLEEALYVRLFREGSSEVSVRQQLNQFLKSSKLVFKWEVSDT  61

Query  1764  VKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSK  1585
             +K LR R LY PA+KLSETM KRGMNKT S+Q IH+DLVAK++GI AAE YFI+LPETSK
Sbjct  62    IKKLRSRNLYHPALKLSETMSKRGMNKTVSEQAIHLDLVAKTRGIPAAENYFIDLPETSK  121

Query  1584  NHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAII  1405
             N  TYGALLNCYCKELMTE+AEALIEKMKEL+L L+SM YNS MTLYT+ GQPEK+P II
Sbjct  122   NLLTYGALLNCYCKELMTEEAEALIEKMKELSLGLSSMSYNSFMTLYTKVGQPEKVPEII  181

Query  1404  QEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYAD  1225
             QE+K  ++MPDS+TYN+WMRALAA+ DISGVERVI+EMKRD RVA +WTTYSNLASIY D
Sbjct  182   QEMKANNVMPDSYTYNVWMRALAAVNDISGVERVIEEMKRDARVAVNWTTYSNLASIYVD  241

Query  1224  AGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANIS  1045
             AG  +KAE ALKELEK+N  ++L+A+QFL+TLYGR GNL+EVYRIWRSLRLAFPKTANIS
Sbjct  242   AGYFEKAETALKELEKRNANKDLSAFQFLVTLYGRTGNLLEVYRIWRSLRLAFPKTANIS  301

Query  1044  YLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQ  865
             YLNMIQVLVNL D+PGAEKCF+EWESG  TYDIRVAN LI AYAK+G+L KA+EL++RA 
Sbjct  302   YLNMIQVLVNLKDVPGAEKCFREWESGCLTYDIRVANVLISAYAKEGMLDKAEELKERAH  361

Query  864   RSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFE  685
             R GAKPNAKTWEIFLDYYLKN +I  AVDC+ KA++TGRG+GQKWVPSPVIVG LM HFE
Sbjct  362   RRGAKPNAKTWEIFLDYYLKNEDIKVAVDCLAKAVSTGRGNGQKWVPSPVIVGSLMAHFE  421

Query  684   TKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAK  505
              +KDV+GAE ++  LKK+ D +  E+ ESLIRTYA AG+ S +MRRR+KMEN E+S++ +
Sbjct  422   QQKDVDGAEGLIEILKKAVDDVAVEVFESLIRTYAVAGRKSQMMRRRLKMENVEVSDDCE  481

Query  504   KLLDVISAE  478
             KLL+ I  E
Sbjct  482   KLLEAICVE  490



>ref|XP_004296672.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Fragaria vesca subsp. vesca]
Length=490

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/491 (71%), Positives = 416/491 (85%), Gaps = 2/491 (0%)
 Frame = -2

Query  1950  SFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVG  1771
             + +Q+F  +TK++ KRS+K Y+EEALY  L K+GG E S  + LNEF+KS K  +KWEVG
Sbjct  2     AMMQQFG-RTKSVTKRSSK-YVEEALYVWLFKDGGSEVSVRQKLNEFIKSRKRVFKWEVG  59

Query  1770  RSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPET  1591
              ++K LRQRKLY PA+KLSETM KRGMNKT SDQ IH+DLVAK++GI AAE YF NLPE+
Sbjct  60    DTLKKLRQRKLYYPALKLSETMAKRGMNKTVSDQAIHLDLVAKARGIPAAEDYFKNLPES  119

Query  1590  SKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPA  1411
             SKNH +YGALLNCYCKELMTE+AEAL+EKMKELNL LTSMPYNSLMTLY++TG+PEKIPA
Sbjct  120   SKNHLSYGALLNCYCKELMTEEAEALLEKMKELNLPLTSMPYNSLMTLYSKTGKPEKIPA  179

Query  1410  IIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIY  1231
             IIQE+K C++M DS++YN+WMRALAA+ D+SGVERVIDEMKRDGRVA DWTTYSNLASIY
Sbjct  180   IIQEMKGCNVMLDSYSYNVWMRALAAVDDVSGVERVIDEMKRDGRVASDWTTYSNLASIY  239

Query  1230  ADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTAN  1051
              DAG+ +KAE AL+ELEKKNT R+L+A+QFLITLYGR GNL+EV+R+WRSLRLAFPKTAN
Sbjct  240   VDAGMPEKAENALRELEKKNTHRDLSAFQFLITLYGRTGNLLEVHRVWRSLRLAFPKTAN  299

Query  1050  ISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkr  871
             ISYLNMIQVLVNL D+PGAEKCF+EWES  +TYDIRVAN LIGAYAK+G+L+KAK L+++
Sbjct  300   ISYLNMIQVLVNLRDLPGAEKCFREWESRCSTYDIRVANVLIGAYAKEGMLEKAKVLKEQ  359

Query  870   AQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRH  691
             A+R GAKP+AKTWEIF+D YLKN E   AV+ +  AI+ G+GDG KWVPS   +  LM H
Sbjct  360   ARRRGAKPSAKTWEIFVDCYLKNAEYDLAVESVANAISIGKGDGGKWVPSHETIKTLMEH  419

Query  690   FETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEE  511
             FE  KDVEGAE  L  LKK+ + LGAE+ ESLI+TYAAAGKT+  MR R+KMEN E+SE 
Sbjct  420   FEQTKDVEGAEGFLEILKKATESLGAEVFESLIKTYAAAGKTTPAMRHRLKMENVEVSEA  479

Query  510   AKKLLDVISAE  478
             +KKLL+ I  E
Sbjct  480   SKKLLESICVE  490



>gb|KDP26635.1| hypothetical protein JCGZ_17793 [Jatropha curcas]
Length=490

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/483 (72%), Positives = 406/483 (84%), Gaps = 1/483 (0%)
 Frame = -2

Query  1926  KTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQ  1747
             +TKN+ KRS KKYLEEALY +L KEG  E S  + LNEFLKS K  YKWEVG ++K LR 
Sbjct  9     RTKNVTKRS-KKYLEEALYVRLFKEGSSEVSVRQQLNEFLKSSKRVYKWEVGDTIKKLRD  67

Query  1746  RKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYG  1567
             R LY PA+KLSE M KRGMNKT SDQ IH+DLVAK++GI AAE YFI+LPETSKNH TYG
Sbjct  68    RNLYYPALKLSEAMSKRGMNKTVSDQAIHLDLVAKTRGIPAAENYFIDLPETSKNHLTYG  127

Query  1566  ALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKEC  1387
             ALLNCYCKELMTE+AE+L EKMKELNL L+SM YNSLMTLYT+  QPE++PAIIQE+K  
Sbjct  128   ALLNCYCKELMTEEAESLKEKMKELNLGLSSMSYNSLMTLYTKISQPERVPAIIQEMKAD  187

Query  1386  DIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDk  1207
             +IMPDS+TYN+WMRALAA+ DISGVERVI+EMKRDGRVA DWTTYSNLASIY DAGL DK
Sbjct  188   NIMPDSYTYNVWMRALAAVNDISGVERVIEEMKRDGRVAADWTTYSNLASIYVDAGLLDK  247

Query  1206  aekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQ  1027
             AEKALKELEK+N  R+ +A+QFLITLYGRIG L+EVYRIWRSLRLAFPKT+NISYLNMIQ
Sbjct  248   AEKALKELEKRNAHRDHSAFQFLITLYGRIGKLLEVYRIWRSLRLAFPKTSNISYLNMIQ  307

Query  1026  VLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKP  847
             VLVNL D+PG+EKCF+EWES  + YDIR+ N LI AYAK GLL++A+EL++RA   GAKP
Sbjct  308   VLVNLKDLPGSEKCFREWESSCSNYDIRIVNVLIKAYAKDGLLERAEELKERACGRGAKP  367

Query  846   NAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVE  667
             NAKTWEIFLDYYL+ G++  AVDC+  AI+ GRGDGQKWVPSP IV   M HFE +KDV+
Sbjct  368   NAKTWEIFLDYYLEKGDVKLAVDCVANAISKGRGDGQKWVPSPEIVMSFMEHFEQQKDVD  427

Query  666   GAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
              AE  +  LKK+ D++GA + ESLIRTYAAAG+TS VM RR+KMEN E+S  ++KLL+VI
Sbjct  428   SAEAFIEILKKAVDNVGANVFESLIRTYAAAGRTSNVMCRRLKMENVEVSAPSQKLLEVI  487

Query  486   SAE  478
             + E
Sbjct  488   TVE  490



>ref|XP_010023484.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Eucalyptus grandis]
 gb|KCW59775.1| hypothetical protein EUGRSUZ_H02521 [Eucalyptus grandis]
Length=490

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/490 (71%), Positives = 403/490 (82%), Gaps = 3/490 (1%)
 Frame = -2

Query  1944  IQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRS  1765
             +Q F  +TK++ KRS KKYLEEALYR+L ++G  E S  + LN+FLKS K  YKWEVG +
Sbjct  3     LQPFG-RTKSVSKRS-KKYLEEALYRRLFRDGSAEVSVRQQLNQFLKSSKRVYKWEVGDT  60

Query  1764  VKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSK  1585
             +K LR R LY PA KLSE M  RGMN+T SDQ IH+DLVAK+KGI AAE YFINLPE SK
Sbjct  61    LKKLRGRGLYYPAFKLSEAMADRGMNRTVSDQAIHLDLVAKAKGITAAENYFINLPEASK  120

Query  1584  NHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAII  1405
             NH +YGALLNCYCKELM E+AE L+EKMKELNL L+SMPYNS+MTLYTRTGQPEK+PAII
Sbjct  121   NHLSYGALLNCYCKELMVEEAEGLLEKMKELNLELSSMPYNSIMTLYTRTGQPEKVPAII  180

Query  1404  QEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYAD  1225
             QE+K   IM DSF+YNIWMRALAA  D SGVERV++EMKRDGRVA DWTTYSN+ASIY D
Sbjct  181   QEMKSSHIMLDSFSYNIWMRALAATSDTSGVERVVEEMKRDGRVAPDWTTYSNIASIYVD  240

Query  1224  AGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANIS  1045
             AGL +KAEKALKELEK N  +NL+AYQ LITLYGR GNL+EVYR+WRSLRLAFPKTANIS
Sbjct  241   AGLFEKAEKALKELEKINARKNLSAYQILITLYGRTGNLLEVYRVWRSLRLAFPKTANIS  300

Query  1044  YLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQ  865
             YLNMIQ LV L D+PGAEKCFKEWESG TTYD+R+ NALIGAYAK+G L+KAK+LR RA+
Sbjct  301   YLNMIQALVKLKDLPGAEKCFKEWESGCTTYDMRIVNALIGAYAKEGSLEKAKDLRDRAR  360

Query  864   RS-GAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHF  688
             R+ GAKPNAKTWEIFLDYYL+NG++  A +C++ AI+TGRGDG+KWVPSP  V  +M HF
Sbjct  361   RTRGAKPNAKTWEIFLDYYLQNGDVKLAAECVDNAISTGRGDGRKWVPSPETVRIMMGHF  420

Query  687   ETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEA  508
             E +KDV+GAE  L  LKK+ED L   + ESLIRTY A G+    MRRR+KMEN ELSE A
Sbjct  421   EQQKDVDGAECFLEILKKTEDPLEVTVFESLIRTYVAVGRKEPTMRRRLKMENVELSEVA  480

Query  507   KKLLDVISAE  478
              KLLD I  E
Sbjct  481   TKLLDKICDE  490



>ref|XP_007044736.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
 gb|EOY00568.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
Length=491

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/484 (71%), Positives = 408/484 (84%), Gaps = 2/484 (0%)
 Frame = -2

Query  1926  KTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQ  1747
             +TKN+ +RS KKYLEEALY +L K+G  E S  + LN+FLKS K  YKWEV  ++K LR 
Sbjct  9     RTKNVTRRS-KKYLEEALYHRLFKDGSSEISVRQQLNQFLKSSKRVYKWEVDDTLKKLRH  67

Query  1746  RKLYSPAIKLSETM-EKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTY  1570
             RKLY PA+KLSETM  KRGMNKT SDQ IH+DLVAK++GI AAE YFI+LPE  KNH TY
Sbjct  68    RKLYYPALKLSETMVTKRGMNKTVSDQAIHLDLVAKAQGIPAAENYFIDLPEALKNHLTY  127

Query  1569  GALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKE  1390
             GALLNCYCKELMTEKAEAL+EKMKE NL L SM YNSLMTLYT+ GQPE++P +IQE+K 
Sbjct  128   GALLNCYCKELMTEKAEALMEKMKEHNLPLGSMSYNSLMTLYTKIGQPERVPDVIQEMKS  187

Query  1389  CDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSD  1210
             C IMPDS+TYN+WMRALAA+ DISG ERVIDEMKRD    +DWTTYSN+AS+Y DAGL  
Sbjct  188   CGIMPDSYTYNVWMRALAAMNDISGFERVIDEMKRDAEDDDDWTTYSNIASVYVDAGLFK  247

Query  1209  kaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMI  1030
             KAE+ALKELEK+N+ R+L+A+ FLITLYG++GNL+EVYRIWRSLRL+F KTAN+S+LNMI
Sbjct  248   KAEEALKELEKRNSRRDLSAFHFLITLYGKVGNLLEVYRIWRSLRLSFHKTANVSFLNMI  307

Query  1029  QVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAK  850
             QVLVNL D+PGAEKCF+EWESG +TYDIR+ANALIGAYAK+GLL+KA+EL++RA++ G K
Sbjct  308   QVLVNLKDLPGAEKCFREWESGCSTYDIRIANALIGAYAKEGLLEKAQELKERARKRGVK  367

Query  849   PNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDV  670
             PNAKTWEIFLDYYLKNG+I  AVDC+  AI+TGRGDG KWVPS   +G +M HFE +KDV
Sbjct  368   PNAKTWEIFLDYYLKNGDIKLAVDCVANAISTGRGDGGKWVPSSKTIGTVMWHFEQEKDV  427

Query  669   EGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDV  490
             +GAE  L  LKK+ DH+G E+ ESLIRTYAAAG+TS VM  R+KME  E+SE +KKL++V
Sbjct  428   DGAEGFLEILKKAVDHVGEEVFESLIRTYAAAGRTSPVMHHRLKMEKVEVSEASKKLVEV  487

Query  489   ISAE  478
             IS E
Sbjct  488   ISVE  491



>ref|XP_010553613.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Tarenaya hassleriana]
Length=490

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/484 (70%), Positives = 399/484 (82%), Gaps = 0/484 (0%)
 Frame = -2

Query  1929  SKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLR  1750
             S+TKN+ KRSTKKYLEE LY +L K+G  E S  + LN+FLKS KS +KWEVG ++K LR
Sbjct  7     SRTKNVAKRSTKKYLEEPLYHRLFKDGSSEVSVRQQLNQFLKSSKSVFKWEVGDTIKKLR  66

Query  1749  QRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTY  1570
               +LY PA+KLSE ME R MNKT SDQ IH+DLVAK++GIAAAE YF++LPETSK H TY
Sbjct  67    SHRLYYPALKLSEAMEDRCMNKTVSDQAIHLDLVAKARGIAAAENYFVDLPETSKTHLTY  126

Query  1569  GALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKE  1390
             G+LLNCYCKELMT+KAE L++KMKELN TLTSM YNSLMTLYT+TGQ EK+PAIIQE+K 
Sbjct  127   GSLLNCYCKELMTDKAEGLLDKMKELNFTLTSMSYNSLMTLYTKTGQSEKVPAIIQEMKA  186

Query  1389  CDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSD  1210
              +IMPDS+TYN+WMRALAA  DISGVERV +EM RDGRVA DWTTYSNLA+IY DAGLS+
Sbjct  187   ENIMPDSYTYNVWMRALAATKDISGVERVSEEMNRDGRVAPDWTTYSNLATIYVDAGLSE  246

Query  1209  kaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMI  1030
             KAEKAL+ELE+KN   +  AYQFLITLYGR+G + EVYR+WRSLRLAFPKT N++YLN I
Sbjct  247   KAEKALQELERKNDHGDFLAYQFLITLYGRLGKVTEVYRVWRSLRLAFPKTTNVAYLNTI  306

Query  1029  QVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAK  850
             QVLVNL D+PGAE  FKEW+S  + YDIRV N LIGAYA+ GL+ KAKE++ +A R GAK
Sbjct  307   QVLVNLKDLPGAETLFKEWQSNCSIYDIRVVNVLIGAYARDGLVVKAKEMKDKAHRRGAK  366

Query  849   PNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDV  670
              NAKTWEIF+DYY+KNGEI+ AV+CI KA++ GRGDG KW+PS   +G LM HFE +KDV
Sbjct  367   ANAKTWEIFMDYYMKNGEIAQAVECISKAVSIGRGDGSKWLPSQETIGTLMGHFEQEKDV  426

Query  669   EGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDV  490
             +GAE  +  LKK  D++G E+LESLIRTYAAAGK ST MRRR+KMEN E+SE  KKLLD 
Sbjct  427   DGAESFVEILKKGTDNVGVEVLESLIRTYAAAGKKSTAMRRRLKMENVEVSEATKKLLDE  486

Query  489   ISAE  478
             I  E
Sbjct  487   ICEE  490



>ref|XP_004508130.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Cicer arietinum]
Length=490

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/491 (69%), Positives = 413/491 (84%), Gaps = 2/491 (0%)
 Frame = -2

Query  1950  SFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVG  1771
             S +QR+  + K++ KRS KKYL+EALY KL K+GG + +  + LN+F+KS K  YKWEVG
Sbjct  2     SLMQRYG-RCKSVVKRS-KKYLDEALYLKLFKDGGSQLNVRQQLNQFIKSGKLVYKWEVG  59

Query  1770  RSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPET  1591
              ++K LRQRKLY PA+KLSETM KR M KT SDQ IH+DL+AK+KGI AAE YF+NLP++
Sbjct  60    DTLKKLRQRKLYQPALKLSETMAKRNMIKTVSDQAIHIDLIAKAKGIVAAENYFVNLPDS  119

Query  1590  SKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPA  1411
             +KNH +YGALLNCYCKELMT+KAE ++EKMK+L L LTSMPYNSLMTLYT+ GQPEKIP+
Sbjct  120   AKNHLSYGALLNCYCKELMTDKAEGVVEKMKDLGLPLTSMPYNSLMTLYTKVGQPEKIPS  179

Query  1410  IIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIY  1231
             +IQE+K  +IMPDS+TYN+WMRALAA+ DISGVERVIDEMKRDGRV  DWTTYSNLASIY
Sbjct  180   MIQEMKASNIMPDSYTYNVWMRALAAVNDISGVERVIDEMKRDGRVTGDWTTYSNLASIY  239

Query  1230  ADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTAN  1051
              DAGL +KAE ALKELEK+N  +NL+AYQF+ITLYGRIG   EVYR+WRSLRLAFPKTAN
Sbjct  240   VDAGLFEKAEGALKELEKRNAYKNLSAYQFIITLYGRIGKTYEVYRVWRSLRLAFPKTAN  299

Query  1050  ISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkr  871
             ISYLNMIQVLVNL D+PGAEKCF+EWES  TTYDIRVANALIGAY K  +L+KA+EL++R
Sbjct  300   ISYLNMIQVLVNLKDLPGAEKCFREWESTCTTYDIRVANALIGAYTKLDMLEKAEELKER  359

Query  870   AQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRH  691
             A+R GAKPNAKTWEIFLD +L+ G++  AVDC+ +AI+ GRG+G+KWVPS   +G +MRH
Sbjct  360   ARRRGAKPNAKTWEIFLDCHLRKGDLKLAVDCLTEAISIGRGNGEKWVPSSETIGIMMRH  419

Query  690   FETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEE  511
             +E +KDV+GAE  +  LKKS D + AE+ ESLIRTYAAAGKTS+ M RR+KMEN  ++E+
Sbjct  420   YEQEKDVDGAEEFIEILKKSVDSIEAEVFESLIRTYAAAGKTSSSMHRRLKMENVTVNED  479

Query  510   AKKLLDVISAE  478
              +KLL  IS E
Sbjct  480   TQKLLKAISVE  490



>gb|EYU39860.1| hypothetical protein MIMGU_mgv1a005194mg [Erythranthe guttata]
Length=493

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/492 (69%), Positives = 402/492 (82%), Gaps = 1/492 (0%)
 Frame = -2

Query  1953  ASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEV  1774
             ++F+Q+F+ K +++ KRS+KKYLEEALY+KLL +GG E    + LN+F+ S KSA+KWE 
Sbjct  3     STFMQQFAKK-RSLLKRSSKKYLEEALYKKLLSDGGEERCVREKLNQFIDSRKSAFKWEA  61

Query  1773  GRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPE  1594
             G S+K+LR RKLY PA+KLSE  EKRGMNKT SDQ IH+DL+AKS+GI AAE YFI LPE
Sbjct  62    GHSLKILRSRKLYGPALKLSEVTEKRGMNKTISDQAIHLDLIAKSRGITAAEDYFIRLPE  121

Query  1593  TSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIP  1414
             +SKNH TYGALLNCYCKE MTEKA+ L EKMKELNL L +M YNSLMTL+ + G P+ +P
Sbjct  122   SSKNHLTYGALLNCYCKESMTEKAQTLFEKMKELNLELGAMSYNSLMTLHLKNGLPKMVP  181

Query  1413  AIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASI  1234
               IQE+K  DIMPD++TYN+WMRALA++ DISGVERVIDEMKRDGRVA DWTTYSNLASI
Sbjct  182   TFIQEMKANDIMPDTYTYNVWMRALASVNDISGVERVIDEMKRDGRVAGDWTTYSNLASI  241

Query  1233  YADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTA  1054
             YADAGL DKAEKALKELE KN  + L  YQFLITLYGR GNL+EVYR+WRSL+LAFPKTA
Sbjct  242   YADAGLFDKAEKALKELESKNATKELLPYQFLITLYGRTGNLIEVYRVWRSLKLAFPKTA  301

Query  1053  NISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrk  874
             N+SYLNMIQVLVNLND+PGAEKCF+EW SG   YDIR+ANALIGAY K+G L KA++L+ 
Sbjct  302   NLSYLNMIQVLVNLNDIPGAEKCFREWVSGCPVYDIRIANALIGAYLKEGSLDKAQKLKD  361

Query  873   rAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMR  694
             + +R G + NAKTWE++LDYYLK GE   AV C+  AIT GRGDG KWVP   +V  LM+
Sbjct  362   QVRRRGIQANAKTWELYLDYYLKKGEFKFAVKCVANAITAGRGDGGKWVPPTAVVKTLMQ  421

Query  693   HFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSE  514
             +FE  KDV GAE  +  LKKS+D +GAE+LESLI+TYAAAGK S VM RRVKMEN ELSE
Sbjct  422   YFEENKDVLGAESFVEVLKKSKDEVGAEVLESLIKTYAAAGKKSAVMHRRVKMENVELSE  481

Query  513   EAKKLLDVISAE  478
             E K+LL+ I  E
Sbjct  482   EGKELLNEILEE  493



>ref|XP_008368256.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Malus domestica]
Length=489

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/489 (70%), Positives = 411/489 (84%), Gaps = 2/489 (0%)
 Frame = -2

Query  1944  IQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRS  1765
             +Q+F  +TK++ KRS+K YLEEALY +L K+GG E S  + LNE LK  K  YKWEVG +
Sbjct  3     LQQFG-RTKSVTKRSSK-YLEEALYLRLFKDGGSEVSVRQQLNEVLKGRKRVYKWEVGDT  60

Query  1764  VKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSK  1585
             +K LR+RKLY PA+KLSE M++RGMNKT SDQ IH+DLVAK +GI AAE+YFI+LPE++K
Sbjct  61    LKKLRERKLYYPALKLSEAMDRRGMNKTVSDQAIHLDLVAKVRGIPAAESYFIDLPESAK  120

Query  1584  NHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAII  1405
              H  YGALLNCYCKELMTEKAEALIEKMK LNL LTSMPYNSLMTLYT+TG+P+KIPAI+
Sbjct  121   THLCYGALLNCYCKELMTEKAEALIEKMKALNLPLTSMPYNSLMTLYTKTGKPDKIPAIV  180

Query  1404  QEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYAD  1225
             QE+K C++M DS++YN+WMRALAA+ DISG ERVIDEMKRDGRVA DWTTYSNLASI+ +
Sbjct  181   QEMKACNVMLDSYSYNVWMRALAAVNDISGAERVIDEMKRDGRVASDWTTYSNLASIFVE  240

Query  1224  AGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANIS  1045
             AG+ +KAE ALKELEKKN  R+L+A+QFLITLYG+ GNL E+YR+WRSLRLAFPKTANIS
Sbjct  241   AGMFEKAENALKELEKKNLCRDLSAFQFLITLYGKTGNLREIYRVWRSLRLAFPKTANIS  300

Query  1044  YLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQ  865
             YLNMIQVLVNLND+PGAEK F+EWE   +TYDIRVAN LIGAYA+QG+L+KAKEL++ A+
Sbjct  301   YLNMIQVLVNLNDVPGAEKTFREWECQCSTYDIRVANVLIGAYAEQGMLEKAKELKELAR  360

Query  864   RSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFE  685
             R GAKPNAKTWEIFLDYYLK+GE   AVDC+  AI+ GRGDG+KW PS  IV  LM +FE
Sbjct  361   RRGAKPNAKTWEIFLDYYLKSGEYQLAVDCVANAISIGRGDGRKWSPSHKIVKTLMENFE  420

Query  684   TKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAK  505
              +KDV+GAE  L  LKKS + LG E+ ESLIRTYAAAG+TS  MR R+KME  E+SE ++
Sbjct  421   QEKDVDGAEGFLEILKKSVESLGLEVFESLIRTYAAAGRTSPAMRARLKMEKLEVSEASE  480

Query  504   KLLDVISAE  478
             KLL+ +  E
Sbjct  481   KLLEAVCVE  489



>ref|XP_011014138.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Populus euphratica]
 ref|XP_011014139.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Populus euphratica]
 ref|XP_011014140.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Populus euphratica]
Length=490

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/483 (71%), Positives = 404/483 (84%), Gaps = 1/483 (0%)
 Frame = -2

Query  1926  KTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQ  1747
             +TK++ KRS KKYLEEALY +L KEG  E S  + LN+FLKS +  +KWEVG ++K LR 
Sbjct  9     RTKSVTKRS-KKYLEEALYVRLFKEGSSEVSVRQQLNQFLKSSRRVFKWEVGDTIKKLRS  67

Query  1746  RKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYG  1567
             R LY PA+KLSETM  RGMNKT SDQ IH+DLVAK++GI AAE YFI+LPETSKN  TYG
Sbjct  68    RNLYYPAVKLSETMSSRGMNKTVSDQAIHLDLVAKTRGIPAAENYFIDLPETSKNLQTYG  127

Query  1566  ALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKEC  1387
             ALLNCYCKELMTE+AEALIEKMKELNL L SM YNSLMTLYT+ GQPE+IPAIIQE+K  
Sbjct  128   ALLNCYCKELMTEEAEALIEKMKELNLGLGSMSYNSLMTLYTKVGQPERIPAIIQEMKAD  187

Query  1386  DIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDk  1207
             ++MPDS+TYN+WMRALAA+ DISGVERVI+EMKRD RVA +WTTYSNLASIY DAG  DK
Sbjct  188   NVMPDSYTYNVWMRALAAVNDISGVERVIEEMKRDARVAVNWTTYSNLASIYVDAGYFDK  247

Query  1206  aekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQ  1027
             AEKALKELEK N  ++L A+QFLITLYGR G L+EVYRIWRSLRLAFPKTANISYLNMIQ
Sbjct  248   AEKALKELEKINANKDLFAFQFLITLYGRTGKLLEVYRIWRSLRLAFPKTANISYLNMIQ  307

Query  1026  VLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKP  847
             VLVNL D+PGAEKCF+EWESG +TYDIRVAN +I AY K+GL+ KA+EL++RA+R GAKP
Sbjct  308   VLVNLKDVPGAEKCFREWESGCSTYDIRVANVIISAYTKEGLVDKAEELKERARRRGAKP  367

Query  846   NAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVE  667
             N KTWEIF DYYLKNG++  AVDC+  A++ GRG+GQKWVPSPVI+G LM HFE +KDV+
Sbjct  368   NCKTWEIFCDYYLKNGDVKLAVDCLANAVSAGRGNGQKWVPSPVILGSLMAHFEQQKDVD  427

Query  666   GAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
             GAE ++  LKK+ D +      SLIRTYAAAG+ S +MRRR+KMEN E++++ +KLL+ I
Sbjct  428   GAEDLIEILKKAVDDVAGGGFVSLIRTYAAAGRKSQMMRRRLKMENVEVNDDCQKLLEAI  487

Query  486   SAE  478
               E
Sbjct  488   CVE  490



>ref|XP_008389701.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Malus domestica]
Length=489

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/489 (70%), Positives = 410/489 (84%), Gaps = 2/489 (0%)
 Frame = -2

Query  1944  IQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRS  1765
             +Q+F  +TK++ KRS+K YLEEALY +L K+GG E S  + LNE LKS K  YKWEVG +
Sbjct  3     LQQFG-RTKSVTKRSSK-YLEEALYLRLFKDGGSEVSVRQQLNEVLKSRKRVYKWEVGDT  60

Query  1764  VKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSK  1585
             +K LR+RKLY PA+KLSE M++RGMNKT SDQ +H+DLVAK++GI AAE YFI+LPE++K
Sbjct  61    LKKLRERKLYYPALKLSEAMDRRGMNKTVSDQAMHLDLVAKARGIPAAENYFIDLPESAK  120

Query  1584  NHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAII  1405
              H  YGALLNCYCKE MTEKAEALIEKMK LNL LTSMPYNSLMTLY++TG+P+KIPAII
Sbjct  121   THLCYGALLNCYCKEWMTEKAEALIEKMKALNLPLTSMPYNSLMTLYSKTGKPDKIPAII  180

Query  1404  QEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYAD  1225
             QE+K C++M DS++YN+WMRALA++ DISG ERVIDEMKRDGRVA DWTTYSNLASI+ +
Sbjct  181   QEMKACNVMLDSYSYNVWMRALASVNDISGAERVIDEMKRDGRVASDWTTYSNLASIFVE  240

Query  1224  AGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANIS  1045
             AG+ +KAE ALKELEKKN+ R+L A+QFLITLYG+ GNL EVYR+WRSLRLAFPKTAN+S
Sbjct  241   AGMFEKAENALKELEKKNSSRDLFAFQFLITLYGKTGNLREVYRVWRSLRLAFPKTANVS  300

Query  1044  YLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQ  865
             YLNMIQVLVNLND+PGAEK F++WE   +TYDIRVAN LIGAYA+QG+L+KAKEL++ A+
Sbjct  301   YLNMIQVLVNLNDVPGAEKTFRDWECQCSTYDIRVANVLIGAYAEQGMLEKAKELKEVAR  360

Query  864   RSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFE  685
             R GAKPNA +WEIFLDYYLK+GE   AVDC+  AI+ GRGDG+KW PS  IV  LM HFE
Sbjct  361   RRGAKPNATSWEIFLDYYLKSGEYQLAVDCVASAISIGRGDGKKWSPSNKIVKTLMEHFE  420

Query  684   TKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAK  505
              +KDV+GAE  L  LKKS + LG ++ ESLIRTYAAAG+TS  MR R+KME  E+SE +K
Sbjct  421   QEKDVDGAEGFLEILKKSVESLGVDVFESLIRTYAAAGRTSPAMRARLKMEKLEVSEASK  480

Query  504   KLLDVISAE  478
             KLL+ +  E
Sbjct  481   KLLEAVCVE  489



>ref|XP_002527905.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF34462.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=490

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/483 (71%), Positives = 401/483 (83%), Gaps = 1/483 (0%)
 Frame = -2

Query  1926  KTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQ  1747
             +TKN+ KRS KKYLEEALY +L KEG  E    + LN+FLKS K  YKWEVG ++K LR 
Sbjct  9     RTKNVAKRS-KKYLEEALYFRLFKEGSSEVKVREQLNQFLKSSKRVYKWEVGDTLKKLRS  67

Query  1746  RKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYG  1567
             R LY PA+KLSE M KRGMNKT SDQ IH+DLVAK++GI AAE +FI+LPETSKNH TYG
Sbjct  68    RGLYYPALKLSEAMSKRGMNKTVSDQAIHLDLVAKTRGIPAAEIFFIDLPETSKNHLTYG  127

Query  1566  ALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKEC  1387
             ALLNCYC +LMTE+AEAL+EKMKELNL L+SM YNSLMTLYT+ GQPE+IP IIQE+K  
Sbjct  128   ALLNCYCNQLMTEEAEALMEKMKELNLGLSSMSYNSLMTLYTKIGQPERIPGIIQEMKSD  187

Query  1386  DIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDk  1207
              IMPDS+TYN+WMRALAA+ DISG ERVI+EMKRDGRVA DWTTYSNLASIY DA L +K
Sbjct  188   SIMPDSYTYNVWMRALAAVNDISGAERVIEEMKRDGRVAADWTTYSNLASIYVDAQLFEK  247

Query  1206  aekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQ  1027
             AEK LKELEK+N  R+ +A+QFLITLYGRIGNL E+YRIWRSLRLAFPKT+NISYLNMIQ
Sbjct  248   AEKTLKELEKRNVHRDHSAFQFLITLYGRIGNLHELYRIWRSLRLAFPKTSNISYLNMIQ  307

Query  1026  VLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKP  847
             VLVNL D+PGAEKCF+EWES  + YDIRVAN LI AYAK+GLL+KA+EL++RA   GAKP
Sbjct  308   VLVNLKDLPGAEKCFREWESNCSGYDIRVANVLIKAYAKKGLLEKAEELKERAIGRGAKP  367

Query  846   NAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVE  667
             NAKTWEIF DYY +NG+I  +V+C+  AI+ GRGDGQKW+PSP +V   M HFE +KDV+
Sbjct  368   NAKTWEIFSDYYFENGDIKLSVECLANAISKGRGDGQKWIPSPEVVASFMAHFEQQKDVD  427

Query  666   GAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
             GAE  +  LKK+ D + A + ESLIRTYAAAG+TS V+RRR+KMEN E+SE  +KLL++I
Sbjct  428   GAEGFIEILKKATDDVEANVFESLIRTYAAAGRTSQVLRRRLKMENVEVSEAGQKLLEMI  487

Query  486   SAE  478
               E
Sbjct  488   CVE  490



>ref|XP_009359185.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g60770 [Pyrus x bretschneideri]
Length=498

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/498 (69%), Positives = 412/498 (83%), Gaps = 11/498 (2%)
 Frame = -2

Query  1944  IQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRS  1765
             +Q+F  +TK++ KRS+K YLEEALY +L K+GG E S  + LNE LKS K  YKWEVG +
Sbjct  3     LQQFG-RTKSVTKRSSK-YLEEALYLRLFKDGGSEVSVRQQLNEVLKSRKRVYKWEVGDT  60

Query  1764  VKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIA---------AAEAY  1612
             +K LR+RKLY PA+KLSE M++RGMNKT SDQ IH+DLVAK +GI          AAE+Y
Sbjct  61    LKKLRERKLYYPALKLSEAMDRRGMNKTVSDQAIHLDLVAKVRGIPXXXXXXXXPAAESY  120

Query  1611  FINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTG  1432
             FI+LPE++K H  YGALLNCYCKELMTEKAEALIEKMK LNL LTSMPYNSLMTLYT+TG
Sbjct  121   FIDLPESAKTHLCYGALLNCYCKELMTEKAEALIEKMKALNLPLTSMPYNSLMTLYTKTG  180

Query  1431  QPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTY  1252
             +P+KIPAI+QE+K C++M DS++YN+WMRALAA+ DISG ERVIDEMKRDGRVA DWTTY
Sbjct  181   KPDKIPAIVQEMKACNVMLDSYSYNVWMRALAAVNDISGAERVIDEMKRDGRVASDWTTY  240

Query  1251  SNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRL  1072
             SN+ASI+ +AG+ +KAE ALKELEKKN  R+L+A+QFLITLYG+ GNL E+YR+WRSLRL
Sbjct  241   SNIASIFVEAGMFEKAENALKELEKKNLHRDLSAFQFLITLYGKTGNLREIYRVWRSLRL  300

Query  1071  AFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkk  892
             AFPKTANISYLNMIQVLVNLND+PGAEK F+EWE   +TYDIRVAN LIGAYA+QG+L+K
Sbjct  301   AFPKTANISYLNMIQVLVNLNDVPGAEKTFREWECQCSTYDIRVANVLIGAYAEQGMLEK  360

Query  891   akelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVI  712
             AKEL++ A+R GAKPNAKTWEIFLDYYLK+GE   AVDC+  AI+ GRGDG+KW PS  I
Sbjct  361   AKELKELARRRGAKPNAKTWEIFLDYYLKSGEYQLAVDCVANAISIGRGDGRKWSPSHKI  420

Query  711   VGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKME  532
             V  LM  FE +KDV+GAE  L  LKKS + LG E+ ESLIRTYAAAG+TS  MR R++ME
Sbjct  421   VKTLMESFEQEKDVDGAEGFLEILKKSVESLGVEVFESLIRTYAAAGRTSPAMRARLRME  480

Query  531   NAELSEEAKKLLDVISAE  478
               E+SE ++KLL+ + AE
Sbjct  481   KLEVSEASEKLLEAVCAE  498



>ref|XP_007222350.1| hypothetical protein PRUPE_ppa004842mg [Prunus persica]
 gb|EMJ23549.1| hypothetical protein PRUPE_ppa004842mg [Prunus persica]
Length=489

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/489 (70%), Positives = 404/489 (83%), Gaps = 2/489 (0%)
 Frame = -2

Query  1944  IQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRS  1765
             +Q+F  +TK++ KRSTK Y+E+ALY +L K+GG E S  + LNE LKS K  YKWEVG +
Sbjct  3     LQQFG-RTKSVTKRSTK-YVEQALYLRLFKDGGSEVSVRQQLNEVLKSRKRVYKWEVGDT  60

Query  1764  VKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSK  1585
             +K LR+RKLY PA+KLSE M++RGMNKT SDQ IH+DL+AK++ I AAE YFI+LPE +K
Sbjct  61    LKKLRERKLYYPALKLSEAMDRRGMNKTVSDQAIHLDLIAKTRDIPAAENYFIDLPEAAK  120

Query  1584  NHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAII  1405
              H +YGALLNCYCKE+M EKAEAL+EKMK LNL+LTSMPYNSLMTLY++TG PEKIPAII
Sbjct  121   THHSYGALLNCYCKEMMAEKAEALMEKMKALNLSLTSMPYNSLMTLYSKTGHPEKIPAII  180

Query  1404  QEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYAD  1225
             QE+K   +M DS +YN+WMRALAA+ DISGVERVIDEMKRDGRV+ DWTTYSNLASIY +
Sbjct  181   QEMKAGSVMLDSCSYNVWMRALAAVNDISGVERVIDEMKRDGRVSSDWTTYSNLASIYVE  240

Query  1224  AGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANIS  1045
             AG+ +KAEK L ELEKKN  R+L  YQFLITLYG+ GNL EV+R+WRSLRLAFPKTANIS
Sbjct  241   AGMFEKAEKTLNELEKKNARRDLLVYQFLITLYGKTGNLREVHRVWRSLRLAFPKTANIS  300

Query  1044  YLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQ  865
             YLNMIQVLVNLND+PGAEKCF+EWES  +TYDIRVAN LIGAYAK+G+L+KAKEL+++A+
Sbjct  301   YLNMIQVLVNLNDLPGAEKCFREWESRCSTYDIRVANVLIGAYAKEGMLEKAKELKEQAR  360

Query  864   RSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFE  685
             R GAKPNAKTWEIFLDYYL+ GE   AVDC+  A + GRGDG KW PS  IV  LM HFE
Sbjct  361   RRGAKPNAKTWEIFLDYYLETGEYQLAVDCVANATSIGRGDGGKWSPSRKIVKTLMEHFE  420

Query  684   TKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAK  505
              +KDV+GAE  L  LKKS D LG E+ ESLIRTYAAAG+T+  MR R+KME  E+ E +K
Sbjct  421   QEKDVDGAEGFLEILKKSVDSLGVEVFESLIRTYAAAGRTTPSMRARLKMEKLEVGEASK  480

Query  504   KLLDVISAE  478
             KLL+ +  E
Sbjct  481   KLLEAVCVE  489



>gb|KEH20176.1| PPR containing plant protein [Medicago truncatula]
Length=490

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/491 (68%), Positives = 411/491 (84%), Gaps = 2/491 (0%)
 Frame = -2

Query  1950  SFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVG  1771
             S +QR+  K K++ KRS KKYL+EALY KL K+GG E +  + LN+F+KS K  YKWEVG
Sbjct  2     SVMQRYG-KCKSVVKRS-KKYLDEALYLKLFKDGGSELNVRQQLNQFIKSGKRVYKWEVG  59

Query  1770  RSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPET  1591
              ++K LRQRKLY PA+KLSETM KR M KT SDQ IH+DLVAK++GI AAE YF++LPE+
Sbjct  60    DTLKKLRQRKLYQPALKLSETMAKRNMIKTVSDQAIHIDLVAKARGIVAAEKYFVDLPES  119

Query  1590  SKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPA  1411
              KNH  YGALLNCYCKELMT+KAE ++EKMK+L+  L+S+ YNSLMTLYT+ GQPEKIP+
Sbjct  120   KKNHLCYGALLNCYCKELMTDKAEGVVEKMKDLDFPLSSLSYNSLMTLYTKVGQPEKIPS  179

Query  1410  IIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIY  1231
             IIQE+K  +IMPDS+TYN+WMRALAA+ DISGVERVIDEMKRDGRV  DWTTYSNLASIY
Sbjct  180   IIQEMKSSNIMPDSYTYNVWMRALAAVNDISGVERVIDEMKRDGRVTGDWTTYSNLASIY  239

Query  1230  ADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTAN  1051
              DA L +KAE ALKELEK+N  ++L+AYQFLITLYG+IG + EVYR+WRSLRLAFPKTAN
Sbjct  240   VDANLFEKAEGALKELEKRNGYKDLSAYQFLITLYGKIGKVYEVYRVWRSLRLAFPKTAN  299

Query  1050  ISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkr  871
             ISYLNMIQVLVNL D+PGAEKCF+EWES  TTYDIRVAN LIG YAK  +L+KA+EL++R
Sbjct  300   ISYLNMIQVLVNLKDLPGAEKCFREWESSCTTYDIRVANVLIGTYAKLDMLEKAEELKER  359

Query  870   AQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRH  691
             A+R GAKPNAKTWEIFLD++L+N +   AVDC+ +AI+ GRG+G+KWVPS   +G +M+H
Sbjct  360   ARRRGAKPNAKTWEIFLDHHLRNADFKLAVDCLSEAISIGRGNGEKWVPSSETIGIMMKH  419

Query  690   FETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEE  511
             +E +KDV+GAE  +  LKKS + +G E+ ESLIRTYAAAG+TS  M+RR+KMEN  ++E+
Sbjct  420   YEQEKDVDGAEEFIEILKKSMESVGEEVFESLIRTYAAAGRTSAAMKRRLKMENVNVNED  479

Query  510   AKKLLDVISAE  478
             A+KLL+ IS E
Sbjct  480   AQKLLEAISEE  490



>ref|XP_004509657.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
isoform X1 [Cicer arietinum]
Length=490

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/491 (69%), Positives = 410/491 (84%), Gaps = 2/491 (0%)
 Frame = -2

Query  1950  SFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVG  1771
             S +QR+  + K++ KRS KKYL+EALY KL K+GG + +  + LN F+KS K  YKWEVG
Sbjct  2     SLMQRYG-RCKSVVKRS-KKYLDEALYLKLFKDGGSQLNVRQQLNHFIKSGKRVYKWEVG  59

Query  1770  RSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPET  1591
              ++K LRQRKLY PA+KLSETM KR M KT SDQ IH+DL+AK+KGI AAE YF+NLPE+
Sbjct  60    DTLKKLRQRKLYQPALKLSETMAKRNMIKTVSDQAIHIDLIAKAKGIVAAENYFVNLPES  119

Query  1590  SKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPA  1411
             +KNH  YGALLNCYCKELMT+KAE ++EKMK+L L L+SMPYNSLMTLYT+ GQPEKIP+
Sbjct  120   AKNHLCYGALLNCYCKELMTDKAEGVVEKMKDLGLPLSSMPYNSLMTLYTKVGQPEKIPS  179

Query  1410  IIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIY  1231
             +IQE+K  +IM DS+TYN+WMRALAA+ DISGVERVIDEMKRDGRV  DWTTYSNLASIY
Sbjct  180   MIQEMKASNIMLDSYTYNVWMRALAAVNDISGVERVIDEMKRDGRVIGDWTTYSNLASIY  239

Query  1230  ADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTAN  1051
              DAGL +KAE ALKELEK+N  +NL+AYQF+ITLYGRI  + EVYR+WRSLRLAFPKTAN
Sbjct  240   VDAGLFEKAEGALKELEKRNAYKNLSAYQFVITLYGRINKIYEVYRVWRSLRLAFPKTAN  299

Query  1050  ISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkr  871
             ISYLNMIQVLVNL D+PGAEKCF+EWES   TYDIRVANALI AYAK  +L+KA+EL++R
Sbjct  300   ISYLNMIQVLVNLKDLPGAEKCFREWESTCNTYDIRVANALIEAYAKLDMLEKAEELKER  359

Query  870   AQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRH  691
             A+R GAKPNAKTWEIFLD +L+ G+   AVDC+ +AI+ GRG+G+KWVPS   +G +MRH
Sbjct  360   ARRRGAKPNAKTWEIFLDCHLRKGDFKLAVDCLTEAISIGRGNGEKWVPSSETIGIMMRH  419

Query  690   FETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEE  511
             +E +KDV+GAE  +  LKKS D +GAE+ ESLIRTYA AGKTS+ ++RR+KMEN  ++E+
Sbjct  420   YEQEKDVDGAEEFIEILKKSVDSVGAEVFESLIRTYATAGKTSSSLQRRLKMENVNVNED  479

Query  510   AKKLLDVISAE  478
              +KLL+ IS E
Sbjct  480   TQKLLEAISVE  490



>ref|XP_007153764.1| hypothetical protein PHAVU_003G063200g [Phaseolus vulgaris]
 gb|ESW25758.1| hypothetical protein PHAVU_003G063200g [Phaseolus vulgaris]
Length=489

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/491 (69%), Positives = 410/491 (84%), Gaps = 3/491 (1%)
 Frame = -2

Query  1950  SFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVG  1771
             S +QR + + K++ KRS KKYLEEALY KL K+G  + S  ++LN F+K+ K  YKWEVG
Sbjct  2     SMMQR-NGRNKSVVKRS-KKYLEEALYVKLFKDGSSQLSVRQSLNNFIKTGKRVYKWEVG  59

Query  1770  RSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPET  1591
              ++K LR RKLY PA+KLSETM KR M KT SD  IH+DL+AK++G  AAE YF+NLPE+
Sbjct  60    DTLKKLRDRKLYQPALKLSETMAKRNMIKTVSDNAIHLDLLAKARGTTAAENYFVNLPES  119

Query  1590  SKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPA  1411
             +KNH  YGALLNCYCKELMTEKAE L++KMKEL+L L+SMPYNSLMTLYT+ GQPEK+P+
Sbjct  120   AKNHLCYGALLNCYCKELMTEKAEGLMDKMKELSLPLSSMPYNSLMTLYTKVGQPEKVPS  179

Query  1410  IIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIY  1231
             II+E+K  +I  DSFTYN+WMRALAA+ DISGVERV DEMKRDG V  DWTTYSNLASI+
Sbjct  180   IIREMKASNITLDSFTYNVWMRALAAVNDISGVERVHDEMKRDG-VTGDWTTYSNLASIF  238

Query  1230  ADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTAN  1051
              DAG  DKAE ALKELEK+N  ++L+AYQFLITLYGR GNL EVYR+WRSLRLAFPKTAN
Sbjct  239   VDAGFLDKAEVALKELEKRNAFKDLSAYQFLITLYGRTGNLYEVYRVWRSLRLAFPKTAN  298

Query  1050  ISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkr  871
             ISYLNMIQVLVNL D+PGAEKCF+EWESG   YDIRVAN LIGAYAK  +L+KA+EL++R
Sbjct  299   ISYLNMIQVLVNLKDLPGAEKCFREWESGSPKYDIRVANVLIGAYAKLDMLEKAEELKER  358

Query  870   AQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRH  691
             A+RSGAKPNAK+WEIFLDY+L+ G+   AVDC++KAI+ GRG+G+KW+PS  I+  +MRH
Sbjct  359   ARRSGAKPNAKSWEIFLDYHLQKGDFKLAVDCLDKAISIGRGNGEKWIPSSKIMVIMMRH  418

Query  690   FETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEE  511
             FE +KDV+GAE  L  +KKS D LGAE+ ESLIRTYAAAG+TS+ M+RR+KMEN E+SE+
Sbjct  419   FEQEKDVDGAEEFLEIVKKSMDSLGAEVFESLIRTYAAAGRTSSAMQRRLKMENVEVSED  478

Query  510   AKKLLDVISAE  478
              +KLL+ IS E
Sbjct  479   TQKLLEAISVE  489



>ref|XP_010245038.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Nelumbo nucifera]
Length=489

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/483 (69%), Positives = 399/483 (83%), Gaps = 1/483 (0%)
 Frame = -2

Query  1926  KTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQ  1747
             +TKN+ KRS KKYLE AL   L KEG  + S    LN+FLKS K  YKWEVG +++ LRQ
Sbjct  8     RTKNVAKRS-KKYLENALNETLFKEGSSDKSVRTELNKFLKSSKRVYKWEVGVTLRKLRQ  66

Query  1746  RKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYG  1567
             R  + PA+KLSE+M KRGMN T SDQ IH+DL+AKS+GIAAAE YF++LPE SK H  YG
Sbjct  67    RGRFCPALKLSESMVKRGMNMTASDQAIHLDLIAKSRGIAAAENYFMDLPEASKTHLCYG  126

Query  1566  ALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKEC  1387
             ALLNCYCKELMTEKAEAL+EKMKEL    +SM YNSLMTLY++ GQ +KIPAIIQE+K  
Sbjct  127   ALLNCYCKELMTEKAEALMEKMKELRFASSSMAYNSLMTLYSKNGQFDKIPAIIQEMKAS  186

Query  1386  DIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDk  1207
             DI PD+ TYNIWMRALAA+ DISGVERV++EMKRDGR   DWTTYSNLASIY +AGL DK
Sbjct  187   DIKPDTCTYNIWMRALAAVNDISGVERVMEEMKRDGRATGDWTTYSNLASIYVEAGLYDK  246

Query  1206  aekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQ  1027
             AEKALKELEK+N  ++L+A+QFLITLYGR GN++E+YR+WRSLRLAFPKTANISYLNMIQ
Sbjct  247   AEKALKELEKRNACKDLSAFQFLITLYGRTGNVIELYRVWRSLRLAFPKTANISYLNMIQ  306

Query  1026  VLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKP  847
              LV L D+PGAEKCFKEWESG +TYDIR+AN LIGAYAK+G+L+KA+E+++R+QR G+KP
Sbjct  307   ALVKLKDLPGAEKCFKEWESGCSTYDIRIANVLIGAYAKEGMLEKAEEVKQRSQRRGSKP  366

Query  846   NAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVE  667
             NAKTWEIF+DYYLKNGE+  AVDC+  AI+TGRGDG KW PSP +V  LM HFE ++DVE
Sbjct  367   NAKTWEIFMDYYLKNGEMKLAVDCVANAISTGRGDGGKWSPSPEVVQSLMTHFEQERDVE  426

Query  666   GAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
             GAE  +  LKK++ ++GAE+ ESLIR YAA+GKTS  MR R+KME  EL E A+KLL+VI
Sbjct  427   GAEGFMETLKKADVNIGAEVFESLIRMYAASGKTSASMRHRLKMEKVELGEAAEKLLNVI  486

Query  486   SAE  478
               +
Sbjct  487   CVD  489



>ref|XP_010473256.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Camelina sativa]
Length=491

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/487 (67%), Positives = 398/487 (82%), Gaps = 0/487 (0%)
 Frame = -2

Query  1938  RFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVK  1759
             R  S+++++ KRSTKKY+EE LY +L K+GG E    + LN+FLK  K  +KWEVG ++K
Sbjct  4     RHLSRSRDVTKRSTKKYIEEPLYHRLFKDGGTEVKVRQQLNQFLKGTKHVFKWEVGDTIK  63

Query  1758  LLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH  1579
              LR R LY PA+KLSE ME+RGMNKT SDQ IH+DLVAKS+GI A E YF++LPETSK  
Sbjct  64    KLRNRGLYYPALKLSEVMEERGMNKTVSDQAIHLDLVAKSRGITAGENYFVDLPETSKTE  123

Query  1578  FTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQE  1399
              TYG+LLNCYCKELMTEKAE L+ KMKELN+T +SM YNSLMTLYT+TGQPEK+PA+IQE
Sbjct  124   LTYGSLLNCYCKELMTEKAEGLLNKMKELNITPSSMSYNSLMTLYTKTGQPEKVPAMIQE  183

Query  1398  IKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAG  1219
             +K  ++MPDS+TYN+WMRALAA  DISGVERVI+EM RDGRVA DWTTYSN+ASIY DAG
Sbjct  184   LKAENVMPDSYTYNVWMRALAATNDISGVERVIEEMNRDGRVAPDWTTYSNMASIYVDAG  243

Query  1218  LSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYL  1039
             LS KAEKAL+ELE KNT R+ TAYQFLITLYGR+G L EVYRIWRSLRLA PKT+N++YL
Sbjct  244   LSQKAEKALQELEMKNTQRDFTAYQFLITLYGRLGKLTEVYRIWRSLRLAIPKTSNVAYL  303

Query  1038  NMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRS  859
             NMIQVLVNL D+PGAE  FKEW++  +TYDIR+ N LIGAYAK GL++KA+EL+++A R 
Sbjct  304   NMIQVLVNLKDLPGAETLFKEWQANCSTYDIRIVNVLIGAYAKDGLIEKARELKEKAPRR  363

Query  858   GAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETK  679
             G+K NAKTWEIF+DYY+K G+ + A++C+ KA++ GRGDG KWVPS   +  LM  FE K
Sbjct  364   GSKANAKTWEIFMDYYVKRGDTAQALECMSKAVSIGRGDGGKWVPSQETIRTLMSLFEQK  423

Query  678   KDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKL  499
             KDV GAE ++  LKK  D++GAE+ E LIRTYAAAGK+   MRRR+KMEN E++E  KKL
Sbjct  424   KDVNGAENLVEILKKVTDNIGAEIFEPLIRTYAAAGKSHPAMRRRLKMENVEVNEATKKL  483

Query  498   LDVISAE  478
             LD +S E
Sbjct  484   LDEVSQE  490



>ref|XP_008446176.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Cucumis melo]
Length=491

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/493 (67%), Positives = 405/493 (82%), Gaps = 2/493 (0%)
 Frame = -2

Query  1956  MASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWE  1777
             MA  +++F   +K++ KRST+KYLEEALY +L K+GG E S    LN+F+KS K  +KWE
Sbjct  1     MALPLRKFKP-SKDLAKRSTEKYLEEALYIRLFKDGGSEKSVRLQLNKFIKSRKRVFKWE  59

Query  1776  VGRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLP  1597
             VG ++K LR RKLY PA+KLSETM KRGMNKT SDQ IH+DLVAK++GIAAAE YF++LP
Sbjct  60    VGDTLKKLRDRKLYYPALKLSETMAKRGMNKTVSDQAIHLDLVAKARGIAAAENYFVSLP  119

Query  1596  ETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKI  1417
             E+SKNH +Y +LLNCYCKEL+TEKAE+L EKMKELNL LTSMP N LMTLYT+ GQP+K+
Sbjct  120   ESSKNHLSYSSLLNCYCKELLTEKAESLFEKMKELNLPLTSMPCNCLMTLYTKIGQPDKV  179

Query  1416  PAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLAS  1237
             P+IIQE+K  ++  DS+TY +WMRALAAL DISGVERVIDEMKRDG V  DWTTYSNLAS
Sbjct  180   PSIIQEMKAANVTFDSYTYVVWMRALAALNDISGVERVIDEMKRDG-VKGDWTTYSNLAS  238

Query  1236  IYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKT  1057
             IY +A + +KA KAL +LEK NT R+L A+QFLITLYG+IG+L++VY +WRSLRLAFP+T
Sbjct  239   IYVNANMFEKAAKALMDLEKINTSRDLFAFQFLITLYGQIGDLIKVYSVWRSLRLAFPRT  298

Query  1056  ANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelr  877
             ANISYLNMIQ L+ L D+PGAEKCFKEWESG +TYDIR+ANALIGAY K+GLL+KA  L+
Sbjct  299   ANISYLNMIQTLLKLKDLPGAEKCFKEWESGCSTYDIRIANALIGAYTKEGLLEKAMALK  358

Query  876   krAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELM  697
             +RA + GA+PNAKTWEIFLDYYLKNG    A DC+ KA++ G+GDG KW+PSP I+   M
Sbjct  359   ERALKRGARPNAKTWEIFLDYYLKNGNFKLAGDCVAKAVSRGKGDGGKWMPSPEIIKSFM  418

Query  696   RHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELS  517
              HFE +KDV+GAE  L  +KK+ D L +E+ ESLIRTY+AAG+TS+ M RR+KMEN E+S
Sbjct  419   SHFEQEKDVDGAESFLEIVKKTVDSLESEVFESLIRTYSAAGRTSSSMNRRLKMENVEVS  478

Query  516   EEAKKLLDVISAE  478
             E  KKLL+ IS E
Sbjct  479   EACKKLLNEISIE  491



>ref|XP_008221878.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g60770 [Prunus mume]
Length=482

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/489 (70%), Positives = 400/489 (82%), Gaps = 9/489 (2%)
 Frame = -2

Query  1944  IQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRS  1765
             +Q+F  +TK++ KRSTK Y+E+ALY +L K+GG E S  + LNE LKS K  YKWEVG +
Sbjct  3     LQQFG-RTKSVTKRSTK-YVEQALYLRLFKDGGSEVSVRQQLNEVLKSRKRVYKWEVGDT  60

Query  1764  VKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSK  1585
             +K LR+RKLY PA+KLSE M++RGMNKT SDQ IH+DL+        AE YFI+LPE +K
Sbjct  61    LKKLRERKLYYPALKLSEAMDRRGMNKTVSDQAIHLDLIX-------AENYFIDLPEAAK  113

Query  1584  NHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAII  1405
              H +YGALLNCYCKELMTEKAEAL+EKMK LNL+LTSMPYNSLMTLY++TG PEKIPAII
Sbjct  114   THHSYGALLNCYCKELMTEKAEALMEKMKALNLSLTSMPYNSLMTLYSKTGHPEKIPAII  173

Query  1404  QEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYAD  1225
             QE+K   +M DS +YN+WMRALAA+ DISGVERVIDEMKRDGRV+ DWTTYSNLASIY +
Sbjct  174   QEMKAGGVMLDSCSYNVWMRALAAVNDISGVERVIDEMKRDGRVSSDWTTYSNLASIYVE  233

Query  1224  AGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANIS  1045
             AG+ +KAEK L ELEKKN  R+L AYQFLITLYG+ GNL EVYR+WRSLRLAFPKTANIS
Sbjct  234   AGMFEKAEKTLNELEKKNARRDLLAYQFLITLYGKTGNLREVYRVWRSLRLAFPKTANIS  293

Query  1044  YLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQ  865
             YLNMIQVLVNLND+PGAEKCF+EWES  +TYDIRVAN LIGAYAK+G+L+KAKEL+++A+
Sbjct  294   YLNMIQVLVNLNDLPGAEKCFREWESRCSTYDIRVANVLIGAYAKEGMLEKAKELKEQAR  353

Query  864   RSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFE  685
             R GAKPNAKTWEIFLDYYL+ GE   AVDC+  A + GRGDG KW PS  IV  LM HFE
Sbjct  354   RRGAKPNAKTWEIFLDYYLETGEYQLAVDCVANATSIGRGDGGKWSPSRKIVKTLMEHFE  413

Query  684   TKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAK  505
              +KDV+GAE  L  LKKS D LG E+ ESLIRTYAAAG+T+  MR R+KME  E+ E +K
Sbjct  414   QEKDVDGAEGFLEILKKSVDSLGVEVFESLIRTYAAAGRTTPSMRARLKMEKLEVGEASK  473

Query  504   KLLDVISAE  478
             KLL+ +  E
Sbjct  474   KLLEAVCVE  482



>ref|XP_002886593.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH62852.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=491

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/487 (67%), Positives = 400/487 (82%), Gaps = 0/487 (0%)
 Frame = -2

Query  1938  RFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVK  1759
             R  S+++++ KRSTKKY+EE LY +L K+GG E    + LN+FLK  K  +KWEVG ++K
Sbjct  4     RHLSRSRDVTKRSTKKYIEEPLYHRLFKDGGTEVKVRQQLNQFLKGTKHVFKWEVGDTIK  63

Query  1758  LLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH  1579
              LR R LY PA+KLSE ME+RGMNKT SDQ IH+DLVAK++GI A E YF++LPETSK  
Sbjct  64    KLRNRGLYYPALKLSEVMEERGMNKTVSDQAIHLDLVAKARGITAGENYFVDLPETSKTE  123

Query  1578  FTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQE  1399
              TYG+LLNCYCKEL+TEKAE L+ KMKELN+T +SM YNSLMTLYT+TGQ EK+PA+IQE
Sbjct  124   LTYGSLLNCYCKELLTEKAEGLLNKMKELNITPSSMSYNSLMTLYTKTGQTEKVPAMIQE  183

Query  1398  IKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAG  1219
             +K  ++MPDS+TYN+WMRALAA  DISGVERVI+EM RDGRVA DWTTYSN+ASIY DAG
Sbjct  184   LKAENVMPDSYTYNVWMRALAATNDISGVERVIEEMNRDGRVAPDWTTYSNMASIYVDAG  243

Query  1218  LSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYL  1039
             LS KAEKAL+ELE KNT R+ TAYQFLITLYGR+G L EVYRIWRSLRLA PKT+N++YL
Sbjct  244   LSQKAEKALQELEMKNTQRDFTAYQFLITLYGRLGKLTEVYRIWRSLRLAMPKTSNVAYL  303

Query  1038  NMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRS  859
             NMIQVLV LND+PGAE  FKEW++  +TYDIR+ N LIGAYAK+GL++KAKEL+++A R 
Sbjct  304   NMIQVLVKLNDLPGAETLFKEWQANCSTYDIRIVNVLIGAYAKEGLIEKAKELKEKAPRR  363

Query  858   GAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETK  679
             G K NAKTWEIF+DYY+K+G+++ A++C+ KA++ G+GDG KW+PS   V  LM +FE K
Sbjct  364   GGKANAKTWEIFMDYYVKSGDMAHALECMSKAVSIGKGDGGKWIPSQETVRTLMSYFEQK  423

Query  678   KDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKL  499
             KDV GAE +L  LK   D++GAE+ ESLIRTYAAAGK+   MRRR+KMEN E++E  KKL
Sbjct  424   KDVNGAENLLEILKNGTDNIGAEIFESLIRTYAAAGKSHPAMRRRLKMENVEVNEVTKKL  483

Query  498   LDVISAE  478
             LD +S E
Sbjct  484   LDEVSQE  490



>ref|XP_006302183.1| hypothetical protein CARUB_v10020193mg [Capsella rubella]
 gb|EOA35081.1| hypothetical protein CARUB_v10020193mg [Capsella rubella]
Length=491

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/487 (66%), Positives = 395/487 (81%), Gaps = 0/487 (0%)
 Frame = -2

Query  1938  RFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVK  1759
             R   +++++ KRSTKKY+EE LY +L K+GG E    + LN+FLK  K  +KWEVG ++K
Sbjct  4     RHLGRSRDVTKRSTKKYIEEPLYHRLFKDGGTEVKVRQQLNQFLKGTKHVFKWEVGDTIK  63

Query  1758  LLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH  1579
              LR R LY PA+KLSE ME+RGMNKT SDQ IH+DLVAK++GI A E YF++LPETSK  
Sbjct  64    KLRNRGLYYPALKLSEVMEERGMNKTVSDQAIHLDLVAKARGITAGENYFVDLPETSKTE  123

Query  1578  FTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQE  1399
              TYG+LLNCYCKELM EKAE L+ KMKELN+T +SM YNSLMTLYT+TGQPEK+PA+IQE
Sbjct  124   LTYGSLLNCYCKELMAEKAEGLLNKMKELNITPSSMSYNSLMTLYTKTGQPEKVPAMIQE  183

Query  1398  IKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAG  1219
             +K  ++MPDS+TYN+WMRALAA  DISGVERVIDEM RDGRVA DWTTYSN+ASIY DAG
Sbjct  184   LKAENVMPDSYTYNVWMRALAATNDISGVERVIDEMNRDGRVAPDWTTYSNMASIYVDAG  243

Query  1218  LSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYL  1039
             L+ KAEKAL+ELE KNT R+ TAYQFLITLYGR+G L EVYRIWRSLRLA PKT+N++YL
Sbjct  244   LTQKAEKALQELEMKNTQRDFTAYQFLITLYGRLGKLTEVYRIWRSLRLAIPKTSNVAYL  303

Query  1038  NMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRS  859
             NMIQVLVNL D+PGAE  FKEW++  +TYDIR+ N LIGAYAK+GL++KA+EL+++A R 
Sbjct  304   NMIQVLVNLKDLPGAETLFKEWQANCSTYDIRIVNVLIGAYAKEGLIEKARELKEKAPRR  363

Query  858   GAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETK  679
             G K NAKTWEIF+DYY+K  ++  A++C+ KA++ GRGDG KW+PS   +  LM HFE K
Sbjct  364   GGKANAKTWEIFMDYYVKKADMDQALECMSKAVSIGRGDGGKWLPSQETIRTLMSHFEQK  423

Query  678   KDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKL  499
             KDV GAE ++  LKK  D +GAE+ E LIRTYAAAG++   MRRR+KMEN E++E  KKL
Sbjct  424   KDVNGAENLVEILKKVTDKIGAEIFEPLIRTYAAAGRSHPAMRRRLKMENVEVNEATKKL  483

Query  498   LDVISAE  478
             LD +S E
Sbjct  484   LDEVSQE  490



>ref|XP_010510912.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Camelina sativa]
Length=492

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/488 (67%), Positives = 396/488 (81%), Gaps = 1/488 (0%)
 Frame = -2

Query  1938  RFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVK  1759
             R  S+++++ KRSTKKY+EE LY  L K+GG E    + LN+FLK  K  +KWEVG ++K
Sbjct  4     RHLSRSRDVTKRSTKKYIEEPLYHLLFKDGGTEVKVRQQLNQFLKGTKHVFKWEVGDTIK  63

Query  1758  LLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH  1579
              LR R LY PA+KLSE ME+RGMNKT SDQ IH+DLVAKS+GI A E YF++LPETSK  
Sbjct  64    KLRNRGLYYPALKLSEVMEERGMNKTVSDQAIHLDLVAKSRGITAGENYFVDLPETSKTE  123

Query  1578  FTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQE  1399
              TYG+LLNCYCKELMTEKAE L+ KMKELN+T +SM YNSLMTLYT+TGQPEK+PA+IQE
Sbjct  124   LTYGSLLNCYCKELMTEKAEGLLNKMKELNITPSSMSYNSLMTLYTKTGQPEKVPAMIQE  183

Query  1398  IKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAG  1219
             +K  ++MPDSFTYN+WMRALAA  DISGVERVI+EM RDGRVA DWTTYSN+ASIY DAG
Sbjct  184   LKAENVMPDSFTYNVWMRALAATNDISGVERVIEEMNRDGRVAPDWTTYSNMASIYVDAG  243

Query  1218  LSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYL  1039
             LS KAEKAL+ELE KNT R+ TAYQFLITLYGR+G L EVYR+WRSLRLA PKT+N++YL
Sbjct  244   LSQKAEKALQELEMKNTQRDFTAYQFLITLYGRLGKLTEVYRVWRSLRLAIPKTSNVAYL  303

Query  1038  NMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQ-GllkkakelrkrAQR  862
             NMIQVLVNL D+PGA   FKEW++  +TYDIR+ N LIGAYAK+ GL++KA+EL+++A R
Sbjct  304   NMIQVLVNLKDLPGAATLFKEWQANCSTYDIRIVNVLIGAYAKEDGLIEKARELKEKAPR  363

Query  861   SGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFET  682
              G K NAKTWEIF+DYY+K G+++ A++C+ KA++ GRGDG KWVPS   +  LM  FE 
Sbjct  364   RGGKANAKTWEIFMDYYVKRGDMAQALECMSKAVSIGRGDGGKWVPSQETIRTLMSQFEQ  423

Query  681   KKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKK  502
             KKDV GAE ++  LKK  D +GAE+ E LIRTYAAAGK+   MRRR+KMEN E++E  KK
Sbjct  424   KKDVNGAENLVEILKKVTDTIGAEIFEPLIRTYAAAGKSHPAMRRRLKMENVEVNEATKK  483

Query  501   LLDVISAE  478
             LLD +S E
Sbjct  484   LLDEVSQE  491



>ref|XP_006392119.1| hypothetical protein EUTSA_v10023426mg [Eutrema salsugineum]
 gb|ESQ29405.1| hypothetical protein EUTSA_v10023426mg [Eutrema salsugineum]
Length=491

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/487 (66%), Positives = 396/487 (81%), Gaps = 0/487 (0%)
 Frame = -2

Query  1938  RFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVK  1759
             R  S+ ++I KRSTKKYLEE LY +L K+GG E S  + LN+FLK  K  +KWEVG ++K
Sbjct  4     RHLSRPRDIIKRSTKKYLEEPLYHRLFKDGGSEVSVRQQLNQFLKGTKHVFKWEVGDTIK  63

Query  1758  LLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH  1579
              LR R LY PA+KLSE ME+RGMNKT SDQ IH+DLVAK++GIAA E+YF++LPETSK  
Sbjct  64    KLRSRGLYYPALKLSEVMEERGMNKTVSDQAIHLDLVAKARGIAAGESYFVDLPETSKTE  123

Query  1578  FTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQE  1399
              TY +LLNCYCKELMTEKAE L+ KMKELN+T++SM YNSLMTLYT+TGQPEK+PA+IQE
Sbjct  124   LTYASLLNCYCKELMTEKAEGLLNKMKELNITVSSMSYNSLMTLYTKTGQPEKVPAMIQE  183

Query  1398  IKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAG  1219
             +K  ++MPDS+TYN+WMRALAA  D+SGVERVI+EM RDGRVA DWTTYSN+ASIY DA 
Sbjct  184   MKAENVMPDSYTYNVWMRALAATKDVSGVERVIEEMNRDGRVAPDWTTYSNMASIYVDAR  243

Query  1218  LSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYL  1039
             LS+KAEKAL+ELE KNT R+  AYQFLITLYGR+G L EVYRIWRSLRLA PKT N++YL
Sbjct  244   LSEKAEKALQELEMKNTQRDFKAYQFLITLYGRLGKLTEVYRIWRSLRLAIPKTTNVAYL  303

Query  1038  NMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRS  859
             NMIQVLVNL D+PGAE  FKEW++  +TYDIRV N LIGAY K+GL++KAKEL+++A R 
Sbjct  304   NMIQVLVNLKDLPGAETLFKEWQANCSTYDIRVVNVLIGAYTKEGLIEKAKELKEKAPRR  363

Query  858   GAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETK  679
             G KPNAKTWEIF+DYY+K+G+ + A+ CI +A++ G+GDG KW+PS   +  LM  FE K
Sbjct  364   GGKPNAKTWEIFMDYYVKSGDTAQALKCISEAVSIGKGDGGKWLPSQETIRTLMSQFEEK  423

Query  678   KDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKL  499
             KDV GAE ++  LKK +D +G E+ E+LIR YAAAGK+   MRRR+KMEN E++E  +KL
Sbjct  424   KDVNGAENLVEILKKGKDDVGTEIFETLIRIYAAAGKSPPAMRRRLKMENVEVNEATQKL  483

Query  498   LDVISAE  478
             LD I  E
Sbjct  484   LDEICQE  490



>gb|KFK40762.1| hypothetical protein AALP_AA2G037700 [Arabis alpina]
Length=494

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/493 (66%), Positives = 397/493 (81%), Gaps = 0/493 (0%)
 Frame = -2

Query  1956  MASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWE  1777
             M     R  S+ ++I KRSTKKY++E LY +L K+GG E S  + LN+FLK  K  +KWE
Sbjct  1     MDKMALRHLSRPRDIVKRSTKKYIDEPLYHRLFKDGGTEVSVRQQLNQFLKGTKHVFKWE  60

Query  1776  VGRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLP  1597
             VG ++K LR R LY PA+KLSE ME+RGMNKT SDQ IH+DLVAK++GI A E+YF+ LP
Sbjct  61    VGDTIKKLRTRGLYYPALKLSEVMEERGMNKTVSDQAIHLDLVAKARGITAGESYFVGLP  120

Query  1596  ETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKI  1417
             ETSK   TYG+LLNCYCKEL+TEKAE L+ KMKELN+TL+SM YNSLMTLYT+TGQ EK+
Sbjct  121   ETSKTELTYGSLLNCYCKELVTEKAEGLLSKMKELNITLSSMSYNSLMTLYTKTGQHEKV  180

Query  1416  PAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLAS  1237
             PA+IQE+K  ++MPDS+TYN+WMRALAA  D+SGVERVIDEM RDGRVA DWTTYSN+AS
Sbjct  181   PAMIQEMKAENVMPDSYTYNVWMRALAANNDVSGVERVIDEMNRDGRVAPDWTTYSNMAS  240

Query  1236  IYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKT  1057
             IY DA LS+KAEKAL+ELE KNT R+  AYQFLITLYGR+G L EVYRIWRSLRLA PKT
Sbjct  241   IYVDAQLSEKAEKALQELEIKNTQRDFKAYQFLITLYGRLGKLTEVYRIWRSLRLAIPKT  300

Query  1056  ANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelr  877
              N++YLNMIQVLV LND+PGAE  FKEW++  +TYDIR+ N +IGAYAK+GL++KAKELR
Sbjct  301   TNVAYLNMIQVLVKLNDVPGAEALFKEWQANCSTYDIRIVNVMIGAYAKEGLIEKAKELR  360

Query  876   krAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELM  697
             ++A R G KPNAKTWEIF+DYY+K+G  + A++CI KA+T G+GDG KW+PS   +  LM
Sbjct  361   EKAPRRGGKPNAKTWEIFMDYYVKSGNSTQALECISKAVTIGKGDGGKWLPSQETIRTLM  420

Query  696   RHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELS  517
               FE KKDV GAE ++  LKK  D +GA++ E LIRTYAAAGK+   MRRR+KMEN E++
Sbjct  421   SQFEKKKDVNGAENLVEILKKGTDDIGADVFEPLIRTYAAAGKSHPAMRRRLKMENVEVN  480

Query  516   EEAKKLLDVISAE  478
             E  KKLLD +S +
Sbjct  481   EATKKLLDEVSQD  493



>ref|NP_176276.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|O22714.1|PPR86_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g60770 
[Arabidopsis thaliana]
 gb|AAB71963.1| Hypothetical protein [Arabidopsis thaliana]
 gb|AAO22693.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42395.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33730.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=491

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/487 (66%), Positives = 398/487 (82%), Gaps = 0/487 (0%)
 Frame = -2

Query  1938  RFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVK  1759
             R  S+++++ KRSTKKY+EE LY +L K+GG E    + LN+FLK  K  +KWEVG ++K
Sbjct  4     RHLSRSRDVTKRSTKKYIEEPLYNRLFKDGGTEVKVRQQLNQFLKGTKHVFKWEVGDTIK  63

Query  1758  LLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH  1579
              LR R LY PA+KLSE ME+RGMNKT SDQ IH+DLVAK++ I A E YF++LPETSK  
Sbjct  64    KLRNRGLYYPALKLSEVMEERGMNKTVSDQAIHLDLVAKAREITAGENYFVDLPETSKTE  123

Query  1578  FTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQE  1399
              TYG+LLNCYCKEL+TEKAE L+ KMKELN+T +SM YNSLMTLYT+TG+ EK+PA+IQE
Sbjct  124   LTYGSLLNCYCKELLTEKAEGLLNKMKELNITPSSMSYNSLMTLYTKTGETEKVPAMIQE  183

Query  1398  IKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAG  1219
             +K  ++MPDS+TYN+WMRALAA  DISGVERVI+EM RDGRVA DWTTYSN+ASIY DAG
Sbjct  184   LKAENVMPDSYTYNVWMRALAATNDISGVERVIEEMNRDGRVAPDWTTYSNMASIYVDAG  243

Query  1218  LSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYL  1039
             LS KAEKAL+ELE KNT R+ TAYQFLITLYGR+G L EVYRIWRSLRLA PKT+N++YL
Sbjct  244   LSQKAEKALQELEMKNTQRDFTAYQFLITLYGRLGKLTEVYRIWRSLRLAIPKTSNVAYL  303

Query  1038  NMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRS  859
             NMIQVLV LND+PGAE  FKEW++  +TYDIR+ N LIGAYA++GL++KA EL+++A R 
Sbjct  304   NMIQVLVKLNDLPGAETLFKEWQANCSTYDIRIVNVLIGAYAQEGLIQKANELKEKAPRR  363

Query  858   GAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETK  679
             G K NAKTWEIF+DYY+K+G+++ A++C+ KA++ G+GDG KW+PSP  V  LM +FE K
Sbjct  364   GGKLNAKTWEIFMDYYVKSGDMARALECMSKAVSIGKGDGGKWLPSPETVRALMSYFEQK  423

Query  678   KDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKL  499
             KDV GAE +L  LK   D++GAE+ E LIRTYAAAGK+   MRRR+KMEN E++E  KKL
Sbjct  424   KDVNGAENLLEILKNGTDNIGAEIFEPLIRTYAAAGKSHPAMRRRLKMENVEVNEATKKL  483

Query  498   LDVISAE  478
             LD +S +
Sbjct  484   LDEVSQD  490



>ref|XP_010682416.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Beta vulgaris subsp. vulgaris]
Length=490

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/483 (69%), Positives = 397/483 (82%), Gaps = 1/483 (0%)
 Frame = -2

Query  1926  KTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQ  1747
             KTKNI  RS KKY+EEALYRKL KEGG E +    LN F+KSHK AYKWEVG ++K LR 
Sbjct  9     KTKNIANRS-KKYVEEALYRKLFKEGGDEVTVRHQLNLFIKSHKRAYKWEVGDTIKKLRD  67

Query  1746  RKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYG  1567
             RK Y  A+KLS+TM  RGMN T SDQ IH+DL+AK+ GI AAE YFI+LPE+SK    YG
Sbjct  68    RKHYYAALKLSDTMASRGMNMTLSDQAIHLDLIAKTHGIPAAENYFIDLPESSKYIECYG  127

Query  1566  ALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKEC  1387
             +LLNCYCKEL+++KAEAL+EKMKEL L +T+M YNSLMT+YT++GQPE++PA+ QE+K  
Sbjct  128   SLLNCYCKELISDKAEALMEKMKELGLPITAMSYNSLMTMYTKSGQPERVPALAQEMKAS  187

Query  1386  DIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDk  1207
             +IM   +TYN+WMRALAA  DI GVERV+DEMKRDGRVAEDWTTYSNLASIY DAG+SDK
Sbjct  188   NIMLQPYTYNVWMRALAASNDIYGVERVLDEMKRDGRVAEDWTTYSNLASIYVDAGMSDK  247

Query  1206  aekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQ  1027
             AE ALKELEK+N  + L+ +QFLITLYG+ GNL+EVYR+WRSLRL FP+T NI+YLNMIQ
Sbjct  248   AENALKELEKRNRSKELSPFQFLITLYGKTGNLLEVYRVWRSLRLTFPRTPNIAYLNMIQ  307

Query  1026  VLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKP  847
             VLVNL D+PGAEKCF EWES  TTYDIR+AN+LIG Y K+G L+KA+EL++RA   GAKP
Sbjct  308   VLVNLKDIPGAEKCFSEWESSCTTYDIRIANSLIGYYIKEGFLEKAQELKQRAGGRGAKP  367

Query  846   NAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVE  667
             NA+TWEIFLD+++K GEI SAV+C+E AITTGRGDG KWVP   IV  +M+ FE KKDV+
Sbjct  368   NARTWEIFLDHHMKQGEIESAVNCVENAITTGRGDGTKWVPKVEIVNGIMQLFEQKKDVD  427

Query  666   GAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
             GAE  +  +KK+ D L AE  ESLIRTYAAAG+TS  MRRR+KMEN E++EE KKLLD +
Sbjct  428   GAEGFMELVKKAVDKLWAEAFESLIRTYAAAGRTSPSMRRRLKMENVEVNEECKKLLDTV  487

Query  486   SAE  478
             +AE
Sbjct  488   TAE  490



>ref|XP_003531991.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Glycine max]
Length=490

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/489 (68%), Positives = 398/489 (81%), Gaps = 1/489 (0%)
 Frame = -2

Query  1944  IQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRS  1765
             I +   ++K++ KRS KKYLEEALY KL K+G  +    ++LN F+KS K  YKWEVG +
Sbjct  3     IMQLYGRSKSVVKRS-KKYLEEALYMKLFKDGSSQLIVRQSLNNFVKSRKRVYKWEVGDT  61

Query  1764  VKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSK  1585
             +K LR RKLY PA+KLSETM KR M KT SD  IH+DL+AK++GI AAE YF++LPE SK
Sbjct  62    LKKLRDRKLYQPALKLSETMAKRNMIKTVSDHAIHLDLLAKARGITAAENYFVSLPEPSK  121

Query  1584  NHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAII  1405
             NH  YGALLNCYCKELMTEK+E L+EKMKEL+L L+SMPYNSLMTLYT+ GQPEKIP++I
Sbjct  122   NHLCYGALLNCYCKELMTEKSEGLMEKMKELSLPLSSMPYNSLMTLYTKVGQPEKIPSLI  181

Query  1404  QEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYAD  1225
             QE+K  ++M DS+TYN+WMRALAA+ DISGVERV DEMKR G+V  DWTTYSNLASI+ D
Sbjct  182   QEMKASNVMLDSYTYNVWMRALAAVNDISGVERVHDEMKRGGQVTGDWTTYSNLASIFVD  241

Query  1224  AGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANIS  1045
             AGL DKAE ALKELEK+N  ++LTAYQFLITLYGR GNL EVYR+WRSLRLAFPKTANIS
Sbjct  242   AGLFDKAEVALKELEKRNAFKDLTAYQFLITLYGRTGNLYEVYRVWRSLRLAFPKTANIS  301

Query  1044  YLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQ  865
             YLNMIQVLVNL D+PGAEKCF+EWE G  TYDIRVAN LI AY K  +L+KA+EL++RA+
Sbjct  302   YLNMIQVLVNLKDLPGAEKCFREWECGCPTYDIRVANVLIRAYVKLDMLEKAEELKERAR  361

Query  864   RSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFE  685
             R GAKPNAKT EIF+DYYL  G+   AVD + +AI+ GRG+G+KWVPS  I+  +MRHFE
Sbjct  362   RRGAKPNAKTLEIFMDYYLLKGDFKLAVDYLNEAISMGRGNGEKWVPSSRIISIMMRHFE  421

Query  684   TKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAK  505
              +KDV+GAE  L  LKKS +  G E+ ESLIRTYAAAG+ S+ M+RR+KMEN E+SE  +
Sbjct  422   QEKDVDGAEEFLEILKKSVESPGVEVFESLIRTYAAAGRISSAMQRRLKMENVEVSEGTQ  481

Query  504   KLLDVISAE  478
             KLL+ IS E
Sbjct  482   KLLEAISVE  490



>ref|XP_010100377.1| hypothetical protein L484_027687 [Morus notabilis]
 gb|EXB82511.1| hypothetical protein L484_027687 [Morus notabilis]
Length=500

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/483 (67%), Positives = 392/483 (81%), Gaps = 11/483 (2%)
 Frame = -2

Query  1893  KYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKL-  1717
             KYLEEALY++L K+GG E S  + LN+FLKS K  +KWEV  +++ LR RKLY PA+KL 
Sbjct  18    KYLEEALYKRLFKDGGSEVSVRRQLNDFLKSRKRVFKWEVDDTLRKLRDRKLYCPALKLF  77

Query  1716  ----------SETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYG  1567
                       SE M KRGMNKT SDQ IH+DL+AK++GI AAE YF++LPE+ KNH +YG
Sbjct  78    TGELNYVIQLSEAMAKRGMNKTVSDQAIHLDLIAKARGIPAAETYFVDLPESFKNHLSYG  137

Query  1566  ALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKEC  1387
             ALLNCYCKEL+TE+AEAL+EKMKELN  L+SMPYNSLMTLY + G+PEKIPAIIQE+K  
Sbjct  138   ALLNCYCKELITEEAEALMEKMKELNHPLSSMPYNSLMTLYAKKGKPEKIPAIIQEMKAS  197

Query  1386  DIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDk  1207
              IM DS++YN+WMRALAA+ DISGVERVIDE+K+DGRV  DWT YSNLASIY DAGL   
Sbjct  198   GIMLDSYSYNVWMRALAAVDDISGVERVIDEIKKDGRVVSDWTIYSNLASIYVDAGLFGM  257

Query  1206  aekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQ  1027
             AE ALKELEKKN  R+ +A+QFLITLYGR+GNLVEVYRIWRSLRLAFPKT+NISYLNMIQ
Sbjct  258   AESALKELEKKNVERDHSAFQFLITLYGRMGNLVEVYRIWRSLRLAFPKTSNISYLNMIQ  317

Query  1026  VLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKP  847
             VLVNL D+PGAEKCF+EW+S  + YDIRVAN LIGAYAK+  L+KA+EL++ A+R GAK 
Sbjct  318   VLVNLKDLPGAEKCFREWQSNCSAYDIRVANVLIGAYAKENSLEKAQELKEHARRRGAKA  377

Query  846   NAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVE  667
             N KTWEIFLDYYL+N +  SAVD +  AI+TGRGDG+KW+PSP IV  LM++FE +KDV+
Sbjct  378   NVKTWEIFLDYYLRNEDFKSAVDFVANAISTGRGDGEKWIPSPDIVKTLMQNFELEKDVD  437

Query  666   GAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
             GAE  L  LKK  + L  ++ ESLIRTYAAAG+TS+ MRRR+KME  E+S+ +KKLL+ I
Sbjct  438   GAEGFLEILKKVVNFLEVDVFESLIRTYAAAGRTSSSMRRRLKMEEVEVSDASKKLLEEI  497

Query  486   SAE  478
               +
Sbjct  498   CVD  500



>emb|CDX96239.1| BnaC02g14120D [Brassica napus]
Length=491

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/482 (66%), Positives = 390/482 (81%), Gaps = 0/482 (0%)
 Frame = -2

Query  1938  RFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVK  1759
             R  S+ ++I KRSTKKYL+E LY +L K+GG E S  + LN+FLK  K  +KWEVG ++K
Sbjct  4     RHLSRPRDIVKRSTKKYLDEPLYHRLFKDGGSEVSVRQQLNQFLKGTKHVFKWEVGDTIK  63

Query  1758  LLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH  1579
              LR R LY PA+KLSE ME RGMNKT SDQ IH+DL+AK++GIAA E+YF++LPETSK  
Sbjct  64    KLRSRGLYYPALKLSEVMEHRGMNKTVSDQAIHLDLIAKARGIAAGESYFVDLPETSKTE  123

Query  1578  FTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQE  1399
              TY +LLNCYCKELMTEKAE L+ KMKELN+T++SM YNSLMTLYT+TGQ E++P +IQE
Sbjct  124   LTYASLLNCYCKELMTEKAEGLLNKMKELNITVSSMSYNSLMTLYTKTGQAERVPGMIQE  183

Query  1398  IKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAG  1219
             +K  D+MPDS+TYN+WMRALAA  D+SGVERVI+EM RDGRVA DWTTYSN+ASIY DAG
Sbjct  184   MKAEDVMPDSYTYNVWMRALAATEDVSGVERVIEEMNRDGRVAPDWTTYSNMASIYVDAG  243

Query  1218  LSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYL  1039
             LS+KAEKAL+ELE KNT R+  AYQFLITLYGR+G L EVYRIWRSLRLA PKT+N++YL
Sbjct  244   LSEKAEKALQELEMKNTERDFKAYQFLITLYGRLGKLNEVYRIWRSLRLAMPKTSNVAYL  303

Query  1038  NMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRS  859
             NMIQVLVNL D+PGAE  FKEW++  +TYDIRV N +IGAYA++GL++KA EL++++ R 
Sbjct  304   NMIQVLVNLKDLPGAETLFKEWQANCSTYDIRVVNVMIGAYAREGLIEKANELKEKSPRR  363

Query  858   GAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETK  679
             G K NAKTWE+F+DYY+K GE + A++CI KA++ G+GDG KW+PS   V  LM  FE K
Sbjct  364   GGKLNAKTWELFMDYYVKRGETAQALECITKAVSIGKGDGGKWLPSEDTVRALMSQFEEK  423

Query  678   KDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKL  499
             KDV GAE +L  LKK  D +GAE  ESLIRTYAAAGK+   MR+R+KME  ++ +  +KL
Sbjct  424   KDVNGAESLLEILKKGTDDVGAETFESLIRTYAAAGKSHPAMRQRLKMEKVKVDKATEKL  483

Query  498   LD  493
             LD
Sbjct  484   LD  485



>ref|XP_009103962.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Brassica rapa]
Length=492

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/485 (65%), Positives = 393/485 (81%), Gaps = 1/485 (0%)
 Frame = -2

Query  1938  RFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVK  1759
             R  S+ ++I KRSTKKYL+E LY +L K+GG E S  + LN+FLK  K  +KWEVG ++K
Sbjct  4     RHLSRPRDIVKRSTKKYLDEPLYHRLFKDGGSEVSVRQQLNQFLKGTKHVFKWEVGDTIK  63

Query  1758  LLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH  1579
              LR R LY PA+KLS+ ME RGMNKT SDQ IH+DLVAK++GIAA E YF+NLPETSK  
Sbjct  64    KLRSRGLYYPALKLSQVMEHRGMNKTVSDQAIHLDLVAKARGIAAGETYFVNLPETSKTE  123

Query  1578  FTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQE  1399
              TY +LLNCYCKELMTEKAE L+ KMKELN+T++SM YNSLMTLYT+TG  E++P ++QE
Sbjct  124   LTYASLLNCYCKELMTEKAEGLLNKMKELNITVSSMSYNSLMTLYTKTGHAERVPGMVQE  183

Query  1398  IKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAG  1219
             +K  ++MPDS+TYN+WMRALAA  D+SGVERVI+EM RDGRVA DWTTYSN+ASIY DA 
Sbjct  184   MKAENVMPDSYTYNVWMRALAATDDVSGVERVIEEMNRDGRVAPDWTTYSNMASIYVDAR  243

Query  1218  LSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYL  1039
             LS+KAEKAL+ELE KNT R+  AYQFL+TLYGR+G L EVYRIWRSLRLA PKT+N++YL
Sbjct  244   LSEKAEKALQELEMKNTDRDFKAYQFLVTLYGRLGKLSEVYRIWRSLRLAIPKTSNVAYL  303

Query  1038  NMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRS  859
             NMIQVLVNL D+ GAE  FKEW++  TTYDIRV N +IGAYAK+GL++KAKEL+++A R 
Sbjct  304   NMIQVLVNLKDVTGAETLFKEWQANCTTYDIRVVNVMIGAYAKEGLIEKAKELKEKAPRR  363

Query  858   GAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETK  679
             G KPNAKTWEIF+DYY+K+G+ + A++CI KA++ G+GDG KW+PS   +  LM  FE K
Sbjct  364   GGKPNAKTWEIFMDYYVKSGDTAQALECISKAVSIGKGDGGKWLPSQEAISTLMSQFEVK  423

Query  678   KDVEGAERVLGNLKK-SEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKK  502
             KDV GAE +L   KK ++D +GAE+ ESL+RTYAAAGK+   MR+R+KME  E++E  +K
Sbjct  424   KDVNGAENLLEIFKKGTDDSIGAEIFESLVRTYAAAGKSHPAMRQRLKMEKVEVNEATQK  483

Query  501   LLDVI  487
             LLD +
Sbjct  484   LLDAL  488



>ref|XP_004135263.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Cucumis sativus]
 ref|XP_004155363.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g60770-like [Cucumis sativus]
 gb|KGN51774.1| hypothetical protein Csa_5G599800 [Cucumis sativus]
Length=489

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/493 (66%), Positives = 396/493 (80%), Gaps = 4/493 (1%)
 Frame = -2

Query  1956  MASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWE  1777
             MAS +Q+F   +K++ KRS +KYLEEALY +L K+GG E S    LN+F+KSHK  +KWE
Sbjct  1     MASPLQKFRP-SKDLAKRSAEKYLEEALYIRLFKDGGSEKSVRLQLNKFIKSHKRVFKWE  59

Query  1776  VGRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLP  1597
             VG +++ LR RKLY PA+KLSE M KRGMNKT SDQ IH+DLVAK++GI AAE YF++LP
Sbjct  60    VGDTLRKLRDRKLYYPALKLSEIMAKRGMNKTVSDQAIHLDLVAKARGIDAAENYFVSLP  119

Query  1596  ETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKI  1417
             E+SKNH +Y +LLNCYCKEL+TEKAEAL EK+KELNL +T +PYNSLMTLY++ G+P+K+
Sbjct  120   ESSKNHLSYSSLLNCYCKELLTEKAEALFEKIKELNLPVTPVPYNSLMTLYSKIGRPDKV  179

Query  1416  PAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLAS  1237
               IIQE+K  ++  D +TY +WMRALAAL DISGVERVIDEMKRDG V  DWTTYSNLAS
Sbjct  180   CTIIQEMKAANVTFDPYTYIVWMRALAALNDISGVERVIDEMKRDG-VKGDWTTYSNLAS  238

Query  1236  IYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKT  1057
             IY +A + +KA KALK+LEK NT R+L  +QFLITLYG+IG+L EVYR+WRSLRLAFP+T
Sbjct  239   IYVNANMFEKAAKALKDLEKINTRRDLIGFQFLITLYGQIGDLTEVYRVWRSLRLAFPRT  298

Query  1056  ANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelr  877
             ANISYLNMIQ L  L D+PGAEKCFKEWESG  TYDIR+ NALIGAY K GLL+KA  L+
Sbjct  299   ANISYLNMIQTLTKLKDLPGAEKCFKEWESGSPTYDIRIPNALIGAYTKGGLLEKAMALK  358

Query  876   krAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELM  697
             +RA R GA+PNAKTWE FL+YYLKNG+   A DC+ KAI  G+GD  KW+PSP I+   M
Sbjct  359   ERALRRGARPNAKTWEFFLNYYLKNGDFKLAGDCVAKAI--GKGDRGKWIPSPEIIKSFM  416

Query  696   RHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELS  517
              HFE +KDV+GAE  L  +KK+ D L +E+ ESLIRTY+AAG+TS+ M RR+KMEN E+S
Sbjct  417   SHFEQEKDVDGAESFLEIVKKTVDSLESEVFESLIRTYSAAGRTSSSMSRRLKMENVEVS  476

Query  516   EEAKKLLDVISAE  478
             E  KKLL+ IS E
Sbjct  477   EACKKLLNKISIE  489



>emb|CDY46999.1| BnaC09g14050D [Brassica napus]
Length=491

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/482 (65%), Positives = 388/482 (80%), Gaps = 0/482 (0%)
 Frame = -2

Query  1938  RFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVK  1759
             R  S+ ++I KRSTKKYL+E LY +L K+GG E S  + LN+FLK  K  +KWEVG ++K
Sbjct  4     RHLSRPRDIVKRSTKKYLDEPLYHRLFKDGGSEVSVRQQLNQFLKGTKHVFKWEVGDTIK  63

Query  1758  LLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH  1579
              LR R LY PA+KLSE ME RGMNKT SDQ IH+DLVAK++GIAA E+YF++LPETSK  
Sbjct  64    KLRSRGLYYPALKLSEVMEHRGMNKTVSDQAIHLDLVAKARGIAAGESYFVDLPETSKTE  123

Query  1578  FTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQE  1399
              TY +LLNCYCKELMTEKAE L+ KMKELN+T++SM YNSLMTLYT+TGQ E++P +IQE
Sbjct  124   LTYASLLNCYCKELMTEKAEGLLNKMKELNITVSSMSYNSLMTLYTKTGQAERVPGMIQE  183

Query  1398  IKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAG  1219
             +K  D+MPDS+TYN+WMRALAA  D+SGVERVI+EM RDGRVA DWTTYSN+ASIY DAG
Sbjct  184   MKAEDVMPDSYTYNVWMRALAATEDVSGVERVIEEMNRDGRVAPDWTTYSNMASIYVDAG  243

Query  1218  LSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYL  1039
             LS+KAEKAL+ELE KNT R+  AYQFLITLYGR+G L EVYRIWRS RLA PKT+N++YL
Sbjct  244   LSEKAEKALQELEMKNTDRDFKAYQFLITLYGRLGKLNEVYRIWRSSRLAMPKTSNVAYL  303

Query  1038  NMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRS  859
             NMIQVLVNL D+PGAE  FKEW++  +TYDIRV N +IGAY ++GL++KA EL++++ R 
Sbjct  304   NMIQVLVNLKDLPGAETLFKEWQANCSTYDIRVVNVMIGAYTREGLVEKANELKEKSPRR  363

Query  858   GAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETK  679
             G K NAKTWE+F+DYY+K GE + A++CI KA++ G+GDG KW+PS   V  LM  FE K
Sbjct  364   GGKLNAKTWELFMDYYVKRGETAQALECITKAVSIGKGDGGKWLPSEDTVRALMSQFEEK  423

Query  678   KDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKL  499
             KDV GAE +L  LKK  D +GAE  ESLIRTYAAAGK+   MR+R+KME  ++ +  +KL
Sbjct  424   KDVNGAESLLEILKKGTDDVGAETFESLIRTYAAAGKSHPAMRQRLKMEKVKVDKATEKL  483

Query  498   LD  493
             LD
Sbjct  484   LD  485



>emb|CDY34141.1| BnaC01g28810D [Brassica napus]
Length=492

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/488 (65%), Positives = 394/488 (81%), Gaps = 1/488 (0%)
 Frame = -2

Query  1938  RFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVK  1759
             R  S+ ++I KRSTKKYLEE LY +L K+GG E S  + LN+FLK  K  +KWEVG ++K
Sbjct  4     RHLSRPRDIVKRSTKKYLEEPLYHRLFKDGGSEVSVRQQLNQFLKGTKHVFKWEVGDTIK  63

Query  1758  LLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH  1579
              LR R LY PA+KLSE ME RG+NKT SDQ IH+DLVAK++GIAA E YF+NLPETSK  
Sbjct  64    KLRSRGLYYPALKLSEVMEHRGLNKTVSDQAIHLDLVAKARGIAAGETYFVNLPETSKTE  123

Query  1578  FTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQE  1399
              TY +LLNCYCKELMTEKAE L+ KMKELN+T++SM YNSLMTLYT+TGQ E++P ++QE
Sbjct  124   LTYASLLNCYCKELMTEKAEGLLNKMKELNITVSSMSYNSLMTLYTKTGQAERVPGMVQE  183

Query  1398  IKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAG  1219
             +K  ++MPDS+TYN+WMRALAA  D+SGVERVI+EM RDGRVA DWTTYSN+ASIY DA 
Sbjct  184   MKAENVMPDSYTYNVWMRALAATDDVSGVERVIEEMNRDGRVAPDWTTYSNMASIYVDAR  243

Query  1218  LSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYL  1039
             LS+KAEKAL+ELE KNT R+  AYQFLITLYGR+G L EVYRIWRSLRLA PKT+N++YL
Sbjct  244   LSEKAEKALQELEMKNTDRDFKAYQFLITLYGRLGKLTEVYRIWRSLRLAMPKTSNVAYL  303

Query  1038  NMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRS  859
             NMIQVLVNL D+ GAE  FKEW++  TTYDIRV N +IGAYAK+ L++KAKEL+++A R 
Sbjct  304   NMIQVLVNLKDVTGAETLFKEWQANCTTYDIRVVNVMIGAYAKEVLIEKAKELKEKAPRR  363

Query  858   GAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETK  679
             G KPNAKTWEIF+DYY+K+ + + A++CI KA++ G+GDG KW+PS   +  LM  FE K
Sbjct  364   GGKPNAKTWEIFMDYYVKSCDTAHALECISKAVSIGKGDGGKWLPSQEAISSLMIQFEEK  423

Query  678   KDVEGAERVLGNLKK-SEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKK  502
             KDV GAE +L  LKK ++D +GAE+ ESL+RTYAAAGK+   MR+R+KME  E++E  +K
Sbjct  424   KDVNGAENLLEILKKGTDDSIGAEIFESLVRTYAAAGKSHPAMRQRLKMEKVEVNEATQK  483

Query  501   LLDVISAE  478
             LLD +  E
Sbjct  484   LLDELCHE  491



>ref|XP_009113186.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Brassica rapa]
Length=491

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/482 (65%), Positives = 388/482 (80%), Gaps = 0/482 (0%)
 Frame = -2

Query  1938  RFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVK  1759
             R  S+ ++I KRSTKKYL+E LY +L K+GG E S  + LN FLK  K  +KWEVG ++K
Sbjct  4     RHLSRPRDIVKRSTKKYLDEPLYHRLFKDGGSEVSVRQQLNHFLKGTKHVFKWEVGDTIK  63

Query  1758  LLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH  1579
              LR R LY PA+KLSE ME RGMNKT SDQ IH+DLVAK++GIAA E+YF++LPETSK  
Sbjct  64    KLRSRGLYYPALKLSEVMEHRGMNKTVSDQAIHLDLVAKARGIAAGESYFVDLPETSKTE  123

Query  1578  FTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQE  1399
              TY +LLNCYCKELMTEKAE L+ KMKELN+T++SM YNSLMTLYT+TGQ E++P +IQE
Sbjct  124   LTYASLLNCYCKELMTEKAEGLLSKMKELNITVSSMSYNSLMTLYTKTGQAERVPGMIQE  183

Query  1398  IKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAG  1219
             +K  D+MPDS+TYN+WMRALAA  D+SGVERVI+EM RDGRVA DWTTYSN+ASIY DAG
Sbjct  184   MKAEDVMPDSYTYNVWMRALAATEDVSGVERVIEEMNRDGRVAPDWTTYSNMASIYVDAG  243

Query  1218  LSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYL  1039
             LS+KAEKAL+ELE KNT R+  AYQFLITLYGR+G L EVYRIWRSLRLA PKT+N++YL
Sbjct  244   LSEKAEKALQELEMKNTERDFKAYQFLITLYGRLGKLTEVYRIWRSLRLAMPKTSNVAYL  303

Query  1038  NMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRS  859
             NMIQVLVNL D+PGAE  FKEW++  +TYDIRV N +IGAYA++GL++KA EL++++ R 
Sbjct  304   NMIQVLVNLKDVPGAETLFKEWQANCSTYDIRVVNVMIGAYAREGLIEKANELKEKSPRR  363

Query  858   GAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETK  679
             G K NAKTWE+F+DY++K GE + A++CI KA++ G+GDG KW+PS   V  +M  FE K
Sbjct  364   GGKLNAKTWELFMDYFVKRGETAQALECITKAVSIGKGDGGKWLPSEDTVRAVMSQFEEK  423

Query  678   KDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKL  499
             KDV GAE +L  LKK  D +GAE   SLIRTYAAAGK+   MR+R+KME  ++ +  +KL
Sbjct  424   KDVNGAESLLEILKKGTDDVGAETFASLIRTYAAAGKSHPAMRQRLKMEKVKVDKATEKL  483

Query  498   LD  493
             LD
Sbjct  484   LD  485



>emb|CBI23460.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/484 (68%), Positives = 380/484 (79%), Gaps = 46/484 (10%)
 Frame = -2

Query  1929  SKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLR  1750
             S+TKNI KRS KKYLEEALY +L K+G  E S  + LN FLKS K  +KWEVG +VK LR
Sbjct  7     SRTKNIAKRS-KKYLEEALYDRLFKDGSSEVSVRQQLNHFLKSSKRVFKWEVGDTVKKLR  65

Query  1749  QRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTY  1570
              RK + PA+KLSETM KRGMN T SDQ I++DL+ K++G+AAAE YFI+LPETSKNH TY
Sbjct  66    DRKRFYPALKLSETMAKRGMNMTISDQAIYLDLITKTRGVAAAENYFIDLPETSKNHLTY  125

Query  1569  GALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKE  1390
             GALLNCYCKEL+TEKAEAL+E+MKEL L L+SMPYNSLMTLYT+ GQPEKIP IIQE+K 
Sbjct  126   GALLNCYCKELLTEKAEALMERMKELKLGLSSMPYNSLMTLYTKIGQPEKIPTIIQELKS  185

Query  1389  CDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSD  1210
              DIMPDS+TYNIWMRALAA+ DISGVERVI+EMKRDGRVA DWTTYSNLASIY DAG+ +
Sbjct  186   LDIMPDSYTYNIWMRALAAVNDISGVERVIEEMKRDGRVASDWTTYSNLASIYVDAGVFE  245

Query  1209  kaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMI  1030
             KAEKALKELEK+N  R+LTA+QFLITLYGRIGNL+EVYR+WRSLRLAFPKTAN+SYLNMI
Sbjct  246   KAEKALKELEKRNACRDLTAFQFLITLYGRIGNLLEVYRVWRSLRLAFPKTANVSYLNMI  305

Query  1029  QVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAK  850
             QVLVNL D+PGAEKCF+EWESG + YDIRVANALIGAYAK GLL+KA+EL++ A+R GAK
Sbjct  306   QVLVNLKDLPGAEKCFREWESGCSIYDIRVANALIGAYAKDGLLEKAEELKEHARRRGAK  365

Query  849   PNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDV  670
             PNAKTWEIFL Y+LKN E+  AVDC+  AI+T                            
Sbjct  366   PNAKTWEIFLAYHLKNREMKQAVDCVANAIST----------------------------  397

Query  669   EGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDV  490
                              G E+ ESLIR YAAAG+TS VMRRR+KMEN E+S+  KKLL+ 
Sbjct  398   -----------------GVEVFESLIRIYAAAGRTSPVMRRRLKMENVEVSDSCKKLLEE  440

Query  489   ISAE  478
             +S E
Sbjct  441   VSVE  444



>emb|CDO99769.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/408 (77%), Positives = 357/408 (88%), Gaps = 0/408 (0%)
 Frame = -2

Query  1953  ASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEV  1774
             ++F+Q+F+ K+K + KRSTKKYLEEALYRKLLK G  E S  + LNEFLKSHKSAYKWE 
Sbjct  3     STFMQQFTRKSKTVAKRSTKKYLEEALYRKLLKGGSEEESVRQQLNEFLKSHKSAYKWEA  62

Query  1773  GRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPE  1594
               S+KLLRQRKLY PA+KLSE M KRGMNKT SDQ IH+DL+AK +GIA+AE YFINLPE
Sbjct  63    DHSLKLLRQRKLYGPALKLSENMTKRGMNKTVSDQAIHIDLIAKVRGIASAETYFINLPE  122

Query  1593  TSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIP  1414
              SKNH TYGALLNCYCK LM +KAEAL++KMKELNL+LTSMPYNSLMTLYT+ GQPEKIP
Sbjct  123   ASKNHLTYGALLNCYCKALMIDKAEALMDKMKELNLSLTSMPYNSLMTLYTKIGQPEKIP  182

Query  1413  AIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASI  1234
             +IIQE+K  +I+PDS+TYN+WMRALAA  DI+GVERVIDEMKRDGRV+ DWTTYSNLASI
Sbjct  183   SIIQEMKASEILPDSYTYNVWMRALAAENDITGVERVIDEMKRDGRVSGDWTTYSNLASI  242

Query  1233  YADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTA  1054
             YADAGL DKAEKALKELEKKN  R+L+AYQFLITLYGR GNL+EVYR+WRSLRLAFPKTA
Sbjct  243   YADAGLFDKAEKALKELEKKNARRDLSAYQFLITLYGRTGNLLEVYRVWRSLRLAFPKTA  302

Query  1053  NISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrk  874
             NISYLNMIQVLVNLND+PGAEKCF+EWESG   YDIR+AN LIGAYAKQG LKKA+EL++
Sbjct  303   NISYLNMIQVLVNLNDLPGAEKCFREWESGHPAYDIRIANVLIGAYAKQGSLKKAEELKE  362

Query  873   rAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKW  730
             RA+RSGAK NAKTWEIFLDYYL+NGEI  AV+C+ + +      G +W
Sbjct  363   RARRSGAKANAKTWEIFLDYYLRNGEIKPAVECLLEELVLSCAGGSRW  410



>ref|XP_008800895.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Phoenix dactylifera]
Length=485

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/486 (63%), Positives = 383/486 (79%), Gaps = 1/486 (0%)
 Frame = -2

Query  1935  FSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKL  1756
              +++TK + KRS+K YLEEALY++L +EG    S  + L++FLKS K  +KWEVG +++ 
Sbjct  1     MATRTKLVAKRSSK-YLEEALYKRLFREGSSTASVRRELDDFLKSRKRVFKWEVGVTIRK  59

Query  1755  LRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHF  1576
             LR RK + PA+KLSETM +RGMN T SDQ I +DLVAK++GIA+AE YFINLPET+KNH 
Sbjct  60    LRDRKRFRPALKLSETMARRGMNLTVSDQAIRLDLVAKARGIASAEDYFINLPETAKNHL  119

Query  1575  TYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEI  1396
             TYGALLNCYCKELMT+KAEAL+EKMKEL  T + M YNSLMTLY++  QPEK+P IIQE+
Sbjct  120   TYGALLNCYCKELMTDKAEALMEKMKELKFTSSPMAYNSLMTLYSKINQPEKVPTIIQEM  179

Query  1395  KECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGL  1216
             K  D++ D +TYN+WMRALAA+ DI GVERVI+EMKR+GRV  DWTTYSNLASIY DAG+
Sbjct  180   KTNDVLLDCYTYNVWMRALAAINDIFGVERVIEEMKRNGRVTADWTTYSNLASIYVDAGM  239

Query  1215  SDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLN  1036
               KAE ALKELEK+ T  +L AYQFLITLYGR GNLVEV+RIWRSL+LA PK AN+SYLN
Sbjct  240   FQKAEGALKELEKRKTDDDLGAYQFLITLYGRTGNLVEVHRIWRSLKLAHPKIANVSYLN  299

Query  1035  MIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSG  856
             MIQVLVNL D+PGAE+CFK+W+S   TYDIRVANA+I AYAK+G+L KA+ ++K A+  G
Sbjct  300   MIQVLVNLKDLPGAEECFKDWKSKCATYDIRVANAMIRAYAKEGMLDKAEAVKKHAKMRG  359

Query  855   AKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKK  676
             A+ NAKTWEIF++YYL  G++     C ++AI  GR  G+ WVP  V++  +M +FE KK
Sbjct  360   ARLNAKTWEIFMEYYLNKGDMKMVHWCADRAIKKGRSHGRIWVPPLVVIRAIMAYFEEKK  419

Query  675   DVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
             DV GAE+ +  L+K +  LGAE+ E+LIRTY AAGK S  MRRR+KMEN  +SE  +KLL
Sbjct  420   DVAGAEKFIELLQKVDYDLGAEVFEALIRTYVAAGKNSPGMRRRLKMENVVVSEATEKLL  479

Query  495   DVISAE  478
             D +  E
Sbjct  480   DTLCVE  485



>ref|XP_010924205.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Elaeis guineensis]
Length=485

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/486 (63%), Positives = 384/486 (79%), Gaps = 1/486 (0%)
 Frame = -2

Query  1935  FSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKL  1756
              +++TK + KRS+K YLE+ALY++L +EG    S  + L++FLKS K  +KWEVG +++ 
Sbjct  1     MATRTKLVAKRSSK-YLEDALYKRLFREGSSPESVRRELDDFLKSRKRVFKWEVGVTIRK  59

Query  1755  LRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHF  1576
             LR RK + PA+KLSETM +RGMN T SDQ I +DLVAK++G+A+AE YFINLPE +K+H 
Sbjct  60    LRDRKRFRPALKLSETMARRGMNLTVSDQAIRLDLVAKARGVASAEEYFINLPEPAKHHL  119

Query  1575  TYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEI  1396
             TYGALLNCYCKELM +KAEAL+EKMKEL    + M YNSLMTLYT+T QPEK+P+IIQE+
Sbjct  120   TYGALLNCYCKELMPDKAEALMEKMKELKFASSPMAYNSLMTLYTKTNQPEKVPSIIQEM  179

Query  1395  KECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGL  1216
             K  D++PD +TYN+WMRALAA+ DIS VERVI+EMKRDGRV  DWTTYSNLASI+ DAG+
Sbjct  180   KTNDVLPDCYTYNVWMRALAAINDISSVERVIEEMKRDGRVTADWTTYSNLASIFVDAGM  239

Query  1215  SDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLN  1036
               KAE+ALKELEK+N   +L AYQFLITLYGR GNLVEV+RIWR L+LA PK ANISYLN
Sbjct  240   FQKAEEALKELEKRNMDNDLRAYQFLITLYGRTGNLVEVHRIWRFLKLAHPKMANISYLN  299

Query  1035  MIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSG  856
             MIQVLVNL D+PGAE CFK+WES  +TYDIRVANA+I AYAK+G+L KA+ ++KRA+  G
Sbjct  300   MIQVLVNLKDLPGAEACFKDWESKCSTYDIRVANAMIRAYAKEGMLDKAEAVKKRAKMRG  359

Query  855   AKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKK  676
             A+ NAKTWEIF++YYL  G++  A  C ++AI  GR  G+ WVP   ++  +M +FE  K
Sbjct  360   ARLNAKTWEIFMEYYLNKGDMKMAHWCADRAIKKGRSHGRIWVPPREVIRAIMAYFEENK  419

Query  675   DVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
             DV GAE  +  L+K  + L AE+ E+L+RTYAAAGK S  MRRR+KMENA +SE  +KLL
Sbjct  420   DVAGAENFIELLQKVVNDLEAEVFEALVRTYAAAGKNSPGMRRRLKMENAVVSEATEKLL  479

Query  495   DVISAE  478
             D++  E
Sbjct  480   DIVCVE  485



>gb|AIZ68164.1| pentatricopeptide repeat-containing protein At1g60770-like isoform 
X1 [Ornithogalum saundersiae]
Length=491

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/484 (63%), Positives = 382/484 (79%), Gaps = 2/484 (0%)
 Frame = -2

Query  1929  SKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLR  1750
             ++TK I KRS+K YLEEALY++L +EG    S  K L +FLKS K  +KWEVG S+K LR
Sbjct  5     TRTKLITKRSSK-YLEEALYKRLFREGSSPESVRKELTDFLKSRKRVFKWEVGVSIKKLR  63

Query  1749  QRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTY  1570
              RK + PA+KLSETM +RGMN T SD  I +DLVAK++GIA+AE YF+NLPE +K H  Y
Sbjct  64    DRKRFRPALKLSETMARRGMNLTNSDHAIRLDLVAKARGIASAEEYFVNLPEDAKTHLAY  123

Query  1569  GALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKE  1390
             GALLNCYCKELMTEKAEA++EKMKE+    + M YNSLMTLY++T QP+KIP+IIQE+K 
Sbjct  124   GALLNCYCKELMTEKAEAIMEKMKEMGFASSPMAYNSLMTLYSKTKQPDKIPSIIQEMKA  183

Query  1389  CDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSD  1210
              D++PD +T+NIWMR+LAA+ DISGVERV+DEMKRDGRVA DWTTYSNLASIY DAG+  
Sbjct  184   NDVLPDCYTHNIWMRSLAAMNDISGVERVMDEMKRDGRVAADWTTYSNLASIYVDAGMFQ  243

Query  1209  kaekalkelekKNTP-RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNM  1033
             KAE AL+ELEK+NTP ++L AYQFLITLYGR  NLVEVYRIWRSL+LAFPK ANISYLNM
Sbjct  244   KAEGALRELEKRNTPGQSLEAYQFLITLYGRTENLVEVYRIWRSLKLAFPKMANISYLNM  303

Query  1032  IQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGA  853
             IQVLV LND+ GAE CFKEWES  +TYDIR+ NAL+GAY K+G+L+KA+  +++A+R GA
Sbjct  304   IQVLVKLNDLSGAETCFKEWESQCSTYDIRIVNALLGAYLKEGMLEKAENFKRKAKRKGA  363

Query  852   KPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKD  673
             + NAK+WE+ ++Y+LKNG++ S + C+++ I  GR   + WVP   ++  LM +FE KK+
Sbjct  364   RLNAKSWELLMEYHLKNGDMKSVLHCVDRGIKKGRSHDRIWVPPEDVIFSLMSYFEDKKE  423

Query  672   VEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLD  493
             V+GAE  +  LK  +  LGAE+ ESL+RTY AAGK S  MR R+K EN  +SE  +KLLD
Sbjct  424   VKGAEAFIELLKVVKPDLGAEVFESLVRTYVAAGKKSPGMRHRLKKENVVVSEITEKLLD  483

Query  492   VISA  481
              + A
Sbjct  484   EVCA  487



>gb|EPS60636.1| hypothetical protein M569_14165, partial [Genlisea aurea]
Length=485

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/492 (63%), Positives = 390/492 (79%), Gaps = 9/492 (2%)
 Frame = -2

Query  1956  MASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWE  1777
             MAS   R  +K K IG+RS+KKYL EALY+ LLK+GG + +  KNLN F+KS KSAYKWE
Sbjct  1     MASSFMRQFAKKKVIGRRSSKKYLTEALYKNLLKDGGEDRNVRKNLNLFIKSRKSAYKWE  60

Query  1776  VGRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLP  1597
             VGR++++LR+RKLY PA+KLSETMEKRGMNKT  DQ IH+ LVAK++G AAAE YFINLP
Sbjct  61    VGRTLQILRRRKLYGPALKLSETMEKRGMNKTVRDQAIHLHLVAKTQGTAAAETYFINLP  120

Query  1596  ETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKI  1417
             E+SK+  TYGALL+ YCKELM EK++AL++KMK+LNL LT+M YNS+M+LY ++  P+ +
Sbjct  121   ESSKDQRTYGALLHTYCKELMIEKSQALLQKMKDLNLELTAMSYNSIMSLYLKSNLPQTV  180

Query  1416  PAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLAS  1237
             P +IQE+K  DIM D  TYN+W R+LAA+ DI GV+RV+DEMKRDGRVA D +TYSNLAS
Sbjct  181   PTLIQEMKSRDIMLDPCTYNLWFRSLAAMNDIGGVDRVLDEMKRDGRVAPDCSTYSNLAS  240

Query  1236  IYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKT  1057
             IY +AGL DKAE ALKELE KN+ R+L+ YQ+LITLYGR GNL++VYR+WRSL+LAFP T
Sbjct  241   IYVEAGLFDKAENALKELESKNSYRSLSVYQYLITLYGRTGNLLQVYRVWRSLKLAFPNT  300

Query  1056  ANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelr  877
             ANISYLNMIQVLV LND+PGAE CFKEW S  +T D+R+AN LIGAY ++GL +KA++L 
Sbjct  301   ANISYLNMIQVLVKLNDIPGAENCFKEWSSNCSTRDVRIANVLIGAYLREGLFEKAEKL-  359

Query  876   krAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELM  697
                 R GAKPNAKTWE +LDYYL  G++ SAVD ++KA T+    G K+VPSP +V  +M
Sbjct  360   ----RKGAKPNAKTWEHYLDYYLNKGDVGSAVDSMDKAATS--AGGGKFVPSPSVVKRVM  413

Query  696   RHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENA--E  523
             + FE KKDV+GAER +  +KK +D L  E++E ++R Y+ AG+ S +M +RVKME A   
Sbjct  414   QIFEEKKDVDGAERFIKVVKKCKDELDCEVVEWILRIYSGAGRKSKLMEQRVKMEKAGGG  473

Query  522   LSEEAKKLLDVI  487
             LSEE +KLL  I
Sbjct  474   LSEEGRKLLSQI  485



>ref|XP_008801961.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
isoform X1 [Phoenix dactylifera]
Length=485

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/486 (63%), Positives = 382/486 (79%), Gaps = 1/486 (0%)
 Frame = -2

Query  1935  FSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKL  1756
              +++TK + KRS+K YLEEALYR+L ++G    S  + L++FLKS K  +KWEVG S++ 
Sbjct  1     MATRTKLVAKRSSK-YLEEALYRRLFRQGSSPASVRQELDDFLKSRKRVFKWEVGVSIRK  59

Query  1755  LRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHF  1576
             LR RK + PA+KLSETM +RGMN T SDQ I +DLVAK++GI +AE YFINLPE +KNH 
Sbjct  60    LRDRKRFRPALKLSETMARRGMNLTLSDQAICLDLVAKARGIVSAEEYFINLPEPAKNHL  119

Query  1575  TYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEI  1396
             TYGALLNCYCKE MT+KAEAL+EKMKEL    + M YNSLMTLYT+T QPEK+P++IQE+
Sbjct  120   TYGALLNCYCKESMTDKAEALMEKMKELKFASSPMAYNSLMTLYTKTNQPEKVPSVIQEM  179

Query  1395  KECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGL  1216
             K  D++ D +TYN+WMRALAA+ DISGVER+I+EMKRDGRV  DWTTYSNLASIY DAG+
Sbjct  180   KANDVLLDCYTYNVWMRALAAINDISGVERIIEEMKRDGRVTADWTTYSNLASIYVDAGM  239

Query  1215  SDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLN  1036
               KAE ALKELEK+ T ++L AYQFLITLYGR GNLVEV+RIWRSL+LA PK ANISYLN
Sbjct  240   FQKAEGALKELEKRCTDQDLGAYQFLITLYGRTGNLVEVHRIWRSLKLAHPKMANISYLN  299

Query  1035  MIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSG  856
             MIQVLVNL D+PGAE CFKEWE+  +TYDIRVANA+I AYAK+G+L KA+ ++KRA+  G
Sbjct  300   MIQVLVNLKDLPGAEACFKEWEAKCSTYDIRVANAMIRAYAKEGMLDKAEAVKKRAKMRG  359

Query  855   AKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKK  676
              + NAKTW+IF++YYL  G++     C ++AI  GR  G+ WVP   ++  +M +FE KK
Sbjct  360   GRLNAKTWQIFMEYYLSKGDMKMVHLCADRAIKKGRSHGRVWVPPREVILAIMAYFEEKK  419

Query  675   DVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
             DV GAE+ +  L+K E  LGAE+ E+L+RTY+AAGK S  MRRR+KMEN  +S+  + LL
Sbjct  420   DVGGAEKFIELLQKVEKDLGAEIFEALVRTYSAAGKNSPGMRRRLKMENVVVSKATENLL  479

Query  495   DVISAE  478
             D +  E
Sbjct  480   DTLCVE  485



>ref|XP_010925090.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Elaeis guineensis]
Length=486

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/485 (62%), Positives = 379/485 (78%), Gaps = 1/485 (0%)
 Frame = -2

Query  1935  FSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKL  1756
              +++TK + KRS+K YLEEALY++L ++G    S  + L++FLKS K  +KWEVG S++ 
Sbjct  1     MATRTKLVAKRSSK-YLEEALYKRLFRQGSSPGSVRQELDDFLKSRKRVFKWEVGVSIRK  59

Query  1755  LRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHF  1576
             LR RK + PA+KLSETM +RGMN T SDQ I +DLVAK++GIA+AE YFINLPE +KNH 
Sbjct  60    LRNRKRFRPALKLSETMARRGMNLTLSDQAIRLDLVAKARGIASAEEYFINLPEPTKNHL  119

Query  1575  TYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEI  1396
             TYGALLNCYCKELMT+KAE L+EKMKEL    + M YNSLMTLYT+T QPEK+P+IIQE+
Sbjct  120   TYGALLNCYCKELMTDKAEGLMEKMKELKFASSPMAYNSLMTLYTKTDQPEKVPSIIQEM  179

Query  1395  KECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGL  1216
             K  D++PD +TYN+WMRALAA+ DISGV+RVI+EMKRDGRV  DWTTYSNLASIY DAG+
Sbjct  180   KANDVLPDCYTYNVWMRALAAINDISGVQRVIEEMKRDGRVMADWTTYSNLASIYVDAGM  239

Query  1215  SDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLN  1036
               KAE ALKELEK+NT ++L AY FLITLYGR GNLVEV+RIWRSL+LA  K ANISYLN
Sbjct  240   FQKAEGALKELEKRNTDQDLGAYHFLITLYGRTGNLVEVHRIWRSLKLAHSKMANISYLN  299

Query  1035  MIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSG  856
             MIQVLVNL D+PGAE  FKEWES  +TYDIRVANA+I AYAK+G+L KA+ ++K A+  G
Sbjct  300   MIQVLVNLKDLPGAEARFKEWESKCSTYDIRVANAMIRAYAKEGMLDKAEGVKKHAKMRG  359

Query  855   AKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKK  676
              + NAKTW+IF++YY+  G++     C ++AI  GR  G+ WVP   ++  +M  FE +K
Sbjct  360   GRLNAKTWQIFMEYYMSKGDMKMVHWCADRAIKKGRSHGRIWVPPCEVIQAIMAFFEEQK  419

Query  675   DVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
             DV GAE+ +  L+K E  LG E+ E+LIRTYAAAGK S  MRRR+KMEN   S+  +KLL
Sbjct  420   DVAGAEKFIELLQKVEMDLGPEIFEALIRTYAAAGKNSPGMRRRLKMENVVASQATEKLL  479

Query  495   DVISA  481
             D + +
Sbjct  480   DTVCS  484



>ref|XP_004964414.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g60770-like [Setaria italica]
Length=487

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/486 (60%), Positives = 372/486 (77%), Gaps = 0/486 (0%)
 Frame = -2

Query  1935  FSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKL  1756
              +++ K++ +RSTKKY+EEALYR+L ++G    +  + ++ FL S K A+KWEVG  V+ 
Sbjct  1     MATRVKDVARRSTKKYVEEALYRRLFRKGSTPQAVREEVDGFLDSRKRAFKWEVGVCVRR  60

Query  1755  LRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHF  1576
             +R+  LY PA+KLSE M +RGMN T SDQ I +DLVAKS+GIAAAE YF++LPETSK H 
Sbjct  61    MRRNALYRPALKLSEVMARRGMNPTISDQAIRLDLVAKSRGIAAAEKYFLDLPETSKTHL  120

Query  1575  TYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEI  1396
             TYGALLNCYCKELM EKAEAL+EKMKELN   T+M +NSLMTLYT+  QPEK+P+IIQ++
Sbjct  121   TYGALLNCYCKELMAEKAEALMEKMKELNFAFTAMSFNSLMTLYTKVNQPEKVPSIIQDM  180

Query  1395  KECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGL  1216
             K  D++PD FTYN+WMRALAAL DI GV+RVI+EMKRDGRV  DWT YSNLASIY +AGL
Sbjct  181   KADDVLPDIFTYNVWMRALAALKDIPGVKRVIEEMKRDGRVTPDWTXYSNLASIYVNAGL  240

Query  1215  SDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLN  1036
              +KAE +LKELEK+NT  ++ AYQFLITLYGR  NLVEV+R+WRSL+   P+ AN+SYLN
Sbjct  241   FEKAEASLKELEKRNTSNDIEAYQFLITLYGRTQNLVEVHRVWRSLKRNCPRKANMSYLN  300

Query  1035  MIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSG  856
             MIQVL +LND+P AE CFKEWE+  T YDIRVANA+I AY  +G+L KA  L+KRA+  G
Sbjct  301   MIQVLASLNDLPAAEACFKEWEAQYTKYDIRVANAMIKAYIAEGMLDKAVALKKRAKMRG  360

Query  855   AKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKK  676
              + NAKTWEIF+++YLK G++  A  C ++AI  G   G+ WVP   +   LM +FE  K
Sbjct  361   GRLNAKTWEIFMEHYLKEGDLKMAHWCADRAIKKGHSSGRIWVPPRDVTETLMGYFEKNK  420

Query  675   DVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
             DV+GAE+ +  LKK +  LG  + E L+RTYAAAGK    MR+R+K+EN E+ EEA KLL
Sbjct  421   DVDGAEQYVEVLKKVQKDLGTLVFEPLVRTYAAAGKKFPGMRQRLKIENVEVGEEAAKLL  480

Query  495   DVISAE  478
             D I  +
Sbjct  481   DSICVD  486



>ref|XP_009400074.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Musa acuminata subsp. malaccensis]
Length=487

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/485 (62%), Positives = 372/485 (77%), Gaps = 1/485 (0%)
 Frame = -2

Query  1932  SSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLL  1753
             ++ TK + KRS+K YLEE LY++L +EG    S  + L  FLKS K  YKWEV  S++ L
Sbjct  4     ATGTKLVAKRSSK-YLEEPLYKRLFREGTKPQSVRQQLELFLKSRKRVYKWEVDVSIRRL  62

Query  1752  RQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFT  1573
             R +K + PA+KLSE M KRGMN T SDQ + +DLVAKS+GIA+AE YFINLPE++KNH T
Sbjct  63    RGQKRFHPALKLSEVMAKRGMNLTLSDQAVRLDLVAKSRGIASAEEYFINLPESAKNHLT  122

Query  1572  YGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIK  1393
             YGALLNCYCKEL+TEKAE L+EKMKEL    + M YNSLMTLY +T QP K+P IIQE+K
Sbjct  123   YGALLNCYCKELLTEKAEGLMEKMKELKFASSPMAYNSLMTLYAKTNQPGKVPGIIQEMK  182

Query  1392  ECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLS  1213
               D+MPD FT+N+WMR+LAA+ DISGVERV++EMKRDGRVA DWTTYSNLASIY DAG+ 
Sbjct  183   ADDVMPDCFTFNVWMRSLAAMNDISGVERVMEEMKRDGRVAADWTTYSNLASIYVDAGMF  242

Query  1212  DkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNM  1033
              KAE ALKELEK+N  +++ AYQFLITLYGR GNLVEV+RIWRSL+L  PK AN+SYLNM
Sbjct  243   QKAEGALKELEKRNLGQDVVAYQFLITLYGRTGNLVEVHRIWRSLKLVRPKMANVSYLNM  302

Query  1032  IQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGA  853
             IQVLVNL D+PGAE CFKEWES  + YDIRVANA+I AYA +G+L KA+ ++K A+  G 
Sbjct  303   IQVLVNLKDLPGAEACFKEWESNFSVYDIRVANAMIKAYANEGMLDKAQAVKKHAKMLGG  362

Query  852   KPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKD  673
             + NAKTWEIF+DYY+  G++  A  C ++AI  G+  G+ WVP    +  L+ +FE KKD
Sbjct  363   RLNAKTWEIFMDYYMNKGDLKMAHWCADRAIKKGKSLGRFWVPPRETIITLIAYFEQKKD  422

Query  672   VEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLD  493
             V GAE+ +  L+  E  LGAE+ E+LIRTYAAAGK S  MR R+KME+  + E+ ++LL+
Sbjct  423   VAGAEKFIELLQTVEKDLGAEVFEALIRTYAAAGKRSPGMRHRLKMEHVVVGEDTEQLLE  482

Query  492   VISAE  478
              I  E
Sbjct  483   SICVE  487



>ref|XP_002436399.1| hypothetical protein SORBIDRAFT_10g001830 [Sorghum bicolor]
 gb|EER87766.1| hypothetical protein SORBIDRAFT_10g001830 [Sorghum bicolor]
Length=536

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/535 (54%), Positives = 370/535 (69%), Gaps = 49/535 (9%)
 Frame = -2

Query  1935  FSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKL  1756
              +++ K++ +RSTKKY+EEALYR+L ++G    +  + ++ FL S K A+KWEVG  V+ 
Sbjct  1     MATRVKDVARRSTKKYVEEALYRRLFRKGSTPQAVREEVDGFLDSRKRAFKWEVGVCVRR  60

Query  1755  LRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHF  1576
             +R+  LY PA+KLSE M +RGMN T SDQ I +DL+AKS+GIAAAE YF++LPETSK H 
Sbjct  61    MRRNALYRPALKLSEVMTRRGMNPTVSDQAICLDLIAKSRGIAAAEKYFLDLPETSKTHL  120

Query  1575  TYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEI  1396
             TYGALLN YCKELMTEKAE+L+ KM ELN   T+MP+NSLMT+YT+  QPEK+P IIQ +
Sbjct  121   TYGALLNSYCKELMTEKAESLMAKMSELNFAFTAMPFNSLMTMYTKVNQPEKVPGIIQYM  180

Query  1395  KECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGL  1216
             K  D++P  FTYN+WMRALAAL DI GVERVI+EMKRDGRVA DWTTYSNLASIY DAGL
Sbjct  181   KADDVLPHVFTYNVWMRALAALNDIPGVERVIEEMKRDGRVAPDWTTYSNLASIYVDAGL  240

Query  1215  SDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLN  1036
              +KAE ALKELEK+NT  ++ AYQFLITLYGR  NLVEV+R+WRSL+   P+ AN+SYLN
Sbjct  241   FEKAEAALKELEKRNTSNDVEAYQFLITLYGRTQNLVEVHRVWRSLKRNNPRMANMSYLN  300

Query  1035  MIQVLVNLNDMPGAEKCFKEWES-------------------------------------  967
             MIQVL NL D+P AE CFKEWE+                                     
Sbjct  301   MIQVLANLKDLPAAEACFKEWEARHIHPPKTKAKDSGADNISTTDPESSSNLPNNQSGIK  360

Query  966   ------------GQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIF  823
                             YDIRVANA+I AY  +G+L KA  ++KRA+  G + NAKTWEIF
Sbjct  361   ETGDEAAKDLQLKHPKYDIRVANAMIKAYIAEGMLDKAVAVKKRAKMHGGRLNAKTWEIF  420

Query  822   LDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGN  643
             ++++LK G++  A  C ++A+  G   G+ WVP P +   LM +FE  KDV+GAE+ + +
Sbjct  421   MEHHLKTGDLKMAHWCADRAMKKGHSSGRIWVPPPAVTETLMSYFEENKDVDGAEQYVES  480

Query  642   LKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
             LKK +  LG  + E L+RTYAAAGK    MR+R+K+EN E+ EE  +LLD I A+
Sbjct  481   LKKVQKDLGTPVFEPLLRTYAAAGKKFPGMRQRLKIENVEVGEETDQLLDSICAD  535



>ref|NP_001168600.1| uncharacterized protein LOC100382384 [Zea mays]
 gb|ACN28808.1| unknown [Zea mays]
Length=536

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/535 (55%), Positives = 374/535 (70%), Gaps = 49/535 (9%)
 Frame = -2

Query  1935  FSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKL  1756
              +++ K++ +RSTKKY+EEALYR+L ++G    +  + ++ FL S K A+KWEVG  V+ 
Sbjct  1     MATRMKDVARRSTKKYVEEALYRRLFRKGSTPQAVREEVDGFLDSRKRAFKWEVGVCVRR  60

Query  1755  LRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHF  1576
             +R+  LY P++KLSE M +RGMN T SDQ I +DL+AKS+GIAAAE YF++LPETSK H 
Sbjct  61    MRRNALYRPSLKLSEVMARRGMNPTVSDQAIRLDLIAKSRGIAAAEKYFLDLPETSKTHL  120

Query  1575  TYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEI  1396
             TYGALLN YCKELMTEKAE+L+EKMKELN   T+M +NSLMT+YT+  Q EK+P+IIQ++
Sbjct  121   TYGALLNSYCKELMTEKAESLMEKMKELNFAFTAMSFNSLMTMYTKVNQAEKVPSIIQDM  180

Query  1395  KECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGL  1216
             K  D++PD FTYN+WMRALAAL DI GVERVI+EMKRDGRVA DWTTYSNLASIY +AG+
Sbjct  181   KADDVLPDVFTYNVWMRALAALKDIPGVERVIEEMKRDGRVAPDWTTYSNLASIYVEAGM  240

Query  1215  SDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLN  1036
              +KAE ALKELEK+NT  ++ AYQFLITLYGR  NLVEV+R+WRSL+   P+ AN+SYLN
Sbjct  241   FEKAEAALKELEKRNTSNDIEAYQFLITLYGRTQNLVEVHRVWRSLKRDNPRMANMSYLN  300

Query  1035  MIQVLVNLNDMPGAEKCFKEW---------------------------------------  973
             MIQVL NL D+  AE CFKEW                                       
Sbjct  301   MIQVLANLKDLSAAEACFKEWEARHIHPPKTNTKGSGADNTPGADPKSPSNPPNNQSGTK  360

Query  972   ESGQTT----------YDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIF  823
             E+G  T          YDIRVANA+I AY  +G+L KA  ++KRA+  G + NAKTWEIF
Sbjct  361   ETGDETAEDLQPKHPKYDIRVANAMIKAYITEGMLDKAVAMKKRAKMRGGRLNAKTWEIF  420

Query  822   LDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGN  643
             +++YLK G++  A  C ++A+  G   G+ WVP P +   LM +FE  KDV+GAER +G 
Sbjct  421   MEHYLKTGDLKMAHWCADRAMKKGHSSGRIWVPPPAVTETLMSYFEENKDVDGAERYVGA  480

Query  642   LKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
             LKK +  LGA + E L+RTYAAAGK    MR+R+K+EN E+ E   +LLD I A+
Sbjct  481   LKKVQKDLGAPVFEPLVRTYAAAGKKFPGMRQRLKIENVEVGEGTAQLLDSICAD  535



>gb|AFW86057.1| hypothetical protein ZEAMMB73_674343 [Zea mays]
Length=596

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/533 (55%), Positives = 373/533 (70%), Gaps = 49/533 (9%)
 Frame = -2

Query  1929  SKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLR  1750
             ++ K++ +RSTKKY+EEALYR+L ++G    +  + ++ FL S K A+KWEVG  V+ +R
Sbjct  63    TRMKDVARRSTKKYVEEALYRRLFRKGSTPQAVREEVDGFLDSRKRAFKWEVGVCVRRMR  122

Query  1749  QRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTY  1570
             +  LY P++KLSE M +RGMN T SDQ I +DL+AKS+GIAAAE YF++LPETSK H TY
Sbjct  123   RNALYRPSLKLSEVMARRGMNPTVSDQAIRLDLIAKSRGIAAAEKYFLDLPETSKTHLTY  182

Query  1569  GALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKE  1390
             GALLN YCKELMTEKAE+L+EKMKELN   T+M +NSLMT+YT+  Q EK+P+IIQ++K 
Sbjct  183   GALLNSYCKELMTEKAESLMEKMKELNFAFTAMSFNSLMTMYTKVNQAEKVPSIIQDMKA  242

Query  1389  CDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSD  1210
              D++PD FTYN+WMRALAAL DI GVERVI+EMKRDGRVA DWTTYSNLASIY +AG+ +
Sbjct  243   DDVLPDVFTYNVWMRALAALKDIPGVERVIEEMKRDGRVAPDWTTYSNLASIYVEAGMFE  302

Query  1209  kaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMI  1030
             KAE ALKELEK+NT  ++ AYQFLITLYGR  NLVEV+R+WRSL+   P+ AN+SYLNMI
Sbjct  303   KAEAALKELEKRNTSNDIEAYQFLITLYGRTQNLVEVHRVWRSLKRDNPRMANMSYLNMI  362

Query  1029  QVLVNLNDMPGAEKCFKEW---------------------------------------ES  967
             QVL NL D+  AE CFKEW                                       E+
Sbjct  363   QVLANLKDLSAAEACFKEWEARHIHPPKTNTKGSGADNTPGADPKSPSNPPNNQSGTKET  422

Query  966   GQTT----------YDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLD  817
             G  T          YDIRVANA+I AY  +G+L KA  ++KRA+  G + NAKTWEIF++
Sbjct  423   GDETAEDLQPKHPKYDIRVANAMIKAYITEGMLDKAVAMKKRAKMRGGRLNAKTWEIFME  482

Query  816   YYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLK  637
             +YLK G++  A  C ++A+  G   G+ WVP P +   LM +FE  KDV+GAER +G LK
Sbjct  483   HYLKTGDLKMAHWCADRAMKKGHSSGRIWVPPPAVTETLMSYFEENKDVDGAERYVGALK  542

Query  636   KSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
             K +  LGA + E L+RTYAAAGK    MR+R+K+EN E+ E   +LLD I A+
Sbjct  543   KVQKDLGAPVFEPLVRTYAAAGKKFPGMRQRLKIENVEVGEGTAQLLDSICAD  595



>ref|NP_001052458.1| Os04g0320200 [Oryza sativa Japonica Group]
 emb|CAE04700.1| OSJNBa0041M06.2 [Oryza sativa Japonica Group]
 emb|CAE01505.2| OSJNBb0026L04.10 [Oryza sativa Japonica Group]
 dbj|BAF14372.1| Os04g0320200 [Oryza sativa Japonica Group]
 gb|EAY89640.1| hypothetical protein OsI_11170 [Oryza sativa Indica Group]
 gb|EAZ30246.1| hypothetical protein OsJ_14297 [Oryza sativa Japonica Group]
 dbj|BAG99602.1| unnamed protein product [Oryza sativa Japonica Group]
Length=524

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/520 (55%), Positives = 363/520 (70%), Gaps = 37/520 (7%)
 Frame = -2

Query  1935  FSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKL  1756
              +++ K++ +RS+KKY++EALYR+L + G    +  + ++ FL S K A+KWEVG  V+ 
Sbjct  1     MATRVKDVARRSSKKYVDEALYRRLFRRGSTPQAVREEVDGFLDSRKRAFKWEVGVCVRR  60

Query  1755  LRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHF  1576
             LR++ LY PA+KLSE M +RGMN T SDQ I +DLVAKS+GIAAAE YF++LPETSK H 
Sbjct  61    LRKQALYRPALKLSEVMARRGMNPTVSDQAIRLDLVAKSRGIAAAEKYFLDLPETSKTHL  120

Query  1575  TYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEI  1396
             TYGALLNCYCK+LMTEKAEAL+ KMKELN   T+M YNSLMTLYT+  Q EK+P++IQ++
Sbjct  121   TYGALLNCYCKDLMTEKAEALMGKMKELNFAFTAMCYNSLMTLYTKVNQHEKVPSVIQDM  180

Query  1395  KECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGL  1216
             K  D++PD +TYN+WMRALAA  DI GVERVI+EMKRDGRV  DWTTYSNLASIY DAGL
Sbjct  181   KADDVLPDIYTYNVWMRALAARVDIKGVERVIEEMKRDGRVTPDWTTYSNLASIYVDAGL  240

Query  1215  SDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLN  1036
              +KAE ALKELEK NT  +L AYQFLITLY R  NLVEV+R+WRSL+   P+ AN+SYLN
Sbjct  241   FEKAEAALKELEKWNTSNDLEAYQFLITLYARTQNLVEVHRVWRSLKRNQPRRANMSYLN  300

Query  1035  MIQVLVNLNDMPGAEKCFKEWESG------------------------------------  964
             MIQ L NL D+PGAE CFKEWE+                                     
Sbjct  301   MIQALANLKDLPGAEACFKEWEAQYINPPKTNTKAPGTAETSSNESDVKATKDKGTDGEL  360

Query  963   -QTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISS  787
                 YDIRVANA+I AY  +G+  KA  ++KRA+  G + NAKTWEIF+++YLK G++  
Sbjct  361   KHPKYDIRVANAMIKAYITEGMFDKAVAVKKRAKMRGGRLNAKTWEIFMEHYLKEGDLKM  420

Query  786   AVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAEL  607
                C ++AI  G   G+ WVP   +   LM +FE  KDV+GAE+ +  LKK +  LG  +
Sbjct  421   VHWCADRAIKKGHSAGRIWVPPHEVTETLMDYFEKNKDVDGAEKFVEVLKKVQKDLGTVV  480

Query  606   LESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
              E L+RTYAAAGK    MR R+K+EN E+SEE  KLLD +
Sbjct  481   FEPLVRTYAAAGKKLPGMRHRLKIENVEVSEETAKLLDSV  520



>ref|XP_003557118.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Brachypodium distachyon]
Length=536

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/536 (54%), Positives = 373/536 (70%), Gaps = 50/536 (9%)
 Frame = -2

Query  1935  FSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKL  1756
              +++ K++ +RS+KKY+EEALYR+L + G    +  + ++ FL S K A+KWEVG  V+ 
Sbjct  1     MATRVKDLARRSSKKYVEEALYRRLFRRGSTPQAVREEVDGFLDSRKRAFKWEVGVCVRR  60

Query  1755  LRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHF  1576
             LR+++LY PA+KL+E M +RGMN T  DQ I +DLVAKS+GIAAAE YF++LPETSK H 
Sbjct  61    LRRQELYRPALKLTEVMARRGMNPTVGDQAIRLDLVAKSRGIAAAEKYFMDLPETSKTHL  120

Query  1575  TYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEI  1396
             TYGALLNCYCKE MTEKAEAL+EKMKELN   T+M YNSLMTLYT+  QPEK+P+IIQ++
Sbjct  121   TYGALLNCYCKESMTEKAEALMEKMKELNFAFTAMSYNSLMTLYTKVNQPEKVPSIIQDM  180

Query  1395  KECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGL  1216
             K  D++PD +TYN+WMR+LAA  DISGVERVI+EMKRDGRV  DWTTYSNLASIY +AGL
Sbjct  181   KADDVLPDVYTYNVWMRSLAARQDISGVERVIEEMKRDGRVVPDWTTYSNLASIYVEAGL  240

Query  1215  SDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLN  1036
              +KAE ALKELEK+NT  +L AYQFLITLYGR  NLVEV+ +WRSL+   P+ AN+SYLN
Sbjct  241   FEKAEAALKELEKRNTSNDLEAYQFLITLYGRTQNLVEVHHVWRSLKRNNPRKANMSYLN  300

Query  1035  MIQVLVNLNDMPGAEKCFKEWES------------------------GQTT---------  955
             MIQVL NL D+P AE CFKEWE+                          TT         
Sbjct  301   MIQVLANLKDLPAAEACFKEWEARYIRPPKTKAIDAVTTETSKLDQESSTTNASNNDSDA  360

Query  954   -----------------YDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEI  826
                              YDIRVANAL+ AY  +G+L KA  L+KRA+  G + N+KTWEI
Sbjct  361   KGTEDKGMEEIDMKHPKYDIRVANALMKAYVTEGMLDKAVALKKRAKMRGGRLNSKTWEI  420

Query  825   FLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLG  646
             F+++Y+K G++ +A  C ++AI  G   G+ WVP   +   LM +FE KKDV+GAE+ + 
Sbjct  421   FMEHYIKVGDLKNAHWCTDRAIKKGHSSGRIWVPPRDVTETLMGYFEKKKDVDGAEKFVE  480

Query  645   NLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
              LKK +  LG  + E L+RTYAAAGK    MR R+K+EN E+SEE  KL+D +  +
Sbjct  481   VLKKVQKDLGTVVFEPLVRTYAAAGKKFPGMRHRLKIENVEVSEEIAKLVDSLCVD  536



>emb|CAH66166.1| H0107B07.5 [Oryza sativa Indica Group]
Length=524

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/520 (55%), Positives = 362/520 (70%), Gaps = 37/520 (7%)
 Frame = -2

Query  1935  FSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKL  1756
              +++ K++ +RS+KKY++EALYR+L + G    +  + ++ FL S K A+KWEVG  V+ 
Sbjct  1     MATRVKDVARRSSKKYVDEALYRRLFRRGSTPQAVREEVDGFLDSRKRAFKWEVGVCVRR  60

Query  1755  LRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHF  1576
             LR++ LY PA+KLSE M +RGMN T SDQ I +DLVAKS+GIAAAE YF++LPETSK H 
Sbjct  61    LRKQALYRPALKLSEVMARRGMNPTVSDQAIRLDLVAKSRGIAAAEKYFLDLPETSKTHL  120

Query  1575  TYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEI  1396
             TYGALLNCYCK+LMTEKAEAL+ KMKELN   T+M YNSLMTLYT+  Q EK+P++IQ++
Sbjct  121   TYGALLNCYCKDLMTEKAEALMGKMKELNFAFTAMCYNSLMTLYTKVNQHEKVPSVIQDM  180

Query  1395  KECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGL  1216
             K  D++PD +TYN+WMRALAA  DI GVERVI+EMKRDGRV  DWTTYSNLASIY DAGL
Sbjct  181   KADDVLPDIYTYNVWMRALAARVDIKGVERVIEEMKRDGRVTPDWTTYSNLASIYVDAGL  240

Query  1215  SDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLN  1036
              +KAE ALKELEK NT  +L AYQFLITLY R  NLVEV+R+WRSL+   P+ AN+SYLN
Sbjct  241   FEKAEAALKELEKWNTSNDLEAYQFLITLYARTQNLVEVHRVWRSLKRNQPRRANMSYLN  300

Query  1035  MIQVLVNLNDMPGAEKCFKEWESG------------------------------------  964
             MIQ L NL D+PGAE CFKEWE+                                     
Sbjct  301   MIQALANLKDLPGAEACFKEWEAQYINPPKTNTKAPGTAETSSNESDVKATKDKGTDGEL  360

Query  963   -QTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISS  787
                 YDIRVANA+I  Y  +G+  +A  ++KRA+  G + NAKTWEIF+++YLK G++  
Sbjct  361   KHPKYDIRVANAMIKEYITEGMFDQAVAVKKRAKMRGGRLNAKTWEIFMEHYLKEGDLKM  420

Query  786   AVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAEL  607
                C ++AI  G   G+ WVP   +   LM +FE  KDV+GAE+ +  LKK +  LG  +
Sbjct  421   VHWCADRAIKKGHSAGRIWVPPHEVTETLMDYFEKNKDVDGAEKFVEVLKKVQKDLGTVV  480

Query  606   LESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
              E L+RTYAAAGK    MR R+K+EN E+SEE  KLLD +
Sbjct  481   FEPLVRTYAAAGKKLPGMRHRLKIENVEVSEETAKLLDSV  520



>gb|AFW86058.1| hypothetical protein ZEAMMB73_674343 [Zea mays]
Length=626

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/563 (52%), Positives = 373/563 (66%), Gaps = 79/563 (14%)
 Frame = -2

Query  1929  SKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLR  1750
             ++ K++ +RSTKKY+EEALYR+L ++G    +  + ++ FL S K A+KWEVG  V+ +R
Sbjct  63    TRMKDVARRSTKKYVEEALYRRLFRKGSTPQAVREEVDGFLDSRKRAFKWEVGVCVRRMR  122

Query  1749  QRKLYSPAIK------------------------------LSETMEKRGMNKTTSDQGIH  1660
             +  LY P++K                              LSE M +RGMN T SDQ I 
Sbjct  123   RNALYRPSLKPEQMQNTTPSQARGRCLGRAYALVQDCRLVLSEVMARRGMNPTVSDQAIR  182

Query  1659  VDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTL  1480
             +DL+AKS+GIAAAE YF++LPETSK H TYGALLN YCKELMTEKAE+L+EKMKELN   
Sbjct  183   LDLIAKSRGIAAAEKYFLDLPETSKTHLTYGALLNSYCKELMTEKAESLMEKMKELNFAF  242

Query  1479  TSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVI  1300
             T+M +NSLMT+YT+  Q EK+P+IIQ++K  D++PD FTYN+WMRALAAL DI GVERVI
Sbjct  243   TAMSFNSLMTMYTKVNQAEKVPSIIQDMKADDVLPDVFTYNVWMRALAALKDIPGVERVI  302

Query  1299  DEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGR  1120
             +EMKRDGRVA DWTTYSNLASIY +AG+ +KAE ALKELEK+NT  ++ AYQFLITLYGR
Sbjct  303   EEMKRDGRVAPDWTTYSNLASIYVEAGMFEKAEAALKELEKRNTSNDIEAYQFLITLYGR  362

Query  1119  IGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEW-----------  973
               NLVEV+R+WRSL+   P+ AN+SYLNMIQVL NL D+  AE CFKEW           
Sbjct  363   TQNLVEVHRVWRSLKRDNPRMANMSYLNMIQVLANLKDLSAAEACFKEWEARHIHPPKTN  422

Query  972   ----------------------------ESGQTT----------YDIRVANALIGAYAKQ  907
                                         E+G  T          YDIRVANA+I AY  +
Sbjct  423   TKGSGADNTPGADPKSPSNPPNNQSGTKETGDETAEDLQPKHPKYDIRVANAMIKAYITE  482

Query  906   GllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWV  727
             G+L KA  ++KRA+  G + NAKTWEIF+++YLK G++  A  C ++A+  G   G+ WV
Sbjct  483   GMLDKAVAMKKRAKMRGGRLNAKTWEIFMEHYLKTGDLKMAHWCADRAMKKGHSSGRIWV  542

Query  726   PSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRR  547
             P P +   LM +FE  KDV+GAER +G LKK +  LGA + E L+RTYAAAGK    MR+
Sbjct  543   PPPAVTETLMSYFEENKDVDGAERYVGALKKVQKDLGAPVFEPLVRTYAAAGKKFPGMRQ  602

Query  546   RVKMENAELSEEAKKLLDVISAE  478
             R+K+EN E+ E   +LLD I A+
Sbjct  603   RLKIENVEVGEGTAQLLDSICAD  625



>ref|XP_008801962.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
isoform X2 [Phoenix dactylifera]
Length=421

 Score =   528 bits (1360),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 268/415 (65%), Positives = 331/415 (80%), Gaps = 0/415 (0%)
 Frame = -2

Query  1722  KLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCK  1543
             +LSETM +RGMN T SDQ I +DLVAK++GI +AE YFINLPE +KNH TYGALLNCYCK
Sbjct  7     QLSETMARRGMNLTLSDQAICLDLVAKARGIVSAEEYFINLPEPAKNHLTYGALLNCYCK  66

Query  1542  ELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFT  1363
             E MT+KAEAL+EKMKEL    + M YNSLMTLYT+T QPEK+P++IQE+K  D++ D +T
Sbjct  67    ESMTDKAEALMEKMKELKFASSPMAYNSLMTLYTKTNQPEKVPSVIQEMKANDVLLDCYT  126

Query  1362  YNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkel  1183
             YN+WMRALAA+ DISGVER+I+EMKRDGRV  DWTTYSNLASIY DAG+  KAE ALKEL
Sbjct  127   YNVWMRALAAINDISGVERIIEEMKRDGRVTADWTTYSNLASIYVDAGMFQKAEGALKEL  186

Query  1182  ekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDM  1003
             EK+ T ++L AYQFLITLYGR GNLVEV+RIWRSL+LA PK ANISYLNMIQVLVNL D+
Sbjct  187   EKRCTDQDLGAYQFLITLYGRTGNLVEVHRIWRSLKLAHPKMANISYLNMIQVLVNLKDL  246

Query  1002  PGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIF  823
             PGAE CFKEWE+  +TYDIRVANA+I AYAK+G+L KA+ ++KRA+  G + NAKTW+IF
Sbjct  247   PGAEACFKEWEAKCSTYDIRVANAMIRAYAKEGMLDKAEAVKKRAKMRGGRLNAKTWQIF  306

Query  822   LDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGN  643
             ++YYL  G++     C ++AI  GR  G+ WVP   ++  +M +FE KKDV GAE+ +  
Sbjct  307   MEYYLSKGDMKMVHLCADRAIKKGRSHGRVWVPPREVILAIMAYFEEKKDVGGAEKFIEL  366

Query  642   LKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
             L+K E  LGAE+ E+L+RTY+AAGK S  MRRR+KMEN  +S+  + LLD +  E
Sbjct  367   LQKVEKDLGAEIFEALVRTYSAAGKNSPGMRRRLKMENVVVSKATENLLDTLCVE  421



>gb|KDO82308.1| hypothetical protein CISIN_1g011226mg [Citrus sinensis]
Length=353

 Score =   504 bits (1297),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 258/353 (73%), Positives = 297/353 (84%), Gaps = 0/353 (0%)
 Frame = -2

Query  1536  MTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYN  1357
             MTEKAEAL+EKMKELNL  +SMP+NSLMTLY +TG PEKIPAIIQE+K   IMPDS+TYN
Sbjct  1     MTEKAEALLEKMKELNLGFSSMPFNSLMTLYAKTGHPEKIPAIIQEMKASSIMPDSYTYN  60

Query  1356  IWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelek  1177
             +WMRALAA+ DISG ERVI+EMKRDGRVA DWTT+SNLASIY +AGL +KAE+ALKELE 
Sbjct  61    VWMRALAAVNDISGAERVIEEMKRDGRVAADWTTFSNLASIYVEAGLFEKAERALKELEN  120

Query  1176  KNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPG  997
             +N  R+L+AYQFLITLYG+ GNL EVYRIWRSLRLAFP TANISYLNMIQVLVNL D+PG
Sbjct  121   RNAHRDLSAYQFLITLYGQTGNLSEVYRIWRSLRLAFPNTANISYLNMIQVLVNLKDLPG  180

Query  996   AEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLD  817
             AEKCFKEWESG  TYDIRV N +IGAYAK+G L+ A+EL++RA+R GA PNAKTWEIF D
Sbjct  181   AEKCFKEWESGCATYDIRVTNVMIGAYAKEGRLENAEELKERARRRGADPNAKTWEIFSD  240

Query  816   YYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLK  637
             YYL+NG++  AVDC+EKAI TGRGDG KWVPS   +   MRHFE +KDV+GAE  L  LK
Sbjct  241   YYLRNGDMKLAVDCLEKAIDTGRGDGGKWVPSSETIRTFMRHFEQEKDVDGAEGFLEILK  300

Query  636   KSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
             K+ D LG E+ E LIRTYAAAG+TS VM RR+KME  E+SE +KKLL+ I  E
Sbjct  301   KAVDDLGVEVFEPLIRTYAAAGRTSPVMLRRLKMEKVEVSEASKKLLEAICVE  353



>ref|XP_006840979.1| hypothetical protein AMTR_s00085p00059480 [Amborella trichopoda]
 gb|ERN02654.1| hypothetical protein AMTR_s00085p00059480 [Amborella trichopoda]
Length=483

 Score =   502 bits (1292),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 265/464 (57%), Positives = 346/464 (75%), Gaps = 2/464 (0%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLK-SHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEK  1699
             LY++LLK+G  E S GK LN ++K   K   KW+   SVK LR+RK Y+ A++LSETM +
Sbjct  19    LYQRLLKQGSSERSVGKELNSWIKVPKKRTRKWDAALSVKELRKRKRYTQALRLSETMAR  78

Query  1698  RGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAE  1519
             +GM+ T+ D  I +DL++K++GIA+AE YF++ P  +K+H  YGALLNCYCKE +TEKAE
Sbjct  79    KGMSPTSGDDAIRIDLISKTRGIASAEKYFMDRPVPAKSHLAYGALLNCYCKENLTEKAE  138

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
             AL+ KMKEL    + + YNSLMTLY  +G P KIP+IIQE+K  +I PD+FTYNIWMR+L
Sbjct  139   ALMMKMKELGFVYSPLSYNSLMTLYMNSGDPVKIPSIIQEMKANNITPDTFTYNIWMRSL  198

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
             A + DI GVERV+ EMKRDGRV+EDWTT+SNLASIYA  GL +KAE ALKE+EKKN  R+
Sbjct  199   AEVHDIDGVERVLSEMKRDGRVSEDWTTFSNLASIYAKVGLHEKAEAALKEVEKKNGFRD  258

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
             L A+QFLITLYG+ GNL EVYRIWRSL+LAFPKTANISYLNM QVLV L D+PGAEKCF+
Sbjct  259   LVAFQFLITLYGQTGNLAEVYRIWRSLKLAFPKTANISYLNMTQVLVKLGDLPGAEKCFR  318

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWE+  + YDIRVANA+I A  K GLL+KAK+++ RA+R GAKPN KT EIF++YYL+ G
Sbjct  319   EWEASCSVYDIRVANAMIDANLKAGLLEKAKDVQIRAKRRGAKPNLKTHEIFIEYYLREG  378

Query  798   EISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHL  619
             +I   ++ IEKA+   +   ++W P   +  E+M +FE +KDV+ AE     L+K    +
Sbjct  379   KIVLVLEHIEKAVLVAQRSRREWKPGHDVACEIMAYFEWQKDVDRAEGFCAILRKL-GTV  437

Query  618   GAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
              A + E+L+RTY  AGK    M  R++ E  E++ E +KLL ++
Sbjct  438   DARVCEALLRTYVGAGKKDAKMGLRLRAEGVEVNSEMEKLLQLV  481



>gb|EMT02140.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii]
Length=480

 Score =   491 bits (1263),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 265/465 (57%), Positives = 321/465 (69%), Gaps = 49/465 (11%)
 Frame = -2

Query  1725  IKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYC  1546
             IKL+E M +RGMN T  DQ I +DLVAKS+GIAAAE YF++LPETSK H TYGALLNCYC
Sbjct  16    IKLTEVMTRRGMNPTVGDQAIRLDLVAKSRGIAAAEKYFMDLPETSKTHLTYGALLNCYC  75

Query  1545  KELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSF  1366
             KELMTEKAE+L+EKMKELN   T+M YNSLMTLYT+  QPE +P+IIQ++K  D++PD +
Sbjct  76    KELMTEKAESLMEKMKELNFAFTAMSYNSLMTLYTKVNQPEMVPSIIQDMKADDVLPDVY  135

Query  1365  TYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalke  1186
             TYN+WMR+LAA  DI GVERVI+EM RDGRVA DWTTYSNLASIY DAG S+KAE ALKE
Sbjct  136   TYNVWMRSLAARQDILGVERVIEEMTRDGRVAPDWTTYSNLASIYVDAGQSEKAEAALKE  195

Query  1185  lekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLND  1006
             LEK+NT  +L AYQFLITLYGR  NLVEV+R+WRSL+   P+ AN+SYLNMIQVL NL D
Sbjct  196   LEKRNTGNDLEAYQFLITLYGRTQNLVEVHRVWRSLKRNNPRKANMSYLNMIQVLANLKD  255

Query  1005  MPGAEKCFKEWES-----------------------------------------------  967
             +P AE CFKEWE+                                               
Sbjct  256   LPAAEACFKEWEARYIRPPKTKATDAVTTETSKLEEEASTEASNNDSDVKETEDKGTEEL  315

Query  966   --GQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEI  793
                +  YDIRVANAL+ AY  +G+L KA  L+KRA+  G + NAKTWEIF+D+YLK G++
Sbjct  316   DLKRPKYDIRVANALMKAYVTEGMLDKAIALKKRAKMRGGRLNAKTWEIFMDHYLKVGDL  375

Query  792   SSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGA  613
              +A  C ++AI  G   G+ WVP   +   LM +FE KKDV+GAE  +  LKK +  LG 
Sbjct  376   KNAHWCADRAIKKGHSSGRIWVPPHDVTKTLMGYFEKKKDVDGAESFVEVLKKVQKDLGT  435

Query  612   ELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
              + E L+RTYAAAGK    MR R+K+EN ELSEE  KL+D I  +
Sbjct  436   VVFEPLVRTYAAAGKKFPGMRHRLKIENVELSEETDKLVDSICVD  480



>ref|XP_006653269.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Oryza brachyantha]
Length=449

 Score =   487 bits (1254),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 262/448 (58%), Positives = 315/448 (70%), Gaps = 38/448 (8%)
 Frame = -2

Query  1707  MEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTE  1528
             M +RGMN T SDQ I +DLVAKS+GIAAAE YF++LPETSK H TYGALLNCYCKELMTE
Sbjct  1     MARRGMNPTVSDQAIRLDLVAKSRGIAAAEKYFLDLPETSKTHLTYGALLNCYCKELMTE  60

Query  1527  KAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWM  1348
             KAEAL+EKMK+LN   T+M YNSLMTLYT+T Q EK+P++IQ++K  D++PD +TYN+WM
Sbjct  61    KAEALMEKMKKLNFAFTAMCYNSLMTLYTKTNQHEKVPSVIQDMKADDVLPDIYTYNVWM  120

Query  1347  RALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNT  1168
             RALAA  DI GVERVI+EMKRDGRV  DWTTYSNLASIY DAGL +KAE ALKELEK+NT
Sbjct  121   RALAAREDIQGVERVIEEMKRDGRVTPDWTTYSNLASIYVDAGLFEKAEAALKELEKRNT  180

Query  1167  PRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEK  988
               +L AYQFLITLY R  NLVEV+RIWRSL+   P+ AN+SYLNMIQ L NL D+  AE 
Sbjct  181   SNDLEAYQFLITLYARTQNLVEVHRIWRSLKRNQPRMANMSYLNMIQALANLKDISAAES  240

Query  987   CFKEWE-------------SGQT-------------------------TYDIRVANALIG  922
             CFKEWE             SG T                          YDIRVANA+I 
Sbjct  241   CFKEWEARHIHPAKTNTKDSGTTKTSNNESAAKATNDKGTDETDVKHPKYDIRVANAMIK  300

Query  921   AYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGD  742
             AY  +G+  KA  ++KRA+  G + NAKTWEIF++YYLK G++  A  C ++AI  G   
Sbjct  301   AYITEGMFDKADAVKKRAKMRGGRLNAKTWEIFMEYYLKAGDLKMAHWCADRAIKKGHSS  360

Query  741   GQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTS  562
             G+ WVP   +   LM +FE  KDV+GAE+ +  LK  +  LGA + ESLIRTYAAAGK  
Sbjct  361   GRIWVPPTDVTDTLMDYFEKNKDVDGAEKFVLTLKHVKKDLGAVVFESLIRTYAAAGKKL  420

Query  561   TVMRRRVKMENAELSEEAKKLLDVISAE  478
               MR R+K+EN E+SEE  KLLD +  +
Sbjct  421   PGMRHRLKIENVEVSEETAKLLDSVCVD  448



>emb|CDY24553.1| BnaA01g22570D [Brassica napus]
Length=288

 Score =   399 bits (1025),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 196/285 (69%), Positives = 234/285 (82%), Gaps = 0/285 (0%)
 Frame = -2

Query  1938  RFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVK  1759
             R  S+ ++I KRSTKKYL+E LY +L K+GG E S  + LN+FLK  K  +KWEVG ++K
Sbjct  4     RHLSRPRDIVKRSTKKYLDEPLYHRLFKDGGSEVSVRQQLNQFLKGTKHVFKWEVGDTIK  63

Query  1758  LLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH  1579
              LR R LY PA+KLSE ME RGMNKT SDQ IH+DLVAK++GIAA E YF+NLPETSK  
Sbjct  64    KLRSRGLYYPALKLSEVMEHRGMNKTVSDQAIHLDLVAKARGIAAGETYFVNLPETSKTE  123

Query  1578  FTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQE  1399
              TY +LLNCYCKELMTEKAE L+ KMKELN+T++SM YNSLMTLYT+TG  E++P ++QE
Sbjct  124   LTYASLLNCYCKELMTEKAEGLLNKMKELNITVSSMSYNSLMTLYTKTGHAERVPGMVQE  183

Query  1398  IKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAG  1219
             +K  ++MPDS+TYN+WMRALAA  D+SGVERVI+EM RDGRVA DWTTYSN+ASIY DA 
Sbjct  184   MKAENVMPDSYTYNVWMRALAATDDVSGVERVIEEMNRDGRVAPDWTTYSNMASIYVDAR  243

Query  1218  LSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWR  1084
             LS+KAEKAL+ELE KNT R+  AYQFLITLYGR+G L EVYRIWR
Sbjct  244   LSEKAEKALQELEVKNTDRDFKAYQFLITLYGRLGKLSEVYRIWR  288



>ref|XP_010249903.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Nelumbo nucifera]
Length=500

 Score =   370 bits (949),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 216/497 (43%), Positives = 317/497 (64%), Gaps = 4/497 (1%)
 Frame = -2

Query  1971  KTLTKMASFIQRFSSK--TKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSH  1798
             +T T+  SF+    S+  +  +   +  K  E +LYR+L   GG E S    LNE++K  
Sbjct  3     RTATRAISFLSSTPSRGLSTAMATVTASKDKESSLYRRLSALGGSEASVVDTLNEWVKEG  62

Query  1797  KSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAE  1618
             KS  + E+   V  LR+ K Y  A++L + MEKRG + T  DQ I +DL++K +GIA+AE
Sbjct  63    KSVKRVEIIGYVNQLRKYKKYKHALQLLKWMEKRGRDLTHGDQAIRLDLLSKVEGIASAE  122

Query  1617  AYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTR  1438
              YF +L E++KN  TYGALLNCYCKE M +KA +L EKMK+L++  TS+ YN+LM L  R
Sbjct  123   KYFDSLKESAKNKLTYGALLNCYCKEKMVDKAMSLFEKMKKLSVASTSLAYNNLMALNMR  182

Query  1437  TGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWT  1258
                P+K+  +++E+K+  I+PD  TYN+ M + A L +I GVERV++EM  +G +  DW 
Sbjct  183   MSYPKKVAPLVEEMKKNQIVPDIVTYNLLMNSYAYLHNIKGVERVVEEMNTNG-IRFDWA  241

Query  1257  TYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSL  1078
             T++NLA+IY  AGL DKA+ AL+ELEK     +  A+  LI LY R+ NL  V R+W+SL
Sbjct  242   THANLATIYVKAGLFDKAKSALEELEKVANLHDREAFHVLICLYARMSNLEGVNRVWQSL  301

Query  1077  RLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGll  898
             + AFPK  N SYL M++ L  +     A +CFKEWES  +TYDIR+AN LI +Y  Q ++
Sbjct  302   KSAFPKVTNASYLVMLKALCTMGYRDTANECFKEWESVCSTYDIRLANILIDSYLSQFMI  361

Query  897   kkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSP  718
             K+A+ L + A + GAKPN +T E+F++Y+L   ++  A+D ++ A +  + +  KW PS 
Sbjct  362   KEAELLCESAVQKGAKPNFRTLEMFMNYHLMKQQMDLALDYLKTAASKAKVERNKWQPSQ  421

Query  717   VIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVK  538
               V   +++FE+K DV GAE +  +LKK    L +E   SL+RTY A GKT   MR+R+ 
Sbjct  422   ETVSVFLKYFESKNDVGGAEELCDSLKKLR-CLNSEAYSSLLRTYIAIGKTDPEMRKRMS  480

Query  537   MENAELSEEAKKLLDVI  487
              +  E++ +  KLL+ +
Sbjct  481   ADGIEMNSDINKLLEKV  497



>ref|XP_009610168.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=498

 Score =   368 bits (944),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 204/466 (44%), Positives = 301/466 (65%), Gaps = 3/466 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LYR+L   G  + S  + +NE+++  +   K+E+ + +K LR+ K Y  A+++ E MEKR
Sbjct  36    LYRRLSALGATKGSVTETINEYMREGRVVKKYELEKCIKELRKYKRYQHALEIMEWMEKR  95

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
             G+N +  D G+ +DL+AK +GI AAE YF  L  + +N  TYGALLNCYC E MT+KA +
Sbjct  96    GINLSFGDYGVRLDLIAKVQGITAAENYFGGLSPSMQNQSTYGALLNCYCVEKMTDKALS  155

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
             L EKM +LN T  S+ +N+LM+LY R GQPEK+P ++QE+K   +   +FTYNI M + +
Sbjct  156   LFEKMDQLNFTSKSLAFNNLMSLYMRLGQPEKVPPLVQEMKSRKVPLCTFTYNILMNSYS  215

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNL  1156
              LGDI GVERV +E+K++     DWTTYSNLA  Y  AGL DKAE ALK+LE++  PRN 
Sbjct  216   CLGDIEGVERVFEEIKQENAKECDWTTYSNLAVAYVKAGLHDKAELALKKLEEEMGPRNR  275

Query  1155  TAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKE  976
              AY +LI+L+  I NL  VYRIW SL+  F  T N SYL M+Q L  LND+ G +KC++E
Sbjct  276   EAYHYLISLHAGISNLGGVYRIWNSLKSHFSITTNSSYLVMLQSLGKLNDINGLKKCYEE  335

Query  975   WESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGE  796
             WES  ++YD+R+AN++IGAY +  +L  A+E+   A +    P    WE+F+ ++L+N +
Sbjct  336   WESSCSSYDMRLANSVIGAYLRHDMLHDAEEVFHHALKRSQGPFFLAWEMFMAFFLRNRQ  395

Query  795   ISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLG  616
             I+ A+ C+E A +  R    +W P   ++ + + +F  ++DV+GAE     LKK  + L 
Sbjct  396   INLAMKCMEAAAS--RVKKNEWQPKYEMINKFLEYFVEERDVDGAEEFYKYLKKL-NCLS  452

Query  615   AELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
             +++   L+RTY  A +T+  M  R+K +  E+S E + LL  +  E
Sbjct  453   SDVYSLLLRTYIVANRTAEDMLLRIKEDGTEMSCELEDLLKRVCPE  498



>ref|XP_010267968.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Nelumbo nucifera]
Length=511

 Score =   359 bits (922),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 195/440 (44%), Positives = 297/440 (68%), Gaps = 3/440 (1%)
 Frame = -2

Query  1797  KSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAE  1618
             K+  ++++   V  LR+ K +S A++L E ME+RGM+ T  D    +DL+ K++GI +AE
Sbjct  75    KTICRYDISNFVNQLRKYKQFSLALQLLEWMERRGMHLTYGDHAYRIDLLWKAEGILSAE  134

Query  1617  AYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTR  1438
              YF +LP++ +N FTYGALLNCYC E M +KA A + KM+ELNL   +  YNSLMTL+ +
Sbjct  135   KYFTDLPKSFQNKFTYGALLNCYCNEKMVDKAMAHLRKMRELNLASNAPAYNSLMTLHMK  194

Query  1437  TGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWT  1258
              G+ EK+P + QE+KE  I PDSFTYNI M + A+L DI GVERV++E+K    +  +WT
Sbjct  195   LGEAEKVPVLAQEMKEKLIEPDSFTYNILMSSYASLKDIEGVERVMEEVKTRSEIDGNWT  254

Query  1257  TYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSL  1078
              Y +LA++Y  +GL +KA+ ALKELE++N P++  A+ FL+++Y  IGN  EV R+W+SL
Sbjct  255   MYGSLAAVYIASGLFEKAQLALKELEQRNKPKDREAFHFLLSMYASIGNAAEVNRVWQSL  314

Query  1077  RLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGll  898
             + AF KT N+SYL M+Q L  L+D+ G  KCF+EWESG ++YDIR+ N L+GAY K+ ++
Sbjct  315   KSAFQKTTNLSYLTMLQTLARLDDLDGLAKCFEEWESGCSSYDIRLINVLMGAYLKRDMI  374

Query  897   kkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSP  718
             ++AK L ++A R G+ PN  T+ +F+D+Y+KN ++  A+ C++ AI   +    +W    
Sbjct  375   QEAKLLLEKATRKGSNPNYATFMMFVDFYVKNQDMDWALKCMDTAIPKVK--EHEWKLYR  432

Query  717   VIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVK  538
                  L+++FE +KDV+ AE +   LK++ + L  E+   LIRTY  AG     MR+R++
Sbjct  433   ERSYFLLKNFEEEKDVDHAEELYRILKRA-NCLDQEVYNFLIRTYVVAGMVEPQMRQRME  491

Query  537   MENAELSEEAKKLLDVISAE  478
              +  E+  E ++LL+ I  +
Sbjct  492   ADGIEIMPETERLLESICPD  511



>ref|XP_008227878.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial [Prunus mume]
Length=501

 Score =   354 bits (908),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 201/467 (43%), Positives = 289/467 (62%), Gaps = 4/467 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LYR+L   G    S  K LN+++   K   K+E+ R +K LR+ + +  A+++ E ME R
Sbjct  38    LYRRLSALGATGGSVAKTLNQYIMEGKMLKKYELERCIKELRKYRKFQHALEIMEWMEFR  97

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
              MN + +D  I +DL +K KGI AAE YF  L  + K+ FTYGALLNCYCKELM EKA +
Sbjct  98    KMNYSKADFAIRLDLTSKVKGIEAAEDYFSGLSPSLKDRFTYGALLNCYCKELMEEKALS  157

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
             L E M EL    +S+ +N+LM+++ R  QPEK+  ++QE+K+  I  D+FTYNIWM++ A
Sbjct  158   LYETMDELEFASSSLVFNNLMSMHMRKQQPEKVAPLVQEMKQRKIPLDTFTYNIWMQSFA  217

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP-RN  1159
             +L +  GVERV+DEM++       W+TYSNLA+IY  A + DKAE ALK+ E+   P + 
Sbjct  218   SLNNFEGVERVLDEMQKQDGDQCSWSTYSNLAAIYVKAKIFDKAELALKKSEEMMKPLKQ  277

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
                Y FLI+LY    NL EV R+W SL+ AFP T NISYL M+Q L  LND+ G ++CF+
Sbjct  278   RNTYHFLISLYACTSNLGEVKRVWESLKKAFPATNNISYLIMLQALCKLNDIEGLKECFE  337

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWE   ++YD+R+AN  I  Y  Q + ++A  +   A +    P  K  E+F+ Y+LKN 
Sbjct  338   EWECKCSSYDMRLANTAIRGYLSQDMYEEAALVFSDACKRTKGPFFKAREMFMLYFLKNC  397

Query  798   EISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHL  619
             ++  AV  +  A++      ++W PSP       ++FE +KDVE AE     LK+  + L
Sbjct  398   QVDLAVSYLGAAVS--ETVDEEWHPSPDTTSAFFKYFEEEKDVESAENFCKILKRL-NCL  454

Query  618   GAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
              +     L++TY AAGK    MR+R+K E+ E+S E + LL+ +S E
Sbjct  455   CSNEYYLLLKTYIAAGKLDPEMRQRLKEEDIEISPELESLLERVSPE  501



>emb|CDP17058.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   354 bits (908),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 197/495 (40%), Positives = 304/495 (61%), Gaps = 8/495 (2%)
 Frame = -2

Query  1953  ASFIQRFSSKTKNIGKRSTKKY-LEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWE  1777
             A  + R  S   N+ K +T++   E  LY++L   G  +   G  +NE+L+  +  +K E
Sbjct  18    AEALTRGVSTAVNVEKETTQQPGRERNLYKRLSALGAKKGLVGATINEYLREGRVPHKQE  77

Query  1776  VGRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLP  1597
             + R +K LR+   +  A++  E M+ R +  +  D    +DL+ K++GI AAE YF  LP
Sbjct  78    LMRCIKELRRFGRHHQALETMEWMDTRNVKLSHRDHATRLDLICKTQGIDAAEDYFNGLP  137

Query  1596  ETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKI  1417
              ++KN FTYGALLNCYC E M +KA  L ++M ++ +  +S+ +N++M+LY R GQPEK+
Sbjct  138   PSAKNQFTYGALLNCYCVEKMKDKALDLFDEMHQMQIAPSSLAFNNVMSLYMRLGQPEKV  197

Query  1416  PAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLAS  1237
             P ++ E+K+  I   +FTYNI+M + + L DI GVERV +E+ ++G    DWTT+SNLA 
Sbjct  198   PPLVDEMKKRKIPLSTFTYNIFMHSYSCLDDIEGVERVFEEIMQEGGKRYDWTTFSNLAV  257

Query  1236  IYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKT  1057
              Y +AGL++KA  ALK++E++  PRN  A+ +L++LY R  N+ EV+RIW+SLR + P  
Sbjct  258   AYVNAGLNEKAVLALKKVEQEMGPRNREAFHYLLSLYARTANIGEVHRIWKSLRSSLPTV  317

Query  1056  ANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelr  877
              N+SYL ++Q L  LND+ G + CF+EWES  ++YDIR+AN  IGAY +  + + A+ + 
Sbjct  318   TNLSYLTLLQALNKLNDVHGLQNCFQEWESTCSSYDIRLANLAIGAYLRHDMAEDAESVF  377

Query  876   krAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELM  697
               A +  + P     E+ + YYLKN  I  A+ C+E AI+    DG +W P    + + +
Sbjct  378   HSALKRSSGPFFVAREMLMMYYLKNRNIRLALQCMEAAIS--ELDGSEWQPKSDSICKFL  435

Query  696   RHFETKKDVEGAERVLGNLKKSE--DHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAE  523
                E +KDV+ AE     LKK    +H G    +SL++TY AA KT+  MR R++ +  E
Sbjct  436   TVCEEEKDVDSAEEFCKYLKKVNCLNHRG---YKSLLQTYVAAAKTAPYMRTRIEGDGIE  492

Query  522   LSEEAKKLLDVISAE  478
             +  E + LL  +S E
Sbjct  493   ICSELENLLQNVSPE  507



>ref|XP_006349176.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Solanum tuberosum]
Length=495

 Score =   353 bits (906),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 203/466 (44%), Positives = 296/466 (64%), Gaps = 4/466 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LYR+L   G  + S  + +N + +  +   K+E+ + +K LR+ K Y  A+++ E MEKR
Sbjct  34    LYRRLSALGATKGSVTETINAYTREGRVVKKYELEKCIKELRKYKRYQHALEIMEWMEKR  93

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
             G+N +  D G+ +DL+AK +GI AAE YF  L  + +N  TYGALLNCYC E M +KA +
Sbjct  94    GINFSYGDYGVRLDLIAKVQGITAAEKYFGGLSPSMQNQSTYGALLNCYCVEKMADKALS  153

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
               EKM +L  T  S+ +N+LM+LY R GQPEK+  ++QE+K   +   +F+YNIWM + +
Sbjct  154   FFEKMDQLKFTNKSLAFNNLMSLYMRLGQPEKVAPLVQEMKSRKVPLCTFSYNIWMNSYS  213

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNL  1156
              L DI GVERV +E+K++     DWTTYSNLA  Y  AG ++KAE ALK+LE++  PRN 
Sbjct  214   CLDDIEGVERVFEELKQENAKECDWTTYSNLAVAYVKAGHNEKAELALKKLEEEMGPRNR  273

Query  1155  TAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKE  976
              AY +LI+L+ RI NL EVYRIW SL+ +   T N SYL M+Q L   NDM G +K ++E
Sbjct  274   QAYHYLISLHARISNLGEVYRIWGSLKSSLDLT-NSSYLVMLQSLSKHNDMDGLKKYYEE  332

Query  975   WESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGE  796
             WES  +TYD+R+AN +IGAY +  +L  A+++   A +    P    WE+F+ +YL+  +
Sbjct  333   WESSCSTYDMRLANNVIGAYLRHDMLNNAEKVFHSALKRSQGPFFLAWEMFMLFYLRKRQ  392

Query  795   ISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLG  616
             I+ A  C+E AI + R    KW P    +   + +F  +KDV+GAE     LKK  + L 
Sbjct  393   INFAQQCME-AIAS-RIKENKWRPKYETISNFLEYFVEEKDVDGAEDFYKFLKKV-NCLS  449

Query  615   AELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
             +++  SL+RTYAAA +T+  MR R+K +  E+S E ++LL  +  E
Sbjct  450   SDVYSSLLRTYAAANRTTDDMRLRIKEDGIEMSCELEELLKSVCPE  495



>ref|XP_010921472.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial [Elaeis guineensis]
Length=513

 Score =   353 bits (907),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 205/466 (44%), Positives = 299/466 (64%), Gaps = 5/466 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGL-ENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM-E  1702
             LYR+L   GG  E S  K LN++++  + A   E+ + VK LR+ + Y+ A++L + M  
Sbjct  50    LYRRLSALGGAPEGSVTKTLNKWVREGRPARAVELMKYVKELRKYRRYNHALELMDWMVN  109

Query  1701  KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKA  1522
              RGMN + ++  I +DL+AK +GI +AE YF  LPE +KN  TYGALLNCYC E M +KA
Sbjct  110   TRGMNMSYTNHAIRLDLIAKVRGIESAEEYFFKLPEPAKNERTYGALLNCYCSEKMADKA  169

Query  1521  EALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRA  1342
              AL EKM E+N+  +++ +N+LM+LY + GQPEK+PA +QE+KE +I PD+ T  I M +
Sbjct  170   NALYEKMNEMNIASSTLVHNNLMSLYMKLGQPEKVPAQVQEMKEKNIAPDNLTCCILMNS  229

Query  1341  LAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPR  1162
              A+LGDI  VE VI EM+ +G V  +W+ YS LA+IY+ AGL  KAE ALK+LE+     
Sbjct  230   YASLGDIDSVEGVIKEMEEEGEVTLNWSAYSTLAAIYSSAGLVTKAESALKQLEELVDSH  289

Query  1161  NLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCF  982
             +   + FLI+LY   GNLVEV RIW+SL+  FPK  N+S+L M+Q L  L+D+    +C+
Sbjct  290   DREPFHFLISLYAGTGNLVEVNRIWKSLKTTFPKPTNMSFLTMLQALNKLDDIDSLTQCY  349

Query  981   KEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKN  802
             +EWES   TYD+++ N ++GAY ++G++K+A+ L  R    GA  + +T E+FLD YLKN
Sbjct  350   EEWESFYVTYDLKLTNLMLGAYLRKGMVKEAEALWARTSEKGAGFDRRTCELFLDCYLKN  409

Query  801   GEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDH  622
               +  A+  +E A++  + D  +W  S   V   ++  E  KDVEGAER   +L K  + 
Sbjct  410   HNMELALKWLENAVSMVKQD--EWKLSQEKVSTFLKCLEEAKDVEGAERFSKSL-KVLNC  466

Query  621   LGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVIS  484
             L     ESL+RTY+ A +    +R+R+  +  ELS   K+LL  +S
Sbjct  467   LDTRAYESLLRTYSLARRRDPSLRQRINDDKIELSSHTKRLLKRVS  512



>ref|XP_004229380.2| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial [Solanum lycopersicum]
Length=509

 Score =   353 bits (906),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 201/466 (43%), Positives = 298/466 (64%), Gaps = 4/466 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LYR+L   G  + S  + +N + +  +   K+E+ + +K LR+ K Y  A+++ E MEKR
Sbjct  48    LYRRLSALGATKGSVTETINAYTREGRVVKKYELEKCIKELRKYKRYQHALEIMEWMEKR  107

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
             G+N +  D G+ +DL+AK +GI AAE YF +L  + +N  TYGALLNCYC E MT+KA  
Sbjct  108   GINFSYGDYGVRLDLIAKVQGITAAEKYFGSLSPSMQNQSTYGALLNCYCVEKMTDKALT  167

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
               E+M +L  T  S+ +N+LM+LY R GQPEK+  ++QE+K   +   +F+YN+WM + +
Sbjct  168   FFERMDQLKFTNRSLAFNNLMSLYMRLGQPEKVAPLVQEMKSRKVPLCTFSYNVWMNSYS  227

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNL  1156
              L DI GVERV +E+K++     DWTTYSNLA  Y  AG ++KAE ALK+LE++  PRN 
Sbjct  228   CLDDIEGVERVFEELKQENAKECDWTTYSNLAVAYVKAGHNEKAELALKKLEEEMGPRNR  287

Query  1155  TAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKE  976
              AY +LI+L+ RI NL EVYRIW SL+ +   T N SYL M+Q L   NDM G +K ++E
Sbjct  288   QAYHYLISLHARISNLGEVYRIWGSLKSSLDLT-NSSYLVMLQSLSKHNDMDGLKKYYEE  346

Query  975   WESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGE  796
             WES  +TYD+R+AN +IGAY +  +L  A+++   A +    P    WE+F+ +YL+  +
Sbjct  347   WESSCSTYDMRLANNVIGAYLRHDMLNNAEKVFHCALKRSQGPFFLAWEMFMLFYLRKRQ  406

Query  795   ISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLG  616
             I+ A  C+E AI + R    KW P    +   + +F  +KDV+GAE     LKK  + L 
Sbjct  407   INFAQQCME-AIAS-RIKENKWRPKYETISNFLEYFVEEKDVDGAEEFYKFLKKV-NCLS  463

Query  615   AELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
             +++  SL+RTYAAA +T+  M+ R+K +  E+S E ++LL+ +  E
Sbjct  464   SDVYNSLLRTYAAANRTTDDMKLRIKEDGIEMSCELEELLESVCPE  509



>ref|XP_008781131.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial-like [Phoenix dactylifera]
Length=514

 Score =   353 bits (906),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 207/466 (44%), Positives = 299/466 (64%), Gaps = 5/466 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGL-ENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM-E  1702
             LYR+L   GG  E S  K LN++++  + A   E+ + VK LR+ + Y  A++L + M  
Sbjct  51    LYRRLSALGGAPEGSVTKTLNKWVREGRPARAVELMKYVKELRKYRRYKHALELMDWMVN  110

Query  1701  KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKA  1522
              RGMN + ++  I +DL+AK +GI +AE YF  LPE +KN  TYGALLNCYC E M +KA
Sbjct  111   TRGMNMSYTNHAIRLDLIAKVRGIESAEEYFSKLPEPAKNERTYGALLNCYCSEKMLDKA  170

Query  1521  EALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRA  1342
              AL EKM ELN+  +++ +N+LM+LY + GQPEK+P  +QE+K  +I PD+ T  I M +
Sbjct  171   IALYEKMNELNMASSTLVHNNLMSLYMKLGQPEKVPTHLQEMKVKNIAPDNLTCCILMNS  230

Query  1341  LAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPR  1162
              A+LGDI  VE VI EM+ +  V  +W+ YS LA+IY+ AGL  KAE ALK+LE+     
Sbjct  231   YASLGDIDSVEGVIKEMEEEDEVTLNWSAYSTLAAIYSSAGLITKAESALKKLEELVDSH  290

Query  1161  NLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCF  982
             +   + FLI+LY   GNL EV R+W+SL+ AFPK  N+S+L M+Q L  L+D+ G  +C+
Sbjct  291   DREPFHFLISLYAGTGNLAEVNRVWKSLKTAFPKPTNMSFLTMLQALNKLDDIDGLTQCY  350

Query  981   KEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKN  802
             +EWES   TYD+++ N +IGAY  +G++K+A+ L  R    GA  + +T E+FLDYYLKN
Sbjct  351   EEWESFYVTYDLKLTNLMIGAYLTKGMVKEAESLWARTSEKGAGFDFRTCELFLDYYLKN  410

Query  801   GEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDH  622
              E+  A+  +E A++  + D  +W      V   +++ E  KDVEGAER   +L K  + 
Sbjct  411   REMGLALKWLENAVSMVKQD--EWKLDQEKVNTFLKYLEEAKDVEGAERFSKSL-KVLNC  467

Query  621   LGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVIS  484
             L     ESL+RT+  AG+    +R+R+K +  ELS + KKLL  +S
Sbjct  468   LDTRAYESLLRTHFLAGRGEPSLRQRIKDDKIELSSQTKKLLKRVS  513



>ref|XP_002301516.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE80789.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=511

 Score =   348 bits (893),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 200/477 (42%), Positives = 289/477 (61%), Gaps = 16/477 (3%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             +YR+L + G    S  K LNE +       K  +   +K LR+   +  AI++ E M+KR
Sbjct  36    MYRRLSELGASGGSVSKTLNELILEGGKTSKINLTTCIKKLRKYGRFDHAIEVMEWMQKR  95

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
              MN +  D  +++DL AK+KGIAAAE YF NLP + +NH TY  LLNCYCKE M+EKA  
Sbjct  96    KMNFSHVDHAVYLDLTAKTKGIAAAENYFDNLPPSVQNHVTYSTLLNCYCKERMSEKALT  155

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
             L EKM ++ L  TSMP+++LMTL+ R GQPEK+  I+QE+K+  + P +FTYNIWM++  
Sbjct  156   LFEKMDKMKLLSTSMPFSNLMTLHMRLGQPEKVLDIVQEMKQRGVSPGTFTYNIWMQSYG  215

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalke----------  1186
              L D  GV+RV+DEMK DG+    WTTYSNLA+IY  AGL DKAE AL++          
Sbjct  216   CLNDFEGVQRVLDEMKTDGKENFSWTTYSNLATIYVKAGLFDKAESALRKLEEQIECGRD  275

Query  1185  ---lekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVN  1015
                 +K+    +  AY FLI+LY    NL EV+R+W SL+ +F  T NISYLN++Q L  
Sbjct  276   CDFQKKRRHDADREAYHFLISLYAGTSNLSEVHRVWNSLKSSFRTTTNISYLNVLQALAK  335

Query  1014  LNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKT  835
             L D+ G  KCFKEWES   +YD+R+AN  I A  +  + ++A  +   A +       K 
Sbjct  336   LKDVEGLLKCFKEWESSCHSYDMRLANVAIRACLEHDMYEEAASIFDEALKRTKGLFFKA  395

Query  834   WEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAER  655
              E+F+ ++LKN +   A+  ++ A +  +    +W P    V   + +FE  KDV+GAER
Sbjct  396   REMFMVFFLKNHQPDLALKHMKAAFSEAK--EIEWQPDQKTVSAFLNYFEDGKDVDGAER  453

Query  654   VLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVIS  484
              L  + K  + L +     L++TY AAG+ +  MR+R++ +N E++ E + LL+ +S
Sbjct  454   -LCKIWKQINRLNSNAYILLLKTYTAAGRLAPEMRQRLEEDNIEINPELENLLERVS  509



>ref|XP_010249890.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Nelumbo nucifera]
Length=497

 Score =   348 bits (892),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 195/470 (41%), Positives = 311/470 (66%), Gaps = 8/470 (2%)
 Frame = -2

Query  1881  EALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETME  1702
             ++LYR+L   G    S  + +N++++  KS  K ++   +K LR+ K +  A+ L E ME
Sbjct  34    DSLYRRLSALGATGGSVSQAVNKYVREGKSVKKRQIESCIKELRKYKRFQHALDLMEWME  93

Query  1701  KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKA  1522
             KR    + SD  + +DL++K++GI +AE YF +L E +KN  TYGALLNCYCKE M +KA
Sbjct  94    KRDTVLSYSDYAVRLDLLSKTRGIDSAEEYFNSLSEPAKNRLTYGALLNCYCKEKMKDKA  153

Query  1521  EALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRA  1342
              AL EKM EL  + +++ YN+LMTLY R G+P ++P ++Q +KE +I PD+FTY++ + +
Sbjct  154   LALFEKMSELGFS-STLAYNNLMTLYMRLGKPAEVPLLLQAMKEKNISPDNFTYDVLIAS  212

Query  1341  LAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPR  1162
              A+  D + +ERV+ E++R+     +W TYSN+A  Y +AGL +KAE ALK+LEK+  PR
Sbjct  213   YASTKDFAEMERVLAEVEREIGDNVNWNTYSNVAVAYVEAGLFEKAELALKQLEKQMKPR  272

Query  1161  NLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCF  982
             +  AY FLI+LY  + NL EV R+W SL+LA PKT N+SYL M+Q L  L+D  G + CF
Sbjct  273   DRMAYHFLISLYAGMSNLSEVNRVWASLKLALPKTTNLSYLVMLQALARLDDFDGIKTCF  332

Query  981   KEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK-  805
             KEWE+  ++YD+R+AN  I    ++ +L++A+ +   A + G+ PN +T E+F+D++LK 
Sbjct  333   KEWEASCSSYDMRLANVYISTCLRRDMLEEAESVCNGAIQRGSAPNFRTSEMFMDFFLKA  392

Query  804   -NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSE  628
              NG++  A+  +E A++  + +  +W P+   V   +++FE +++VEGAE+    LK+  
Sbjct  393   RNGDL--ALKHMEAAVSKVKNN--EWQPTQERVETFLKYFEEERNVEGAEKFCKMLKEV-  447

Query  627   DHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
             + L +E+   L+RTY AAG+    + +R++ +  E+++E K LL+VI  E
Sbjct  448   NCLNSEVYHLLLRTYVAAGRRDPALPKRMEDDKIEMTDEIKNLLEVICQE  497



>ref|XP_004288536.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Fragaria vesca subsp. vesca]
Length=446

 Score =   345 bits (885),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 186/437 (43%), Positives = 280/437 (64%), Gaps = 7/437 (2%)
 Frame = -2

Query  1785  KWEVGRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFI  1606
             K+E+ R VK LR+ + +  A+++ E ME R +N +  D  + +DL AK+KGI AAE+YF 
Sbjct  8     KYELDRCVKELRKYRQFQTALEIMEWMEFRKINYSLPDYAVRLDLTAKAKGIEAAESYFS  67

Query  1605  NLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQP  1426
             NLP+++KN  TYG+LLNCYCKE+M EKA AL +KM ELN   +++ +N+LM LY R  QP
Sbjct  68    NLPQSAKNKLTYGSLLNCYCKEVMEEKALALYKKMDELNYVDSALVFNNLMALYMRKKQP  127

Query  1425  EKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSN  1246
             EK+   ++E+K  +I  D+F+YNIWM++ A+L D+ GVE V++EM+       DW+TYSN
Sbjct  128   EKVAPFVEEMKRREIRLDTFSYNIWMQSYASLNDMKGVESVVEEMQSQDEDECDWSTYSN  187

Query  1245  LASIYADAGL---SDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLR  1075
             LASIY  A L   ++ A K  +++     P+  T Y FLITLY   GNL EV RIW SL+
Sbjct  188   LASIYVKAQLYEKAEVALKLSEKVMMSGKPQRQT-YHFLITLYANTGNLGEVKRIWESLK  246

Query  1074  LAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllk  895
             LAFP T NISYL ++Q L  L D+ G ++CF+EW+S  ++YD+R+AN +I AY  Q + +
Sbjct  247   LAFPDTNNISYLLVVQALCKLKDVEGLKECFEEWQSNCSSYDMRLANVVIRAYLSQNMYE  306

Query  894   kakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPV  715
             +A  + K A +    P  K  EIF+ Y+L N +   A+  +E+AI   + D  +W PSP 
Sbjct  307   EALLIFKDATKRCRGPFFKAREIFMAYFLDNRQPDLAISYLEEAILETKDD--EWRPSPE  364

Query  714   IVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKM  535
              +   + +FE  KD++ AE     LK+  + L +     L++ Y AAG+    + +R+K 
Sbjct  365   TIAAFLNYFEETKDIDSAENFCKILKRL-NCLSSNEYCLLLKVYVAAGEFLPEICQRLKE  423

Query  534   ENAELSEEAKKLLDVIS  484
             +N ++S E ++L++ +S
Sbjct  424   DNIQISPELEELVEKVS  440



>ref|XP_007051132.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
[Theobroma cacao]
 gb|EOX95289.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
[Theobroma cacao]
Length=501

 Score =   347 bits (889),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 194/466 (42%), Positives = 284/466 (61%), Gaps = 5/466 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LY +L        +  + LN+F+   K   K E+GR VK LR+ + Y  A+ + + ME+R
Sbjct  41    LYPRLSALAATGGTVSEALNDFIMEGKKIRKDELGRCVKELRKYRRYQHALDIMDWMERR  100

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
              ++ +  D  I +DL+AK+KGI AAE Y   LP ++KN  TYGALLNCYC  LM +KA +
Sbjct  101   NLHLSHVDHAIRLDLIAKTKGIDAAENYLSALPPSAKNQLTYGALLNCYCNNLMKDKASS  160

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
             L +KM EL  T  ++P+N+LM LY R GQPEK+P ++ E+K  +I    FTY +WM++ A
Sbjct  161   LFQKMDELRFTNNTLPFNNLMCLYMRLGQPEKVPELVDELKLRNIPRCRFTYVVWMQSYA  220

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNL  1156
              L DI GVERV++E+ +D      WTTY+NLA+IY  AGL +KAE  LK+LEK   PR  
Sbjct  221   NLNDIEGVERVLEELAQDSEDKCTWTTYNNLAAIYVKAGLFEKAEACLKKLEKDMMPRQR  280

Query  1155  TAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKE  976
              AY FLI+LY    NL EV+R+W +L+ AF    N SYL M+Q L  L D+ G +KCF E
Sbjct  281   EAYHFLISLYAGTSNLAEVHRVWEALKRAFSTVTNTSYLVMVQALAKLKDLEGLKKCFAE  340

Query  975   WESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGE  796
             WES  + YDIR+A + I  Y    LL++A+ +   A +    P  K  E+F+ Y+L+  +
Sbjct  341   WESSCSAYDIRLATSTIRGYLSGDLLEEAELVLGNAMKRSKGPFHKVRELFMVYFLEKCQ  400

Query  795   ISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLG  616
                A+  +E A+ +  GD   W P+P  +     +F  ++DV+ AE     + KS++ L 
Sbjct  401   FDLALQHVE-AVVSEMGD---WRPAPETITAFFDYFMKERDVDAAEE-FCRILKSKNGLD  455

Query  615   AELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
             +     L++TY AAGK +  MRRR++++  +LS+E + LL+ +  E
Sbjct  456   SNAYHLLLKTYVAAGKVAPDMRRRLEVDGIQLSQELQDLLENVCRE  501



>ref|XP_011042275.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial [Populus euphratica]
Length=511

 Score =   347 bits (890),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 199/479 (42%), Positives = 294/479 (61%), Gaps = 16/479 (3%)
 Frame = -2

Query  1881  EALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETME  1702
             +++YR+L + G    S  + LNEF+       K  +   +K LR+   +  A ++ E M+
Sbjct  34    KSMYRRLSELGASGGSVSRTLNEFILEGGKISKINLTACIKELRKYGRFDHASEVMEWMQ  93

Query  1701  KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKA  1522
             KR MN +  D  +++DL AK+KGIAAAE YF NLP + +NH TY  LLNCYCKELM+EKA
Sbjct  94    KRKMNFSHVDHAVYLDLTAKTKGIAAAENYFDNLPPSVQNHVTYSTLLNCYCKELMSEKA  153

Query  1521  EALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRA  1342
               L EKM ++ L  TSMP+++LMTL+ R GQPEK+  I+QE+K+  + P +FTYNIWM++
Sbjct  154   LTLFEKMDKMKLLSTSMPFSNLMTLHMRLGQPEKVLDIVQEMKQRGVSPGTFTYNIWMQS  213

Query  1341  LAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalke--------  1186
                L D  GV+RV+DEMK DG+    WTTYSNLA+IY  AGL DKAE AL++        
Sbjct  214   YGCLNDFEGVQRVLDEMKMDGKENFSWTTYSNLATIYIKAGLFDKAESALRKLEEQIECG  273

Query  1185  -----lekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVL  1021
                   +K+    +  AY FLI+LY    NL EV+R+W SL+ +F  T NISYLN++Q L
Sbjct  274   RDCDFQKKRRHDADREAYHFLISLYAGTSNLSEVHRVWNSLKSSFRTTTNISYLNVLQAL  333

Query  1020  VNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNA  841
               L D+ G  +CFK+WES   +YD+R+AN  I A  ++ + K+A  +   A +       
Sbjct  334   AKLKDVEGLLECFKDWESSCHSYDMRLANVAIRACLERDMYKEAASIFDEALKRTKGLFF  393

Query  840   KTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGA  661
             K  E+F+ ++LKN +   A+  ++ A +  +    +W P    V   + +FE +KDV+GA
Sbjct  394   KAREMFMVFFLKNHQPDLALKHMKAAFSEAK--EIEWQPDQKTVSAFLNYFEDEKDVDGA  451

Query  660   ERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVIS  484
             ER L  + K  + L +     L++TY AAG+ +  MR+R++ +N E++ E + LL+ +S
Sbjct  452   ER-LCKMWKQLNRLNSNAYILLLKTYIAAGRLAPEMRQRLEEDNIEINPELENLLERVS  509



>ref|XP_002515265.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF47249.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=504

 Score =   346 bits (888),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 199/487 (41%), Positives = 296/487 (61%), Gaps = 5/487 (1%)
 Frame = -2

Query  1941  QRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSV  1762
             QRFS+    +          E LY KL   G    S  + LNE +   K+  K E+ R +
Sbjct  18    QRFSTAEAAVPPAVVSPRQSEKLYHKLSALGATGGSVSRTLNEHIMEGKTITKIELSRCI  77

Query  1761  KLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKN  1582
             + LR+ + +  A ++ E MEKR MN + +D+ I +DL+ K++GIAAAE YF  L  ++KN
Sbjct  78    RELRKYRRFDHAFEIMEWMEKRKMNFSYADRAIRLDLIGKARGIAAAEDYFNGLSPSAKN  137

Query  1581  HFT-YGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAII  1405
             H T YGALLNCYCKELM++KA AL ++M E     +S+P+N+LM++Y R GQPEK+P ++
Sbjct  138   HHTSYGALLNCYCKELMSDKALALFQEMDEKKFLYSSLPFNNLMSMYMRLGQPEKVPPLV  197

Query  1404  QEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRD-GRVAEDWTTYSNLASIYA  1228
              E+K+  + P SFTYNIWM++   L D  GV+RV+ E+  D G+    WTTYSNLA+IY 
Sbjct  198   DEMKKRKVSPCSFTYNIWMQSYGCLNDFQGVDRVLREIVNDGGKDNLQWTTYSNLATIYL  257

Query  1227  DAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANI  1048
              AG+ +KAE ALK+LE     RN  AY FLI++Y   GN  EV R+W  L+ +F    N+
Sbjct  258   KAGIFEKAESALKKLEAIMGFRNREAYHFLISIYAGTGNSNEVNRVWGLLKSSFNMINNL  317

Query  1047  SYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrA  868
             SYL M+Q L  L D+ G  KCF+EWESG T YD+R+AN  I  + +  + ++A+ +   A
Sbjct  318   SYLVMLQALAKLKDVEGVAKCFREWESGCTNYDMRIANVAIRVFLQHDMYEEAELIFDDA  377

Query  867   QRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHF  688
              +    P  K  E F+ ++LK  ++  A+  +  A +    +  +W P    V     +F
Sbjct  378   LKRTRGPFFKARERFMLFFLKIHQLDLALKHMRAAFS--ESEKHEWKPLQETVNAYFDYF  435

Query  687   ETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEA  508
              T+KDV+GAE+ L  + K  + L + +   L++TY AAGK +  MR+R++ +N E+S+E 
Sbjct  436   RTEKDVDGAEK-LSKILKHINCLNSSVYSLLLKTYIAAGKLAPEMRQRLEEDNIEISDEL  494

Query  507   KKLLDVI  487
             + LL+ +
Sbjct  495   EYLLESV  501



>ref|XP_010069830.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Eucalyptus grandis]
 gb|KCW58313.1| hypothetical protein EUGRSUZ_H01002 [Eucalyptus grandis]
Length=521

 Score =   342 bits (876),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 189/468 (40%), Positives = 290/468 (62%), Gaps = 7/468 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             +YR+L    G   S  K LNE+    +   K ++ R  K LR+ + Y  A+++ + MEKR
Sbjct  42    IYRRLSPLAGFGGSVSKTLNEYFMEGRKVSKIDLVRCAKELRKYRRYEHALEVMQWMEKR  101

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
              +N   +D  +++DL++K KG+ AAE YF  LPE++KN  TYG LLNCYCKE   +KA A
Sbjct  102   NINFAYADYALNLDLISKVKGLDAAEKYFNGLPESAKNIITYGTLLNCYCKEANEDKALA  161

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
             L +KM ELN + T + +++LMTLY + G+PE +P++++++KE  I  DSF Y +WM++ A
Sbjct  162   LFKKMDELNFSSTRLAFSNLMTLYLKLGKPEMVPSLVEKMKERKISLDSFAYVLWMQSYA  221

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNL  1156
             +L +I GVE V  EM  D    +DW  YSNLA+IY  AGL +KAE AL+ LE    P+N 
Sbjct  222   SLDNIEGVEMVWQEMLNDSSQCDDWVVYSNLAAIYVKAGLFEKAESALRTLETVMKPQNR  281

Query  1155  TAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKE  976
              AY FLI+LY    NL EV R+W SL++AF    N SYL M+Q L  L D+ G  KCFKE
Sbjct  282   EAYHFLISLYAGTSNLKEVNRVWESLKVAFNTPTNFSYLVMLQALHRLKDVEGLLKCFKE  341

Query  975   WESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGE  796
             W+SG ++YD R+A A + A  +  +L++A  L   A +   +P  K  E+F+ Y+LK GE
Sbjct  342   WKSGCSSYDERLAKAAVSACLEHDMLEEASSLFDEAIQRSNRPFFKGREVFMLYFLKKGE  401

Query  795   ISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLG  616
             +  A++ +  A    R +G++W P  VI+   ++HFE  KD++ A      LK   + +G
Sbjct  402   VDLAIEHL--AAVIARTEGEEWRPDAVIMDAFLKHFEETKDIDSANNFYELLK---NEMG  456

Query  615   AELLES--LIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
              +++ S  L++TY AAG+T+  +R  ++ ++  + +E + L + ++ +
Sbjct  457   VKVIASKVLLKTYIAAGRTAPEIREMLERDDITMDDELRNLCEKVAHD  504



>ref|XP_002277733.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial [Vitis vinifera]
 emb|CBI39600.3| unnamed protein product [Vitis vinifera]
Length=498

 Score =   341 bits (874),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 188/466 (40%), Positives = 293/466 (63%), Gaps = 2/466 (0%)
 Frame = -2

Query  1884  EEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM  1705
             E +LY KL    G E    + L++++K  KS  ++++   V  LR+ K Y  A ++ E M
Sbjct  32    EASLYWKLSALRGTEGDVAETLDKWVKEGKSVKRFDMISCVNQLRRFKKYKHAAQIYEWM  91

Query  1704  EKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
             EK   +   +D+ I +DL+AK++GIA AE YF +L E++K + TYGALLNCYCKE M +K
Sbjct  92    EKSKNDLNNADRAIRIDLLAKTEGIAQAENYFNSLQESAKTNKTYGALLNCYCKENMLDK  151

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             A  L +K+KELN   +++ YN++++LY R GQPEK+P+++ E++E DI  D +TYN+ M 
Sbjct  152   AVELFKKLKELNFVSSALSYNNMISLYLRVGQPEKVPSLVHEMEEKDIPADLYTYNLLMN  211

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             + A++ D   VE+V+D+MK+ G V  DW TY NLA+IY DAG + KA  AL++LE+    
Sbjct  212   SYASVKDFEAVEQVLDKMKKRG-VERDWFTYGNLANIYVDAGHTKKANYALQKLEQNKNL  270

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
              +  A++ LI LY R  NL  V R W SL+LA PK  N SYL M+  L  L D+ G EKC
Sbjct  271   HDPEAFRMLINLYARTSNLEGVNRAWESLKLAHPKINNKSYLIMLLALSKLGDVAGLEKC  330

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             FKEWESG +TYD+R++N ++ +Y  + ++++A  L +   + G +   KT ++F+ +YLK
Sbjct  331   FKEWESGCSTYDVRLSNVMLESYLNREIIEEANLLSESIAKRGPELKLKTLDLFMKFYLK  390

Query  804   NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSED  625
               ++  A+  ++   +    +  KW P+   +   + +FE  KDV+ AE+    ++K   
Sbjct  391   KHQLDLAMKYLDMGASKADPENNKWFPTEETITMFLEYFEEVKDVDSAEKFCETMRKI-S  449

Query  624   HLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
              L +++ +SL+RTY AAGK   +M  R+K +  E+S E +KLL  +
Sbjct  450   RLDSKIYDSLLRTYIAAGKEEPLMSERMKDDGIEISSETEKLLQKV  495



>ref|XP_009757638.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Nicotiana sylvestris]
Length=413

 Score =   337 bits (863),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 187/410 (46%), Positives = 270/410 (66%), Gaps = 3/410 (1%)
 Frame = -2

Query  1725  IKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYC  1546
             +++ E MEKRG+N +  D G+ +DL+AK +G+ AAE YF +L  + +N  TYGALLNCYC
Sbjct  1     MQIMEWMEKRGINLSFGDYGVRLDLIAKVQGVTAAENYFGSLSPSMQNQSTYGALLNCYC  60

Query  1545  KELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSF  1366
              E MT+KA +L EKM + N T  S+ +N+LM+LY R GQPEK+  ++QE+K   +   +F
Sbjct  61    VEKMTDKALSLFEKMDQFNFTSKSLAFNNLMSLYMRLGQPEKVAPLVQEMKSRKVPLCTF  120

Query  1365  TYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalke  1186
             TYNI M + + LGDI  VERV +E+K++     DWTTYSNLA  Y  AGL DKAE ALK+
Sbjct  121   TYNILMNSYSCLGDIEEVERVFEEIKQENAKECDWTTYSNLAVTYVKAGLRDKAELALKK  180

Query  1185  lekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLND  1006
             LE++  PRN  AY +LI+L+  I NL EVYRIW SL+  F  T N SYL M+Q L  LND
Sbjct  181   LEEEMGPRNREAYHYLISLHSGISNLHEVYRIWNSLKSHFSITTNSSYLVMLQSLGKLND  240

Query  1005  MPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEI  826
             +   +KC+KEWES  ++YD+R+AN++IGAY +  LL  A+E+ + A +    P    WE+
Sbjct  241   IDDLKKCYKEWESCCSSYDMRLANSVIGAYLRHDLLHDAEEVFRHALKRSQGPFFLAWEM  300

Query  825   FLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLG  646
             F+ ++L+N +I+ A+ C+E A    R    +W P   ++ +   +F  ++DV+GAE    
Sbjct  301   FMAFFLRNHQINLAMKCMEAA--ASRVKKNEWQPKYEMINKFFEYFVEERDVDGAEEFYK  358

Query  645   NLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
              LKK  + L +++  SL+RTY AA +T+  M  R+K +  E+S E ++LL
Sbjct  359   YLKKL-NCLSSDVYSSLLRTYIAANRTAEDMLLRIKEDGIEMSCELEELL  407



>emb|CAN71816.1| hypothetical protein VITISV_023421 [Vitis vinifera]
Length=494

 Score =   339 bits (869),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 187/466 (40%), Positives = 293/466 (63%), Gaps = 2/466 (0%)
 Frame = -2

Query  1884  EEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM  1705
             E +LY KL    G E    + L++++K  KS  ++++   V  LR+ K Y  A ++ E M
Sbjct  28    EASLYWKLSALRGTEGDVAETLDKWVKEGKSVKRFDMISCVNQLRRFKKYKHAAQIYEWM  87

Query  1704  EKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
             EK   +   +D+ I +DL+AK++GIA AE YF +L E++K + TYGALLNCYCKE M +K
Sbjct  88    EKSKNDLNNADRAIRIDLLAKTEGIAQAENYFNSLQESAKTNKTYGALLNCYCKENMVDK  147

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             A  L +K+KELN   +++ YN++++LY R GQPEK+P+++ E++E DI  D +TYN+ M 
Sbjct  148   AVELFKKLKELNFVSSALSYNNMISLYLRVGQPEKVPSLVHEMEEKDIPADLYTYNLLMN  207

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             + A++ D   VE+V+++MK+ G V  DW TY NLA+IY DAG + KA  AL++LE+    
Sbjct  208   SYASVKDFEAVEQVLEKMKKRG-VERDWFTYGNLANIYVDAGHTKKANYALQKLEQNKNL  266

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
              +  A++ LI LY R  NL  V R W SL+LA PK  N SYL M+  L  L D+ G EKC
Sbjct  267   HDPEAFRMLINLYARTSNLEGVNRAWESLKLAHPKINNKSYLIMLLALSKLGDVAGLEKC  326

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             FKEWESG +TYD+R++N ++ +Y  + ++++A  L +   + G +   KT ++F+ +YLK
Sbjct  327   FKEWESGCSTYDVRLSNVMLESYLNREMIEEANLLSESIAKRGPELKLKTLDLFMKFYLK  386

Query  804   NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSED  625
               ++  A+  ++   +    +  KW P+   +   + +FE  KDV+ AE+    ++K   
Sbjct  387   KHQLDLAMKYLDMGASKADPENNKWFPTEETITMFLEYFEEVKDVDSAEKFCETMRKI-S  445

Query  624   HLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
              L +++ +SL+RTY AAGK   +M  R+K +  E+S E +KLL  +
Sbjct  446   RLDSKIYDSLLRTYIAAGKEEPLMSERMKDDGIEISSETEKLLQKV  491



>ref|XP_006840468.1| hypothetical protein AMTR_s00045p00181820 [Amborella trichopoda]
 gb|ERN02143.1| hypothetical protein AMTR_s00045p00181820 [Amborella trichopoda]
Length=479

 Score =   338 bits (866),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 183/427 (43%), Positives = 280/427 (66%), Gaps = 3/427 (1%)
 Frame = -2

Query  1914  IGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLY  1735
             +   S K+   + LYR+L   G    SAG+ L  ++   K+  KWE+ R +K LR+ K +
Sbjct  46    VATASKKQSKGKTLYRRLSALGDSSKSAGQELTRWVGEGKAVKKWEIERIIKELRKFKRF  105

Query  1734  SPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLN  1555
               A++LSE M+KRGMN +  D  I VDL++K++G+ +AE+YF  LP ++KN ++YGALLN
Sbjct  106   HHALELSEWMDKRGMNLSYGDYAIRVDLLSKTRGLESAESYFTGLPHSAKNQYSYGALLN  165

Query  1554  CYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMP  1375
             CYCK+ +TEKAEAL  KMKELN  LT + YN++MTLY  TG PE++P+++Q++KE    P
Sbjct  166   CYCKDKLTEKAEALFSKMKELNTNLT-LAYNNMMTLYITTGHPEQVPSLLQDMKENGKKP  224

Query  1374  DSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaeka  1195
             D+FT NI M + A + D+ GVERV++EM + G +  DWTT++NLA+I+  AGL DKA   
Sbjct  225   DTFTCNILMNSYALMKDMEGVERVVNEMIKTGEIISDWTTHTNLAAIFIQAGLFDKANAT  284

Query  1194  lkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVN  1015
             LK +E+K+  R   AY FLITLY   GNL EV+RIW+ L+ AF KT N+SYL M+Q L  
Sbjct  285   LKLVEEKHMVRCRIAYHFLITLYAGTGNLAEVHRIWQQLKSAFSKTTNLSYLVMLQALAR  344

Query  1014  LNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKT  835
             L+D+   ++ F EWE   ++YD+R+ N L+G Y ++ ++++A+ +++ A + G + N KT
Sbjct  345   LDDLGATKELFNEWEKNCSSYDMRLTNVLLGVYLRRDMIQEAEAVKEEATKRG-ELNCKT  403

Query  834   WEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAER  655
               +F+++YLKN +   A+  + K I        +       +   +++ + K+DV GA+ 
Sbjct  404   LVMFMEWYLKNSDTGLALSYL-KGIALKSHYRVELRTKQEELQAFVKYIKEKEDVTGAKE  462

Query  654   VLGNLKK  634
             +L  L+K
Sbjct  463   LLQTLEK  469



>gb|EYU46819.1| hypothetical protein MIMGU_mgv1a004991mg [Erythranthe guttata]
Length=501

 Score =   338 bits (867),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 191/492 (39%), Positives = 297/492 (60%), Gaps = 3/492 (1%)
 Frame = -2

Query  1953  ASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEV  1774
             ++ ++ FS+  K     +     E+ LYR+L   G  + +    +NE+++  +S  K+E+
Sbjct  13    SALVREFSTAVKAEASAAATAGQEDRLYRRLSALGNKKGTVASTINEYIREGRSVSKFEL  72

Query  1773  GRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPE  1594
                +K LR+ K ++ A+++ + M+ R  N    D  + +DL+AK++GIAAAE YF  L  
Sbjct  73    EACIKQLRKYKRFNHALEIMDWMDVRKFNFGHKDYAVRLDLIAKAQGIAAAENYFSGLSP  132

Query  1593  TSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIP  1414
             + K H TYG+LLNCYC E MT+KA  L   M + N+  T +P N+LM+LY R GQPEK+P
Sbjct  133   SVKVHCTYGSLLNCYCTEKMTDKALDLFATMVKENMVSTPLPLNNLMSLYIRLGQPEKVP  192

Query  1413  AIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASI  1234
              + +E+K+ +I PD+F+YN+ M + + L DI G ERV +EMKR+     +WTTYSNLA +
Sbjct  193   ILAEEMKKRNIQPDTFSYNLLMNSYSLLNDIEGAERVFEEMKRENAKQCNWTTYSNLAIL  252

Query  1233  YADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTA  1054
             Y   G  +KA  AL+ LEK+  P +  AY FLITLY  I +L  V+RIW++L+       
Sbjct  253   YTRVGYKEKAALALQNLEKEMRPNDREAYHFLITLYAGISDLHNVHRIWKALKSTMRVVT  312

Query  1053  NISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrk  874
             N SY+ M+Q L NL D+ G +KCF+EWE G + YD+R+AN  IGAY  QG+L++A+   +
Sbjct  313   NNSYIIMLQSLRNLEDIKGVKKCFEEWELGCSNYDVRLANTAIGAYLTQGMLEEAESTLQ  372

Query  873   rAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMR  694
              A      P    WE+F+ ++LK  +I  A++ ++  I T R    +W P      + + 
Sbjct  373   NAVSRSRGPFFTAWEMFVIFFLKKNQIKQALEIMD--IATSRVREGEWRPKSDTTEKFLD  430

Query  693   HFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSE  514
             +F+ + DV+GAE     L K  + +  +LL+ L++TY AAGKT   MR R++ +  + ++
Sbjct  431   YFKKEGDVDGAEEFY-KLMKRINCIDRDLLKMLLQTYVAAGKTQLDMRARIEEDGIKTNK  489

Query  513   EAKKLLDVISAE  478
             E + LL  +  E
Sbjct  490   ELEDLLATVCPE  501



>ref|XP_009349931.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial [Pyrus x bretschneideri]
Length=511

 Score =   338 bits (868),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 197/466 (42%), Positives = 288/466 (62%), Gaps = 4/466 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LYR+L   G    S  K LN+++   K   K+E+ + +K LR+ + Y  A+++ E ME R
Sbjct  44    LYRRLSALGATGESVAKTLNQYVMEGKMVRKFELEKCIKELRKYRKYQHALEIMEWMEFR  103

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
              MN + +D  I VDL++K KGI AAE YF  LPE+SK+ FTYGALLNCYCKELM EKA A
Sbjct  104   KMNYSKADYAIRVDLMSKVKGIGAAEDYFSGLPESSKDRFTYGALLNCYCKELMEEKALA  163

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
               E M ELN   +++ +N+LM+L+ R   PEK+  ++QE+K+ ++  D+FTYNIWM++ A
Sbjct  164   HFETMDELNFASSTLVFNNLMSLHMRKQNPEKVDPLVQEMKKRNLPLDTFTYNIWMQSYA  223

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP-RN  1159
              L D  GV+RV+ EM+        W+TYSNLA+IY  A L DKAE+ALK+ E+   P + 
Sbjct  224   GLNDFEGVKRVLAEMETQDEEKCSWSTYSNLAAIYIKAELFDKAEQALKKSEEMMKPLKQ  283

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
                Y FLI+LY    NL EV R+W+ L+ +FP T NISYL M+Q L  LND+ G +  F+
Sbjct  284   REPYHFLISLYACTSNLGEVKRVWKMLKKSFPATNNISYLVMLQALCKLNDIEGLKDLFE  343

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWES   +YD+R+AN  I  Y  QG+ ++A+ +   A +       K  E+ + + L   
Sbjct  344   EWESICFSYDMRLANVAIRGYLSQGMHEEAELVFTNACKKTKGSFMKAREMLMVHALNTR  403

Query  798   EISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHL  619
             ++  AV  +E A++  +   ++W P P      +++FE +K V+GAE+    LK+    L
Sbjct  404   KVDLAVSHLEAAVSESK--NEEWHPFPDTRIAFLKYFEEEKIVDGAEKFCQILKRL-GCL  460

Query  618   GAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISA  481
             G      L++TY AAGK+   MR R+K ++ E+S E + LL+ +SA
Sbjct  461   GCNEYYLLLKTYIAAGKSDPEMRHRLKEDHIEISPELENLLEKVSA  506



>ref|XP_003632411.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g02370, mitochondrial [Vitis vinifera]
Length=506

 Score =   338 bits (867),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 194/466 (42%), Positives = 294/466 (63%), Gaps = 5/466 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LY +L   G    S    LNE +K  K   K E+   +K LR+ + +  A+++ + ME R
Sbjct  46    LYHRLSALGATGGSVADTLNEHIKEGKLIAKHELSSCIKQLRKYRQFQHALEIMDWMENR  105

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
              +  + +D  + +DL++K+KG+A AE YF NL  ++KN  TYG LLNCYCKE M EKA A
Sbjct  106   KIFFSYADYAVRLDLLSKTKGLATAEEYFNNLSPSAKNLLTYGTLLNCYCKEKMEEKALA  165

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
             L EKM ELN   TS+ +N+LM+L+ R G+PE +P ++ E+K+  I PD+FTYNI M++ A
Sbjct  166   LFEKMDELNFASTSLTFNNLMSLHMRLGKPEMVPPLVDEMKKRSISPDTFTYNILMQSYA  225

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNL  1156
              L DI G ERV++E+KR+      WTTYSNLA++Y +A L +KAE ALK+LE++    + 
Sbjct  226   RLNDIEGAERVLEEIKRENEDKLSWTTYSNLAAVYVNARLFEKAELALKKLEEEMGFHDR  285

Query  1155  TAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKE  976
              AY FLI+LY  I NL EV R+W SL+ AFPKT N+SY  M+Q L NLND+ G + CF+E
Sbjct  286   LAYHFLISLYAGINNLSEVNRVWNSLKSAFPKTNNMSYFIMLQALANLNDVDGLKICFEE  345

Query  975   WESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGE  796
             W+S   ++D+R+AN  + A+    ++K A+ +   A +  + P     ++F+ ++LK  E
Sbjct  346   WKSSCFSFDVRLANVAVRAFLGWDMIKDAESILYEAVKRSSGPFYTALDMFMAHHLKVRE  405

Query  795   ISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLG  616
             I +A+  +E A +  + +  +W P+P  V   +++FE +KDVEGAE+    LK     L 
Sbjct  406   IDTALKYMEAAASEVKNN--EWQPAPERVLAFLKYFEEEKDVEGAEKFCKILKNISG-LD  462

Query  615   AELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
             +   + L++T  AAG+T   MR+R+K ++ E+  ++K LL  +  E
Sbjct  463   SNAYQLLLQTXVAAGRTEPEMRKRMKEDDIEV--DSKDLLQRVGPE  506



>ref|XP_008381422.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Malus domestica]
Length=505

 Score =   338 bits (866),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 196/466 (42%), Positives = 287/466 (62%), Gaps = 4/466 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LYR+L   G    S  K LN+++   K   K+E+ + +K LR+ + Y  A+++ E ME R
Sbjct  38    LYRRLSALGATGESVAKTLNQYVMEGKMVRKFELEKCIKELRKYRKYQHALEIMEWMEFR  97

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
              MN + +D  I VDL++K KGI AAE YF  LPE+SK+ FTYGALLNCYCKELM EKA A
Sbjct  98    KMNYSKADYAIRVDLMSKVKGIGAAEDYFSGLPESSKDRFTYGALLNCYCKELMEEKALA  157

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
               E M ELN   +++ +N+LM+L+ R   PEK+  ++QE+K+ ++  D+FTYNIWM++ A
Sbjct  158   HFETMDELNFASSTLVFNNLMSLHMRKQNPEKVGPLVQEMKKRNLPLDTFTYNIWMQSYA  217

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP-RN  1159
             AL D   V RV++EM+        W+TYSNLA+IY  A L DKAE+ALK+ E+   P + 
Sbjct  218   ALXDFEXVXRVLEEMETQDEEKCSWSTYSNLAAIYIKAELFDKAEQALKKSEEMMKPLKQ  277

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
                Y FLI+LY    NL EV R+W++L+ +FP T NISYL M+Q L  LND+ G +  F+
Sbjct  278   RAPYHFLISLYACTSNLGEVKRVWKTLKKSFPATNNISYLVMLQALCKLNDIEGLKDLFE  337

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWES   ++DIR+AN  I  Y  QG+  +A+ +   A +       K  E+ + + L   
Sbjct  338   EWESICISFDIRLANVAIRGYLSQGMHDEAELVFTNASKKTKGSFMKAREMLMVHALNTR  397

Query  798   EISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHL  619
             +   AV  +E A++  +   ++W P P      +++FE +K V+GAE+    LK+    L
Sbjct  398   KXDLAVSHLEAAVSESK--NEEWHPFPDTRIAFLKYFEEEKXVDGAEKFCQILKRL-GCL  454

Query  618   GAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISA  481
                    L++TY AAGK+   MR+R+K ++ E+S E + LL+ +SA
Sbjct  455   SCNEYYVLLKTYIAAGKSDPEMRQRLKEDHXEISPELENLLEKVSA  500



>ref|XP_011079543.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Sesamum indicum]
Length=500

 Score =   336 bits (861),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 190/495 (38%), Positives = 302/495 (61%), Gaps = 6/495 (1%)
 Frame = -2

Query  1962  TKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYK  1783
             T  +SF++  S++ K    +  +   E++LYR+L K G  E +    +NE+++  +   K
Sbjct  12    TGASSFVRWLSTEAKPAAAQLQQ---EDSLYRRLSKLGRNEGAVASTINEYIREGRPVKK  68

Query  1782  WEVGRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFIN  1603
             +E+   VK LR+ K YS A+++ E ME R  N    D  + +DL+ K++G+AAAE YF  
Sbjct  69    FELDLCVKELRKYKRYSHALEIIEWMEARKFNFGHKDCAVRLDLIGKARGLAAAENYFSG  128

Query  1602  LPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPE  1423
             L  ++K   TYG+LLNCYCK  MT+KA  L  KM + N+   ++P+N++M+L+ R+GQPE
Sbjct  129   LSPSAKVPCTYGSLLNCYCKVKMTDKALNLFSKMLKENMISKALPFNNIMSLFMRSGQPE  188

Query  1422  KIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNL  1243
             K+ ++ +E+K+ +I PD+FTYN+ M + + L DI GVERV +EMK++     +WTTYSN+
Sbjct  189   KVASLAEEMKKMNIKPDTFTYNLLMNSHSCLNDIEGVERVFEEMKQENEKQCNWTTYSNM  248

Query  1242  ASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFP  1063
             A +Y   G  +KA  ALK LEK  + ++  AY FLI+LY  + +L  V+RIW+SL+ +  
Sbjct  249   AVLYNRGGHREKAVLALKNLEKAMSLKDREAYHFLISLYAGLSDLHNVHRIWKSLKSSMR  308

Query  1062  KTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkake  883
                N+SYL M+Q L NLND+ G +KC++EW S  ++YDIR+A   IGAY    +L +A+ 
Sbjct  309   TVTNMSYLIMLQALSNLNDISGMKKCYEEWRSVCSSYDIRLAKVAIGAYLAHDMLGEAES  368

Query  882   lrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGE  703
             + + A      P  K WE F+ ++LK  +I  A+  +E  I T      +W P    +  
Sbjct  369   VLQDALERSNGPFFKAWETFMIFFLKKHQIQQALQFME--IATSEACDNEWRPRCDTIDG  426

Query  702   LMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAE  523
              + HF+ + DV  AE     +K+  + + + + ESL++TY AAG+T + MR R++ +  E
Sbjct  427   FLNHFKEQGDVTSAEEFYQFMKRI-NCVDSRVYESLLQTYVAAGRTLSDMRARIEGDRVE  485

Query  522   LSEEAKKLLDVISAE  478
             +S + + LL  +  E
Sbjct  486   ISSKLQDLLASVCPE  500



>ref|XP_004146883.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Cucumis sativus]
 ref|XP_004166436.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Cucumis sativus]
Length=474

 Score =   332 bits (850),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 186/474 (39%), Positives = 282/474 (59%), Gaps = 12/474 (3%)
 Frame = -2

Query  1884  EEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM  1705
             +  LY +L   G    S  K +N+F+       K+E+ + +K LR+ + Y   +++ E M
Sbjct  8     QRGLYPRLSALGATGGSVAKTINQFIMEGNIVKKYELEKCIKELRKYRRYHHCLQIMEWM  67

Query  1704  EKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
             E R +N + +D  + +DL++K  G+ AAE YF +LP ++KN  TYGALLNCYCKE+M EK
Sbjct  68    ETRKINYSFTDYALRLDLISKVNGVTAAEKYFYDLPPSAKNRCTYGALLNCYCKEMMEEK  127

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             A  L +KM EL ++ TS+ +N+LMT+Y R   PEK+P +I E+K+      +FTYN+WM 
Sbjct  128   ALTLFKKMDELKIS-TSLSFNNLMTMYMRMDHPEKVPPLIGEMKQRGFYLTTFTYNVWMN  186

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDka--ekalkelekKN  1171
             + A+L DI  VE +++EMK + R   DWTTYSNLAS Y  AG  +KA       E E K+
Sbjct  187   SCASLNDIGKVEEILEEMKMEDRNKFDWTTYSNLASFYVKAGQFEKAELALKKLEEEMKS  246

Query  1170  TPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAE  991
                +   Y  LI+LY    NL EV RIW +L+  +    NISYL M+Q L  L D+ G +
Sbjct  247   DKNDRLVYHCLISLYASTSNLSEVNRIWNALKSVYSTMTNISYLVMLQALRKLKDIEGLK  306

Query  990   KCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYY  811
             + +KEWES    +D+R+ N +IGAY +Q + + A  + + A +    P ++  E+F+ Y+
Sbjct  307   RTYKEWESNCRNFDLRIVNDIIGAYLQQDMYEDAAMIFEDATKRSKGPFSRAREMFMVYF  366

Query  810   LKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAE---RVLGNL  640
             LK  ++ SA   +E A++  +   ++W PS       + +FE +KDVEGAE   R+L  L
Sbjct  367   LKLKQVDSAFSHLESALSESK--EKEWHPSLATTTAFLNYFEEEKDVEGAEDFARILKRL  424

Query  639   KKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
             K     L A     L++TY AAGK +  MR+R+K ++ E+S E ++LL  +  +
Sbjct  425   K----CLDASGYHLLLKTYVAAGKLAPDMRKRLKEDDIEISSELEELLGTVCPQ  474



>ref|XP_007221478.1| hypothetical protein PRUPE_ppa005037mg [Prunus persica]
 gb|EMJ22677.1| hypothetical protein PRUPE_ppa005037mg [Prunus persica]
Length=480

 Score =   332 bits (850),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 188/430 (44%), Positives = 266/430 (62%), Gaps = 5/430 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LYR+L   G    S  K LN+++   K   K+E+ R +K LR+ + +  A+++ E ME R
Sbjct  38    LYRRLSALGATGGSVAKTLNQYIMEGKMLKKYELERCIKELRKYRKFQHALEIMEWMEFR  97

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
              MN + +D  I +DL +K KGI AAE YF  L  + K+ FTYGALLNCYCKELM EKA A
Sbjct  98    KMNYSKADFAIRLDLTSKVKGIEAAEDYFSGLSPSLKDRFTYGALLNCYCKELMEEKALA  157

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
             L E M EL    +S+ +N+LM+++ R  QPEK+  ++QE+K+ +I  D+FTYNIWM++ A
Sbjct  158   LYETMDELEFASSSLVFNNLMSMHMRKQQPEKVAPLVQEMKQRNIPLDTFTYNIWMQSFA  217

Query  1335  ALGDISGVERVIDEM-KRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP-R  1162
             +L D  G ERV+DEM K+DG     W+TYSNLA+IY  A + DKAE ALK+ E+   P +
Sbjct  218   SLNDFEGAERVLDEMQKQDGNQC-SWSTYSNLAAIYVKAKIFDKAELALKKSEEMMKPLK  276

Query  1161  NLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCF  982
                 Y FLI+LY    NL EV R+W SL+ AFP T N+SYL M+Q L  LND+ G ++CF
Sbjct  277   QRNTYHFLISLYACTSNLGEVKRVWESLKKAFPATNNMSYLIMLQALCKLNDIEGLKECF  336

Query  981   KEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKN  802
             +EWE   ++YD+R+AN  I  Y  Q + ++A  +   A +    P  K  E+F+ Y+LKN
Sbjct  337   EEWECKCSSYDMRLANTAIRGYLSQDMYEEAALVFADACKRTKGPFFKAREMFMLYFLKN  396

Query  801   GEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDH  622
              ++  AV  +  A++    DG+ W PSP       ++FE +KDVE AE     LK+    
Sbjct  397   CQVDLAVSYLGAAVSET-ADGE-WHPSPDTTSAFFKYFEEEKDVESAENFCKILKRLNCL  454

Query  621   LGAELLESLI  592
                E ++ L+
Sbjct  455   CSNEYIQRLL  464



>gb|KGN53198.1| Pentatricopeptide repeat-containing protein [Cucumis sativus]
Length=498

 Score =   331 bits (849),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 186/474 (39%), Positives = 282/474 (59%), Gaps = 12/474 (3%)
 Frame = -2

Query  1884  EEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM  1705
             +  LY +L   G    S  K +N+F+       K+E+ + +K LR+ + Y   +++ E M
Sbjct  32    QRGLYPRLSALGATGGSVAKTINQFIMEGNIVKKYELEKCIKELRKYRRYHHCLQIMEWM  91

Query  1704  EKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
             E R +N + +D  + +DL++K  G+ AAE YF +LP ++KN  TYGALLNCYCKE+M EK
Sbjct  92    ETRKINYSFTDYALRLDLISKVNGVTAAEKYFYDLPPSAKNRCTYGALLNCYCKEMMEEK  151

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             A  L +KM EL ++ TS+ +N+LMT+Y R   PEK+P +I E+K+      +FTYN+WM 
Sbjct  152   ALTLFKKMDELKIS-TSLSFNNLMTMYMRMDHPEKVPPLIGEMKQRGFYLTTFTYNVWMN  210

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDka--ekalkelekKN  1171
             + A+L DI  VE +++EMK + R   DWTTYSNLAS Y  AG  +KA       E E K+
Sbjct  211   SCASLNDIGKVEEILEEMKMEDRNKFDWTTYSNLASFYVKAGQFEKAELALKKLEEEMKS  270

Query  1170  TPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAE  991
                +   Y  LI+LY    NL EV RIW +L+  +    NISYL M+Q L  L D+ G +
Sbjct  271   DKNDRLVYHCLISLYASTSNLSEVNRIWNALKSVYSTMTNISYLVMLQALRKLKDIEGLK  330

Query  990   KCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYY  811
             + +KEWES    +D+R+ N +IGAY +Q + + A  + + A +    P ++  E+F+ Y+
Sbjct  331   RTYKEWESNCRNFDLRIVNDIIGAYLQQDMYEDAAMIFEDATKRSKGPFSRAREMFMVYF  390

Query  810   LKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAE---RVLGNL  640
             LK  ++ SA   +E A++  +   ++W PS       + +FE +KDVEGAE   R+L  L
Sbjct  391   LKLKQVDSAFSHLESALSESK--EKEWHPSLATTTAFLNYFEEEKDVEGAEDFARILKRL  448

Query  639   KKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
             K     L A     L++TY AAGK +  MR+R+K ++ E+S E ++LL  +  +
Sbjct  449   K----CLDASGYHLLLKTYVAAGKLAPDMRKRLKEDDIEISSELEELLGTVCPQ  498



>gb|KDP28274.1| hypothetical protein JCGZ_14045 [Jatropha curcas]
Length=505

 Score =   330 bits (846),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 191/465 (41%), Positives = 287/465 (62%), Gaps = 3/465 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LY +L   G    S    LNE++    +  K E+ R +K LR+ + +  A+++ E MEKR
Sbjct  43    LYPRLSALGAKGGSVSMTLNEYVMEGNTIRKAELTRCIKELRKYQRFDHALEIMEWMEKR  102

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
              MN + ++  I +DL+AK+KG++AAE+YF +L   +K   TYGALLNCY K LM +KA  
Sbjct  103   KMNFSRAEYAIKLDLIAKTKGVSAAESYFSSLSPNAKTRSTYGALLNCYTKGLMPDKALD  162

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
             L EK+  +NL  TS+P+N+LM+LY R GQPEK+PA++ ++K  +I P SF+YNIWM++  
Sbjct  163   LFEKLDAMNLLSTSLPFNNLMSLYMRLGQPEKVPALVHDMKRRNIHPCSFSYNIWMQSYG  222

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNL  1156
              L D  GVERV+ E+++DG     W TYSN+A+IY  AGL +KAE ALK+LE K   RN 
Sbjct  223   CLNDFEGVERVLAEIEKDGEDNCKWNTYSNVATIYLKAGLFEKAESALKKLELKMGIRNR  282

Query  1155  TAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKE  976
              AY FLI++Y    NL EV R+W SL+ +F    N SYL M+Q L  L D+ G  K FKE
Sbjct  283   EAYHFLISIYSGTQNLNEVNRVWNSLKKSFTTVTNTSYLVMLQALAKLKDVDGIAKLFKE  342

Query  975   WESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGE  796
             WES  ++YD+R+AN  I AY +Q + ++A+ +   A +    P  K  E+F+ ++LK  E
Sbjct  343   WESSCSSYDMRLANTAIKAYLEQDMYEEAELIFDGALKRAKGPFFKVREMFMVFFLKINE  402

Query  795   ISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLG  616
             +  A++ ++ A +    +  +W P    V     +F  +KD++GAE+    LK   + L 
Sbjct  403   LDLALEHMKVAFS--ETEEYQWKPKAETVSAFFSYFCEEKDIDGAEKFCKILKHI-NCLD  459

Query  615   AELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISA  481
             +     L++TY AA + +  MR+R++ +N ++S E + LL+  S 
Sbjct  460   SNAYSLLLQTYIAADRLAPDMRKRLEEDNIQISHELEDLLERTSC  504



>ref|XP_010480914.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial [Camelina sativa]
Length=523

 Score =   330 bits (846),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 191/464 (41%), Positives = 279/464 (60%), Gaps = 2/464 (0%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LY+KL K      S    LN+F+    +  K ++ R  K LR+ + +  A+++ + MEKR
Sbjct  59    LYKKLSKLNVTGGSVADTLNQFIMEGITVRKDDLFRCAKDLRKFRRHQHALEIFDWMEKR  118

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH-FTYGALLNCYCKELMTEKAE  1519
              M  + SD  I +DL+AK+KG+ AAE Y  +L  ++K H  TYGAL+NCYC EL  EKA+
Sbjct  119   KMTLSVSDHAIRLDLIAKTKGLEAAENYLNSLDTSAKIHQSTYGALMNCYCVELEEEKAK  178

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
             A  EKM EL     S+P+N+LM++Y R GQPEK+P ++  +K+ DI P   TY+IWM++ 
Sbjct  179   AHFEKMDELKFVNNSLPFNNLMSMYMRLGQPEKVPVLVDAMKQRDISPSGVTYSIWMQSC  238

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
              +L D+ G+E+VIDEM +D      W T+SNLA+IY  AGL +KAE ALK +E+K  P N
Sbjct  239   GSLNDLDGLEKVIDEMGKDSEAKTTWNTFSNLAAIYTKAGLYEKAELALKSMEEKMNPNN  298

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
               +Y FLI+LY  I    EVYR+W SL+ A P+  N+SYL M+Q +  L D+ G +K F 
Sbjct  299   RDSYHFLISLYAGISKAPEVYRVWESLQEARPEVNNLSYLVMLQAMSKLGDIDGIKKIFT  358

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWES    YD+R+AN  I  Y K  + ++A+++   A +    P +K+ ++ + + L+ G
Sbjct  359   EWESKCWAYDMRLANIAINTYLKVNMYEEAEQILDGAMKKSNGPFSKSRQLLMIHLLEKG  418

Query  798   EISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHL  619
             +   A+  +E A++    +  +W  S  +V     HFE  KDV+GAE     L K    L
Sbjct  419   KADLAMKHLEAAVSDSAENKDEWSWSSELVSLFYLHFEKAKDVQGAEEFCRVLSKWRP-L  477

Query  618   GAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
              +E    LI+TYAAA KT   MR R+     E+SEE + LL+ +
Sbjct  478   DSETATFLIKTYAAAEKTCPDMRERLSRHQIEVSEEIQDLLETV  521



>ref|XP_009589051.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=501

 Score =   329 bits (843),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 189/466 (41%), Positives = 286/466 (61%), Gaps = 3/466 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LY +L        S  + +NE+++  +   K+E+ + +K LR+ + Y  A+++ + ME+R
Sbjct  39    LYLRLWALEATNGSVSETINEYIREGRVVKKYELNKCIKELRKHRRYQHALEIMDWMERR  98

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
             G+  +  D G+ +DL+AK +GI AAE YF +L  + +   TYGALL+CYC E MT+KA +
Sbjct  99    GIKLSFGDYGVRLDLIAKVQGITAAENYFGSLSPSMQIQSTYGALLHCYCVEKMTDKALS  158

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
             L EKM +LN    S P+N+LM+LY R GQPEK+P ++QE+K   +   +F+Y+  M + +
Sbjct  159   LFEKMDQLNFASNSWPFNNLMSLYMRLGQPEKVPPLVQEMKSRKVPLCTFSYSSLMNSYS  218

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNL  1156
              L DI GVERV +E+K++     DWT YSNLA  Y  AGL DKAE ALK+LE++  PRN 
Sbjct  219   CLDDIEGVERVFEEIKQENVEECDWTIYSNLAVAYVKAGLHDKAELALKKLEEEMGPRNR  278

Query  1155  TAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKE  976
              AY +LI+L+  I NLVEVYRIW SL+  F +  N SYL M Q L  LNDM G +KC++E
Sbjct  279   EAYHYLISLHAGISNLVEVYRIWNSLKSGFLEITNSSYLVMFQSLSKLNDMDGLKKCYEE  338

Query  975   WESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGE  796
             WES   +Y +R+ N +I A  +  +L  A+EL  RA +    P    WE+F+ ++L++  
Sbjct  339   WESSCPSYTMRLPNNVISACLRNDMLHDAEELFLRALKRSQGPFFLAWEMFIAFFLRHRR  398

Query  795   ISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLG  616
             I  A++C+E  +   + +  +W P    + + + +F  ++DV GAE     LKK  + L 
Sbjct  399   IDLAMECLEAVVFLVKEN--EWQPKCETINKFLEYFVEERDVGGAEEFYKYLKKL-NCLS  455

Query  615   AELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
             + +  SL+ TY AA +T+  M  R+K +  E+S E + LL  +  E
Sbjct  456   SGIYSSLLHTYIAANRTADDMLVRIKEDGIEMSCELEGLLKRVCPE  501



>ref|XP_009757637.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Nicotiana sylvestris]
Length=501

 Score =   329 bits (843),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 187/466 (40%), Positives = 285/466 (61%), Gaps = 3/466 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LY +L        S  + +NE++   +   K+E+ + +K LR+ + Y  A+++ + ME+R
Sbjct  39    LYLRLWALEATNGSVSETINEYIGKGRVLKKYELNKCIKELRKHRRYQHALEIMDWMERR  98

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
             G+  +  D G+ +DL+AK +GI AAE YF +L  + +   TYGALL+CYC E MT+KA +
Sbjct  99    GIKLSFGDYGVRLDLIAKVQGITAAENYFGSLSPSMQIQSTYGALLHCYCVEKMTDKALS  158

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
             L EKM +LN    S  +N+LM+LY R GQPEK+P ++QE+K   +   +F+Y+I M + +
Sbjct  159   LFEKMDQLNFASNSWQFNNLMSLYMRLGQPEKVPPLVQEMKSRKVPLCTFSYSILMNSYS  218

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNL  1156
              L DI GVERV +E+K++     DWT YSNLA  Y  AGL DKAE ALK+LE++  PRN 
Sbjct  219   CLDDIEGVERVFEEIKQENVEECDWTIYSNLAVAYVKAGLHDKAELALKKLEEEMGPRNR  278

Query  1155  TAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKE  976
              AY +LI+L+  I NLVEVYRIW SL+  F +  N SYL M Q L  LNDM G +KC++E
Sbjct  279   EAYHYLISLHAGISNLVEVYRIWNSLKSGFLEITNSSYLVMFQSLSKLNDMDGLKKCYEE  338

Query  975   WESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGE  796
             WE    +Y +R+ N +I AY +  +L  A+E+  R  +    P    WE+F+ ++L++  
Sbjct  339   WELSCPSYTMRLPNNVISAYLRNDMLHDAEEVFLRGLKRSQGPFFLAWEMFIAFFLRHHR  398

Query  795   ISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLG  616
             I  A++C+E  +   + +  +W P    + + + +F  ++DV GAE     LKK  + L 
Sbjct  399   IDLAMECLEAVVFLVKEN--EWQPKCETINKFLEYFVEERDVGGAEEFYKYLKKL-NCLS  455

Query  615   AELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
             +++   L+RTY AA +T+  M  R+K +  E+S E + LL  +  E
Sbjct  456   SDIYSLLLRTYIAANRTADDMLVRIKEDGIEMSCELEGLLKRVCPE  501



>ref|XP_008453822.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like isoform X1 [Cucumis melo]
Length=498

 Score =   327 bits (837),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 191/471 (41%), Positives = 287/471 (61%), Gaps = 12/471 (3%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LY +L   G    S  + +N F+       K+E+ + +K LR+ + Y  ++++ E ME R
Sbjct  35    LYPRLSVLGATGGSVAQTINRFIMEGNIVKKYELEKCIKELRKYRRYDHSLQIMEWMEIR  94

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
              +N + +D  + +DL++K  GI AAE YF +LP ++KN  TYGALLNCYCKE+M EKA  
Sbjct  95    KINYSFTDYALRLDLISKVNGITAAEKYFYDLPPSAKNRCTYGALLNCYCKEMMEEKAST  154

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
             L +KM EL   +TS+ +N+LMT+Y R  QPEK+P +I E+K+      +FTYN+WM + A
Sbjct  155   LFKKMDELKF-VTSLAFNNLMTMYMRMDQPEKVPPLIGEMKQRGFYLTTFTYNVWMNSCA  213

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelek--KNTPR  1162
             +L DI  VE +++EMK +     DWTT+SNLAS Y  AG  +KAE ALK++E+  K+  +
Sbjct  214   SLNDIGKVEEILEEMKMEDSNKLDWTTFSNLASFYVKAGQLEKAELALKKVEEEIKSDKK  273

Query  1161  NLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCF  982
             +  AY  LI+LY    NL EV RIW  L+  +P   N SYL M+Q L  L D+ G +K +
Sbjct  274   DRLAYHCLISLYASTSNLSEVNRIWNLLKSVYPTMTNTSYLVMLQALSKLKDIEGLKKTY  333

Query  981   KEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKN  802
             KEWES    +D+R+ N +IGAY +Q + + A  + + A +    P ++  E F+ Y+LK 
Sbjct  334   KEWESICHIFDLRLVNVIIGAYLQQDMYEDAAMIFEDAIKRSKGPFSRAREKFMVYFLKL  393

Query  801   GEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAE---RVLGNLKKS  631
              ++ SA   +E AI+  +   ++W PS       + +FE +KDVEGAE   R+L  L K 
Sbjct  394   KQVDSAFSHLESAISESK--EKEWHPSLATTNAFLNYFEEEKDVEGAEDFARILKRL-KC  450

Query  630   EDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
              D  G  L   L++TY AAGK++  MR+R+K ++  +S E ++LL  +  +
Sbjct  451   LDESGYHL---LLKTYVAAGKSAPDMRQRLKEDDIGISSELEELLGTVCPQ  498



>ref|XP_002889397.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH65656.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=524

 Score =   327 bits (839),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 188/467 (40%), Positives = 281/467 (60%), Gaps = 8/467 (2%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LY+KL K      +  + LN+F+    +  K ++ R  K LR+ + +  A+++ + MEKR
Sbjct  60    LYKKLSKLSVAGGTVAETLNQFIMEGITVRKVDLFRCAKDLRKFRRHQHALEIFDWMEKR  119

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH-FTYGALLNCYCKELMTEKAE  1519
              M  + SD  I +DL+AK+KG+ AAE YF NL  ++KNH  TYGAL+NCYC EL   KA+
Sbjct  120   KMTFSVSDHAIRLDLIAKAKGLEAAENYFNNLDPSAKNHQSTYGALMNCYCVELEEGKAK  179

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
             A  EKM ELN    S+P+N++M++Y R  QPEK+P ++  +K+  I P   TY+IWM++ 
Sbjct  180   AHFEKMDELNFVNNSLPFNNMMSMYMRLSQPEKVPVLVDAMKQRGISPCGVTYSIWMQSC  239

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
              +L D+ G+E++IDEM +D      W T+SNLA+I+  AGL +KAE ALK +EKK  P N
Sbjct  240   GSLNDLDGLEKIIDEMGKDSEAKTTWNTFSNLAAIFTKAGLYEKAESALKSMEKKMNPNN  299

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
               ++ FLI+LY  I    EVYR+W SL+ A P+  N+SYL M+Q +  L D+ G +K F 
Sbjct  300   RDSHHFLISLYAGISKGTEVYRVWESLKKARPEVNNLSYLVMLQAMSKLGDIDGIKKIFT  359

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWES    YD+R+AN  I  Y K  + ++A+++   A      P +K  ++ + + L+NG
Sbjct  360   EWESKCWAYDMRLANIAINTYLKGNMYEEAEKILDGAMEKSKGPFSKARQLLMIHLLENG  419

Query  798   EISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAE---RVLGNLKKSE  628
             +   A+  +E A++    +  +W  S  +V     HF+  KDV+GAE   ++L N K   
Sbjct  420   KADLAMKHLETAVSDPAENKDEWSWSSELVSLFFLHFKRAKDVDGAEDFCKILSNWKP--  477

Query  627   DHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
               +  E +  LI+TYAAA KT   MR R+     E+SEE + LL  +
Sbjct  478   --VDCETMSFLIKTYAAAEKTCPDMRERLSQHQIEVSEEIQDLLKTV  522



>ref|XP_009119640.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial [Brassica rapa]
Length=515

 Score =   327 bits (838),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 190/470 (40%), Positives = 284/470 (60%), Gaps = 7/470 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             +Y+KL K      +  + LN+F+       K ++ R  K LR+ + +  A+++ + ME R
Sbjct  48    IYKKLSKLSVTGGTVTQTLNQFIMEGTPVRKDDLFRCAKDLRKFRRHQHALEIFDWMEMR  107

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH-FTYGALLNCYCKELMTEKAE  1519
              M  + +D  I +DL+AK+KG+ AAE+YF  L  ++K+H  TYGAL+NCYC EL  EKA+
Sbjct  108   KMTLSIADHAIRLDLIAKTKGLEAAESYFNGLDPSTKSHQSTYGALMNCYCVELKEEKAK  167

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
             +  EKM ELN    ++P+N++M++Y R GQPEK+P ++ E+K+ +I P   TY+IWM++ 
Sbjct  168   SHFEKMDELNFVNNTLPFNNMMSMYMRLGQPEKVPVLVDEMKKREISPCGITYSIWMQSC  227

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
              +L D+ G+E+VIDEM +D      W T+S+LA IY  AGL +KAE AL+ +E+K  P N
Sbjct  228   GSLNDLEGLEKVIDEMNKDSEAKTTWNTFSSLAGIYTKAGLHEKAESALRTMEEKMNPNN  287

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
               A+ FLI+LY  I    EV R+W SL+ A P+  NISYL M+Q L  L D+ G ++ F 
Sbjct  288   RDAHHFLISLYAGISKASEVERVWESLKKARPEVNNISYLVMLQALSKLGDIDGVKRVFT  347

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWES    YD+R+ N  I AY K G+ ++A+ + + A +    P +K+ ++ + + L+ G
Sbjct  348   EWESKCYAYDMRLGNIAINAYLKGGMYREAEMIMEGALKKCKGPFSKSRQLLMVHLLEKG  407

Query  798   EISSAVDCIEKA---ITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSE  628
             E   A+  +E A   +   R D   W  S  +V     HFE  KDVEGAE +   L K  
Sbjct  408   EAGLAMKHLEAAASDLVENRDDEWSW--SSELVSLFFLHFEKAKDVEGAEELCRILSKWR  465

Query  627   DHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
               L +E +  LI+TYAAA KT   MR R+  E  E+SEE + LL+ +  +
Sbjct  466   P-LDSETVTFLIKTYAAAEKTCPDMRERLFREQIEVSEEMQDLLETVCPQ  514



>ref|XP_008781129.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial [Phoenix dactylifera]
Length=484

 Score =   325 bits (832),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 196/438 (45%), Positives = 284/438 (65%), Gaps = 5/438 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLEN-SAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEK  1699
             LYR+L   GG +  S  + +N +LK  +   + E+ R VK LR+   +  A++L + ME 
Sbjct  45    LYRRLSALGGAQGGSVTETMNGWLKEGRVVTEVEIKRFVKELRKYNRHRHALELMDWMES  104

Query  1698  RGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAE  1519
             RGM  +  D  + ++L++K KGI  AE YF +LP+ +KN  TYGALLN Y +E + +KA 
Sbjct  105   RGMMFSFGDHAVRLNLISKVKGIDMAEEYFSSLPDLAKNQQTYGALLNSYIQEKIADKAI  164

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
             AL EKMKELNL  T++  N+LMTL+ + GQP+K+  + QE+K  DI PD+FTY + M + 
Sbjct  165   ALYEKMKELNLVSTTLVQNNLMTLHIKLGQPKKVIELFQEMKANDISPDNFTYCMLMSSY  224

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
             AA+ DI+ VERVI+EMK +G +  DWT YSNLA+ Y  AGL  KAE ALK+LE+    R+
Sbjct  225   AAMNDINSVERVIEEMK-EGGITLDWTIYSNLAAHYNSAGLFQKAESALKKLEEVIDKRD  283

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
              TA+  LI+LY   GNL EV R+W+SL+ AF +T N+SYL M+Q L  L+++   ++CF+
Sbjct  284   RTAFHCLISLYAGAGNLAEVSRVWKSLKAAFARTTNMSYLVMLQALNKLDNIDELKQCFE  343

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWES   TYD+R+ N LIGAY ++ ++K+A  L ++A +  A+ + +T E+F+ YYLK+ 
Sbjct  344   EWESACVTYDVRLVNVLIGAYLRKDMVKEALTLWEKAMQKNAQSDFRTSELFISYYLKSQ  403

Query  798   EISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHL  619
             E+  A+ C+E A  T       W P   +V E +++FE  KDV+G E     LK+   + 
Sbjct  404   EMDLALKCLEAA--TNLAKKNGWKPKKKLVNEFLKYFEEVKDVDGMESFCKILKQLA-YP  460

Query  618   GAELLESLIRTYAAAGKT  565
              AE  ESL+RT  A+ KT
Sbjct  461   DAEAYESLLRTSLASSKT  478



>gb|AAL38889.1| unknown protein [Arabidopsis thaliana]
Length=537

 Score =   325 bits (832),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 187/467 (40%), Positives = 280/467 (60%), Gaps = 8/467 (2%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LY+KL        +  + LN+F+    +  K ++ R  K LR+ +    A ++ + MEKR
Sbjct  73    LYKKLSMLSVTGGTVAETLNQFIMEGITVRKDDLFRCAKTLRKFRRPQHAFEIFDWMEKR  132

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH-FTYGALLNCYCKELMTEKAE  1519
              M  + SD  I +DL+ K+KG+ AAE YF NL  ++KNH  TYGAL+NCYC EL  EKA+
Sbjct  133   KMTFSVSDHAICLDLIGKTKGLEAAENYFNNLDPSAKNHQSTYGALMNCYCVELEEEKAK  192

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
             A  E M ELN    S+P+N++M++Y R  QPEK+P ++  IK+  I P   TY+IWM++ 
Sbjct  193   AHFEIMDELNFVNNSLPFNNMMSMYMRLSQPEKVPVLVDAIKQRGISPCGVTYSIWMQSC  252

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
              +L D+ G+E++IDEM +D      W T+SNLA+IY  AGL +KA+ ALK +E+K  P N
Sbjct  253   GSLNDLDGLEKIIDEMGKDSEAKTTWNTFSNLAAIYTKAGLYEKADSALKSMEEKMNPNN  312

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
               ++ FL++LY  I    EVYR+W SL+ A P+  N+SYL M+Q +  L D+ G +K F 
Sbjct  313   RDSHHFLMSLYAGISKGPEVYRVWESLKKARPEVNNLSYLVMLQAMSKLGDLDGIKKIFT  372

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWES    YD+R+AN  I  Y K  + ++A+++   A +    P +K  ++ + + L+N 
Sbjct  373   EWESKCWAYDMRLANIAINTYLKGNMYEEAEKILDGAMKKSKGPFSKARQLLMIHLLEND  432

Query  798   EISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAE---RVLGNLKKSE  628
             +   A+  +E A++    +  +W  S  +V     HFE  KDV+GAE   ++L N K   
Sbjct  433   KADLAMKHLEAAVSDSAENKDEWGWSSELVSLFFLHFEKAKDVDGAEDFCKILSNWKP--  490

Query  627   DHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
               L +E +  LI+TYAAA KTS  MR R+  +  E+SEE + LL  +
Sbjct  491   --LDSETMTFLIKTYAAAEKTSPDMRERLSQQQIEVSEEIQDLLKTV  535



>gb|AFN53641.1| pentatricopeptide repeat-containing protein [Linum usitatissimum]
Length=516

 Score =   323 bits (829),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 185/472 (39%), Positives = 287/472 (61%), Gaps = 7/472 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LYR+L   G    +  K LN+++    S  K E+ R VK LR+   ++  +++ E MEKR
Sbjct  46    LYRRLSALGATGGTVDKVLNDYVMDGMSIRKVELMRCVKELRKYGRFNHGLEIMEWMEKR  105

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
             G+N    D  + +DL+ K+KGI  AE YF  L  ++KN  TYG+LLN YCK+L +EKA  
Sbjct  106   GINLGHGDLAVRLDLICKTKGITEAENYFNGLVPSAKNPATYGSLLNSYCKKLDSEKALQ  165

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
             L +KM +L     S+P+N+LM++Y R GQ EK+P ++ ++K+ ++ P +FTYNIW+++L 
Sbjct  166   LFQKMDKLKFFRNSLPFNNLMSMYMRLGQQEKVPELVSQMKQMNLPPCTFTYNIWIQSLG  225

Query  1335  ALGDISGVERVIDEMKRDGRVAE--DWTTYSNLASIYADAGLSDkaekalkelekKNTPR  1162
              + D  G+++V++EM+ D       +WTTYSNLA++Y  AG  ++A+ ALK +E++    
Sbjct  226   HMRDFEGIKKVLEEMRNDVNFGNNFNWTTYSNLAAVYTSAGEFERAKLALKMMEERIDSH  285

Query  1161  NLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCF  982
             +  AY FL+TLYG I +L EV+R+W  L+  F +  N SYL M+Q L  L D+ G  K F
Sbjct  286   DRNAYHFLLTLYGGIADLEEVHRVWGCLKAKFNQVTNASYLVMLQALARLKDVEGISKVF  345

Query  981   KEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKN  802
             +EWES  T+YD+RVAN  I  Y ++G+  +A+ +   A      P  KT E+ +   LK 
Sbjct  346   EEWESVCTSYDMRVANVAIRVYLEKGMYNEAEAVFDGAMERTPGPYFKTREMLMVSLLKR  405

Query  801   GEISSAVDCIEKAIT----TGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKK  634
              ++  A+  ++ A T      +G  ++W PS  IV     +FE +KDVEGAE++   L K
Sbjct  406   RQLEPALKQMKAAFTEVGQNEKGHEKEWRPSAEIVNAFFGYFEEEKDVEGAEKMWKIL-K  464

Query  633   SEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
               +   + +   L++TY AAGK++  MR R+  +  E+ EE ++LLDV+  E
Sbjct  465   CINRCDSTVYRLLMKTYIAAGKSAVDMRTRLAEDAVEVDEEIQRLLDVVCPE  516



>ref|NP_171739.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9FZ24.1|PPR4_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG00888.1|AC064879_6 Hypothetical protein [Arabidopsis thaliana]
 gb|AEE27421.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=537

 Score =   323 bits (829),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 186/467 (40%), Positives = 280/467 (60%), Gaps = 8/467 (2%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LY+KL        +  + LN+F+    +  K ++ R  K LR+ +    A ++ + MEKR
Sbjct  73    LYKKLSMLSVTGGTVAETLNQFIMEGITVRKDDLFRCAKTLRKFRRPQHAFEIFDWMEKR  132

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH-FTYGALLNCYCKELMTEKAE  1519
              M  + SD  I +DL+ K+KG+ AAE YF NL  ++KNH  TYGAL+NCYC EL  EKA+
Sbjct  133   KMTFSVSDHAICLDLIGKTKGLEAAENYFNNLDPSAKNHQSTYGALMNCYCVELEEEKAK  192

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
             A  E M ELN    S+P+N++M++Y R  QPEK+P ++  +K+  I P   TY+IWM++ 
Sbjct  193   AHFEIMDELNFVNNSLPFNNMMSMYMRLSQPEKVPVLVDAMKQRGISPCGVTYSIWMQSC  252

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
              +L D+ G+E++IDEM +D      W T+SNLA+IY  AGL +KA+ ALK +E+K  P N
Sbjct  253   GSLNDLDGLEKIIDEMGKDSEAKTTWNTFSNLAAIYTKAGLYEKADSALKSMEEKMNPNN  312

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
               ++ FL++LY  I    EVYR+W SL+ A P+  N+SYL M+Q +  L D+ G +K F 
Sbjct  313   RDSHHFLMSLYAGISKGPEVYRVWESLKKARPEVNNLSYLVMLQAMSKLGDLDGIKKIFT  372

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWES    YD+R+AN  I  Y K  + ++A+++   A +    P +K  ++ + + L+N 
Sbjct  373   EWESKCWAYDMRLANIAINTYLKGNMYEEAEKILDGAMKKSKGPFSKARQLLMIHLLEND  432

Query  798   EISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAE---RVLGNLKKSE  628
             +   A+  +E A++    +  +W  S  +V     HFE  KDV+GAE   ++L N K   
Sbjct  433   KADLAMKHLEAAVSDSAENKDEWGWSSELVSLFFLHFEKAKDVDGAEDFCKILSNWKP--  490

Query  627   DHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
               L +E +  LI+TYAAA KTS  MR R+  +  E+SEE + LL  +
Sbjct  491   --LDSETMTFLIKTYAAAEKTSPDMRERLSQQQIEVSEEIQDLLKTV  535



>emb|CDY15237.1| BnaC05g01160D [Brassica napus]
Length=513

 Score =   323 bits (827),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 188/465 (40%), Positives = 282/465 (61%), Gaps = 3/465 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             +Y+KL K      +  + LN+F+       K ++ R  K LR+ + +  A+++ + MEKR
Sbjct  48    IYKKLSKLSVTGGTVTQTLNQFIMEGTPVRKDDLFRCAKDLRKFRRHQHALEIFDWMEKR  107

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH-FTYGALLNCYCKELMTEKAE  1519
              M  + +D  I +DL+AK+KG+ AAE+YF  L  ++K+H  TYGAL+NCYC EL  EKA+
Sbjct  108   KMTLSIADHAIRLDLIAKTKGLEAAESYFNGLDPSTKSHQSTYGALMNCYCVELKEEKAK  167

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
             A  E+M ELN    ++P+N++M++Y R GQPEK+  ++ E+K  +I P   TY+IWM++ 
Sbjct  168   AHFEEMDELNFVNNTLPFNNMMSMYMRLGQPEKVSLLVDEMKRREISPCGITYSIWMQSC  227

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
              +L D+ G+E+VIDEM +D      W T+S+LA IY  AGL +KAE AL+ +E+K  P N
Sbjct  228   GSLNDLEGLEKVIDEMNKDSEAKTTWNTFSSLAGIYTKAGLHEKAESALRTMEEKMNPNN  287

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
               A+ FLI+LY  I    EV R+W +L+ A P+  NISYL M+Q L  L D+ G ++ F 
Sbjct  288   RDAHHFLISLYAGISKASEVERVWEALKKARPEVNNISYLVMLQALSKLGDIDGVKRVFT  347

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWES    YD+R+AN  I AY K G+ ++A+ + + A +    P +K+ ++ + + L+ G
Sbjct  348   EWESKCYAYDMRLANIAINAYLKGGMYREAEMILEGALKKCKGPFSKSRQLLMVHLLEKG  407

Query  798   EISSAVDCIEKAITT-GRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDH  622
             E   A+  +E A +       ++W  S  +V     HFE  KDVEGAE +   L K    
Sbjct  408   EAGVAMKHLEAAASDFEEKKDEEWSWSSELVSLFFIHFEKAKDVEGAEELCRILSKWRP-  466

Query  621   LGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
             L  E +  LI+TYAAA KT   MR R+  E  E+SEE + LL+ +
Sbjct  467   LDPETVTFLIKTYAAAEKTCPDMRERLFREQIEVSEEIQDLLETV  511



>ref|XP_011041046.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like isoform X1 [Populus euphratica]
Length=506

 Score =   322 bits (824),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 192/477 (40%), Positives = 285/477 (60%), Gaps = 21/477 (4%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LY++L + G    S  K LN+F+       K ++   ++ LR+   +  AI++ E M+KR
Sbjct  36    LYKRLSELGASGGSVSKTLNDFVLEGGKTNKVDLLACIRELRKYGRFDYAIEVMEWMQKR  95

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
              MN +     +++DL+AK+KGIAAAE YF NL  + +NH T+GALL+CYC+ELM+EKA  
Sbjct  96    KMNVS---HAVYLDLIAKTKGIAAAENYFDNLSPSEQNHSTHGALLSCYCRELMSEKALT  152

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
             L EKM ++    TS+P+N+L++L+ R  QPEK+  I+QE+K+  I P +FTYN+WM++  
Sbjct  153   LFEKMDKMKFLSTSLPFNNLISLHLRLDQPEKVLPIVQEMKQKGISPCTFTYNMWMQSYG  212

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekK-NTPRN  1159
              L D  GVERV+DEMK DG+    WTTY+NLA+IY  AG  DKAE ALK++E++    R 
Sbjct  213   CLNDFEGVERVLDEMKMDGQKNFSWTTYTNLATIYVKAGHFDKAESALKKVEEQIERGRE  272

Query  1158  LT----------AYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLN  1009
             +           AY FLITLY    NL EV R+W SL+  F  T N+SYL M+  L  L 
Sbjct  273   IKKKRRQGDYREAYHFLITLYAGTSNLGEVNRVWNSLKSNFHTTTNVSYLTMLHTLAKLK  332

Query  1008  DMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGl--lkkakelrkrAQRSGAKPNAKT  835
             D+ G  KCFKEWES   +YD+R+AN  I A  +  +             +  G   NA+ 
Sbjct  333   DVEGLLKCFKEWESSCHSYDMRLANVAIRACLEHDMYEEAALIFDNALKRTEGLFFNAR-  391

Query  834   WEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAER  655
              E+F+ ++LKN ++  A+  ++ A +  +    +W P P  V     +FE +KDV GAER
Sbjct  392   -EMFMVFFLKNHQLDLALKHMKAAFSEVK--EIEWQPEPKTVSAFFAYFEDEKDVNGAER  448

Query  654   VLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVIS  484
              L  + K  + L +   + L++TY AAG  +  MR+R++ +  E++ E + LL+ + 
Sbjct  449   -LCKILKHINRLDSNAYDLLLKTYIAAGNLAPEMRQRLEEDGIEINPELENLLERVC  504



>ref|XP_006307239.1| hypothetical protein CARUB_v10008848mg [Capsella rubella]
 gb|EOA40137.1| hypothetical protein CARUB_v10008848mg [Capsella rubella]
Length=523

 Score =   322 bits (826),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 184/464 (40%), Positives = 276/464 (59%), Gaps = 8/464 (2%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LY+KL K      +  + LN+F+    +  K ++ R  K LR+ + +  A+++ + MEKR
Sbjct  59    LYKKLSKLNVTGGTVAETLNQFIMEGVTVRKDDLFRCAKDLRKFRRHQHALEIFDWMEKR  118

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH-FTYGALLNCYCKELMTEKAE  1519
              M  + SD  I +DL+ K+KG+  AE YF NL  + KNH  TYGAL+NCYC  L  EKA+
Sbjct  119   KMTLSVSDHAIRLDLIGKTKGLEEAENYFNNLDPSVKNHQSTYGALMNCYCVVLEEEKAK  178

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
             A  EKM EL     S+P+N++M++Y R GQPEK+P ++ E+K+ DI P   TY+IWM++ 
Sbjct  179   AHFEKMDELKFANNSLPFNNMMSMYMRLGQPEKVPVLVNEMKQRDISPSGVTYSIWMQSC  238

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
              +L D+ G+E++IDEM +D      W T+SNLA+IY  AGL +KAE ALK +E+K  P  
Sbjct  239   GSLNDLDGLEKIIDEMGKDSEAKTTWNTFSNLAAIYTKAGLYEKAESALKSMEEKMNPNY  298

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
               ++ FLI+LY  I    EV+R+W  L+ A P+  N+SYL M+Q +  L D+ G +K F 
Sbjct  299   RDSHHFLISLYAGISKAPEVFRVWELLKKARPEVNNMSYLVMLQAMSKLGDLDGIKKIFT  358

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWES    YD+R+AN  I  Y K  + ++A+++   A +    P +K  ++ + + L+NG
Sbjct  359   EWESKCWAYDMRLANIAINTYLKGNMHEEAEKILDGAMKKSKGPFSKARQLLMIHLLQNG  418

Query  798   EISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAE---RVLGNLKKSE  628
             +   A+  +E A++    +  +W  S  +V     HFE  KDV GAE   R+L   +   
Sbjct  419   KADLAMKHLEAAVSDSTENKDEWSWSSELVSLFYLHFENAKDVNGAEEFSRILSKWRP--  476

Query  627   DHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
                 ++    LI+TYAA+GKT   MR R+     E+SEE + LL
Sbjct  477   --FDSDTATFLIKTYAASGKTRPDMRERLSQHEIEVSEEIQDLL  518



>ref|XP_010087220.1| hypothetical protein L484_009729 [Morus notabilis]
 gb|EXB28570.1| hypothetical protein L484_009729 [Morus notabilis]
Length=440

 Score =   319 bits (818),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 174/434 (40%), Positives = 271/434 (62%), Gaps = 3/434 (1%)
 Frame = -2

Query  1785  KWEVGRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFI  1606
             K+E+ + VK LR+ + +  A+++ E ME R +N + SD  + +DL++K+KGIAAAE Y  
Sbjct  8     KYELWQCVKELRKFRKFRSALEIMEWMEMRKINYSHSDHAMRLDLISKTKGIAAAENYMS  67

Query  1605  NLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQP  1426
             NL  + KN F+YGALLNCYC E M +KA  L  KM+EL L   ++P+ +LMT+Y + G+P
Sbjct  68    NLLSSEKNKFSYGALLNCYCMETMEDKASELFGKMEELGLVTNALPFANLMTMYMKMGKP  127

Query  1425  EKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSN  1246
             EK+P I+Q + + ++ P ++ YN+ M+  A+L D  GVERV+ E++   +   +WTTYSN
Sbjct  128   EKVPCIVQGMMKRNVYPSTYVYNVLMQTYASLNDFVGVERVLAEIEMLEQGKCNWTTYSN  187

Query  1245  LASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAF  1066
             LA+IY  AGL +KA  AL++LE    P +  A+ FLI+LY  IG L +V R+W++L   +
Sbjct  188   LATIYVKAGLFEKAMVALRKLECTMKPGSRQAFHFLISLYAGIGQLGDVNRVWKTLNEVY  247

Query  1065  PKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkak  886
             P   N+SYL M+Q L  L+D+ G  KCFKEWES  + +DIR+ N +IG Y + G+ K+A+
Sbjct  248   PTFNNMSYLVMLQALSKLDDVEGLRKCFKEWESSYSCHDIRLTNVVIGVYLRHGMHKEAE  307

Query  885   elrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVG  706
              L +   +    P  KT E F+ ++L+N     A+  ++  ++  +    +W P P +V 
Sbjct  308   LLFEDTIKRFKGPFVKTRERFMFFFLENRRTDLALSYLDSNVSEAK--DVEWHPPPSLVS  365

Query  705   ELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENA  526
               + +FE + DV  AERV+  LK     L ++  + L++ Y AAGK +   RRR++    
Sbjct  366   AFLSYFEEESDVHSAERVVDILKPFR-CLNSDHYQLLLKIYVAAGKIALDTRRRLEEVGV  424

Query  525   ELSEEAKKLLDVIS  484
             E+S E ++LL  + 
Sbjct  425   EISCEIEELLQRVC  438



>ref|XP_010474556.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like, 
partial [Camelina sativa]
Length=253

 Score =   312 bits (800),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 203/252 (81%), Gaps = 0/252 (0%)
 Frame = -2

Query  1233  YADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTA  1054
             Y DAGLS KAEKAL+ELE KNT R+ TAYQFLITLYGR+G L EVYRIWRSLRLA PKT+
Sbjct  1     YVDAGLSQKAEKALQELEMKNTQRDFTAYQFLITLYGRLGKLTEVYRIWRSLRLAIPKTS  60

Query  1053  NISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrk  874
             N++YLNMIQVLVNL D+PGAE  FKEW++  +TYDIR+ N LIGAYAK GL++KA+EL++
Sbjct  61    NVAYLNMIQVLVNLKDLPGAETLFKEWQANCSTYDIRIVNVLIGAYAKDGLIEKARELKE  120

Query  873   rAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMR  694
             +A R G+K NAKTWEIF+DYY+K G+ + A++C+ KA++ GRGDG KWVPS   +  LM 
Sbjct  121   KAPRRGSKANAKTWEIFMDYYVKRGDTAQALECMSKAVSIGRGDGGKWVPSQETIRTLMS  180

Query  693   HFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSE  514
              FE KKDV GAE ++  LKK  D++GAE+ E LIRTYAAAGK+   MRRR+KMEN E++E
Sbjct  181   LFEQKKDVNGAENLVEILKKVTDNIGAEIFEPLIRTYAAAGKSHPAMRRRLKMENVEVNE  240

Query  513   EAKKLLDVISAE  478
               KKLLD +S E
Sbjct  241   ATKKLLDEVSQE  252



>emb|CBI36964.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   321 bits (822),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 178/413 (43%), Positives = 265/413 (64%), Gaps = 2/413 (0%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LY +L   G    S    LNE +K  K   K E+   +K LR+ + +  A+++ + ME R
Sbjct  85    LYHRLSALGATGGSVADTLNEHIKEGKLIAKHELSSCIKQLRKYRQFQHALEIMDWMENR  144

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
              +  + +D  + +DL++K+KG+A AE YF NL  ++KN  TYG LLNCYCKE M EKA A
Sbjct  145   KIFFSYADYAVRLDLLSKTKGLATAEEYFNNLSPSAKNLLTYGTLLNCYCKEKMEEKALA  204

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
             L EKM ELN   TS+ +N+LM+L+ R G+PE +P ++ E+K+  I PD+FTYNI M++ A
Sbjct  205   LFEKMDELNFASTSLTFNNLMSLHMRLGKPEMVPPLVDEMKKRSISPDTFTYNILMQSYA  264

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNL  1156
              L DI G ERV++E+KR+      WTTYSNLA++Y +A L +KAE ALK+LE++    + 
Sbjct  265   RLNDIEGAERVLEEIKRENEDKLSWTTYSNLAAVYVNARLFEKAELALKKLEEEMGFHDR  324

Query  1155  TAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKE  976
              AY FLI+LY  I NL EV R+W SL+ AFPKT N+SY  M+Q L NLND+ G + CF+E
Sbjct  325   LAYHFLISLYAGINNLSEVNRVWNSLKSAFPKTNNMSYFIMLQALANLNDVDGLKICFEE  384

Query  975   WESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGE  796
             W+S   ++D+R+AN  + A+    ++K A+ +   A +  + P     ++F+ ++LK  E
Sbjct  385   WKSSCFSFDVRLANVAVRAFLGWDMIKDAESILYEAVKRSSGPFYTALDMFMAHHLKVRE  444

Query  795   ISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLK  637
             I +A+  +E A +  + +  +W P+P  V   +++FE +KDVEGAE+    LK
Sbjct  445   IDTALKYMEAAASEVKNN--EWQPAPERVLAFLKYFEEEKDVEGAEKFCKILK  495



>emb|CDX89976.1| BnaA10g01060D [Brassica napus]
Length=515

 Score =   320 bits (821),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 188/470 (40%), Positives = 281/470 (60%), Gaps = 7/470 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             +Y+KL K      +  + LN+F+       K ++ R  K LR+ + +  A+++ + ME R
Sbjct  48    IYKKLSKLSVTGGTVTQTLNQFIMEGTPVRKDDLFRCAKDLRKFRRHQHALEIFDWMEMR  107

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH-FTYGALLNCYCKELMTEKAE  1519
              M  + +D  I +DL+AK+KG+ AAE+YF  L  ++K+H  TYGAL+NCYC EL  EKA+
Sbjct  108   KMTLSIADHAIRLDLIAKTKGLEAAESYFNGLDPSTKSHQSTYGALMNCYCVELKEEKAK  167

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
             +  EKM ELN    ++P+N++M++Y R GQPEK+  ++ E+K+ +I P   TY+IWM++ 
Sbjct  168   SHFEKMDELNFVNNTLPFNNMMSMYMRLGQPEKVSLLVDEMKKREIRPCGITYSIWMQSC  227

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
              +L D+ G+E+VIDEM +D      W T+S+LA IY  AGL +KAE AL+ +E+K  P N
Sbjct  228   GSLNDLEGLEKVIDEMNKDSEAKTTWNTFSSLAGIYTKAGLHEKAESALRTMEEKMNPNN  287

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
               A+ FLI+LY  I    EV R+W +L+ A P+  NISYL M+Q L  L D+ G ++ F 
Sbjct  288   RDAHHFLISLYAGISKASEVERVWEALKKARPEVNNISYLVMLQALSKLGDIDGVKRVFT  347

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWES    YD+R+AN  I AY K G+  +A+ + + A +    P +K  ++ + + L+ G
Sbjct  348   EWESKCCAYDMRLANIAINAYLKGGMYGEAEMILEGALKKCKGPFSKLRQLLMVHLLEKG  407

Query  798   EISSAVDCIEKA---ITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSE  628
             E   A+  +E A   +   R D   W  S  +V     HFE  KDVEGAE +   L K  
Sbjct  408   EAGLAMKHLEAAASDLVENRDDEWSW--SSELVSLFFIHFEKAKDVEGAEELCRILSKWR  465

Query  627   DHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
               L +E +  LI+TYAA  KT   MR R+  E  E+SEE + LL+ +  +
Sbjct  466   P-LDSETVTFLIKTYAAVEKTCPDMRERLFREQIEVSEEMQDLLETVCPQ  514



>ref|XP_010542838.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial [Tarenaya hassleriana]
Length=517

 Score =   319 bits (818),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 180/464 (39%), Positives = 283/464 (61%), Gaps = 9/464 (2%)
 Frame = -2

Query  1878  ALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEK  1699
             +LYR L   G    +    LN+F+       K E+ R +K LR+ + Y  A+++ E +EK
Sbjct  55    SLYRTLSGLGADAGTVAGALNQFILEGNPVRKDELVRCIKELRRFRRYQHALEVYEWLEK  114

Query  1698  RGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAE  1519
             R +  + +D  + +DL+AK+KG+  AE++F +L   +KN  TYG++LNCYC  L+ EKA+
Sbjct  115   RKVTFSVTDHAMRLDLIAKTKGLEVAESFFNSLDPAAKNVSTYGSMLNCYCTGLIEEKAK  174

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
                +KM +LNL   S+P+N++M +Y R GQPEK+  ++ E+K+ +I P S +Y+IWM++ 
Sbjct  175   THFQKMSDLNLVANSLPFNNMMGMYMRLGQPEKVSGLVDEMKQRNISPCSVSYSIWMQSC  234

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
             ++L DI GVE V+ EM  D      W T++NLA+IY  AGL +KAE ALK LE+K  PRN
Sbjct  235   SSLNDIDGVENVLTEMANDSEDKSTWNTFANLAAIYTKAGLIEKAELALKSLEEKMNPRN  294

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
               +Y FL++LY    N  EVYR+W +L+ + P+  N SYL M+Q L  LND  G  K F+
Sbjct  295   RDSYHFLLSLYAGTSNHSEVYRVWDTLKTSLPEVNNTSYLVMLQALNKLNDTDGVRKLFE  354

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWES   TYD+R+AN  I +Y K  + ++A+ +   A +    P +K  ++   + LK G
Sbjct  355   EWESRYRTYDMRLANLGISSYLKGDMYQEAEAVLSDAMQKCKGPFSKARQLLTIHLLKKG  414

Query  798   EISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAE---RVLGNLKKSE  628
             E  SA+  +E A++  + D   W  S  ++     H++  +DV+GAE   R+L + +   
Sbjct  415   EAGSALKHLEAAVSGEKKDDWNW--SSELIESFFLHYQKTEDVDGAEEFCRILKHFRP--  470

Query  627   DHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
                 +++   L++TY AAGKTS  M+ R++ +  E+++E K+LL
Sbjct  471   --FDSDIYTLLLKTYVAAGKTSPDMQERLEGDAIEVNDELKELL  512



>gb|KHG24281.1| hypothetical protein F383_04038 [Gossypium arboreum]
Length=502

 Score =   318 bits (815),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 180/467 (39%), Positives = 271/467 (58%), Gaps = 6/467 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LY +L   G    +  + LN ++   K   K E+ R VK +R+ + Y  ++ + + MEKR
Sbjct  41    LYSRLSALGATGGTVAEALNGYIMEGKKIRKDELSRCVKEMRKYRRYQHSLDIMDWMEKR  100

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
              M+ +  D  + +DL+AK+KG+ AAE Y   LP  +KN FTYG+LLNCYC  LM +KA A
Sbjct  101   NMHFSHVDHAVRLDLIAKTKGLGAAEDYLSALPPNAKNKFTYGSLLNCYCNNLMEDKALA  160

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
             L +KM EL      +P+N+LM LY R G+P+K+P ++ E+K CDI   SFTY +WM++ A
Sbjct  161   LFKKMDELKFIDNCLPFNNLMCLYMRLGRPQKVPQLVDEMKRCDIPRGSFTYILWMQSYA  220

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNL  1156
              L DI G E V+ E+  D      W TYSNLA++Y  AG  +KAE  LK+LEK N PR  
Sbjct  221   ELNDIEGAENVLMELSNDSEDKCTWRTYSNLAAMYVKAGQFEKAEACLKKLEKDNMPRQR  280

Query  1155  TAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKE  976
              AY +LI+LY    N  EVYR+W  L+  +P   N SYL M+Q L NL D  G +KCF+E
Sbjct  281   EAYHYLISLYAGTSNRDEVYRLWEDLKQRYPTVNNASYLIMVQALANLKDFKGLKKCFEE  340

Query  975   WESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGE  796
             W++  ++YD R+  + I  +    +L++A+ +   A +    P  K  E F+ Y+L+   
Sbjct  341   WDTSCSSYDRRLVTSTIRGFLLGDMLEEAEVVLDNAMKRSKGPYTKAQEYFMVYFLRKYR  400

Query  795   ISSAVDCIEKAITTGRGDGQKWVP-SPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHL  619
                A+  +E  ++    + + W P +P        +F ++ DV+ AE    +LK + + L
Sbjct  401   FDMALKHMEAVVS----EVKDWSPVNPETTTAFFDYFMSEGDVKAAEEFCKHLKNN-NCL  455

Query  618   GAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
              +E+   L+R Y AAGK +  MRRR++ +  E+S+E + LL  +  E
Sbjct  456   DSEVYHQLLRLYVAAGKVAPDMRRRLEDDGIEISKELEDLLVKVCPE  502



>ref|XP_010474650.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Camelina sativa]
Length=527

 Score =   319 bits (817),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 188/465 (40%), Positives = 274/465 (59%), Gaps = 3/465 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LY+KL K      S    LN+F+    +  K ++ R  K LR+ + +  A+++ + MEKR
Sbjct  59    LYKKLSKLNVTGGSVADTLNQFIMEGITVRKDDLFRCAKDLRKFRRHQHALEIFDWMEKR  118

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH-FTYGALLNCYCKELMTEKAE  1519
              M  + SD  I +DL+ K+KG+ AAE Y  NL  + K H  TYGAL+NCYC EL  EKA+
Sbjct  119   KMTLSVSDHAIRLDLIGKTKGLEAAENYLNNLDTSVKIHQSTYGALMNCYCVELEEEKAK  178

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
             A  EKM EL     S+P+N+ M++Y R GQPEK+P ++  +K+ DI P   TY+IWM++ 
Sbjct  179   AHFEKMDELKFVNNSLPFNNSMSMYMRLGQPEKVPVLVDAMKQRDISPSGVTYSIWMQSC  238

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
              +L D+ G+E+VIDEM +D      W T+SNLA+IY  AGL +KAE ALK +E+K  P N
Sbjct  239   GSLNDLDGLEKVIDEMGKDSEAKTTWNTFSNLAAIYTKAGLYEKAESALKSMEEKMNPNN  298

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
               +Y FLI+LY  I    EVYR+W SL  A P+  N+SYL M+Q +  L D+ G +K F 
Sbjct  299   RDSYHFLISLYAGISKAPEVYRVWESLNKARPEVNNLSYLVMLQAMSKLGDIDGIKKIFT  358

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWES    YD+R+AN  I  Y K  + ++A+++   A +    P +K+ ++ + + L+ G
Sbjct  359   EWESKCWAYDMRLANIAINTYLKVNMYEEAEKILDGAMKKSKGPFSKSRQLLMIHLLEKG  418

Query  798   EISSAVDCIEKAITTGRGDG-QKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDH  622
             +   A+  +  A++    +  ++W  S  +V     HFE  KDV+GAE     L K    
Sbjct  419   KADLAMKHLGAAVSDSAAENKEEWSWSSELVSLFYLHFEKAKDVQGAEEFCRILSKWRP-  477

Query  621   LGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
             L +E    LI+TY AA KT   MR R+     E+SEE + LL+ +
Sbjct  478   LDSETATFLIKTYVAAEKTCPDMRERLSRHQIEVSEEIQALLETV  522



>ref|XP_006418350.1| hypothetical protein EUTSA_v10007036mg [Eutrema salsugineum]
 gb|ESQ36703.1| hypothetical protein EUTSA_v10007036mg [Eutrema salsugineum]
Length=645

 Score =   321 bits (823),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 182/464 (39%), Positives = 276/464 (59%), Gaps = 1/464 (0%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             +Y KL K    E +  + LN+F+    +  K ++ R  KLLR+ + Y  A+++ E ME R
Sbjct  45    IYNKLSKLSVTEGTVPETLNQFIMEGITLRKHDLFRCAKLLRKFRRYQHALEIFEWMEMR  104

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH-FTYGALLNCYCKELMTEKAE  1519
              M  + SD  I +DL+AK++G+ AAE YF  L   +KNH  TYGAL+NCYC +L  EKA+
Sbjct  105   KMAVSASDHAIRLDLIAKTRGLEAAENYFNKLEPCAKNHQSTYGALMNCYCVQLQEEKAK  164

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
             A  EKM EL     S+P++++M++Y R  QPEK+P ++  +K+  I P   TY+IWM++ 
Sbjct  165   AHFEKMDELKFVNNSLPFSNMMSMYMRMSQPEKVPVVVDAMKQRGISPCRVTYSIWMQSC  224

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
             A+  D  G+E++I EM +D      W T+SNLA+IY  AGL ++AE ALK +E+K  P N
Sbjct  225   ASSNDFDGLEKIIAEMGKDSEAKTTWNTFSNLAAIYTKAGLFEEAESALKSMEEKMNPNN  284

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
               A+ FLI+LY  I    EV R+W SL+ A P+  N+SYL M+Q L +L D+ G ++ F 
Sbjct  285   RDAHHFLISLYAGISKASEVNRVWESLKKAHPEINNMSYLVMLQALSSLGDVDGIKRIFT  344

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWES    YD+R+AN  I  Y K  L ++A+ +   A +    P +K  ++ + + L+NG
Sbjct  345   EWESKCQVYDMRLANIAINTYLKGNLYQEAETILDGAMKKCKGPFSKARQLLMIHLLENG  404

Query  798   EISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHL  619
             ++ SA+  +E A++        W  S  ++     HFE  KDV+GAE++   L      +
Sbjct  405   KVDSAMKHLEAAVSDSADIRDHWGWSSELLSLFFLHFEKAKDVDGAEKLCRILSHWRPFM  464

Query  618   GAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
              +E +  LI+TYAAAGK    M  R+     E+SE+ + LL+ +
Sbjct  465   DSETVTFLIKTYAAAGKIYPDMLERLYRNEMEVSEDIQDLLEKV  508


 Score =   117 bits (292),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 83/126 (66%), Gaps = 2/126 (2%)
 Frame = -2

Query  1722  KLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH-FTYGALLNCYC  1546
             K+ ++ EKR +  + SD  + + L+AK+KG+ AAE+YF NL  ++KNH   YG L++CYC
Sbjct  507   KVFDSKEKRKVPFSVSDHAVRLHLIAKTKGLEAAESYFNNLDPSAKNHELIYGTLMHCYC  566

Query  1545  KELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEI-KECDIMPDS  1369
              EL  EKA+A  EKM ELN    S+P+N +M++Y R GQPE +  +++ I K  +I P  
Sbjct  567   VELQEEKAKAHFEKMDELNFVNNSLPFNYMMSMYLRLGQPEMLDVLMEGIRKREEICPCG  626

Query  1368  FTYNIW  1351
              TY IW
Sbjct  627   MTYIIW  632



>ref|XP_002320971.2| hypothetical protein POPTR_0014s11420g [Populus trichocarpa]
 gb|EEE99286.2| hypothetical protein POPTR_0014s11420g [Populus trichocarpa]
Length=407

 Score =   311 bits (798),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 177/412 (43%), Positives = 260/412 (63%), Gaps = 10/412 (2%)
 Frame = -2

Query  1713  ETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELM  1534
             E M+KR MN +     +++DL+AK +GIAAAE YF  L  + +NH T+GALL+CYC+ELM
Sbjct  2     EWMQKRKMNVS---HAVYLDLIAKKEGIAAAENYFDGLSPSEQNHSTHGALLSCYCRELM  58

Query  1533  TEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNI  1354
             +EKA  L EKM ++   LTS+P+N+L++L+ R  QPEK+  I+QE+K+  + P +FTYN+
Sbjct  59    SEKALTLFEKMDKMKFLLTSLPFNNLISLHLRLDQPEKVLPIVQEMKQKGVSPCTFTYNM  118

Query  1353  WMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekK  1174
             WM++   L D  GVERV+DEMK DG+    WTTY+NLA+IY  AG  DKAE ALK++E++
Sbjct  119   WMQSYGCLNDFEGVERVLDEMKMDGQKNFSWTTYTNLATIYVKAGHFDKAESALKKVEEQ  178

Query  1173  NTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGA  994
                    AY FLITLY    NL EV R+W SL+  F  T N+SYL M+  L  L D+ G 
Sbjct  179   IERDYREAYHFLITLYAGTSNLGEVNRVWNSLKSNFHTTTNVSYLTMLHTLAKLKDVEGL  238

Query  993   EKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelr--krAQRSGAKPNAKTWEIFL  820
              KCFKEWES   +YD+R+AN  I A  +  + ++A  +      +  G   NA+  E+F+
Sbjct  239   LKCFKEWESSCHSYDMRLANVAIRACLEHDMYEEAALIFDDALKRTEGLFFNAR--EMFM  296

Query  819   DYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNL  640
              ++LKN ++  A+  ++ A +  +    +W P P  V     +FE +KDV GAER+   L
Sbjct  297   VFFLKNHQLDLALKHMKAAFSEVK--EIEWQPEPKTVSAFFAYFEDEKDVNGAERLCKIL  354

Query  639   KKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVIS  484
             K   + L +   + L++TY AAGK +  MR+R++ +  E++ E + LL+ + 
Sbjct  355   KHI-NRLDSNAYDLLLKTYIAAGKLAPEMRQRLEEDGIEINPELENLLERVC  405



>ref|XP_006480799.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Citrus sinensis]
Length=508

 Score =   311 bits (796),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 193/465 (42%), Positives = 283/465 (61%), Gaps = 7/465 (2%)
 Frame = -2

Query  1884  EEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM  1705
             E+ LY++L   G    S    LN ++   K+  K  +   V+ LR+   Y  A+++ E M
Sbjct  43    EDKLYKRLSALGATGGSVTGALNAYIMEGKTVRKDMLEYCVRSLRKFGRYRHALEVIEWM  102

Query  1704  EKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
             E R ++ + +D  +++DL AK+KGIAAAE YF  L E +KN +TYGALLNCYCKELMTE+
Sbjct  103   ESRKIHFSYTDFAVYLDLTAKTKGIAAAEEYFNGLSEYAKNRYTYGALLNCYCKELMTER  162

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             A AL EKM EL     ++ +N+L T+Y R GQPEK+  ++ ++K+ +I  D+ TY +WM+
Sbjct  163   ALALFEKMDELKFLGNTVAFNNLSTMYLRLGQPEKVRPLVNQMKQRNISLDNLTYIVWMQ  222

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             + + L DI GVERV  EM  +      WTTYSNLASIY  A L +KAE ALK+LE+   P
Sbjct  223   SYSHLNDIDGVERVFYEMCNECEDKCRWTTYSNLASIYVKAELFEKAELALKKLEEMK-P  281

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             R+  AY FLI+LY    NL  V R+W  L+  FP T N SYL ++Q L  LN +   ++C
Sbjct  282   RDRKAYHFLISLYCNTSNLDAVNRVWGILKSTFPPT-NTSYLVLLQALAKLNAIDILKQC  340

Query  984   FKEWESGQTTYDIRVANALIGAY-AKQGllkkakelrkrAQRSGAKPN-AKTWEIFLDYY  811
             F+EWES  ++YD+R+A+ +I AY  K    + A       +R+ A     K+ E F+ YY
Sbjct  341   FEEWESRCSSYDMRLADVIIRAYLQKDMYEEAALIFNNAKKRANASARFFKSRESFMIYY  400

Query  810   LKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKS  631
             L++ ++  A++ +E A++  +     W P  V V    R FE +KDV+GAE     L KS
Sbjct  401   LRSRQLDLALNEMEAALSEAK--QFHWRPMQVTVDTFFRFFEEEKDVDGAEEFCKVL-KS  457

Query  630   EDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
              + L       LI+TY AAGK ++ MR+R++ ++ E+++E + LL
Sbjct  458   LNCLDFSAYSLLIKTYIAAGKLASDMRQRLEDDDIEITDELEDLL  502



>gb|ABR18022.1| unknown [Picea sitchensis]
Length=561

 Score =   312 bits (799),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 183/480 (38%), Positives = 287/480 (60%), Gaps = 8/480 (2%)
 Frame = -2

Query  1923  TKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQR  1744
             T+ +  + T + L + LYR++ + G  + SA + L  ++   +   KW +   V+ LR+ 
Sbjct  80    TEAVATQKTSESLPDNLYRRISRLGDPKRSAVEELERWITEGREVKKWVLREIVRELRKY  139

Query  1743  KLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGA  1564
               +  A+++ E M K+    +  D+ +H+ L+AK  GIA+AE Y+++L    KNH TY A
Sbjct  140   YRHKHALEVFEWMSKK-FPCSVGDRAMHLGLIAKVHGIASAEKYYVDLHHYEKNHLTYFA  198

Query  1563  LLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECD  1384
             LLNCY +E   EK+EA++E++K+L    T+ PY  +MTLY  T Q EK+P +IQE+K+  
Sbjct  199   LLNCYVQEKNIEKSEAIMEELKDLGFIKTAFPYTEMMTLYMNTEQFEKVPLVIQEMKKKG  258

Query  1383  IMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDka  1204
             I  D   YNIWMR+ AAL D+  V  V +E++RD  +  DW+ YS LA+IY +A + DKA
Sbjct  259   ISLDIHCYNIWMRSYAALSDMDQVAEVFNEIERDDNINTDWSIYSTLANIYINAKVLDKA  318

Query  1203  ----ekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLN  1036
                 ++   ++++  T ++  AY  LI+L+GR+GN  EVYRIW+S  LAFPK  N SY+ 
Sbjct  319   GSALKEMENKMKEIETKKDQLAYNHLISLHGRLGNKDEVYRIWQSFELAFPKMTNRSYVC  378

Query  1035  MIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSG  856
             ++  LV + D+ GAE   K+WES +T  D R+  AL+ AY ++G L+KA+ L +R    G
Sbjct  379   LLSSLVGMGDIEGAEVFIKKWESMKTFDDSRIYYALLNAYIEKGWLQKAELLLERVVDKG  438

Query  855   AKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKK  676
              KPNAKTWE   + Y++N +I  A++ ++++++   G+   W P  V V  L++HFE + 
Sbjct  439   GKPNAKTWETLAEGYIQNEQIHKAMEAMKRSLSI-EGNS-PWQPKSVNVLALLKHFEKQG  496

Query  675   DVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
             DV+ AE     L+  +  +  E+  SL+RTY   GK    +   +  +N    EE   LL
Sbjct  497   DVKSAEEFFKILRGVK-FVSTEIYNSLLRTYVYVGKVPPRISELMLEDNVSPDEETDNLL  555



>gb|KFK42596.1| hypothetical protein AALP_AA1G016200 [Arabis alpina]
Length=521

 Score =   310 bits (795),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 182/464 (39%), Positives = 273/464 (59%), Gaps = 2/464 (0%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             +Y++L K      +  + LN+F+       K ++ R  K LR+ + +  A+++ + +E R
Sbjct  57    MYKRLSKLNVTGGTVAQALNQFIMEGIPVRKDDLFRCAKDLRKFRRHQHALEIFDWIEMR  116

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH-FTYGALLNCYCKELMTEKAE  1519
              MN + SD  I +DL+AK+KG+ AAE+YF  L  ++KNH  TYG+L+NCYC  L  EKA+
Sbjct  117   KMNFSVSDHAIRLDLIAKTKGLEAAESYFNGLDLSTKNHQSTYGSLMNCYCVGLNEEKAK  176

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
             A  EKM EL     ++P+N+LM++Y R GQPEK+  ++  +K   I P   TY+IWM++ 
Sbjct  177   AHFEKMDELKFVNNTLPFNNLMSMYMRLGQPEKVSELVDVMKLRGIAPCWITYSIWMQSC  236

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
              +L D+ G+E++IDEM  D      W TYSNLA+I+  AGL ++AE ALK +E+K  P N
Sbjct  237   GSLNDMEGLEKIIDEMGDDSEAKATWNTYSNLAAIFTKAGLYERAESALKSMEEKMNPTN  296

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
               A+ FLI+LY  I    EVYR W SL  A P+  N+SYL MIQ L  L D+ G +K F 
Sbjct  297   RDAHHFLISLYAGISKAPEVYRAWESLNKARPEVNNMSYLVMIQALSKLGDIDGIKKVFT  356

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWES    YD+R+ N  I  Y K+ + ++A+++   A +    P +K  ++ + + L+NG
Sbjct  357   EWESRCWAYDMRLVNIAINTYLKENMYQEAEKVLDNAMKKCKGPFSKARQLLMIFLLENG  416

Query  798   EISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHL  619
             +   A+  +E A++    +   W  S  +V     HFE  KDV+GAE     L KS   L
Sbjct  417   KADLAMKHLEAAVSNTEENKDDWSWSSELVSLWFLHFEKSKDVDGAEEFCKILSKSRP-L  475

Query  618   GAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
              +E +  L++ YAAA KT   MR R+     E+S+E + LL  +
Sbjct  476   DSETVTFLMKVYAAAEKTCPDMRERLLQHKIEVSDEIQDLLQKV  519



>ref|XP_008453823.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like isoform X2 [Cucumis melo]
Length=411

 Score =   306 bits (785),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 178/417 (43%), Positives = 260/417 (62%), Gaps = 12/417 (3%)
 Frame = -2

Query  1713  ETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELM  1534
             E ME R +N + +D  + +DL++K  GI AAE YF +LP ++KN  TYGALLNCYCKE+M
Sbjct  2     EWMEIRKINYSFTDYALRLDLISKVNGITAAEKYFYDLPPSAKNRCTYGALLNCYCKEMM  61

Query  1533  TEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNI  1354
              EKA  L +KM EL   +TS+ +N+LMT+Y R  QPEK+P +I E+K+      +FTYN+
Sbjct  62    EEKASTLFKKMDELKF-VTSLAFNNLMTMYMRMDQPEKVPPLIGEMKQRGFYLTTFTYNV  120

Query  1353  WMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelek-  1177
             WM + A+L DI  VE +++EMK +     DWTT+SNLAS Y  AG  +KAE ALK++E+ 
Sbjct  121   WMNSCASLNDIGKVEEILEEMKMEDSNKLDWTTFSNLASFYVKAGQLEKAELALKKVEEE  180

Query  1176  -KNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMP  1000
              K+  ++  AY  LI+LY    NL EV RIW  L+  +P   N SYL M+Q L  L D+ 
Sbjct  181   IKSDKKDRLAYHCLISLYASTSNLSEVNRIWNLLKSVYPTMTNTSYLVMLQALSKLKDIE  240

Query  999   GAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFL  820
             G +K +KEWES    +D+R+ N +IGAY +Q + + A  + + A +    P ++  E F+
Sbjct  241   GLKKTYKEWESICHIFDLRLVNVIIGAYLQQDMYEDAAMIFEDAIKRSKGPFSRAREKFM  300

Query  819   DYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAE---RVL  649
              Y+LK  ++ SA   +E AI+  +   ++W PS       + +FE +KDVEGAE   R+L
Sbjct  301   VYFLKLKQVDSAFSHLESAISESK--EKEWHPSLATTNAFLNYFEEEKDVEGAEDFARIL  358

Query  648   GNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
               L K  D  G  L   L++TY AAGK++  MR+R+K ++  +S E ++LL  +  +
Sbjct  359   KRL-KCLDESGYHL---LLKTYVAAGKSAPDMRQRLKEDDIGISSELEELLGTVCPQ  411



>ref|XP_011041055.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like isoform X2 [Populus euphratica]
Length=418

 Score =   306 bits (784),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 178/423 (42%), Positives = 258/423 (61%), Gaps = 21/423 (5%)
 Frame = -2

Query  1713  ETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELM  1534
             E M+KR MN +     +++DL+AK+KGIAAAE YF NL  + +NH T+GALL+CYC+ELM
Sbjct  2     EWMQKRKMNVS---HAVYLDLIAKTKGIAAAENYFDNLSPSEQNHSTHGALLSCYCRELM  58

Query  1533  TEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNI  1354
             +EKA  L EKM ++    TS+P+N+L++L+ R  QPEK+  I+QE+K+  I P +FTYN+
Sbjct  59    SEKALTLFEKMDKMKFLSTSLPFNNLISLHLRLDQPEKVLPIVQEMKQKGISPCTFTYNM  118

Query  1353  WMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekK  1174
             WM++   L D  GVERV+DEMK DG+    WTTY+NLA+IY  AG  DKAE ALK++E++
Sbjct  119   WMQSYGCLNDFEGVERVLDEMKMDGQKNFSWTTYTNLATIYVKAGHFDKAESALKKVEEQ  178

Query  1173  -NTPRNLT----------AYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQ  1027
                 R +           AY FLITLY    NL EV R+W SL+  F  T N+SYL M+ 
Sbjct  179   IERGREIKKKRRQGDYREAYHFLITLYAGTSNLGEVNRVWNSLKSNFHTTTNVSYLTMLH  238

Query  1026  VLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGl--lkkakelrkrAQRSGA  853
              L  L D+ G  KCFKEWES   +YD+R+AN  I A  +  +             +  G 
Sbjct  239   TLAKLKDVEGLLKCFKEWESSCHSYDMRLANVAIRACLEHDMYEEAALIFDNALKRTEGL  298

Query  852   KPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKD  673
               NA+  E+F+ ++LKN ++  A+  ++ A +  +    +W P P  V     +FE +KD
Sbjct  299   FFNAR--EMFMVFFLKNHQLDLALKHMKAAFSEVK--EIEWQPEPKTVSAFFAYFEDEKD  354

Query  672   VEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLD  493
             V GAER+   LK   + L +   + L++TY AAG  +  MR+R++ +  E++ E + LL+
Sbjct  355   VNGAERLCKILKHI-NRLDSNAYDLLLKTYIAAGNLAPEMRQRLEEDGIEINPELENLLE  413

Query  492   VIS  484
              + 
Sbjct  414   RVC  416



>ref|XP_006429067.1| hypothetical protein CICLE_v10011521mg [Citrus clementina]
 gb|ESR42307.1| hypothetical protein CICLE_v10011521mg [Citrus clementina]
Length=508

 Score =   307 bits (787),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 192/465 (41%), Positives = 283/465 (61%), Gaps = 7/465 (2%)
 Frame = -2

Query  1884  EEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM  1705
             E+ LY++L   G    S    LN ++   K+  K  +   V+ LR+   Y  A+++ E M
Sbjct  43    EDKLYKRLSALGATGGSVTGALNAYIMEGKTVRKDMLEYCVRSLRKFGRYRHALEVIEWM  102

Query  1704  EKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
             E R ++ + +D  +++DL AK+KGIAAAE YF +L E +KN +TYGALLNCYCKELMTE+
Sbjct  103   ESRKIHFSYTDFAVYLDLTAKTKGIAAAEEYFNSLSEYAKNRYTYGALLNCYCKELMTER  162

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             A AL EKM EL     ++ +N+L T+Y R GQPEK+  ++ ++K+ +I  D+ TY +WM+
Sbjct  163   ALALFEKMDELKFLGNTVAFNNLSTMYLRLGQPEKVRPLVNQMKQRNISLDNLTYIVWMQ  222

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             + + L DI GVERV  EM  +      WTTYSNLASIY  A L +KAE ALK+LE+   P
Sbjct  223   SYSHLNDIDGVERVFYEMCNECEDKCRWTTYSNLASIYVKAELFEKAELALKKLEEMK-P  281

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             R+  AY FLI+LY    NL  V R+W  L+  FP T N S L ++Q L  LN +   ++C
Sbjct  282   RDRKAYHFLISLYCNTSNLDAVNRVWGILKSTFPPT-NTSSLVLLQALAKLNAIDILKQC  340

Query  984   FKEWESGQTTYDIRVANALIGAY-AKQGllkkakelrkrAQRSGAKPN-AKTWEIFLDYY  811
             F+EWES  ++YD+R+A+ +I AY  K    + A       +R+ A     K+ E F+ YY
Sbjct  341   FEEWESRCSSYDMRLADVIIRAYLQKDMYEEAALIFNNAKKRANASARFFKSRESFMIYY  400

Query  810   LKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKS  631
             L++ ++  A++ +E A++  +     W P  V V    R FE +KDV+GAE     L KS
Sbjct  401   LRSRQLDLALNEMEAALSEAK--QFHWRPMQVTVDTFFRFFEEEKDVDGAEEFCKVL-KS  457

Query  630   EDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
              + L       LI+TY AAGK ++ MR+R++ ++ E+++E + LL
Sbjct  458   LNCLDFSAYSLLIKTYIAAGKLASDMRQRLEDDDIEITDELEDLL  502



>gb|KFK30785.1| hypothetical protein AALP_AA6G025600 [Arabis alpina]
Length=507

 Score =   305 bits (781),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 181/466 (39%), Positives = 272/466 (58%), Gaps = 4/466 (1%)
 Frame = -2

Query  1878  ALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEK  1699
             ++Y KL K G       + LN+F+     AYK ++ R VK LR  +    A+++ E ME+
Sbjct  46    SVYNKLTKLGPTRGKIDETLNQFIIEGNHAYKPDLIRYVKDLRAYRQPQRALEVFEWMER  105

Query  1698  RGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAE  1519
             + +  + SD  I +DL+AK+KG+ AAE+YF  L  ++K   TYGALLNCYC E    KA+
Sbjct  106   KEIEFSASDHAIRLDLIAKTKGLEAAESYFNKLDPSTKTISTYGALLNCYCVEREEGKAK  165

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
             A  ++M +LNL  +S+P+N+LM +Y R GQPEK+ A++  +KE  I     TY++W+++ 
Sbjct  166   AHFDEMSDLNLVTSSLPFNNLMAMYLRLGQPEKVVALVVAMKERSIPLCGVTYSMWIQSY  225

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
              +L D+ GVE+V++E K DG     W T++NLA+IY  AGL  KAE+ALK LE+   P  
Sbjct  226   GSLNDLDGVEKVLEEKKADGEGCFSWDTFANLAAIYGKAGLYSKAEEALKSLEEMMNPHK  285

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
               ++ FLI+LY  I N  EVYR+W  L+   PK  N S   M+Q L  LND+ G +K F 
Sbjct  286   RDSFHFLISLYAGISNASEVYRVWDLLKKRHPKVNNTSCFTMLQALSKLNDIDGIKKIFT  345

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWE+   TYD+R+AN +I +Y KQ   ++A+ +   A +      +K  ++ + + LK  
Sbjct  346   EWETTCWTYDMRLANVMISSYLKQNKYEEAEAVFNNAMKKCKGQFSKARQLLMIHLLKTD  405

Query  798   EISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHL  619
             +   A+   E  +T      + W  S  ++     HFE  KDV GAE  +  L K     
Sbjct  406   QADLALKHFEAGVT---DQDKNWTWSSELIRSFFLHFEQSKDVNGAEEFIKTLTKWNPQ-  461

Query  618   GAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISA  481
              +E    LI+TY AA K S  MR+R++ +  E++EE ++LL  IS+
Sbjct  462   DSETFTLLIKTYIAAEKASPGMRKRLEEQGIEINEEMERLLSNISS  507



>ref|XP_009382489.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=519

 Score =   305 bits (781),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 192/480 (40%), Positives = 286/480 (60%), Gaps = 9/480 (2%)
 Frame = -2

Query  1914  IGKRSTKKYLEEALYRKLLKEG-GLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKL  1738
             +G+R   K     LYR+L   G     S  K LN++L+  ++    ++ + VK LR+   
Sbjct  45    VGERKESK----PLYRRLSALGRAPAGSVTKTLNKWLREGRTVTATQLMKYVKELRKYNR  100

Query  1737  YSPAIKLSETME-KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGAL  1561
             YS A++L E M   RGMN + ++  I +DL++K KG  +AE YF  LPE +KN  TYG+L
Sbjct  101   YSHALELMEWMSGTRGMNISYTNHAIRLDLISKVKGTESAEEYFSQLPEPAKNERTYGSL  160

Query  1560  LNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDI  1381
             LNCYC     +KA +L   MK+ N+  +++ +N+LM+LY + GQPE      QE+K  +I
Sbjct  161   LNCYCSGKNADKAISLYNHMKDRNIASSTLVHNNLMSLYMKLGQPENAITQFQEMKSKNI  220

Query  1380  MPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkae  1201
             +PD+ T  I M   A+L DI  VE VI EM+  G V   W+ YS LA+IY+ AG++ KAE
Sbjct  221   VPDNLTCCILMNCYASLNDIVSVESVIKEMEEGGEVTLQWSAYSTLAAIYSSAGMATKAE  280

Query  1200  kalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVL  1021
              ALK+LE     R+   + FLI+LY  IG L EV RIW SL+  +    N+SYL M+Q L
Sbjct  281   SALKQLEGLVDKRDWMPFHFLISLYAGIGKLGEVKRIWMSLKEVYSNPINMSYLKMLQAL  340

Query  1020  VNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNA  841
               L+D+ G +  ++EWESG T YD+R+ N +IG Y K+ ++++A+ + ++A   GA P+ 
Sbjct  341   SKLDDIHGLKLLYEEWESGYTAYDLRLTNLMIGTYLKKDMIREAESIWQKASERGAVPDF  400

Query  840   KTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGA  661
              T + FLDY LKN +   A+  +E A +  + D  +W  +   V   ++ FE  KDVEG 
Sbjct  401   WTCDRFLDYSLKNKDTGLALRWLETATSMVKQD--EWKLNEDKVDAFLKAFEEAKDVEGL  458

Query  660   ERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISA  481
             E    +L++ +  L     E+L+RTY AAGK +  + RR+K +  ++S E KKLL  + A
Sbjct  459   EEFCKSLRRLK-CLDLNAYEALLRTYLAAGKKNPGLHRRIKDDKIKISSETKKLLQWVCA  517



>ref|XP_009134458.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial [Brassica rapa]
Length=501

 Score =   302 bits (773),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 184/456 (40%), Positives = 271/456 (59%), Gaps = 10/456 (2%)
 Frame = -2

Query  1908  KRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSP  1729
             +++ KK  + ++Y+KL   G       + LN+F        K +  R  K LR+ +L   
Sbjct  36    RKTAKK--QRSVYKKLSNLGSKGGKMEETLNKFAMEGIPIVKHDFVRYAKDLRKNRLPQR  93

Query  1728  AIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCY  1549
             A+++ E MEK+ +  T SD  I +DL+AK+KG+ AAE YF  L  +SKN  +YGALLNCY
Sbjct  94    ALEVFEWMEKKEIAFTGSDHAIRLDLIAKTKGLEAAETYFNTLDPSSKNRSSYGALLNCY  153

Query  1548  CKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDS  1369
             C E   +KA++   +M +LNL   S+P+N+LM +Y R GQ +K+PA++  +KE +I P +
Sbjct  154   CVERDEDKAKSHFNEMVDLNLVTNSLPFNNLMAMYLRLGQYDKVPALVLAMKEKNIPPCA  213

Query  1368  FTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalk  1189
              TY++W+++  +L D+ GVE+V++EMK D      W T++NLASIYA AGL  KAE ALK
Sbjct  214   ITYSMWIQSCGSLNDLDGVEKVVEEMKDDS----SWDTFANLASIYAKAGLFSKAEAALK  269

Query  1188  elekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLN  1009
              LE+K  P    +Y FLI+LY  I N  EVYR+W  L+   PK  N S L M+Q L  LN
Sbjct  270   SLEEKMNPHKRDSYHFLISLYAGISNPSEVYRVWELLKKGHPKVNNSSSLAMVQALSRLN  329

Query  1008  DMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWE  829
             D  G +K FKEWES   TYD+RVAN +I +Y K+ + ++A+ +   A +      +K  +
Sbjct  330   DFDGIKKVFKEWESTCYTYDMRVANVMISSYLKENMYEEAEAVFDGAVKKCKGQLSKARQ  389

Query  828   IFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVL  649
             + + Y LKN +   A+  +E A+       + W  S  +V     HFE  KDV+GAE + 
Sbjct  390   LLMVYLLKNDQAGLALKHLEAAVL---DQDKNWSWSSELVSLFFLHFEKSKDVDGAEELC  446

Query  648   GNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRV  541
               L K    LG+E    L++TY AA +T   M++R+
Sbjct  447   KTLVKWSP-LGSESYTPLLKTYVAAERTCNGMQKRL  481



>gb|KDO35896.1| hypothetical protein CISIN_1g048394mg, partial [Citrus sinensis]
Length=485

 Score =   300 bits (769),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 188/448 (42%), Positives = 269/448 (60%), Gaps = 7/448 (2%)
 Frame = -2

Query  1884  EEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM  1705
             E+ LY++L   G    S    LN ++   K+  K  +   V+ LR+   Y  A+++ E M
Sbjct  43    EDKLYKRLSALGATGGSVTGALNAYIMEGKTVRKDMLEYCVRSLRKFGRYRHALEVIEWM  102

Query  1704  EKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
             E R M+ + +D  +++DL AK+ GIAAAE YF  L E +KN +TYGALLNCYCKELMTE+
Sbjct  103   ESRKMHFSYTDFAVYLDLTAKTNGIAAAEKYFNGLSEYAKNRYTYGALLNCYCKELMTER  162

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             A AL EKM EL     ++ +N+L T+Y R GQPEK+  ++ ++K+ +I  D+ TY +WM+
Sbjct  163   ALALFEKMDELKFLGNTVAFNNLSTMYLRLGQPEKVRPLVNQMKQRNISLDNLTYIVWMQ  222

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             + + L DI GVERV  EM  +      WTTYSNLASIY  A L +KAE ALK+LE+   P
Sbjct  223   SYSHLNDIDGVERVFYEMCNECEDKCRWTTYSNLASIYVKAELFEKAELALKKLEEMK-P  281

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             R+  AY FLI+LY    NL  V R+W  L+  FP T N SYL ++Q L  LN +   ++C
Sbjct  282   RDRKAYHFLISLYCNTSNLDAVNRVWGILKSTFPPT-NTSYLVLLQALAKLNAIDILKQC  340

Query  984   FKEWESGQTTYDIRVANALIGAY-AKQGllkkakelrkrAQRSGAKPN-AKTWEIFLDYY  811
             F+EWES  ++YD+R+A+ +I AY  K    + A       +R+ A     K+ E F+ YY
Sbjct  341   FEEWESRCSSYDMRLADVIIRAYLQKDMYEEAALIFNNAKKRANASARFFKSRESFMIYY  400

Query  810   LKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKS  631
             L++ ++  A++ +E A++  +     W P  V V    R FE +KDV+GAE     L KS
Sbjct  401   LRSRQLDLALNEMEAALSEAK--QFHWRPMQVTVDTFFRFFEEEKDVDGAEEFCKVL-KS  457

Query  630   EDHLGAELLESLIRTYAAAGKTSTVMRR  547
              + L       LI+TY AAGK ++ MR+
Sbjct  458   LNCLDFSAYSLLIKTYIAAGKLASDMRQ  485



>emb|CDX91822.1| BnaC03g31240D [Brassica napus]
Length=500

 Score =   299 bits (766),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 181/456 (40%), Positives = 272/456 (60%), Gaps = 10/456 (2%)
 Frame = -2

Query  1908  KRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSP  1729
             +++ KK+   ++Y+KL   G       + LN+         K ++ R  K LR+ +L   
Sbjct  35    RKAAKKH--RSVYKKLSNLGSRGGKMEETLNKLTMEGIPIIKHDLVRYAKDLRKNRLPQR  92

Query  1728  AIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCY  1549
             A+++ E MEK+ +  T SD  I +DL+AK+KG+ AAE+YF  L  +SKN  +YG+LLNCY
Sbjct  93    ALEVFEWMEKKEIAFTGSDHAIRLDLIAKTKGLEAAESYFNTLDPSSKNRSSYGSLLNCY  152

Query  1548  CKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDS  1369
             C E   +KA++   +M +LNL   S+P+N+LM +Y R GQ +K+P+++ E+KE +I P +
Sbjct  153   CVERNEDKAKSHFNEMVDLNLVTNSLPFNNLMAMYLRLGQYDKVPSLVLEMKEKNIPPCA  212

Query  1368  FTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalk  1189
              TY++W+++  +L D+ GVE+V++EMK D      W T++NLASIYA AGL  KAE ALK
Sbjct  213   ITYSMWIQSCGSLNDLDGVEKVVEEMKDDS----SWDTFANLASIYAKAGLYSKAEAALK  268

Query  1188  elekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLN  1009
              LE+K  P    +Y FLI+LY  I N  EVYR+W  L+ A P   N S L MIQ L  LN
Sbjct  269   SLEEKMNPHKRDSYHFLISLYAGISNPSEVYRVWELLKKAHPNVNNSSSLAMIQALSRLN  328

Query  1008  DMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWE  829
             D  G +K FKEWES   TYD+RVAN +I +Y K+ + ++A+ +   A +      +K  +
Sbjct  329   DFDGIKKVFKEWESTCWTYDMRVANVMISSYLKENMYEEAEAVFDGAVKKCKGQLSKARQ  388

Query  828   IFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVL  649
             + + Y LKN +   A+  +E A+       + W  S  ++     HFE  KDV+GAE + 
Sbjct  389   LLMMYLLKNDQADLALKHLEAAVL---DQDKNWSWSSELICSFFLHFEKSKDVDGAEELC  445

Query  648   GNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRV  541
               L K    LG+E    L++TY AA +    M++R+
Sbjct  446   KTLAKWSP-LGSESYTLLLKTYVAAERACNGMQKRL  480



>emb|CDX90962.1| BnaA03g26420D [Brassica napus]
Length=501

 Score =   299 bits (766),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 183/456 (40%), Positives = 270/456 (59%), Gaps = 10/456 (2%)
 Frame = -2

Query  1908  KRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSP  1729
             +++ KK  + ++Y+KL   G       + LN+         K +  R  K LR+ +L   
Sbjct  36    RKTAKK--QRSVYKKLSNLGSRGGKMEETLNKVAMEGIPIVKHDFVRYAKDLRKNRLPQR  93

Query  1728  AIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCY  1549
             A+++ E MEK+ +  T SD  I +DL+AK+KG+ AAE YF  L  +SKN  +YGALLNCY
Sbjct  94    ALEVFEWMEKKEIAFTGSDHAIRLDLIAKTKGLEAAETYFNTLDPSSKNRSSYGALLNCY  153

Query  1548  CKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDS  1369
             C E   +KA++   +M +LNL   S+P+N+LM +Y R GQ +K+PA++  +KE +I P +
Sbjct  154   CVERDEDKAKSHFNEMVDLNLVTNSLPFNNLMAMYLRLGQYDKVPALVLAMKEKNIPPCA  213

Query  1368  FTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalk  1189
              TY++W+++  +L D+ GVE+V++EMK D      W T++NLASIYA AGL  KAE ALK
Sbjct  214   ITYSMWIQSCGSLNDLDGVEKVVEEMKDDS----SWDTFANLASIYAKAGLFSKAEAALK  269

Query  1188  elekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLN  1009
              LE+K  P    +Y FLI+LY  I N  EVYR+W  L+   PK  N S L M+Q L  LN
Sbjct  270   SLEEKMNPHKRDSYHFLISLYAGISNPSEVYRVWELLKKGHPKVNNSSSLAMVQALSRLN  329

Query  1008  DMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWE  829
             D  G +K FKEWES   TYD+RVAN +I +Y K+ + ++A+ +   A +      +K  +
Sbjct  330   DFDGIKKVFKEWESTCYTYDMRVANVMISSYLKENMYEEAEAVFDGAVKKCKGQLSKARQ  389

Query  828   IFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVL  649
             + + Y LKN +   A+  +E A+       + W  S  +V     HFE  KDV+GAE + 
Sbjct  390   LLMVYLLKNDQAGLALKHLEAAVL---DQDKNWSWSSELVSLFFLHFEKSKDVDGAEELC  446

Query  648   GNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRV  541
               L K    LG+E    L++TY AA +T   M++R+
Sbjct  447   KTLVKWSP-LGSESYTPLLKTYVAAERTCNGMQKRL  481



>ref|XP_002872860.1| hypothetical protein ARALYDRAFT_490379 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49119.1| hypothetical protein ARALYDRAFT_490379 [Arabidopsis lyrata subsp. 
lyrata]
Length=500

 Score =   298 bits (764),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 183/473 (39%), Positives = 270/473 (57%), Gaps = 4/473 (1%)
 Frame = -2

Query  1899  TKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIK  1720
             TK     ++Y+KL   G       + LN+ +       K E+ R  K LR+ +    A++
Sbjct  32    TKAKKNPSVYKKLSSLGTRGGKMEETLNQLVMEGVPVKKHELIRYAKDLRKFRQPQRALE  91

Query  1719  LSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKE  1540
             + E ME++ +  T SD  I +DL+AK+KG+ AAE YF +L ++ KN  TYG+LLNCYC E
Sbjct  92    IFEWMERKEIVFTGSDHAIRLDLIAKTKGLEAAETYFNSLNDSIKNQSTYGSLLNCYCVE  151

Query  1539  LMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTY  1360
                +KA+A  E M +LN    S+P+N+LM +Y R GQ EK+PA++  +K+ +I P   TY
Sbjct  152   KEEDKAKAHFENMVDLNHVSNSLPFNNLMAMYLRIGQSEKVPALVVAMKQKNITPCDITY  211

Query  1359  NIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkele  1180
             ++W+++  +L D+ GVE+V+DEMK +G     W T++NLA+IY   GL DKAE+ALK LE
Sbjct  212   SMWIQSCGSLKDLDGVEKVLDEMKAEGEGISSWDTFANLAAIYIKVGLYDKAEEALKSLE  271

Query  1179  kKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMP  1000
              K  P     Y FLI+LY  I N  EVYR+W  L+   P   N SYL M+Q L  LND+ 
Sbjct  272   NKMNPHIRDCYHFLISLYAGIANASEVYRVWDLLKKRHPNVNNSSYLTMLQALSKLNDID  331

Query  999   GAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFL  820
             G +K F EWES   TYD+R+AN  I +Y KQ + ++A+ +   A        +K  ++ +
Sbjct  332   GIKKIFTEWESTCWTYDMRMANVAISSYLKQNMYEEAEAVFNGAMTKCKGQFSKARQLLM  391

Query  819   DYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNL  640
              + LKN +   A+   E A+       + W  S  ++     HFE  KDV+GAE     L
Sbjct  392   MHLLKNDQADLALKHFEAAVLDL---DKNWTWSSELISSFFLHFEEAKDVDGAEEFCKTL  448

Query  639   KKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISA  481
              K    LG+E    L++TY +A K    M++R++ +  ++ EE   LL  I A
Sbjct  449   TKWSP-LGSETYTLLMKTYLSAEKACPDMKKRLEEQGIQVDEEQDCLLSKICA  500



>ref|XP_010422661.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial [Camelina sativa]
Length=501

 Score =   297 bits (760),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 178/472 (38%), Positives = 275/472 (58%), Gaps = 5/472 (1%)
 Frame = -2

Query  1899  TKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIK  1720
             TK     ++Y+KL   G       + LN+F+       K E+ R  K LR+ +    A++
Sbjct  32    TKAKKHPSIYKKLSSLGTRGGKMEETLNQFVMEGVPVKKHELIRYAKDLRKFRQPQRALE  91

Query  1719  LSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKE  1540
             + E ME++ +  ++SD  I +DL+AK+KG+ AAE YF +L ++SKN  TYG+LLNCYC E
Sbjct  92    IFEWMERKEIAFSSSDHAIRLDLIAKTKGLEAAENYFNSLDDSSKNQSTYGSLLNCYCVE  151

Query  1539  LMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTY  1360
                EKA+A  E M +LN    S+P+N+LM +Y R  QPEK+P ++  +K+ +I P   TY
Sbjct  152   REEEKAKAHFENMVDLNHVSNSLPFNNLMAMYLRLDQPEKVPEVVVAMKQRNITPCDITY  211

Query  1359  NIWMRALAALGDISGVERVIDEMKRDG-RVAEDWTTYSNLASIYADAGLSDkaekalkel  1183
             ++W+++  +L D+ GVE+V++EMK +G   +  W T++NLA+IY   GL DKAE+ALK L
Sbjct  212   SMWIQSCGSLKDLDGVEKVLEEMKAEGEETSSSWDTFANLAAIYVKVGLYDKAEEALKSL  271

Query  1182  ekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDM  1003
             E K  P    ++ FLI+LY  + N  EVYR+W  L+   P   N SYL ++Q L  LND+
Sbjct  272   ESKMNPHLRDSFHFLISLYAGVSNAKEVYRVWDLLKKRHPNVNNTSYLIILQALSKLNDV  331

Query  1002  PGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIF  823
              G ++ F EWES   TYD+R+AN  I +Y KQ + + A+ +   A +      +K  ++ 
Sbjct  332   DGVKRIFTEWESTCWTYDMRMANVAISSYLKQNMYEDAEAVFNGAMKKCKGQFSKARQLL  391

Query  822   LDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGN  643
             + + LKN +   A+   E A+       + W+ S  ++     HFE  KDV+GAE     
Sbjct  392   MMHLLKNDQADLALKHFEAAVL---DQDKNWIWSSELIRLFFLHFEEAKDVDGAEEFCKT  448

Query  642   LKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
             L K    L +E    L++TY +AG+    MR+R++ +  ++ EE + LL  I
Sbjct  449   LTKWSP-LDSETYTLLMKTYLSAGEACPDMRKRLEEQGIQVDEEQECLLSKI  499



>ref|XP_007145137.1| hypothetical protein PHAVU_007G213200g [Phaseolus vulgaris]
 gb|ESW17131.1| hypothetical protein PHAVU_007G213200g [Phaseolus vulgaris]
Length=476

 Score =   295 bits (755),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 175/451 (39%), Positives = 273/451 (61%), Gaps = 11/451 (2%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LYR L        S  + LN ++   K+  K E+ R V+ LR+ + +  A+++ E ME R
Sbjct  30    LYRILSALDMTGGSVSETLNSYIMQGKAVKKTELERCVEQLRRYRKFQHALEIIEWMEMR  89

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
              +N + ++  + +DLV+K+KG+  AE +F  LP+ +KN +TYGALLNCYCKELM +KA +
Sbjct  90    KINFSWNNYAVQLDLVSKTKGVVEAENFFSGLPDPAKNKYTYGALLNCYCKELMKDKALS  149

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
                KM EL   +TS+ YN+LM+L+ R G+P+K+P ++  +K   +   SFTY+IWM + A
Sbjct  150   HFHKMDELGY-VTSLSYNNLMSLFMRNGEPQKVPELVGVMKRRSLPLSSFTYHIWMNSCA  208

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNL  1156
             + GD+ GVERV +EM+ +  ++  W TYSNLA+IY      +KAEK LK LEK+  PR  
Sbjct  209   SSGDLDGVERVYEEMRTEELIS--WQTYSNLAAIYVKVKDFEKAEKMLKMLEKQVKPRQR  266

Query  1155  TAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKE  976
              AY  L+ LY   GNL EV+R+W SL+   P T N SYL M+  L  L D+ G  KCFKE
Sbjct  267   DAYHCLLGLYAGTGNLGEVHRVWNSLKSVSPVT-NFSYLIMLSTLRRLKDIEGLTKCFKE  325

Query  975   WESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGE  796
             WE+   TYD R+    + AY  Q ++++A  + + A R   +P  +  E+F+ Y+L+  +
Sbjct  326   WEASCVTYDARLVGVCVSAYLGQNMVEEAALVFEGASRRSKRPLFRIEEMFMLYFLEKRQ  385

Query  795   ISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLG  616
             + +AV  ++ A +  +GD + W PSP +VG  ++++E + DV+G + +   LK +     
Sbjct  386   LEAAVRHLQAAFSEVKGDDE-WHPSPKVVGAFLKYYEEETDVDGVDELSKILKAN-----  439

Query  615   AELLESLIRTYAAAGKTSTVMRRRVKMENAE  523
               + +S I+T   A K+S     R+K ++ +
Sbjct  440   -NIDDSWIKTCINASKSSLETDPRLKEDDLQ  469



>ref|XP_003567580.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial-like [Brachypodium distachyon]
Length=545

 Score =   297 bits (760),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 181/467 (39%), Positives = 286/467 (61%), Gaps = 16/467 (3%)
 Frame = -2

Query  1875  LYRKLLKEGGL-ENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM-E  1702
             LYR+L   G   E S  + LN++++  + A   ++ R VK LR+ K ++ A++L + M  
Sbjct  80    LYRRLSALGNAGEGSVSRVLNKWVREGREARSVDLERYVKELRKYKRHAQALELMDWMVH  139

Query  1701  KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKA  1522
              +GMN + ++  I +DLV K +GI AAE YF  LP+ +KNH TYGALLNCYC     EKA
Sbjct  140   TKGMNMSYTNHAIRLDLVYKVRGIEAAEKYFNGLPDPAKNHRTYGALLNCYCSSKKEEKA  199

Query  1521  EALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRA  1342
               L  KM +L +  +++P+N+LM+LY + GQ +K+  + +E+K  ++ PD+ T  + M +
Sbjct  200   TDLFHKMDDLGIASSTLPFNNLMSLYMKLGQHKKVAGLFEEMKAKNVKPDNLTCCVLMTS  259

Query  1341  LAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPR  1162
              AAL  I  VE V+ EM+ +   A  W+ YS LASIY  AGL +KAE ALK+LE    PR
Sbjct  260   YAALNKIDAVEEVLKEME-EKNAALGWSAYSTLASIYVSAGLVEKAESALKKLEGLVQPR  318

Query  1161  N-LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             +    + FL++LY  +GNL EV R+W  ++  FPK  N SY +M+Q L  LND    ++ 
Sbjct  319   DGRQPFDFLMSLYASVGNLSEVNRVWDVVKATFPKVTNTSYFSMLQALYKLNDADRIKQI  378

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             F+EWES    YD+++ N +  A+ K GL K+A+ L ++A+  GA  ++KT E+FLD+Y+ 
Sbjct  379   FEEWESNHECYDVKLTNIMTRAHLKNGLTKEAELLWEKAKAKGADFDSKTCELFLDHYMG  438

Query  804   NGEISSAVDCIEKAI----TTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLK  637
               ++ SA+  +E         G+ D +K       + +  ++FE +KDV+GAE++   L 
Sbjct  439   TEDMKSALHWVENVTKLPKKAGKLDQEK-------IQKFSKYFEEQKDVQGAEKLCSCL-  490

Query  636   KSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
             ++   +  ++ ESL+RTY AAG+T+  +R+++K +  E+  +  KLL
Sbjct  491   RTLGCIDGKVYESLLRTYLAAGETNHSLRQQIKDDKIEICYDIGKLL  537



>ref|XP_010429011.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial-like [Camelina sativa]
Length=504

 Score =   293 bits (751),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 182/501 (36%), Positives = 288/501 (57%), Gaps = 8/501 (2%)
 Frame = -2

Query  1986  SRQYQKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFL  1807
             +R++  TL  + + I   +S + ++  ++ K     ++YRKL   G       + LN+F+
Sbjct  9     ARRFCATLAAIPAEISGSASASASVPTKAKK---HPSIYRKLSSLGTRGGKIDETLNQFV  65

Query  1806  KSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIA  1627
                    K ++ R  K LR+ +    A+++ E ME + +  + SD  I +DL+AK+KG+ 
Sbjct  66    MEGVPVKKHDLIRYAKDLRKFRQPQRALEIFEWMETKEIAFSGSDHAIRLDLIAKTKGLE  125

Query  1626  AAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTL  1447
             AAE YF +L ++SKN  TYG+LLNCYC E   EKA+A  E M +LN    S+P+N+LM +
Sbjct  126   AAENYFNSLDDSSKNQSTYGSLLNCYCVEREEEKAKAHFENMVDLNHVSNSLPFNNLMAM  185

Query  1446  YTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDG-RVA  1270
             Y R  QPEK+P ++  +K+ +I P   TY++W+++  +L D+ GVE+V++EMK +G   +
Sbjct  186   YLRLDQPEKVPEVVVAMKQRNITPCDITYSMWIQSCGSLKDLDGVEKVLEEMKAEGEETS  245

Query  1269  EDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRI  1090
               W T++NLA+IY   GL DKAE+ALK LE K  P    ++ FLI+LY  + N  EVYR+
Sbjct  246   SSWDTFANLAAIYVKVGLYDKAEEALKSLESKMNPHLRDSFHFLISLYAGVSNAKEVYRV  305

Query  1089  WRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAK  910
             W  L+   P   N SYL ++Q L  LND+ G ++ F EWES   TYD+R+AN  I +Y K
Sbjct  306   WDLLKKRHPNVNNTSYLIILQALSKLNDVDGVKRIFTEWESTCWTYDMRMANVAISSYLK  365

Query  909   QGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKW  730
             Q + + A+ +   A +      +K  ++ + + LKN +   A+   E A+       + W
Sbjct  366   QNMYEDAEGVFNGAMKKYKGQFSKARQLLMMHLLKNDQADLALKHFEAAVL---DQDKNW  422

Query  729   VPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMR  550
               S  ++     HFE  KDV+GAE     L+K    L +E    L++TY +AG+    MR
Sbjct  423   TWSSELIRLFFLHFEEAKDVDGAEEFCRTLRKWSP-LDSETYTLLMKTYFSAGEDCPDMR  481

Query  549   RRVKMENAELSEEAKKLLDVI  487
             +R++ +  ++ EE + LL  I
Sbjct  482   KRLEEQGIQVDEEQECLLSKI  502



>dbj|BAK06496.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   294 bits (753),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 185/468 (40%), Positives = 288/468 (62%), Gaps = 18/468 (4%)
 Frame = -2

Query  1875  LYRKLLKEGGL-ENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM-E  1702
             LYR+L   G   E S    LN++L+  +     ++ R VK LR+ K +S A++L + M  
Sbjct  86    LYRRLSALGNAGEGSVSAVLNKWLREGRETRSVDLERYVKELRRYKRHSQALELMDWMVH  145

Query  1701  KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKA  1522
              +GMN + ++  I +DL+ K +G+ AAE YF  LP+ +KNH T+GALLNCYC     EKA
Sbjct  146   TKGMNMSYTNHAIRLDLIYKVRGLEAAEKYFEGLPDPAKNHRTFGALLNCYCSSKEEEKA  205

Query  1521  EALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRA  1342
               L  KM EL ++ +++P N+LM+LY + GQ +K+ ++ +E+KE ++ PD+ T  I M +
Sbjct  206   TDLYRKMDELGISSSTLPINNLMSLYMKLGQHKKVCSLFEEMKEKNVKPDNLTCCILMTS  265

Query  1341  LAALGDISGVERVIDEM-KRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             LAAL  I  VE+V+ EM ++DG +   W+ YS LASIY  AGL +KAE ALK+LE     
Sbjct  266   LAALNKIDDVEQVLKEMEEKDGVLG--WSAYSTLASIYQSAGLVEKAESALKKLEGLVQD  323

Query  1164  RN-LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEK  988
             R+    + FL++LY  +GNL EV R+W  ++  FPK  N SY +M+Q L+ LND    ++
Sbjct  324   RDGRQPFDFLMSLYASVGNLSEVKRVWGVVKATFPKVTNTSYFSMLQALLKLNDADYMKQ  383

Query  987   CFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYL  808
              F+EWES    YD ++ N +  A+ K G+ K+A+ L ++A+  GA  ++KT E+FLD+Y+
Sbjct  384   VFEEWESNHEFYDAKLTNVMTRAHLKNGMAKEAELLWEKAKEKGACFDSKTCELFLDHYM  443

Query  807   KNGEISSAVDCIEKAI----TTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNL  640
               G++ SA++ +E        T + D  K       + +  ++FE +KDV+GAER    L
Sbjct  444   VAGDMKSALNWVENVTKLPKKTAKLDQDK-------IPKFSKYFEEQKDVQGAERFCRCL  496

Query  639   KKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
              ++   +  +  ESL+RTY AAG+TS  +R+++K +  E+  +  KLL
Sbjct  497   -RALGCIDGKAYESLLRTYLAAGETSRSLRQQIKDDKIEICYDIGKLL  543



>ref|XP_010911077.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Elaeis guineensis]
Length=391

 Score =   288 bits (738),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 165/364 (45%), Positives = 239/364 (66%), Gaps = 4/364 (1%)
 Frame = -2

Query  1665  IHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNL  1486
             + ++L++K KGI AAE YF +LP+ +KN  TYGALLN Y +E + +KA +L EKMKELN 
Sbjct  32    VRLNLISKVKGIDAAEEYFSSLPDLAKNQQTYGALLNSYIQENIADKAISLYEKMKELNF  91

Query  1485  TLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVER  1306
               T++  N+LMTLY + GQ EK+  + +E+K  +I PD FTY + M + AA+ DI  VER
Sbjct  92    ASTTLVQNNLMTLYIKLGQHEKVIELFKEMKANNISPDDFTYCMLMNSYAAMNDIDSVER  151

Query  1305  VIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLY  1126
             VI+EMK +G +  DWT YSNLA+ Y  AGL  KAE ALK+LE     R+ TA+  LI+LY
Sbjct  152   VIEEMK-EGGITLDWTIYSNLAAHYNSAGLFQKAEAALKKLEVVIDKRDRTAFHHLISLY  210

Query  1125  GRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDI  946
               +GNL EV R+W+SL+ AF +T N+SYL M+Q L  L+++   ++CF+EWES   T D+
Sbjct  211   AGVGNLAEVNRVWKSLKAAFTRTTNMSYLIMLQALNKLDNIDELKQCFEEWESACVTCDV  270

Query  945   RVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEK  766
             R+AN LIGAY ++ ++ +A  L K+  + GA  + +T+E+F+ YYLK+  +  A+ C+E 
Sbjct  271   RLANVLIGAYLRKEMVNEALTLWKKTMQKGAHSDFRTFELFIRYYLKSQNMDLALKCLED  330

Query  765   AITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRT  586
             A    +  G+K  P   +V E +++FE  KDV+   +    L K  D+  AE  ESL+  
Sbjct  331   ATNLAKKVGRK--PKKELVNEFLKYFEEVKDVDRV-KSFCKLLKQLDYPDAEAYESLLLK  387

Query  585   YAAA  574
             Y A+
Sbjct  388   YLAS  391



>emb|CDY50358.1| BnaA09g13070D [Brassica napus]
Length=235

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 177/227 (78%), Gaps = 0/227 (0%)
 Frame = -2

Query  1173  NTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGA  994
             NT R+  AYQFL+TLYGR+G L EVYRIWRSLRLA PKT+N++YLNMIQVLVNL D+PGA
Sbjct  3     NTERDFKAYQFLVTLYGRLGKLNEVYRIWRSLRLAMPKTSNVAYLNMIQVLVNLKDLPGA  62

Query  993   EKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDY  814
             E  FKEW++  +TYDIRV N +IGAYA++GL++KA EL++++ R G K NAKTWE+F+DY
Sbjct  63    ETLFKEWQANCSTYDIRVVNVMIGAYAREGLIEKANELKEKSPRRGGKLNAKTWELFMDY  122

Query  813   YLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKK  634
             Y+K GE + A++C+ KA++ G+GDG KW+PS   V  LM  FE KKDV GAE ++  LKK
Sbjct  123   YVKRGETAQALECMTKAVSIGKGDGGKWIPSEDTVRALMSQFEEKKDVNGAESLIEILKK  182

Query  633   SEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLD  493
               D +GAE   SLIRTYAAAGK+   MR+R+KME  ++ +  +KLLD
Sbjct  183   GTDDVGAETFASLIRTYAAAGKSHPAMRQRLKMEKVKVDKATEKLLD  229



>ref|NP_567220.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q93WC5.1|PP300_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK62637.1| AT4g01990/T7B11_26 [Arabidopsis thaliana]
 gb|AAL15390.1| AT4g01990/T7B11_26 [Arabidopsis thaliana]
 gb|AEE82108.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=502

 Score =   291 bits (744),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 182/474 (38%), Positives = 268/474 (57%), Gaps = 9/474 (2%)
 Frame = -2

Query  1899  TKKYLEEALYRKLLKEGGLENSAGK---NLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSP  1729
             TK     ++Y+KL   G      GK    LN+F+       K ++ R  K LR+ +    
Sbjct  33    TKAKKHRSIYKKLSSLGT--RGGGKMEETLNQFVMEGVPVKKHDLIRYAKDLRKFRQPQR  90

Query  1728  AIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCY  1549
             A+++ E ME++ +  T SD  I ++L+AKSKG+ AAE YF +L ++ KN  TYG+LLNCY
Sbjct  91    ALEIFEWMERKEIAFTGSDHAIRLNLIAKSKGLEAAETYFNSLDDSIKNQSTYGSLLNCY  150

Query  1548  CKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDS  1369
             C E    KA+A  E M +LN    S+P+N+LM +Y   GQPEK+PA++  +KE  I P  
Sbjct  151   CVEKEEVKAKAHFENMVDLNHVSNSLPFNNLMAMYMGLGQPEKVPALVVAMKEKSITPCD  210

Query  1368  FTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalk  1189
              TY++W+++  +L D+ GVE+V+DEMK +G     W T++NLA+IY   GL  KAE+ALK
Sbjct  211   ITYSMWIQSCGSLKDLDGVEKVLDEMKAEGEGIFSWNTFANLAAIYIKVGLYGKAEEALK  270

Query  1188  elekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLN  1009
              LE    P     Y FLI LY  I N  EVYR+W  L+  +P   N SYL M++ L  L+
Sbjct  271   SLENNMNPDVRDCYHFLINLYTGIANASEVYRVWDLLKKRYPNVNNSSYLTMLRALSKLD  330

Query  1008  DMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWE  829
             D+ G +K F EWES   TYD+R+AN  I +Y KQ + ++A+ +   A +      +K  +
Sbjct  331   DIDGVKKVFAEWESTCWTYDMRMANVAISSYLKQNMYEEAEAVFNGAMKKCKGQFSKARQ  390

Query  828   IFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVL  649
             + + + LKN +   A+   E A+       + W  S  ++     HFE  KDV+GAE   
Sbjct  391   LLMMHLLKNDQADLALKHFEAAVL---DQDKNWTWSSELISSFFLHFEEAKDVDGAEEFC  447

Query  648   GNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
               L K    L +E    L++TY AAGK    M++R++ +   + EE + LL  I
Sbjct  448   KTLTKWSP-LSSETYTLLMKTYLAAGKACPDMKKRLEEQGILVDEEQECLLSKI  500



>gb|AAD22661.1|AC007138_25 hypothetical protein [Arabidopsis thaliana]
 emb|CAB80692.1| hypothetical protein [Arabidopsis thaliana]
Length=501

 Score =   290 bits (743),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 182/474 (38%), Positives = 268/474 (57%), Gaps = 9/474 (2%)
 Frame = -2

Query  1899  TKKYLEEALYRKLLKEGGLENSAGK---NLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSP  1729
             TK     ++Y+KL   G      GK    LN+F+       K ++ R  K LR+ +    
Sbjct  32    TKAKKHRSIYKKLSSLGT--RGGGKMEETLNQFVMEGVPVKKHDLIRYAKDLRKFRQPQR  89

Query  1728  AIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCY  1549
             A+++ E ME++ +  T SD  I ++L+AKSKG+ AAE YF +L ++ KN  TYG+LLNCY
Sbjct  90    ALEIFEWMERKEIAFTGSDHAIRLNLIAKSKGLEAAETYFNSLDDSIKNQSTYGSLLNCY  149

Query  1548  CKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDS  1369
             C E    KA+A  E M +LN    S+P+N+LM +Y   GQPEK+PA++  +KE  I P  
Sbjct  150   CVEKEEVKAKAHFENMVDLNHVSNSLPFNNLMAMYMGLGQPEKVPALVVAMKEKSITPCD  209

Query  1368  FTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalk  1189
              TY++W+++  +L D+ GVE+V+DEMK +G     W T++NLA+IY   GL  KAE+ALK
Sbjct  210   ITYSMWIQSCGSLKDLDGVEKVLDEMKAEGEGIFSWNTFANLAAIYIKVGLYGKAEEALK  269

Query  1188  elekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLN  1009
              LE    P     Y FLI LY  I N  EVYR+W  L+  +P   N SYL M++ L  L+
Sbjct  270   SLENNMNPDVRDCYHFLINLYTGIANASEVYRVWDLLKKRYPNVNNSSYLTMLRALSKLD  329

Query  1008  DMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWE  829
             D+ G +K F EWES   TYD+R+AN  I +Y KQ + ++A+ +   A +      +K  +
Sbjct  330   DIDGVKKVFAEWESTCWTYDMRMANVAISSYLKQNMYEEAEAVFNGAMKKCKGQFSKARQ  389

Query  828   IFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVL  649
             + + + LKN +   A+   E A+       + W  S  ++     HFE  KDV+GAE   
Sbjct  390   LLMMHLLKNDQADLALKHFEAAVL---DQDKNWTWSSELISSFFLHFEEAKDVDGAEEFC  446

Query  648   GNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
               L K    L +E    L++TY AAGK    M++R++ +   + EE + LL  I
Sbjct  447   KTLTKWSP-LSSETYTLLMKTYLAAGKACPDMKKRLEEQGILVDEEQECLLSKI  499



>gb|ACU24296.1| unknown [Glycine max]
Length=484

 Score =   288 bits (737),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 172/463 (37%), Positives = 272/463 (59%), Gaps = 10/463 (2%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LYR L        +  + L++++   K   K E+ R V+ LR+ + +  A+++ E ME R
Sbjct  30    LYRMLSALDITGGTVSQTLDQYIMEGKVIKKPELERCVEQLRKYRRFQHALEIIEWMEIR  89

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
              +N + S+  + +DLV+K+KG+ AAE +F  LP  +KN +TYGALLNCYCKELM +KA +
Sbjct  90    KVNFSWSNYAVQLDLVSKTKGVDAAENFFGGLPPPAKNRYTYGALLNCYCKELMKDKALS  149

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
               + M EL   +T++ +N++MTL+ + G+P+K+P +++ +K+  I    FTY+IWM + A
Sbjct  150   HFDTMDELGY-VTNLAFNNVMTLFMKLGEPQKVPQLVELMKKRTIPMSPFTYHIWMNSCA  208

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNL  1156
             +  D+ G ERV +EMK +      W TYSNLASIY      +KAE  LK LE++  P+  
Sbjct  209   SSNDLGGAERVYEEMKTENEGQIGWHTYSNLASIYVKFKDFEKAEMMLKMLEEQVKPKQR  268

Query  1155  TAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKE  976
              AY  L+ LY   GNL EV+R+W SL+   P T N SYL M+  L  LNDM G  KCFKE
Sbjct  269   DAYHCLLGLYAGTGNLGEVHRVWDSLKSVSPVT-NFSYLVMLSTLRRLNDMEGLTKCFKE  327

Query  975   WESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGE  796
             WE+   +YD R+ +  + A+  Q +L++A+ + + A R    P  +  E F+ ++LK  E
Sbjct  328   WEASCVSYDARLVSVCVSAHLNQNMLEEAELVFEEASRRSKGPFFRVREEFMKFFLKKHE  387

Query  795   ISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLG  616
             + +AV  +E A++  +GD  KW PSP +VG   +++E + DV+G +      K +     
Sbjct  388   LDAAVRHLEAALSEVKGD--KWRPSPQVVGAFFKYYEEETDVDGVDEFSKIFKAN-----  440

Query  615   AELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
                 +S I++   A K+S  +   +K ++        +LLD++
Sbjct  441   -NFDDSWIKSCITASKSSPEIDPGMKEDSQVYHAHETRLLDIM  482



>ref|XP_006287578.1| hypothetical protein CARUB_v10000787mg [Capsella rubella]
 gb|EOA20476.1| hypothetical protein CARUB_v10000787mg [Capsella rubella]
Length=501

 Score =   287 bits (735),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 173/446 (39%), Positives = 259/446 (58%), Gaps = 4/446 (1%)
 Frame = -2

Query  1878  ALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEK  1699
             ++Y+KL + G       + LN+F        K E+ R  K LR+ +    A+++ + ME 
Sbjct  40    SVYKKLSRLGTRGGKIDETLNQFFMEGIPVKKHELLRYAKDLRKFRQPQRALEIFKWMEG  99

Query  1698  RGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAE  1519
             + +  + SD  I +DL+AK++G+ AAE YF +L  + KN   YG+LLNCYC E   EKA+
Sbjct  100   KEIAFSGSDHAIRLDLIAKTEGLEAAENYFNSLDASIKNQSAYGSLLNCYCVEGEEEKAK  159

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
             A  E M +LN    S+P+N+LM +Y R  QPEK+PA++  +K+ +I P   TY++W+++ 
Sbjct  160   AHFEIMVDLNHVSNSLPFNNLMAMYLRLDQPEKVPALVVAMKQKNITPCDVTYSMWIQSC  219

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
              +L D+ G+E+V+DEMK +G     W T++NLA+IY   GL DKAE+ALK LE K  P  
Sbjct  220   GSLKDLDGIEKVLDEMKAEGEGISSWDTFANLAAIYIKVGLYDKAEEALKSLENKMNPHI  279

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
               +Y FLI+LY  I N  EVYR+W  L+   P   N SYL ++Q L  LND+ G +K F 
Sbjct  280   RDSYYFLISLYAGISNASEVYRVWDLLKKRHPNVNNSSYLTVLQALSKLNDIDGVKKIFT  339

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWES   TYDIR+AN  I +Y KQ + ++A+ +   A +  A   +K  ++ + + LK  
Sbjct  340   EWESTCGTYDIRMANVAISSYLKQNMYEEAEAVFNGAMKKCAGQFSKARQLLMMHLLKEK  399

Query  798   EISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHL  619
             +   A+   E A+       + W  S  ++     HFE  KDV+GAE     L K    L
Sbjct  400   QADLALKHFEAAVL---DQDKNWTWSSDLIRLFFLHFEEAKDVDGAEEFCKTLTKWSP-L  455

Query  618   GAELLESLIRTYAAAGKTSTVMRRRV  541
             G+E    L++TY +AGK    M++R+
Sbjct  456   GSETYTLLMKTYLSAGKACPDMKKRL  481



>ref|XP_006396396.1| hypothetical protein EUTSA_v10029427mg [Eutrema salsugineum]
 gb|ESQ37849.1| hypothetical protein EUTSA_v10029427mg [Eutrema salsugineum]
Length=505

 Score =   287 bits (735),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 175/460 (38%), Positives = 270/460 (59%), Gaps = 7/460 (2%)
 Frame = -2

Query  1917  NIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKL  1738
             ++ K++ K   + ++Y+KL   G       + LN+F        K ++ R VK LR+ + 
Sbjct  32    SVPKKTAKN--QRSVYKKLSSLGKRGGKMEETLNQFTMEGIPVKKDDLIRYVKDLRKHRQ  89

Query  1737  YSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALL  1558
                A+++ E ME++ +  + SD  I +DL+AK+ G+ AAE+YF +L  ++K   +YG+LL
Sbjct  90    PQRALEVFEWMERKEIAFSGSDHAIRLDLIAKTNGLKAAESYFNSLDLSTKTQSSYGSLL  149

Query  1557  NCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIM  1378
             NCYC E   EKA+A  +KM +LNL   S+P+N+LM +  R GQPEK+PA++  +K+ +I 
Sbjct  150   NCYCVEGEEEKAKAHFDKMCDLNLVTNSLPFNNLMAMNLRLGQPEKVPALVVAMKQKNIS  209

Query  1377  PDSFTYNIWMRALAALGDISGVERVIDEMKRD-GRVAEDWTTYSNLASIYADAGLSDkae  1201
             P   TY++W+++   L D+ GVE+VI+EMK D G     W T++NLA+IY+ AGL  KAE
Sbjct  210   PCDVTYSMWIQSCGILNDLDGVEKVIEEMKADGGECRSSWDTFANLAAIYSKAGLYSKAE  269

Query  1200  kalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVL  1021
              ALK LE+K  P   ++Y FLI+LY  I N  EVYR+W  L+   PK  N S L M+Q L
Sbjct  270   AALKSLEEKMNPHERSSYHFLISLYAGISNAPEVYRVWDLLKKGHPKVNNSSCLTMLQAL  329

Query  1020  VNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNA  841
               L+D+ G +K F EWES   TYD+R+AN +I +Y K+ + ++A+ +   A +      +
Sbjct  330   SKLDDIDGMKKIFTEWESTCYTYDMRMANVMISSYLKENMYEEAEAVFNGAMKKCKGQFS  389

Query  840   KTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGA  661
             K  ++ + + LKN +   A+   E A++      + W  S  ++     HFE  KDV+GA
Sbjct  390   KARQLLMMHLLKNDQADLALKHFEAAVS---NQDKNWTWSSELIRSFSLHFEESKDVDGA  446

Query  660   ERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRV  541
             E     L      L ++    LI+TY AA K    MR+R+
Sbjct  447   EEFCKTLTIWSP-LDSDTYTLLIKTYIAAEKACPGMRKRL  485



>gb|KHN16203.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=476

 Score =   286 bits (732),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 169/438 (39%), Positives = 264/438 (60%), Gaps = 10/438 (2%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LYR L        +  + L++++   K   K E+ R V+ LR+ + +  A+++ E ME R
Sbjct  30    LYRMLSALDITGGTVSQTLDQYIMEGKVIKKPELERCVEQLRKYRRFQHALEIIEWMEIR  89

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
              +N + S+  + +DLV+K+KG+ AAE +F  LP  +KN +TYGALLNCYCKELM +KA +
Sbjct  90    KVNFSWSNYAVQLDLVSKTKGVDAAENFFGGLPPPAKNRYTYGALLNCYCKELMKDKALS  149

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
               + M EL   +T++ +N++MTL+ + G+P+K+P +++ +K+  I    FTY+IWM + A
Sbjct  150   HFDTMDELGY-VTNLAFNNVMTLFMKLGEPQKVPQLVELMKKRTIPMSPFTYHIWMNSCA  208

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNL  1156
             +  D+ G ERV +EMK +      W TYSNLASIY      +KAE  LK LE++  P+  
Sbjct  209   SSNDLGGAERVYEEMKTENEGQIGWHTYSNLASIYVKFKDFEKAEMMLKMLEEQVKPKQR  268

Query  1155  TAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKE  976
              AY  L+ LY   GNL EV+R+W SL+   P T N SYL M+  L  LNDM G  KCFKE
Sbjct  269   DAYHCLLGLYAGTGNLGEVHRVWDSLKSVSPVT-NFSYLVMLSTLRRLNDMEGLTKCFKE  327

Query  975   WESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGE  796
             WE+   +YD R+ +  + A+  Q +L++A+ + + A R    P  +  E F+ ++LK  E
Sbjct  328   WEASCVSYDARLVSVCVSAHLNQNMLEEAELVFEEASRRSKGPFFRVREEFMKFFLKKHE  387

Query  795   ISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLG  616
             + +AV  +E A++  +GD  KW PSP +VG  ++++E + DV+G + +   LK +     
Sbjct  388   LDAAVRHLEAALSEVKGD--KWRPSPQVVGAFLKYYEEETDVDGVDELSKILKAN-----  440

Query  615   AELLESLIRTYAAAGKTS  562
                 +S I++   A K+S
Sbjct  441   -NFDDSWIKSCITASKSS  457



>ref|NP_001042820.1| Os01g0301000 [Oryza sativa Japonica Group]
 dbj|BAD87826.1| putative DNA-binding protein [Oryza sativa Japonica Group]
 dbj|BAF04734.1| Os01g0301000 [Oryza sativa Japonica Group]
 dbj|BAG89859.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93359.1| unnamed protein product [Oryza sativa Japonica Group]
Length=522

 Score =   287 bits (735),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 171/468 (37%), Positives = 276/468 (59%), Gaps = 8/468 (2%)
 Frame = -2

Query  1878  ALYRKLLKEGGL-ENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM-  1705
             +LYR+L   GG  E S  + +N++++  + A   ++ + VK LR+ K ++ A++L E M 
Sbjct  56    SLYRRLSALGGAGEGSVSRVMNKWVREGREARAADLAKYVKELRKYKRHAHALELMEWMV  115

Query  1704  EKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
               +GMN + ++  I +DL+ K +GI AAE YF  LP+  KNH TYGALLNCYC   M +K
Sbjct  116   NTKGMNMSYTNHAIRLDLIYKVRGIEAAEQYFAGLPDPGKNHKTYGALLNCYCSAKMEDK  175

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             A  +  KM EL ++ +++P N+LM+LY + GQ  K+ ++ +E+K  ++ PD+ T  + M 
Sbjct  176   ATDIYRKMDELGISSSTLPINNLMSLYVKIGQHRKVTSLFEEMKVKNVKPDNLTCCLLMS  235

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGL-SDkaekalkelekKNT  1168
             + AAL  I  V  V+ EM+ + +VA  W+ YS LAS+Y +A +  +      K     + 
Sbjct  236   SYAALNKIDTVGEVLKEME-EKKVALGWSAYSTLASLYVNANMVEEAESALKKLESLIDV  294

Query  1167  PRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEK  988
                   + FL++LY  +GNL EV R+W  ++  F K  N SYL M+Q L  LND    ++
Sbjct  295   QAGRQPFDFLMSLYASVGNLSEVNRVWNLIKANFQKVTNTSYLGMLQALYKLNDDDRMKQ  354

Query  987   CFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYL  808
              +++WES    YD R+ N +  A+ + GL K+A+ L ++ +  GA+ ++KT E+FL++Y+
Sbjct  355   IYEDWESNYENYDARLTNMMTRAHLRNGLTKEAELLWEKVKEKGAEFDSKTCELFLEHYM  414

Query  807   KNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSE  628
               G+++SA++ +E      R   +K       +   +++FE  KDVEGAER L  L+ S 
Sbjct  415   GKGDMTSALNWVENMTKLPR---KKSKLDQEKISCFLKYFEEHKDVEGAERFLNCLRTS-  470

Query  627   DHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVIS  484
               +  +  ESL+RTY AAGKTS  +R+ +K +  E+     KLL  I+
Sbjct  471   GCIDGKAYESLLRTYLAAGKTSRSIRQMIKEDKIEICYGIGKLLKRIA  518



>gb|EAY73658.1| hypothetical protein OsI_01545 [Oryza sativa Indica Group]
Length=522

 Score =   287 bits (734),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 171/468 (37%), Positives = 276/468 (59%), Gaps = 8/468 (2%)
 Frame = -2

Query  1878  ALYRKLLKEGGL-ENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM-  1705
             +LYR+L   GG  E S  + +N++++  + A   ++ + VK LR+ K ++ A++L E M 
Sbjct  56    SLYRRLSALGGAGEGSVSRVMNKWVREGREARAADLAKYVKELRKYKRHAHALELMEWMV  115

Query  1704  EKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
               +GMN + ++  I +DL+ K +GI AAE YF  LP+  KNH TYGALLNCYC   M +K
Sbjct  116   NTKGMNMSYTNHAIRLDLIYKVRGIEAAELYFAGLPDPGKNHKTYGALLNCYCSAKMEDK  175

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             A  +  KM EL ++ +++P N+LM+LY + GQ  K+ ++ +E+K  ++ PD+ T  + M 
Sbjct  176   ATDIYRKMDELGISSSTLPINNLMSLYVKIGQHRKVTSLFEEMKVKNVKPDNLTCCLLMS  235

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGL-SDkaekalkelekKNT  1168
             + AAL  I  V  V+ EM+ + +VA  W+ YS LAS+Y +A +  +      K     + 
Sbjct  236   SYAALNKIDTVGEVLKEME-EKKVALGWSAYSTLASLYVNANMVEEAESALKKLESLIDV  294

Query  1167  PRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEK  988
                   + FL++LY  +GNL EV R+W  ++  F K  N SYL M+Q L  LND    ++
Sbjct  295   QAGRQPFDFLMSLYASVGNLSEVNRVWNLIKANFQKVTNTSYLGMLQALYKLNDDDRMKQ  354

Query  987   CFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYL  808
              +++WES    YD R+ N +  A+ + GL K+A+ L ++ +  GA+ ++KT E+FL++Y+
Sbjct  355   IYEDWESNYENYDARLTNMMTRAHLRNGLTKEAELLWEKVKEKGAEFDSKTCELFLEHYM  414

Query  807   KNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSE  628
               G+++SA++ +E      R   +K       +   +++FE  KDVEGAER L  L+ S 
Sbjct  415   GKGDMTSALNWVENMTKLPR---KKSKLDQEKISCFLKYFEEHKDVEGAERFLNCLRTS-  470

Query  627   DHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVIS  484
               +  +  ESL+RTY AAGKTS  +R+ +K +  E+     KLL  I+
Sbjct  471   GCIDGKAYESLLRTYLAAGKTSRSIRQMIKEDKIEICYGIGKLLKRIA  518



>gb|KHG14992.1| hypothetical protein F383_17735 [Gossypium arboreum]
Length=533

 Score =   286 bits (731),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 168/451 (37%), Positives = 262/451 (58%), Gaps = 7/451 (2%)
 Frame = -2

Query  1977  YQKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSH  1798
             +QK L    S  Q  S  T +  +R   K+   ALY+K+      E  +   LNE+ K  
Sbjct  40    FQK-LPITCSISQVHSYGTVDFERRPMVKW--NALYKKISLMENPELGSASVLNEWEKGG  96

Query  1797  KSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKGIAA  1624
             +   KWE+ R VK LR+ K +  A+++ E M  RG     + SD  I +DL++K +G+++
Sbjct  97    RKLTKWELCRVVKELRKYKRFKQALEVYEWMNNRGERFRFSASDAAIQLDLISKVRGVSS  156

Query  1623  AEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLY  1444
             AE +F+ LP+T K+   YGALLN Y +  M EKAE+LI+ M+     L  +P+N +MTLY
Sbjct  157   AEDFFLQLPDTLKDKRIYGALLNAYVRARMQEKAESLIDNMRNKGYALHPLPFNVMMTLY  216

Query  1443  TRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAED  1264
                 + +K+ ++I E+ E ++  D ++YNIW+ +  + G +  +E+V ++MK D  +  +
Sbjct  217   MNLKEYDKVESMISEMMEKNVRLDIYSYNIWLSSCGSQGYVERMEQVYEQMKEDRSINPN  276

Query  1263  WTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWR  1084
             WTT+S +A++Y   GLS+KAE+ L+ +E + T R+   Y +LITLYG +GN  EVYRIW+
Sbjct  277   WTTFSTMATMYIKMGLSEKAEECLRNVESRITGRDRIPYHYLITLYGTVGNKEEVYRIWK  336

Query  1083  SLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQG  904
               +  FP   N+ Y  MI  LV  +D+ GAEK ++EW S +T+YD R+AN L+G Y K+G
Sbjct  337   VYKSIFPSIPNLGYHAMISSLVRASDIEGAEKIYEEWLSVKTSYDPRIANLLMGLYVKEG  396

Query  903   llkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVP  724
              L KA+         G KPN+ +WEI  +  ++   I  A+ C+++A  T     + W P
Sbjct  397   NLDKAQSFFNHIADVGGKPNSSSWEILAEGNIQEERIDEALSCLKEAFAT--EGSRSWRP  454

Query  723   SPVIVGELMRHFETKKDVEGAERVLGNLKKS  631
              P  V       + K+D E  E V+G L++S
Sbjct  455   KPTNVSAFFNLCDEKEDTETREVVVGLLRQS  485



>emb|CDY50357.1| BnaA09g13060D [Brassica napus]
Length=200

 Score =   273 bits (698),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 155/194 (80%), Gaps = 0/194 (0%)
 Frame = -2

Query  1938  RFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVK  1759
             R  S+ ++I KRSTKKYL+E LY +L K+GG E S  + LN FLK  K  +KWEVG ++K
Sbjct  4     RHLSRPRDIVKRSTKKYLDEPLYHRLFKDGGSEVSVRQQLNHFLKGTKHVFKWEVGDTIK  63

Query  1758  LLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNH  1579
              LR R LY PA+KLSE ME RGMNKT SDQ IH+DLVAK++GIAA E+YF+ LPETSK  
Sbjct  64    KLRSRGLYYPALKLSEVMEHRGMNKTVSDQAIHLDLVAKARGIAAGESYFVGLPETSKTE  123

Query  1578  FTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQE  1399
              TY +LLNCYCKELMTEKAE L+ KMKELN+T++SM YNSLMTLYT+TGQ E++P +IQE
Sbjct  124   LTYASLLNCYCKELMTEKAEGLLSKMKELNITVSSMSYNSLMTLYTKTGQAERVPGMIQE  183

Query  1398  IKECDIMPDSFTYN  1357
             +K  D+MPDS+TYN
Sbjct  184   MKAEDVMPDSYTYN  197



>gb|KHN08626.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=444

 Score =   281 bits (720),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 155/400 (39%), Positives = 251/400 (63%), Gaps = 4/400 (1%)
 Frame = -2

Query  1836  SAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHV  1657
             +  + L++++   +   K E+ R V+ LR+ + +  A+++ E M+ R +N + ++  + +
Sbjct  11    TVSQTLDQYIMEGEVIKKQELERCVEQLRKYRRFQRALEIIEWMQMRKVNFSWNNYAVQL  70

Query  1656  DLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLT  1477
             DLV+K+KG+ AAE +F  LP  +KN +TYGALLNCYCKELM +KA +  ++M EL   +T
Sbjct  71    DLVSKTKGVVAAENFFSGLPPAAKNMYTYGALLNCYCKELMKDKALSHFDRMNELGY-VT  129

Query  1476  SMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVID  1297
             ++ +N++MTL+ + G+PEK+  +++ +K+  I   +FTY IWM + A+L D+ GVER+ +
Sbjct  130   NLAFNNVMTLFMKLGEPEKVAQLVELMKQRRIPMSAFTYYIWMNSCASLNDLDGVERIYE  189

Query  1296  EMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRI  1117
             EMK +      W TYSNLASIY      +KAE  LK LEK+  P+   AY  L+ LY   
Sbjct  190   EMKTEDEDQIGWQTYSNLASIYVKFKDFEKAEMMLKMLEKQVKPKQRDAYHCLLGLYAGT  249

Query  1116  GNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVA  937
             GNL EV+R+W SL+   P T N SYL M+  L  LND+ G  KCFKEWE+   +YD+R+ 
Sbjct  250   GNLGEVHRVWNSLKSVSPVT-NFSYLVMLSTLRRLNDIEGLTKCFKEWEASCVSYDVRLV  308

Query  936   NALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAIT  757
             +  + A+  Q  L++A+ + + A R    P  +  E F+ ++LK  ++ +AV  +E A++
Sbjct  309   SVCVSAHLNQNKLEEAESVFEEASRRSKGPFFRVREEFMKFFLKKHQLDAAVRYLEAALS  368

Query  756   TGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLK  637
               +G   KW PSP ++G  ++++E + DV+G + +   LK
Sbjct  369   EVKGG--KWRPSPQVLGAFLKYYEEETDVDGVDELSKILK  406



>gb|EMT12044.1| hypothetical protein F775_21441 [Aegilops tauschii]
Length=400

 Score =   280 bits (716),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 162/395 (41%), Positives = 250/395 (63%), Gaps = 6/395 (2%)
 Frame = -2

Query  1677  SDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMK  1498
             ++  I +DL+ K +GI AAE YF  LP+ +KNH TYGALLNCYC     EKA  L  KM 
Sbjct  4     TNHAIRLDLIYKVRGIEAAEKYFDGLPDPAKNHRTYGALLNCYCSSKKEEKATDLYRKMD  63

Query  1497  ELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDIS  1318
             EL ++ +++P N+LM+LY + GQ +K+ ++ +E+KE ++ PD+ T  I M + AAL  I 
Sbjct  64    ELGISSSTLPINNLMSLYMKLGQHKKVCSLFEEMKEKNVKPDNLTCCILMTSCAALNKID  123

Query  1317  GVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN-LTAYQF  1141
              VE+V+ EM+  G V   W+ YS LASIY  AGL +KAE ALK+LE     R+    + F
Sbjct  124   DVEQVLKEMEEKGGVL-GWSAYSTLASIYQSAGLVEKAESALKKLEGLVQDRDGRQPFDF  182

Query  1140  LITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQ  961
             L++LY  +GNL EV R+W  ++  FPK  N SY +M+Q L+ LND    ++ F+EWES  
Sbjct  183   LMSLYASVGNLSEVKRVWGVVKDTFPKVTNTSYFSMLQALLKLNDADYMKQVFEEWESNH  242

Query  960   TTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAV  781
               YD+++ N +  A+ K G+ K+A++L ++A+  GA  ++KT E+FLD+Y+  G++ SA+
Sbjct  243   ECYDVKLTNVMTRAHLKNGMAKEAEQLWEKAKEMGACFDSKTCELFLDHYMGTGDMKSAL  302

Query  780   DCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLE  601
             + +E      +  G+     P  + +  ++FE +KDV+GAER   N  ++   +  +  E
Sbjct  303   NWVENVTKLPKKAGK---LDPDKIPKFSKYFEEQKDVQGAERFC-NCLRALGCMDGKAYE  358

Query  600   SLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
             SL+RTY AAG+TS  +R+++K +  E+  +  KLL
Sbjct  359   SLLRTYLAAGETSRSLRQQIKDDKIEICYDIGKLL  393



>ref|XP_009367213.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009367214.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Pyrus x bretschneideri]
Length=508

 Score =   283 bits (724),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 178/467 (38%), Positives = 265/467 (57%), Gaps = 6/467 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LYR+L   G    +  K LN+++   +   K ++ +  K LR+   +  A+++ E M+  
Sbjct  44    LYRRLSALGATGENLAKTLNQYIMEGEMFRKSQLAKCNKELRKHGKHQQALEIMEWMDFM  103

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
              M  + SD  + VDL +K KGI AAE Y   LPE+S++ FTY AL++CYCKELM EKA A
Sbjct  104   KMEYSKSDYAVRVDLTSKIKGIEAAEDYVSGLPESSRDLFTYSALMHCYCKELMEEKALA  163

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
             L   M EL    ++  +NSLM+L+ R   PEK+  ++QE+K+ +I  D   Y  WM++ A
Sbjct  164   LFATMDELGCASSTFIFNSLMSLHMRKQNPEKVDPLVQEMKKRNIPLDKRAYKTWMQSYA  223

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP-RN  1159
             AL D   V RV+DEMK        W+ YSNLA IY  A L D+A++ LK  EK   P + 
Sbjct  224   ALEDFEAVGRVLDEMKTHNGKKGSWSAYSNLAYIYVKAELFDEADEVLKTAEKLVKPLKR  283

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
                Y FLI+LY    NL  V R+W++LR +FP   N SYL M+Q L  LND+ G ++ F+
Sbjct  284   RKHYYFLISLYACTSNLSGVKRVWKTLRKSFPTKNNESYLVMLQALCKLNDIEGLKEMFE  343

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkak--elrkrAQRSGAKPNAKTWEIFLDYYLK  805
             EWES  + YD+ +AN  I  Y  QG+ ++A+        +  G     +  E+ + + L 
Sbjct  344   EWESICSKYDMSLANVAIRGYLSQGMHEEAELIFANACKKTKGKGSFLEAREMLMVHALN  403

Query  804   NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSED  625
                +  A   +  A++  + DG+ W PSP      +++FE +KDV+GAE+    LK+   
Sbjct  404   TRRVDLADSHLGAAVSESK-DGE-WHPSPDTRIAFLKYFEDEKDVDGAEKFCKILKRL-G  460

Query  624   HLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVIS  484
              L       L++TY AAGK+   MR+R+K E+ E+S E + LL+ +S
Sbjct  461   CLSCNEYCLLLKTYIAAGKSDPAMRQRLKEEHIEISPELENLLEKVS  507



>ref|XP_006849761.1| hypothetical protein AMTR_s00024p00251490 [Amborella trichopoda]
 gb|ERN11342.1| hypothetical protein AMTR_s00024p00251490 [Amborella trichopoda]
Length=501

 Score =   278 bits (712),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 154/417 (37%), Positives = 247/417 (59%), Gaps = 4/417 (1%)
 Frame = -2

Query  1881  EALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETME  1702
             E+LYR++   G     +   L E+++  K   KWE+    + LRQ   +  A+++S+ + 
Sbjct  83    ESLYRRIQLLGSQSIMSSSVLEEWIREGKPLAKWELRNITRQLRQNSRFKQALEVSDWLI  142

Query  1701  KRGMNKT--TSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTE  1528
             + G      + D  IH+DL++K  G   AE YF+ LP+  KN  TY ALLN Y KE M E
Sbjct  143   QHGTKYQLRSGDYAIHLDLISKVNGPHHAERYFLQLPKGMKNKLTYSALLNVYVKENMKE  202

Query  1527  KAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWM  1348
             +AE  ++KM+ L    +++PYN +MTLY  T   EKIP +++E+++   +PD+ +Y IW+
Sbjct  203   RAETTMKKMRMLGFLTSALPYNRMMTLYLNTNNLEKIPILLKEMRDSSTLPDANSYTIWI  262

Query  1347  RALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNT  1168
                 A+ D+  +++V  E+K+      +W  YS LA++Y    L +KAE  LKE+E +  
Sbjct  263   TRCGAVSDVEEMDKVYLELKKVSPERANWIVYSTLANMYIKENLIEKAELCLKEVENRIV  322

Query  1167  PRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEK  988
                   Y++L++LY  +G   E+YRIW+  + +F    N SY+ +I  LV L D+ GAE 
Sbjct  323   NNERAPYKYLLSLYAGMGKKAEMYRIWKLYKTSFKNMTNSSYICLISSLVKLGDIEGAES  382

Query  987   CFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYL  808
             CF+EWES   +YD+RV N L+  YA++G++KKA+    R +R G  PN  TWEI  + YL
Sbjct  383   CFEEWESAGLSYDVRVTNILLACYARKGMVKKAELFFVRMRRQGGMPNPNTWEILAEGYL  442

Query  807   KNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLK  637
             +NG++ +A+  +E+A+++G+G G  W P    V  + + FE + DVE  E+ +  L+
Sbjct  443   QNGQLGNALAAMEEAVSSGKGVG--WKPKLENVHAIFKDFEMQGDVENVEKCMSILR  497



>ref|XP_010087222.1| hypothetical protein L484_009731 [Morus notabilis]
 gb|EXB28572.1| hypothetical protein L484_009731 [Morus notabilis]
Length=454

 Score =   276 bits (707),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 159/423 (38%), Positives = 247/423 (58%), Gaps = 10/423 (2%)
 Frame = -2

Query  1881  EALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYS-------PAI  1723
             E LYR+L        S  K LNE++        +++ R +K LR+ +  +         +
Sbjct  31    ECLYRRLSGVKATGGSIRKMLNEYVMEGNVVLNYDLWRCLKELRKLRKNTVCDDYDVECV  90

Query  1722  KLSETMEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCK  1543
             ++ E M  R +N + +D    +DL++K+KGIAAAE Y  NLP ++KN F+YGALLNCYC 
Sbjct  91    EIMEWMGVRKINYSLTDHARRLDLISKTKGIAAAENYMSNLPPSAKNKFSYGALLNCYCV  150

Query  1542  ELMTEKAEA-LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSF  1366
             E M +KA   L  KM++      + P+ +LMT+Y + G+ E +P ++Q + + ++ P ++
Sbjct  151   ETMEDKALVELFRKMEKSGFISNAFPFANLMTMYMKMGKSENVPVLVQGMIKRNVYPSTY  210

Query  1365  TYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalke  1186
              YN+ M++ A+L DI GVERV+ E++       +WT YSNLA+IY  AGL +KA  AL++
Sbjct  211   VYNVLMQSYASLNDIPGVERVLAEIEILDESKCNWTIYSNLATIYMKAGLLEKATVALRK  270

Query  1185  lekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLND  1006
             +E +  P    AY FL++LY  IG L  V R+W++L   +P   N+SYL ++Q L  L+D
Sbjct  271   VECELKPGPREAYHFLLSLYAGIGQLSHVNRVWKTLNEVYPTCNNMSYLVILQALSKLDD  330

Query  1005  MPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEI  826
               G  KCFKEWES  + +DIR  N +IGAY + G+ K+AK L +  ++    P  K+ E 
Sbjct  331   FEGMRKCFKEWESSHSYHDIRFRNVVIGAYLRHGMDKEAKLLSEDTEKRFKGPFVKSREE  390

Query  825   FLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLG  646
             F  ++L++     A+  ++  +   +  G  W P P +V   +  FE +KDV  AER+L 
Sbjct  391   FTFFFLESHRTDLALSYLDDNVFEAKDGG--WHPPPSLVNAFLNCFEVEKDVPSAERLLN  448

Query  645   NLK  637
              LK
Sbjct  449   ILK  451



>ref|XP_004956425.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Setaria italica]
Length=513

 Score =   278 bits (711),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 167/438 (38%), Positives = 253/438 (58%), Gaps = 8/438 (2%)
 Frame = -2

Query  1875  LYRKL-LKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEK  1699
             LYR++ +  GG     G+ L  + +  +   KWE+ R  K LR+ + ++ A+++ + M +
Sbjct  80    LYRRIAVGHGG--RPVGRTLGAWDEGERRLDKWELCRIAKELRKFRRFNLALQVYDWMTE  137

Query  1698  RG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
             R      ++SD  I +DL+AK +G++ AE YF  LP+  K+  TYG+LLN Y + +M +K
Sbjct  138   RRDRFPLSSSDMAIQLDLIAKVRGVSHAEKYFEELPDPLKDKRTYGSLLNVYAQAMMKDK  197

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
              E   EKM++      ++P N LM  Y   G+P+++ AII E+KE ++  D  TYNIW++
Sbjct  198   TEDTFEKMRKKGFASDTLPCNVLMNFYVDVGEPDEVSAIIDEMKERNVSFDVCTYNIWIK  257

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             + AA  D   +ERV  +M  D  V  +WTTY+ LAS+Y   G S+KAE+ LK  EK+ T 
Sbjct  258   SCAAKQDADEMERVFSQMIADESVIANWTTYTTLASMYIKLGNSEKAEECLKGAEKRTTG  317

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             R+   + +LITLY  +G   EVYRIW   +  FP   N+ Y  ++  LV + D+ GAE  
Sbjct  318   RDKKCFHYLITLYSHLGKKEEVYRIWNWYKATFPTIHNLGYQEVLSALVRIGDIEGAELL  377

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             ++EW S  +++D +  N L+  YA++GL+ KA+++  +    G  P   TWEI    YLK
Sbjct  378   YEEWASKSSSFDPKTMNILLAWYAREGLITKAEQIVNQFVEKGGNPKPNTWEILATAYLK  437

Query  804   NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSED  625
             + +IS A+ C+EKA  T      KW P P  V  L+  F+ K D EGA+R++  L  S  
Sbjct  438   DNKISEALSCMEKA--TAVKSASKWKPRPTNVESLLASFKEKNDTEGADRLVSVL-TSRG  494

Query  624   HLGAELLESLIRTYAAAG  571
                 E  +SLI TYA AG
Sbjct  495   CAEDEEYKSLINTYAFAG  512



>ref|XP_004967563.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial-like isoform X1 [Setaria italica]
Length=520

 Score =   278 bits (710),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 174/468 (37%), Positives = 283/468 (60%), Gaps = 18/468 (4%)
 Frame = -2

Query  1875  LYRKLLKEGGL-ENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM-E  1702
             LYR+L   GG  E S  + LN++++   +    ++ + VK LR+ K ++ A++L + M  
Sbjct  55    LYRRLSALGGAGEGSVSRVLNKWVREGGTPRVDDLVKHVKELRKYKRHAHALELMDWMVN  114

Query  1701  KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKA  1522
              RGM+ + ++  I +DL+ K +G+ AAE YF +LP+ +KNH TYGALLNCYC   M EKA
Sbjct  115   ARGMHMSHTNHAIRLDLIYKVRGLEAAENYFASLPDPAKNHRTYGALLNCYCSAKMEEKA  174

Query  1521  EALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRA  1342
               +  KM EL +  + +P N+LM+LY + G+  K+ ++ +E+K  ++ PD+ T  I M +
Sbjct  175   IDIYRKMDELGICSSRLPINNLMSLYMKLGRHGKVDSLFKEMKVKNVKPDNLTCCILMTS  234

Query  1341  LAALGDISGVERVIDEM-KRDGRVAEDWTTYSNLASIYADAGLSDkaekalkele-kKNT  1168
              A+   I  +E ++ EM ++D  VA  W+ YS LASIYA+AGL +KAE ALK+LE     
Sbjct  235   YASSNKIDAIEELLKEMVEKD--VALGWSAYSTLASIYANAGLVEKAESALKKLEGLVGV  292

Query  1167  PRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEK  988
                   + FL++LY  +GNL EV R+W  ++  F K  N SYL M+Q L  LND+   ++
Sbjct  293   DDGKQPFDFLMSLYASVGNLSEVNRVWDVIKAKFSKVTNTSYLGMLQALYKLNDIDRMKQ  352

Query  987   CFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYL  808
              + +WES    YD+R+ N +I  + K G+  +A+ L ++A+  GA+ ++KT E+FLD+Y+
Sbjct  353   IYVDWESNYENYDVRLTNMMIRGHLKLGMTDEAESLWEKAKEKGAEFDSKTCELFLDHYM  412

Query  807   KNGEISSAVDCIEKAI----TTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNL  640
               G+++ A++ +E  +      G+ D  K       + +  ++FE  KD +GAER   N 
Sbjct  413   GKGDMNLALNWVENMVKLPKKAGKLDQDK-------IHKFQKYFEEHKDADGAERFC-NC  464

Query  639   KKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
              + +  +  +  ESL+RTY AAGK S+ +R+++K +  E+  +  KLL
Sbjct  465   LRMQGCIDGKAYESLLRTYLAAGKKSSSLRQQIKDDKIEICYDIGKLL  512



>gb|AES61635.2| PPR containing plant protein [Medicago truncatula]
Length=480

 Score =   276 bits (707),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 169/441 (38%), Positives = 258/441 (59%), Gaps = 16/441 (4%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAG---KNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM  1705
             LYR+L     LE + G   + LN+++   K+  K E+ R V+ LR+ + +  A ++ E M
Sbjct  33    LYRRL---ADLEKTGGTVSQTLNQYIIEGKALGKDELERCVQELRKYRRFHHAFEIMEWM  89

Query  1704  EKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
               R +N +  +  +++DLV+K KG+  AE +F + P  +KN +TYG+LLNCYCKELM +K
Sbjct  90    MMRQINFSWDNYAVYLDLVSKVKGVVEAENHFNSFPPPAKNKYTYGSLLNCYCKELMLDK  149

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             A +  +KM E    LTS+ + +LM++Y R  QP K+P ++  +KE  I    FTY +WM 
Sbjct  150   ALSHFDKMDEFGY-LTSLSFTNLMSMYMRLSQPSKVPQLVNVMKERKIRMTEFTYILWMN  208

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             + AAL D+  VERV +EMKR+     DW TYSNLA+IY  AG  +KAE  LK++E    P
Sbjct  209   SCAALNDLGEVERVYEEMKREDEDKIDWKTYSNLAAIYIKAGFFEKAELMLKKVEGVMKP  268

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             R    Y FL++LY   GN+ EVYR+W +L+   P T N SYL M+  L  LNDM G  K 
Sbjct  269   RQRETYHFLLSLYAGTGNVKEVYRVWGTLKKITPVT-NRSYLIMLSNLRRLNDMEGIIKL  327

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             FKEWES   +YD R+    + AY  Q + K+A  + + A +S   P  +  E+F+   L+
Sbjct  328   FKEWESRHVSYDSRLVGVAVQAYLSQNMDKEAVLVFEEALKSCRGPFFRIREMFMASLLE  387

Query  804   NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSED  625
              G++  A+  +E A++       K+ PSP +V   ++++E + D++G +  L  + +S +
Sbjct  388   KGQLDGAMSHLEAALS--EASDYKYQPSPQVVSAFLKYYEEETDLDGVDE-LSKILRSHN  444

Query  624   HLGAELLESLIRTYAAAGKTS  562
                    ES I+T   A ++S
Sbjct  445   -----FDESYIKTCITASESS  460



>ref|XP_002448264.1| hypothetical protein SORBIDRAFT_06g024190 [Sorghum bicolor]
 gb|EES12592.1| hypothetical protein SORBIDRAFT_06g024190 [Sorghum bicolor]
Length=515

 Score =   277 bits (708),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 168/441 (38%), Positives = 255/441 (58%), Gaps = 14/441 (3%)
 Frame = -2

Query  1875  LYRKL-LKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEK  1699
             LYR++ +  GG     G+ L  + +  +   KWE+ R  K LR+ + ++ A+++ + M +
Sbjct  82    LYRRIAVGHGG--RPVGRTLGAWDEGERRLDKWELCRIAKELRKFRRFNLALQVYDWMTE  139

Query  1698  RG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
             R    + ++SD  I +DL+AK +G++ AE YF  LP+  K+  TYG+LLN Y + +M EK
Sbjct  140   RRDRFSLSSSDMAIQLDLIAKVRGVSHAEKYFDELPDAMKDKRTYGSLLNVYAQAMMKEK  199

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
              E   E+M++      ++P N LM  Y  +G+P ++ AII E+KE ++  D  TYNIW++
Sbjct  200   TEDTFEQMRKKGFASDTLPCNVLMNFYVDSGEPNEVLAIIDEMKERNVSFDVCTYNIWIK  259

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             + AA  D   +ERV  +M  D  V  +WTTY+ LAS+Y   G S+KAE+ LK+ EK+ T 
Sbjct  260   SCAAKQDAEEMERVFSQMIADESVVANWTTYTTLASMYIKLGNSEKAEECLKDAEKRTTG  319

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             R    + +L+TLY  +G   EVYRIW   +  FP   N+ Y  ++  LV + D+ GAE  
Sbjct  320   REKKCFHYLMTLYSHLGKKEEVYRIWNWYKATFPMIHNLGYQELLSALVRIGDIEGAELL  379

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             ++EW S  +++D +  N L+  YAK+GL+ KA++   R    G  P   TWEI    Y+K
Sbjct  380   YEEWASKSSSFDPKTMNILLAWYAKEGLITKAEQTLNRFVEKGGNPKPNTWEILATAYMK  439

Query  804   NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKK---  634
             + +IS A+ C+EKA  T      KW P P  V  L+  F+ K D EGA+R++  L     
Sbjct  440   DDKISEALSCMEKA--TAIKSANKWKPRPTNVESLLASFKEKNDAEGADRLVSVLTSRGC  497

Query  633   SEDHLGAELLESLIRTYAAAG  571
             +ED    E  +SLI TYA AG
Sbjct  498   AED----EEYKSLINTYAFAG  514



>ref|XP_003591384.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=539

 Score =   276 bits (707),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 169/441 (38%), Positives = 258/441 (59%), Gaps = 16/441 (4%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAG---KNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM  1705
             LYR+L     LE + G   + LN+++   K+  K E+ R V+ LR+ + +  A ++ E M
Sbjct  92    LYRRL---ADLEKTGGTVSQTLNQYIIEGKALGKDELERCVQELRKYRRFHHAFEIMEWM  148

Query  1704  EKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
               R +N +  +  +++DLV+K KG+  AE +F + P  +KN +TYG+LLNCYCKELM +K
Sbjct  149   MMRQINFSWDNYAVYLDLVSKVKGVVEAENHFNSFPPPAKNKYTYGSLLNCYCKELMLDK  208

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             A +  +KM E    LTS+ + +LM++Y R  QP K+P ++  +KE  I    FTY +WM 
Sbjct  209   ALSHFDKMDEFGY-LTSLSFTNLMSMYMRLSQPSKVPQLVNVMKERKIRMTEFTYILWMN  267

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             + AAL D+  VERV +EMKR+     DW TYSNLA+IY  AG  +KAE  LK++E    P
Sbjct  268   SCAALNDLGEVERVYEEMKREDEDKIDWKTYSNLAAIYIKAGFFEKAELMLKKVEGVMKP  327

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             R    Y FL++LY   GN+ EVYR+W +L+   P T N SYL M+  L  LNDM G  K 
Sbjct  328   RQRETYHFLLSLYAGTGNVKEVYRVWGTLKKITPVT-NRSYLIMLSNLRRLNDMEGIIKL  386

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             FKEWES   +YD R+    + AY  Q + K+A  + + A +S   P  +  E+F+   L+
Sbjct  387   FKEWESRHVSYDSRLVGVAVQAYLSQNMDKEAVLVFEEALKSCRGPFFRIREMFMASLLE  446

Query  804   NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSED  625
              G++  A+  +E A++       K+ PSP +V   ++++E + D++G +  L  + +S +
Sbjct  447   KGQLDGAMSHLEAALS--EASDYKYQPSPQVVSAFLKYYEEETDLDGVDE-LSKILRSHN  503

Query  624   HLGAELLESLIRTYAAAGKTS  562
                    ES I+T   A ++S
Sbjct  504   -----FDESYIKTCITASESS  519



>ref|XP_007052357.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOX96514.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
Length=549

 Score =   276 bits (707),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 161/456 (35%), Positives = 262/456 (57%), Gaps = 7/456 (2%)
 Frame = -2

Query  1992  NESRQYQKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNE  1813
             ++++ YQK L    S  Q  S  T +  +R   K+   A+Y+K+      E  +   LNE
Sbjct  35    SQTQSYQK-LPVTCSISQIHSYGTVDYERRPMIKW--NAIYKKISLMENPELGSASVLNE  91

Query  1812  FLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKS  1639
             + K  +   KWE+ R VK LR+ K Y  A+++ + M  RG     + SD  I +DL+AK 
Sbjct  92    WEKGGRKLTKWELCRVVKELRKYKRYKQALEVYDWMNNRGERFRLSASDAAIQLDLIAKV  151

Query  1638  KGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNS  1459
             +G+++AE +F+ LP+T K+   YGALLN Y +  M +KAE LI+ M+     +  +P+N 
Sbjct  152   RGVSSAEDFFVQLPDTMKDKRIYGALLNAYVRAKMRDKAETLIDNMRGKGYAMHPLPFNV  211

Query  1458  LMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDG  1279
             +MTLY    + +K+ +++ E+ E +I  D ++YNIW+ +  + G +  +E V ++MK+D 
Sbjct  212   MMTLYMNLKEYDKVESMVSEMMEKNIRLDIYSYNIWLSSCGSQGSVEKMEEVYEQMKQDQ  271

Query  1278  RVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEV  1099
              +  +WTT+S +A++Y   GL++KAE+ L+ +E + T R+   Y +LI+LYG +GN  EV
Sbjct  272   SINPNWTTFSTMATMYIKMGLTEKAEECLRNVESRITGRDRIPYHYLISLYGGVGNREEV  331

Query  1098  YRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGA  919
             YR+W+  +  FP   N+ +  +I  LV   D+ GAE+ ++EW + +T+YD R+AN L+G 
Sbjct  332   YRVWKVYKSIFPSIPNLGFHAVISSLVRAGDIQGAERIYEEWLTVKTSYDPRIANLLMGW  391

Query  918   YAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDG  739
             Y K+G L KA+ L       G KPN+ +WEI  + ++    I  A+ C++ A  T    G
Sbjct  392   YVKEGNLDKAESLFSHIAEVGGKPNSSSWEILAEGHILEKRIPDALSCLKDAFATEGSRG  451

Query  738   QKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKS  631
               W P P  V       E K D+   E  +G L++S
Sbjct  452   --WRPKPTSVSAFFNLCEEKVDMASREVFVGLLRQS  485



>ref|XP_007145138.1| hypothetical protein PHAVU_007G213200g [Phaseolus vulgaris]
 gb|ESW17132.1| hypothetical protein PHAVU_007G213200g [Phaseolus vulgaris]
Length=393

 Score =   270 bits (689),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 155/381 (41%), Positives = 237/381 (62%), Gaps = 11/381 (3%)
 Frame = -2

Query  1665  IHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNL  1486
             + +DLV+K+KG+  AE +F  LP+ +KN +TYGALLNCYCKELM +KA +   KM EL  
Sbjct  17    VQLDLVSKTKGVVEAENFFSGLPDPAKNKYTYGALLNCYCKELMKDKALSHFHKMDELGY  76

Query  1485  TLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVER  1306
              +TS+ YN+LM+L+ R G+P+K+P ++  +K   +   SFTY+IWM + A+ GD+ GVER
Sbjct  77    -VTSLSYNNLMSLFMRNGEPQKVPELVGVMKRRSLPLSSFTYHIWMNSCASSGDLDGVER  135

Query  1305  VIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLY  1126
             V +EM+ +  ++  W TYSNLA+IY      +KAEK LK LEK+  PR   AY  L+ LY
Sbjct  136   VYEEMRTEELIS--WQTYSNLAAIYVKVKDFEKAEKMLKMLEKQVKPRQRDAYHCLLGLY  193

Query  1125  GRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDI  946
                GNL EV+R+W SL+   P T N SYL M+  L  L D+ G  KCFKEWE+   TYD 
Sbjct  194   AGTGNLGEVHRVWNSLKSVSPVT-NFSYLIMLSTLRRLKDIEGLTKCFKEWEASCVTYDA  252

Query  945   RVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEK  766
             R+    + AY  Q ++++A  + + A R   +P  +  E+F+ Y+L+  ++ +AV  ++ 
Sbjct  253   RLVGVCVSAYLGQNMVEEAALVFEGASRRSKRPLFRIEEMFMLYFLEKRQLEAAVRHLQA  312

Query  765   AITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRT  586
             A +  +GD + W PSP +VG  ++++E + DV+G + +   LK +       + +S I+T
Sbjct  313   AFSEVKGDDE-WHPSPKVVGAFLKYYEEETDVDGVDELSKILKAN------NIDDSWIKT  365

Query  585   YAAAGKTSTVMRRRVKMENAE  523
                A K+S     R+K ++ +
Sbjct  366   CINASKSSLETDPRLKEDDLQ  386



>emb|CDP18258.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   274 bits (701),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 155/418 (37%), Positives = 249/418 (60%), Gaps = 6/418 (1%)
 Frame = -2

Query  1878  ALYRKLLKEGGLENSAGKNLNEFLK---SHKSAYKWEVGRSVKLLRQRKLYSPAIKLSET  1708
             +L+RKL KE  +   +  N++  L    +   A +++V R +  LR RK Y  A++LSE 
Sbjct  51    SLFRKL-KELNIGPGSDANVSVVLDEWANESQAKRFDVARQINFLRSRKHYHLALQLSEW  109

Query  1707  MEKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTE  1528
             +E   +    +D+ + +DL+AK+KGIA+AE YF  L  ++K + TYGALLNCYCKE M +
Sbjct  110   LESSKIEMNNADRAVQIDLLAKAKGIASAEVYFDGLQGSAKTNKTYGALLNCYCKEKMLD  169

Query  1527  KAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWM  1348
             KA  L  KMKELN T +++ YN++M+LY  + QPE++P ++QE+++  +  D +T N+ +
Sbjct  170   KAVQLFAKMKELNFT-STLNYNNVMSLYLSSNQPEQVPLLVQELEQNKLKADKYTCNLLI  228

Query  1347  RALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNT  1168
              + A+  DI+  E+V+++MK+D +V  DW TY NLA+IY +AGL  KA++ + E+EK   
Sbjct  229   NSYASSNDINAAEKVLEKMKKD-KVKYDWFTYGNLATIYVNAGLLPKAKEMIGEMEKFEN  287

Query  1167  PRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEK  988
              R+   +  LI LY  + +L  V  +W SL+  FP  +N SYL M+  L  L D+   EK
Sbjct  288   VRDREFFHMLINLYELMSDLAGVNHVWNSLKSVFPSPSNTSYLIMLLALFKLGDLENLEK  347

Query  987   CFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYL  808
              F+EWES  + YD+R+ N ++ +Y  + ++ +A  L +     G  P   T  IF  Y++
Sbjct  348   YFREWESQCSLYDVRLFNVVLESYLNRNMIGEANALYESMVTKGIDPTLATLNIFTIYHI  407

Query  807   KNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKK  634
             KN +I SA+  +E        +  +W P+   +   + +FE K D   AE+   ++KK
Sbjct  408   KNDQIDSALKYLEMGACKTIPEEHRWFPTDETIKLFLEYFEKKNDATRAEKFCNSMKK  465



>ref|XP_010052788.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Eucalyptus grandis]
 gb|KCW76861.1| hypothetical protein EUGRSUZ_D01216 [Eucalyptus grandis]
Length=528

 Score =   273 bits (699),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 163/444 (37%), Positives = 254/444 (57%), Gaps = 8/444 (2%)
 Frame = -2

Query  1953  ASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEV  1774
              S  Q  S  T +  +R   K+   A+++++      E  A   LN+     K   KWE+
Sbjct  47    CSVSQVHSYNTMDYERRPMVKW--NAVFKRISLMENPELGAASVLNQCEDEGKKLTKWEL  104

Query  1773  GRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINL  1600
              R VK LR+ K Y  A+++ + M  RG     + SD  I +DL+AK +GI++AE +F+ L
Sbjct  105   CRVVKELRKYKRYKLALEVYDWMNNRGERFRLSASDAAIQLDLIAKVRGISSAEDFFLKL  164

Query  1599  PETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEK  1420
             P+  K+   YGALLN Y +  M EKAE+LIEKM+E    + ++P+N +MTLY       K
Sbjct  165   PDALKDRRIYGALLNAYVRAKMKEKAESLIEKMREKGYAMHALPFNVMMTLYMNLKDYGK  224

Query  1419  IPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLA  1240
             + A++ E+ E +I  D ++YNIW+ +  A G + G+E+V ++MK D  +  +WTT+S +A
Sbjct  225   VDALVSEMIEKNIQLDMYSYNIWLSSRGAQGSVEGMEQVFEQMKLDSMINPNWTTFSTMA  284

Query  1239  SIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPK  1060
             ++Y   G  +KAE  LK++E + T R+   Y +LI+LYG +GN  E YR+W + +  FP 
Sbjct  285   TMYIKMGQLEKAEDCLKKVESRITGRDRIPYHYLISLYGTVGNKEETYRVWNTYKSVFPT  344

Query  1059  TANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakel  880
               N+ Y  +I  LV + D+ GAEK ++EW S +T++D R+ N L+  Y K+G L KA+ +
Sbjct  345   IPNLGYHALISSLVRIGDIEGAEKMYEEWLSVRTSFDPRIGNLLMNFYVKEGKLDKAEGI  404

Query  879   rkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQK-WVPSPVIVGE  703
               +    G KPN+ TWEI  + + K   IS A  C + A      DG K W P PV +  
Sbjct  405   LDQMVELGGKPNSTTWEILAEGHTKERRISEAFSCFKDAFL---ADGWKSWRPKPVTLSY  461

Query  702   LMRHFETKKDVEGAERVLGNLKKS  631
                  E + ++E  E ++G L++S
Sbjct  462   FFDLCEEEGNLETKEALVGLLRQS  485



>ref|XP_006644106.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Oryza brachyantha]
Length=412

 Score =   269 bits (688),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 155/407 (38%), Positives = 247/407 (61%), Gaps = 10/407 (2%)
 Frame = -2

Query  1698  RGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAE  1519
             +GMN + ++  I +DL+ K  GI AAE YF +LP+ +KNH TYGALLNCYC   M EKA 
Sbjct  8     KGMNMSYTNHAIRLDLIYKVHGIEAAEKYFADLPDPAKNHRTYGALLNCYCSAKMEEKAM  67

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
              +  KM EL ++ +++P N+LM+LY + GQ +K+ ++ +E+K  ++ PD+ T  I M + 
Sbjct  68    DVYRKMDELGISSSTLPINNLMSLYVKLGQHKKVTSLFEEMKVKNVKPDNLTCCILMSSY  127

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGL---SDkaekalkelekKNT  1168
             AAL  I  V  V+ E++ +  V   W+ YS LASIY +AG+   ++ A K L+ L   N 
Sbjct  128   AALNKIDSVGEVLKEIE-EKEVTLGWSAYSTLASIYVNAGMVKEAESALKKLEGLVHVND  186

Query  1167  PRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEK  988
              R    + FL++LY   GNL EV R+W  ++  F K  N SYL M+Q L  L+D+   ++
Sbjct  187   GRQ--PFDFLMSLYASAGNLGEVNRVWNLIKTTFQKVTNTSYLGMLQALYKLDDVDRMKQ  244

Query  987   CFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYL  808
              +++WES    YDIR+ N +  A+ + G+ K+A+ L ++ +  GA  ++KT E+FL++Y+
Sbjct  245   IYEDWESNYQNYDIRLTNMMTRAHLRNGMAKEAELLWEKVKEKGADVDSKTCELFLEHYM  304

Query  807   KNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSE  628
               G+++SA++ +E          +K +     + +  ++FE  KDVEGAER    L++  
Sbjct  305   TKGDMTSALNWVENMTKLPE---KKRMLDQEKISKFFKYFEEHKDVEGAERFCNCLRQV-  360

Query  627   DHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVI  487
               + ++  E L+RTY AAGKTS  +R+R+K +  E+  +  KLL  I
Sbjct  361   GSIDSKAYEFLLRTYVAAGKTSRSIRQRIKEDKIEICYDIGKLLKRI  407



>ref|XP_007218971.1| hypothetical protein PRUPE_ppa003822mg [Prunus persica]
 gb|EMJ20170.1| hypothetical protein PRUPE_ppa003822mg [Prunus persica]
Length=546

 Score =   273 bits (698),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 164/455 (36%), Positives = 262/455 (58%), Gaps = 8/455 (2%)
 Frame = -2

Query  1986  SRQYQKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFL  1807
             S  +Q+  +   S  Q  +  T +  +R   K+   A+YRK+      E  +   LN++ 
Sbjct  38    SINFQRLPSISCSISQVHNYGTVDYERRPMVKW--NAIYRKISLTDDPEVRSADVLNQWE  95

Query  1806  KSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKG  1633
             K  +   KWE+ R VK LR+ K Y  A+++ + M  RG     +TSD  I +DLVAK +G
Sbjct  96    KEGRKLTKWELCRVVKELRKYKRYDRALEVYDWMSNRGERFRISTSDAAIQLDLVAKVRG  155

Query  1632  IAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLM  1453
             +A+AE YF++LP+T K+   YGALLN Y +  M EKAE+L++KM+     L S+P+N +M
Sbjct  156   VASAENYFLSLPDTLKDRRIYGALLNAYVRTRMKEKAESLLDKMRSKGHALQSLPFNVMM  215

Query  1452  TLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRV  1273
             TLY    + +K+ +II E+ E +I  D ++YNIW+ +  + G    +E+V ++MK D  V
Sbjct  216   TLYMNLKEYDKVDSIISEMMEKNIQLDIYSYNIWLSSRGSQGSEERMEQVFEQMKLDRTV  275

Query  1272  AEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYR  1093
               +WTT+S +A++Y   G  +KAE  LK++E + T R+   Y +L++LYG +GN  E+YR
Sbjct  276   NPNWTTFSTMATMYIKMGQLEKAEACLKKVESRITGRDRIPYHYLLSLYGNVGNKEELYR  335

Query  1092  IWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYA  913
             +W   + +FP   N+ Y  ++  L+ + D+ GAEK ++EW + ++TYD R+AN  I  Y 
Sbjct  336   VWNIYKSSFPSIPNLGYHAIMSSLLRVGDVEGAEKIYEEWLTVKSTYDPRIANVFIAYYI  395

Query  912   KQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQK  733
             K G  +KA+         G KPN+ TWE   + +++   IS A+ C ++A +    +G K
Sbjct  396   KDGDFEKAQSFYDHMVDVGGKPNSTTWETLAEGHIEEQRISEALSCWKEAFS---AEGSK  452

Query  732   -WVPSPVIVGELMRHFETKKDVEGAERVLGNLKKS  631
              W P PV V   +   E + +    E  +G LK+S
Sbjct  453   SWRPKPVNVSAFLELCEQEANSVSKEFFMGLLKQS  487



>ref|XP_011017395.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Populus euphratica]
Length=539

 Score =   273 bits (697),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 164/484 (34%), Positives = 265/484 (55%), Gaps = 7/484 (1%)
 Frame = -2

Query  1992  NESRQYQKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNE  1813
             +++  Y+K      S  Q  +  T +  +R   K+   A+YR++      E  +G  LN+
Sbjct  34    HQTVNYKKLPVITCSISQLHNYGTVDYERRPMMKW--NAIYRRISLMENPELGSGSVLNQ  91

Query  1812  FLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKS  1639
             +    K   KWE+ R VK LR+ K Y  A+++ + M  R      + SD  I +DL+AK 
Sbjct  92    WENEGKRLTKWELCRVVKELRKYKRYQQALEVYDWMNNRQERFGLSPSDAAIQLDLIAKV  151

Query  1638  KGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNS  1459
             +G+++AE +F+ LP T K+   YGALLN Y +  M EKAE+LI++M++ +    ++PYN 
Sbjct  152   RGVSSAEDFFLRLPNTFKDRRIYGALLNAYVRNRMREKAESLIDEMRDKDYVTHALPYNV  211

Query  1458  LMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDG  1279
             +MTLY    + +K+  ++ E+ E +I  D ++YNIW+ +    G    +E+V ++MK DG
Sbjct  212   MMTLYMNINEYDKVDLMVSEMNEKNIKLDIYSYNIWLSSCGLQGSADKMEQVFEQMKSDG  271

Query  1278  RVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEV  1099
              +  +WTT+S +A++Y   G  +KAE  L+ +E + T R+   Y +L++LYG +GN  EV
Sbjct  272   SINPNWTTFSTMATMYIKMGKFEKAEDCLRRVESRITGRDRIPYHYLLSLYGNVGNKEEV  331

Query  1098  YRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGA  919
             YR+W   +  FP   N+ Y  MI  LV ++D+ GAEK ++EW S +T+YD R+AN  + A
Sbjct  332   YRVWNIYKSIFPSIPNLGYHAMISSLVRMDDIEGAEKIYEEWLSIKTSYDPRIANLFMAA  391

Query  918   YAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDG  739
             +  QG L KA+         G KPN+ TWEI    ++     S A+ C+++A  T     
Sbjct  392   FVYQGNLDKAESFFDHMLEEGGKPNSHTWEILAQGHISERRTSEALSCLKEAFAT--PGS  449

Query  738   QKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTST  559
             + W P+P  V    +  E + D+   E +   L++S  HL  +    L+   A     ST
Sbjct  450   KSWKPNPANVSSFFKLCEEEVDMASKEALESFLRQS-GHLKDKAYALLLGMPATGDDLST  508

Query  558   VMRR  547
                R
Sbjct  509   KEER  512



>ref|XP_008232381.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Prunus mume]
Length=546

 Score =   273 bits (697),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 164/455 (36%), Positives = 261/455 (57%), Gaps = 8/455 (2%)
 Frame = -2

Query  1986  SRQYQKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFL  1807
             S  +Q+  +   S  Q  +  T +  +R   K+   A+YRK+      E  +   LN++ 
Sbjct  38    SINFQRLPSISCSISQVHNYGTVDYERRPMVKW--NAIYRKISLTDDPEVRSADVLNQWE  95

Query  1806  KSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKG  1633
             K  +   KWE+ R VK LR+ K Y  A+++ + M  RG     +TSD  I +DLVAK +G
Sbjct  96    KEGRKLTKWELCRVVKELRKYKRYDRALEVYDWMSNRGERFRISTSDAAIQLDLVAKVRG  155

Query  1632  IAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLM  1453
             +A+AE YF++LP+T K+   YGALLN Y +  M EKAE+L++KM+     L S+P+N +M
Sbjct  156   VASAENYFLSLPDTLKDRRIYGALLNAYVRTRMKEKAESLLDKMRSKGHALQSLPFNVMM  215

Query  1452  TLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRV  1273
             TLY    + +K+ +II E+ E +I  D ++YNIW+ +  + G    +E+V ++MK D  V
Sbjct  216   TLYMNLKEYDKVDSIISEMMEKNIQLDIYSYNIWLSSRGSQGSEERMEQVFEQMKLDRTV  275

Query  1272  AEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYR  1093
               +WTT+S +A++Y   G  +KAE  LK++E + T R+   Y +L++LYG +GN  E+YR
Sbjct  276   NPNWTTFSTMATMYIKMGQLEKAEACLKKVESRITGRDRIPYHYLLSLYGNVGNKEELYR  335

Query  1092  IWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYA  913
             +W   + +FP   N+ Y  ++  L+ + D+ GAEK ++EW + ++TYD R+AN  I  Y 
Sbjct  336   VWNIYKSSFPSIPNLGYHAIMSSLLRVGDVEGAEKIYEEWLTVKSTYDPRIANVFIAYYI  395

Query  912   KQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQK  733
             K G  +KA+         G KPN+ TWE   + + +   IS A+ C ++A +    +G K
Sbjct  396   KDGDFEKAQSFYDHMVDVGGKPNSSTWETLAEGHTEEQRISEALSCWKEAFS---AEGSK  452

Query  732   -WVPSPVIVGELMRHFETKKDVEGAERVLGNLKKS  631
              W P PV V   +   E + +    E  +G LK+S
Sbjct  453   SWRPKPVNVSAFLELCEQEANSVSKEVFMGLLKQS  487



>emb|CAE04345.1| OSJNBb0038F03.9 [Oryza sativa Japonica Group]
Length=511

 Score =   271 bits (694),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 159/436 (36%), Positives = 255/436 (58%), Gaps = 8/436 (2%)
 Frame = -2

Query  1878  ALYRKL-LKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETME  1702
             +LYR++ +  GG     G+ L  + +  +   KWE+ R  + LR+ + ++ A+++ + M 
Sbjct  77    SLYRRIAVGHGG--RPVGRTLGAWDEGERRLDKWELCRIARELRKFRRFNLALQVYDWMT  134

Query  1701  KRG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTE  1528
             +R    + ++SD  I +DL+AK +G++ AE YF  LP+  K+  TYG+LLN Y + +M E
Sbjct  135   ERRDRFSLSSSDMAIQLDLIAKVRGVSHAEEYFEELPDPLKDKRTYGSLLNVYAQAMMKE  194

Query  1527  KAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWM  1348
             K E+  E+M++      ++P+N LM  Y    + EK+  +I E+ E ++  D  TYNIW+
Sbjct  195   KTESTFEQMRKKGFATDTLPFNVLMNFYVDAEEAEKVSILIDEMMERNVAFDVCTYNIWI  254

Query  1347  RALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNT  1168
             ++ AA+ D   +E+V ++M RD  V  +WTTY+ LAS++   G S+KAE++LKE EK+ T
Sbjct  255   KSCAAMQDADAMEQVFNQMIRDETVVANWTTYTTLASMHIKLGNSEKAEESLKEAEKRTT  314

Query  1167  PRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEK  988
              R    + +L+TLY  +G   EVYR+W   +  FP   N+ Y  ++  LV L D+ GAE 
Sbjct  315   GREKKCFHYLMTLYSHLGKKEEVYRVWNWYKATFPTIHNLGYQEVLSALVRLGDIEGAEL  374

Query  987   CFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYL  808
              ++EW S  +++D +  N L+  YA++G + KA++   R    G  P   TWEI    YL
Sbjct  375   LYEEWASKSSSFDPKTMNILLAWYAREGFVTKAEQTLNRFVEKGGNPKPNTWEILGTAYL  434

Query  807   KNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSE  628
             K+G+ S A+ C+EKA  T      KW P P  V  L+ +F+ K D E A+R++ N+ +S 
Sbjct  435   KDGQSSEALSCLEKA--TAVASPSKWRPRPTNVESLLANFKEKNDAESADRLM-NVLRSR  491

Query  627   DHLGAELLESLIRTYA  580
                  E  +SLI TYA
Sbjct  492   RCEENEEYKSLINTYA  507



>ref|XP_002301239.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE80512.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=539

 Score =   272 bits (696),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 158/456 (35%), Positives = 255/456 (56%), Gaps = 6/456 (1%)
 Frame = -2

Query  1992  NESRQYQKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNE  1813
             +++  Y+K      S  Q  +  T +  +R   K+   A+YR++      E  +G  LN+
Sbjct  34    HQTVNYKKLPVITCSISQIHNYGTVDYERRPMMKW--NAIYRRISLMENPELGSGSVLNQ  91

Query  1812  FLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKS  1639
             +    K   KWE+ R VK LR+ K Y  A+++ + M  R      + SD  I +DL+AK 
Sbjct  92    WENDGKRLTKWELCRVVKELRKYKRYQQALEVYDWMNNRQERFGLSPSDAAIQLDLIAKV  151

Query  1638  KGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNS  1459
             +G+++AE +F+ LP T K+   YGALLN Y +  M EKAE+LI++M+  +    ++PYN 
Sbjct  152   RGVSSAEDFFLRLPNTFKDRRIYGALLNAYVRNRMREKAESLIDEMRGKDYVTHALPYNV  211

Query  1458  LMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDG  1279
             +MTLY    + +K+  II E+ E +I  D ++YNIW+ +    G    +E+V ++MK DG
Sbjct  212   MMTLYMNINEYDKVDLIISEMNEKNIKLDIYSYNIWLSSCGLQGSADKMEQVFEQMKSDG  271

Query  1278  RVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEV  1099
              +  +WTT+S +A++Y   G  +KAE  L+ +E + T R+   Y +L++LYG +GN  EV
Sbjct  272   SINPNWTTFSTMATMYIKMGKFEKAEDCLRRVESRITGRDRIPYHYLLSLYGNVGNKEEV  331

Query  1098  YRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGA  919
             YR+W   +  FP   N+ Y  MI  LV ++D+ GAEK ++EW S +T+YD R+AN  + A
Sbjct  332   YRVWNIYKSIFPSIPNLGYHAMISSLVRMDDIEGAEKIYEEWLSIKTSYDPRIANLFMAA  391

Query  918   YAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDG  739
             +  QG L KA+         G KPN+ +WEI    ++     S A+ C+++A  T     
Sbjct  392   FVYQGNLDKAESFFDHMLEEGGKPNSHSWEILAQGHISERRTSEALSCLKEAFAT--PGS  449

Query  738   QKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKS  631
             + W P+P  V    +  E + D+   E +   L++S
Sbjct  450   KSWKPNPANVSSFFKLCEEEVDMASKEALASFLRQS  485



>ref|XP_009774058.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Nicotiana sylvestris]
Length=538

 Score =   272 bits (695),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 156/443 (35%), Positives = 259/443 (58%), Gaps = 8/443 (2%)
 Frame = -2

Query  1953  ASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEV  1774
             +S  Q  S  T +  +R   K+   A+Y+++    G E  +   LN++    K   KWE+
Sbjct  52    SSISQVHSYGTVDYERRPIVKW--NAIYKRISMNDGPERGSVSVLNQWENEGKKVTKWEL  109

Query  1773  GRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINL  1600
              R +K LR+ + Y  A+++ E M  R      TTSD  I +DL+AK  GI++AE YF+ L
Sbjct  110   SRVIKELRKFRRYKLALEVYEWMNNRAERFRLTTSDTAIQLDLIAKVHGISSAEEYFVKL  169

Query  1599  PETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEK  1420
             P+T K+   YG+LLN + +    E+AE+LI+KM+    T  ++P+N +MTLY      +K
Sbjct  170   PDTLKDKRIYGSLLNAFVRARKKEQAESLIDKMRNRGYTDHALPFNVMMTLYMNLKDYDK  229

Query  1419  IPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLA  1240
             + +++ E+ E  I  D ++YNIW+ +  + G +  +E+V+++M  D  +  +WTTYS +A
Sbjct  230   VESVVSEMMEKQIPLDIYSYNIWLSSCGSQGSVEKMEKVLEKMNLDTDINPNWTTYSTMA  289

Query  1239  SIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPK  1060
             ++Y   G   KAE +LK +E + T R+   Y +LI+LYG +G   EV RIW++ +  FP 
Sbjct  290   TMYIKLGQLKKAEDSLKSVESRITGRDRIPYHYLISLYGSLGKKEEVLRIWKTYQSQFPT  349

Query  1059  TANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakel  880
               N+ Y ++I  LV L+D+ GAEK + EW   ++ YD R+ N L+G Y ++G + KA   
Sbjct  350   IPNLGYHSVISSLVRLDDIEGAEKIYDEWLPVKSHYDPRLGNLLLGYYVRKGSVDKAIAF  409

Query  879   rkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQK-WVPSPVIVGE  703
               +   +GAKPN+ TWEI  + +++   +S A+ C++ A++T   +G K W P P  V  
Sbjct  410   LDQMVEAGAKPNSMTWEIVAEGHIRERRLSKALSCLKDAVST---EGSKSWRPKPANVSS  466

Query  702   LMRHFETKKDVEGAERVLGNLKK  634
             ++R  E ++D +  E ++  LK+
Sbjct  467   ILRLCEQEEDTQSKEALMEVLKQ  489



>ref|XP_010940923.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Elaeis guineensis]
Length=428

 Score =   268 bits (686),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 154/366 (42%), Positives = 234/366 (64%), Gaps = 5/366 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGL-ENSAGKNLNEF-LKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETME  1702
             LYR+L   GG  E S    L+++ ++  +    W + + ++ LR+ + +  A+++   ME
Sbjct  41    LYRRLSVLGGAPEGSVTATLDQWEMEGWRMTALW-LMKHIRELRKYRRHEHALEMMHWME  99

Query  1701  KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKA  1522
             KRGM        + +DL++K KGI +AE YF NLPE +KN  TYGAL +CYC   MT++A
Sbjct  100   KRGMETPNGYHAVRIDLISKVKGIRSAEEYFSNLPEPAKNRRTYGALFSCYCSGRMTDRA  159

Query  1521  EALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRA  1342
              AL+EKMKE       + YN+LM+LY + GQ EK+P + QE+K  +++PDS TY I M++
Sbjct  160   IALLEKMKERKFASHVLIYNNLMSLYMKLGQLEKVPILFQEMKASNVLPDSCTYRIIMKS  219

Query  1341  LAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPR  1162
              A++ DI  VERV  EM+  G  A D  TY +LA +Y  AGL +KAE ALK+ E      
Sbjct  220   YASMSDIVSVERVTQEMESQG--ASDCLTYCHLAWLYNSAGLFEKAEVALKKAELVMGSH  277

Query  1161  NLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCF  982
             +L++++ LI+LY   GNL EV R+W  L+   P+  N++YL M++ L  L+DM G ++C 
Sbjct  278   DLSSFRLLISLYAAAGNLSEVKRVWNLLKARVPRPTNMNYLIMLEALRKLDDMDGLKQCS  337

Query  981   KEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKN  802
             +EWESG   YDIR+ N LIGAY ++G++ +AK L+++A + G   +  T+ +F+D+YLKN
Sbjct  338   EEWESGCVNYDIRLVNILIGAYLRRGMVDEAKLLQEKADQMGEWSDEHTFVLFIDHYLKN  397

Query  801   GEISSA  784
              ++  A
Sbjct  398   RKLELA  403



>ref|XP_009338668.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Pyrus x bretschneideri]
Length=530

 Score =   271 bits (694),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 160/451 (35%), Positives = 253/451 (56%), Gaps = 6/451 (1%)
 Frame = -2

Query  1977  YQKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSH  1798
             +QK  T   S  Q  +  T +  +R   K+   A+YRK+      +  +   LN++ K  
Sbjct  40    FQKLPTISCSISQVHNYGTVDYERRPMIKW--NAIYRKISLTEDPQVRSADVLNQWEKEG  97

Query  1797  KSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKGIAA  1624
             +   KWE+ R +K LR+ K Y  A+++ + M  RG     +TSD  I +DLVAK +G+A+
Sbjct  98    RKLTKWELCRVIKELRKYKRYDRALEVYDWMSNRGERFRISTSDAAIQLDLVAKVRGVAS  157

Query  1623  AEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLY  1444
             AE YF++LP+T K+   YGALLN Y +  M EKAEAL++KM+     L S+P+N +MTLY
Sbjct  158   AENYFLSLPDTLKDRRIYGALLNAYVRARMKEKAEALLDKMRTKGHALQSLPFNVMMTLY  217

Query  1443  TRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAED  1264
                   +K+ +II E+ E +I  D ++YNIW+ +  + G    +E V ++MK D  +  +
Sbjct  218   MNLKDYDKVDSIISEMLEKNIQLDIYSYNIWLSSRGSQGSAERMEEVFEKMKVDRTIIPN  277

Query  1263  WTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWR  1084
             WTT+S +A++Y   G  DKAE  L+++E + T R+   Y +L++LYG +G   E YR+W 
Sbjct  278   WTTFSTMATMYIKMGQLDKAEACLRKVESRITGRDRIPYHYLLSLYGSVGKKEEAYRVWN  337

Query  1083  SLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQG  904
               + +FP   N+ Y  ++  L+ L D+ GAEK ++EW + ++TYD R+AN  I  Y K+G
Sbjct  338   VYKASFPSIPNLGYHAIMSSLLRLGDIEGAEKLYEEWLTVKSTYDPRIANLFITFYIKEG  397

Query  903   llkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVP  724
                 A+         G KPN+ TWE   + ++    IS+A+ C ++A +    +   W P
Sbjct  398   DFVNAQSFYDHMVDVGGKPNSSTWEALAEGHIAEKRISAALSCWKEAFSAEGSNS--WRP  455

Query  723   SPVIVGELMRHFETKKDVEGAERVLGNLKKS  631
              PV V   +   E + D    E  +G L +S
Sbjct  456   KPVNVSAFLELCEQEADSVSKEVFMGLLSQS  486



>ref|XP_011032472.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Populus euphratica]
Length=539

 Score =   271 bits (693),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 164/480 (34%), Positives = 263/480 (55%), Gaps = 7/480 (1%)
 Frame = -2

Query  1992  NESRQYQKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNE  1813
             +++  Y+K    + S  Q  +  T +  +R   K+    +YR++      E  +G  LN+
Sbjct  34    HQTVNYKKLPVIICSISQIHNYGTVDYERRPMIKW--NGIYRRISLMENPELGSGSVLNQ  91

Query  1812  FLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKS  1639
             +    K   KWE+ R VK LR+ K Y  A+++ + M+ R      + SD  I +DL+AK 
Sbjct  92    WENEGKRLTKWELCRVVKELRKYKRYQQALEVYDWMKNRQERFRLSPSDAAIQLDLIAKV  151

Query  1638  KGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNS  1459
             +G++ AE +F++LP T K+   YGALLN Y +  M EKAE L ++M++      ++P+N 
Sbjct  152   RGVSTAEDFFLSLPNTFKDRRVYGALLNAYVQNRMREKAETLFDEMRDKGYVTHALPFNV  211

Query  1458  LMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDG  1279
              MTLY    + +K+  +I E+ E +I  D ++YNIW+ +  + G    +ERV ++MK D 
Sbjct  212   TMTLYMNIKEYDKVDLMISEMNEKNIKLDIYSYNIWLSSCGSQGSADKMERVYEQMKSDR  271

Query  1278  RVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEV  1099
              +  +WTT+S +A++Y   G  +KAE  L+ +E + T R+   Y +L++LYG +GN  EV
Sbjct  272   SINPNWTTFSTMATMYIKMGQFEKAEDCLRRVESRITGRDRIPYHYLLSLYGNVGNKEEV  331

Query  1098  YRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGA  919
             YR+W   +  FP   N+ Y  MI  LV ++D+ GAEK ++EW S +T+YD R+AN  I A
Sbjct  332   YRVWNIYKSIFPSIPNLGYHAMISSLVRMDDIEGAEKIYEEWLSIKTSYDPRIANLFIAA  391

Query  918   YAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDG  739
             Y  QG L +AK         G KPN+ TWEI    ++     S A+ C+++A  T     
Sbjct  392   YVYQGNLDEAKRFFDHMLEEGGKPNSNTWEILAQGHISERRTSEALSCLKEAFVT--PGS  449

Query  738   QKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTST  559
             + W P+P  V    +  E + D+   E + G L++S  HL  +   SL+       + ST
Sbjct  450   KSWKPNPANVTSFFKLCEEEADMANKEALEGFLRQS-GHLKDKAYASLLGMPVTGDELST  508



>ref|NP_001168310.1| hypothetical protein [Zea mays]
 gb|ACN27772.1| unknown [Zea mays]
 tpg|DAA36624.1| TPA: hypothetical protein ZEAMMB73_688721 [Zea mays]
Length=513

 Score =   270 bits (691),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 164/438 (37%), Positives = 250/438 (57%), Gaps = 8/438 (2%)
 Frame = -2

Query  1875  LYRKL-LKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEK  1699
             LYR++ +  GG     G+ L  + +  +   KWE+ R  K LR+ + ++ A+++ + M +
Sbjct  80    LYRRIAVGHGG--RPVGRTLGAWDEGERRLDKWELCRIAKELRKFRRFNLALQVYDWMTE  137

Query  1698  RG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
             R      ++SD  I +DL+AK +G+  AE YF  LP+  K+  TYG+LLN Y + +M EK
Sbjct  138   RRDRFPLSSSDMAIQLDLIAKVRGVPHAEKYFDELPDAMKDKRTYGSLLNVYAQAMMKEK  197

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
              E   E+M++      ++P N LM  Y  +G+P+++ AII E+KE ++  D  TYNIW++
Sbjct  198   TEETFEQMRKKGFASDTLPCNVLMNFYVDSGEPDEVLAIIDEMKERNVSFDVCTYNIWIK  257

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             + AA  D   +E+V  +M  D  V  +WTTY+ LAS+Y   G S+KAE+ LK+ EK+ T 
Sbjct  258   SCAAKQDAEEMEQVFSQMIADESVVANWTTYTTLASMYLKLGNSEKAEECLKDAEKRTTG  317

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             R    + +L+TLY  +G   EVYRIW   +  FP   N+ Y  ++  L+ + D+ GAE  
Sbjct  318   REKKCFHYLMTLYSHLGKKEEVYRIWNWYKATFPMIHNLGYQELLSALIRIGDIEGAELL  377

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             ++EW S   ++D +  N L+  YAK+GL+ KA++   R    G  P   TWEI    Y+ 
Sbjct  378   YEEWASKSYSFDPKTMNILLAWYAKEGLITKAEQTVNRFVEKGGNPKPNTWEILATAYMN  437

Query  804   NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSED  625
             + +IS A+ C+EKA  T      KW P P  V  L+  F+ K D EGA+R++  L  S  
Sbjct  438   DDKISEALSCMEKA--TAVKSASKWKPRPTNVETLLASFKEKNDAEGADRLVSVL-TSRG  494

Query  624   HLGAELLESLIRTYAAAG  571
                 E  +SLI TYA AG
Sbjct  495   CAEDEEYKSLIDTYAFAG  512



>ref|XP_011085741.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Sesamum indicum]
Length=546

 Score =   271 bits (693),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 165/447 (37%), Positives = 263/447 (59%), Gaps = 14/447 (3%)
 Frame = -2

Query  1953  ASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENS---AGKNLNEFLKSHKSAYK  1783
             +S  Q  S  T +  KR   K+   A+Y+K+     LEN    +   LNE     K   K
Sbjct  57    SSISQVHSYGTVDYEKRPMLKW--NAIYKKI---SMLENPNMGSASVLNEVENEGKRLSK  111

Query  1782  WEVGRSVKLLRQRKLYSPAIKLSETMEKRGMNK--TTSDQGIHVDLVAKSKGIAAAEAYF  1609
             WE+ R VK LR+ + Y  A+++ E M  R  +   TTSD  I +DL+AK  GI++AE YF
Sbjct  112   WELCRVVKELRKFRRYRFALEVYEWMNNRAESYRITTSDTAIQLDLIAKVHGISSAEKYF  171

Query  1608  INLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQ  1429
             + LP+  K+   YG+LLN Y +  M EKAE+L++KM++ +    ++P+N +MTLY     
Sbjct  172   MKLPDALKDKRIYGSLLNAYVRARMREKAESLMDKMRDRSYASHALPFNVMMTLYMNLKD  231

Query  1428  PEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYS  1249
              EKI ++I E+KE +I  D +TYNIW+ +  + G +  +E+V ++M+ D  +  +WTT+S
Sbjct  232   HEKIESLISEMKEKNIALDIYTYNIWLSSRGSQGSLEKMEQVFEQMQLDPTINPNWTTFS  291

Query  1248  NLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLA  1069
              +A++Y   G  +KAE  LK++E + T R+   Y +LI+LYG  GN  EVYR+W + + +
Sbjct  292   TMATMYIKLGHLEKAEDCLKKIESRITGRDRMPYHYLISLYGSAGNKEEVYRVWNTYKAS  351

Query  1068  FPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkka  889
             F    N+ Y  +I  LV +ND+ GAEK + EW S ++ YD RV N L+ +Y ++GL +KA
Sbjct  352   FFNIPNLGYHTVISALVRINDIDGAEKIYDEWLSVKSVYDPRVGNLLLSSYVRKGLSQKA  411

Query  888   kelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQK-WVPSPVI  712
             +    +    G KPN+ TWEI  + +++N  IS A+ C++ A +    +G K W P P+ 
Sbjct  412   ETFFDQMIEVGGKPNSMTWEILGEDHIRNRRISEALSCLKNAAS---AEGSKTWRPKPIN  468

Query  711   VGELMRHFETKKDVEGAERVLGNLKKS  631
             V  +++  E + D    + +L  L+++
Sbjct  469   VSSILKISEQESDTATKDALLEVLRQT  495



>ref|XP_006652599.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Oryza brachyantha]
Length=511

 Score =   270 bits (690),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 163/439 (37%), Positives = 250/439 (57%), Gaps = 8/439 (2%)
 Frame = -2

Query  1878  ALYRKL-LKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETME  1702
             +LYR++ +  GG     G+ L    +  +   KWE+ R  + LR+ + ++ A+++ + M 
Sbjct  77    SLYRRIAVGHGG--RPGGRTLAGGDEGERRLDKWELCRISRELRKFRRFNLALQVYDWMT  134

Query  1701  KRG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTE  1528
             +R    + ++SD  I +DL+AK +G+A AE YF  LP+  K+  TYG+LLN Y + +M E
Sbjct  135   ERRDRFSLSSSDMAIQLDLIAKVRGVAHAEEYFEELPDPLKDKRTYGSLLNVYAQAMMKE  194

Query  1527  KAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWM  1348
             K E+  E+M++      ++P+N LM  Y    + EK+  II E+ + ++  D  TYNIW+
Sbjct  195   KTESTFEQMRKKGFATDTLPFNVLMNFYVDAEEAEKVSIIIDEMMDRNVAFDVCTYNIWI  254

Query  1347  RALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNT  1168
             ++ AA+ D  G+E V ++M RD  V  +WTTY+ LAS+Y   G  +KAE+ LKE EK+ T
Sbjct  255   KSCAAMQDADGIEEVFNQMIRDETVVANWTTYTTLASMYIKLGNFEKAEEFLKEAEKRTT  314

Query  1167  PRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEK  988
              R    + FLITLY  +G   EVYRIW   +  FP   N+ Y  ++  LV L D+ GAE 
Sbjct  315   GREKKCFHFLITLYSHLGKKEEVYRIWNWYKATFPTIHNLGYQEVLSALVRLGDIEGAEL  374

Query  987   CFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYL  808
              ++EW S  + +D +  N L+  YA++G + KA++   R    G  P   TWEI    YL
Sbjct  375   LYEEWASKSSNFDPKTMNILLAWYAREGFVTKAEQTLNRFVEKGGNPKPNTWEILATAYL  434

Query  807   KNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSE  628
             K+G+ S A+ C+EKA  T      KW P P  V  L+  F+ + D E  +R++ N+ +S 
Sbjct  435   KDGQSSEALSCLEKA--TAVVSPSKWRPRPTNVENLLAIFKERNDTESVDRLM-NVLRSR  491

Query  627   DHLGAELLESLIRTYAAAG  571
                  E  +SLI TYA  G
Sbjct  492   GCEENEEYKSLINTYAFQG  510



>gb|EAY95037.1| hypothetical protein OsI_16851 [Oryza sativa Indica Group]
Length=511

 Score =   270 bits (690),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 158/435 (36%), Positives = 254/435 (58%), Gaps = 8/435 (2%)
 Frame = -2

Query  1878  ALYRKL-LKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETME  1702
             +LYR++ +  GG     G+ L  + +  +   KWE+ R  + LR+ + ++ A+++ + M 
Sbjct  77    SLYRRIAVGHGG--RPVGRTLGAWDEGERRLDKWELCRIARELRKFRRFNLALQVYDWMT  134

Query  1701  KRG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTE  1528
             +R    + ++SD  I +DL+AK +G++ AE YF  LP+  K+  TYG+LLN Y + +M E
Sbjct  135   ERRDRFSLSSSDMAIQLDLIAKVRGVSHAEEYFEELPDPLKDKRTYGSLLNVYAQAMMKE  194

Query  1527  KAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWM  1348
             K E+  E+M++      ++P+N LM  Y    + EK+  +I E+ E ++  D  TYNIW+
Sbjct  195   KTESTFEQMRKKGFATDTLPFNVLMNFYVDAEEAEKVSILIDEMMERNVAFDVCTYNIWI  254

Query  1347  RALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNT  1168
             ++ AA+ D   +E+V ++M RD  V  +WTTY+ LAS++   G S+KAE++LKE EK+ T
Sbjct  255   KSCAAMQDADAMEQVFNQMIRDETVVANWTTYTTLASMHIKLGNSEKAEESLKEAEKRTT  314

Query  1167  PRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEK  988
              R    + +L+TLY  +G   EVYR+W   +  FP   N+ Y  ++  LV L D+ GAE 
Sbjct  315   GREKKCFHYLMTLYSHLGKKEEVYRVWNWYKATFPTIHNLGYQEVLSALVRLGDIEGAEL  374

Query  987   CFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYL  808
              ++EW S  +++D +  N L+  YA++G + KA++   R    G  P   TWEI    YL
Sbjct  375   LYEEWASKSSSFDPKTMNILLAWYAREGFVTKAEQTLNRFVEKGGNPKPNTWEILGTAYL  434

Query  807   KNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSE  628
             K+G+ S A+ C+EKA  T      KW P P  V  L+ +F+ K D E A+R++ N+ +S 
Sbjct  435   KDGQSSEALSCLEKA--TAVASPSKWRPRPTNVESLLANFKEKNDAESADRLM-NVLRSR  491

Query  627   DHLGAELLESLIRTY  583
                  E  +SLI TY
Sbjct  492   RCEENEEYKSLINTY  506



>ref|XP_008343713.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Malus domestica]
Length=531

 Score =   270 bits (691),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 163/452 (36%), Positives = 253/452 (56%), Gaps = 8/452 (2%)
 Frame = -2

Query  1977  YQKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSH  1798
             +QK  T   S  Q  +  T +  +R   K+   A+YRK+      +  +   LN++ K  
Sbjct  36    FQKLPTISCSISQVHNYGTVDYERRPMVKW--NAIYRKISLTEDPQVRSADVLNQWEKEG  93

Query  1797  KSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKGIAA  1624
             +   KWE+ R VK LR+ K Y  A+++ + M  RG     +TSD  I +DLVAK +G+A+
Sbjct  94    RKLTKWELCRVVKELRKYKRYDRALEVYDWMSNRGERFRISTSDAAIQLDLVAKVRGVAS  153

Query  1623  AEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLY  1444
             AE YF++LP T K+   YGALLN Y +  M EKAEAL++KM+     L S+P+N +MTLY
Sbjct  154   AENYFLSLPGTLKDRRIYGALLNAYVRARMKEKAEALLDKMRTKGHALQSLPFNVMMTLY  213

Query  1443  TRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAED  1264
                   +K+ +II E+ E +I  D ++YNIW+ +  + G    +E V ++MK D  +  +
Sbjct  214   MNLKDYDKVDSIISEMLEKNIXLDIYSYNIWLSSRGSQGSAERMEEVFEKMKVDRTIIPN  273

Query  1263  WTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWR  1084
             WTT+S +A++Y   G  DKAE  L+++E + T R+   Y +L++LYG +G   E YR+W 
Sbjct  274   WTTFSTMATMYIKMGQLDKAEACLRKVESRITGRDRIPYHYLLSLYGSVGKKEEAYRVWN  333

Query  1083  SLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQG  904
               + +FP   N+ Y  ++  L+ L D+ GAEK ++EW + ++TYD R+AN  I  Y K+G
Sbjct  334   VYKASFPSIPNLGYHAIMSSLLRLGDIEGAEKLYEEWLTVKSTYDPRIANLFITFYIKEG  393

Query  903   llkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQK-WV  727
                 A+         G KPN+ TWE   + ++    IS A+ C ++A +    +G K W 
Sbjct  394   DFVNAQSFYDHMVDVGGKPNSSTWEALAEGHIAEKRISEALSCWKEAFS---AEGSKSWR  450

Query  726   PSPVIVGELMRHFETKKDVEGAERVLGNLKKS  631
             P PV V   +   E + D    E  +G L +S
Sbjct  451   PKPVNVSAFLELCEQEGDSVSKEVFMGLLSQS  482



>ref|XP_009592903.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Nicotiana tomentosiformis]
Length=539

 Score =   270 bits (691),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 155/443 (35%), Positives = 258/443 (58%), Gaps = 8/443 (2%)
 Frame = -2

Query  1953  ASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEV  1774
             +S  Q  S  T +  +R   K+   A+Y+++    G E  +   L ++    K   KWE+
Sbjct  53    SSISQVHSYGTVDYERRPIVKW--NAIYKRISMNDGPERGSVSVLKQWENEGKKVTKWEL  110

Query  1773  GRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINL  1600
              R +K LR+ + Y  A+++ E M  R      TTSD  I +DL+AK  GI++AE YF+ L
Sbjct  111   SRVIKELRKFRRYKLALEVYEWMNNRAERFRLTTSDTAIQLDLIAKVHGISSAEEYFVKL  170

Query  1599  PETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEK  1420
             P+T K+   YG+LLN + +    E+AE+LI+KM+    T  ++P+N +MTLY      +K
Sbjct  171   PDTLKDKRIYGSLLNAFVRARKKEQAESLIDKMRNRGYTDHALPFNVMMTLYMNLKDYDK  230

Query  1419  IPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLA  1240
             + +++ E+ E  I  D ++YNIW+ +  + G +  +E+V+++M  D  +  +WTTYS +A
Sbjct  231   VESVVSEMMEKQIPLDIYSYNIWLSSCGSQGSVEKMEKVLEKMNLDTDINPNWTTYSTMA  290

Query  1239  SIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPK  1060
             ++Y   G   KAE +LK +E + T R+   Y +LI+LYG +G   EV RIW++ +  FP 
Sbjct  291   TMYIKLGQLKKAEDSLKSVESRITGRDRIPYHYLISLYGSLGKKEEVLRIWKTYQSQFPT  350

Query  1059  TANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakel  880
               N+ Y ++I  LV L+D+ GAEK + EW   ++ YD R+ N L+G Y ++G + KA   
Sbjct  351   IPNLGYHSVISALVRLDDIEGAEKIYDEWLPVKSHYDPRLGNLLLGYYVRKGSVDKAIAF  410

Query  879   rkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQK-WVPSPVIVGE  703
               +   +GAKPN+ TWEI  + +++   +S A+ C++ A++T   +G K W P P  V  
Sbjct  411   LDQMVEAGAKPNSMTWEIVAEGHIRERRLSEALSCLKDAVST---EGSKSWRPKPANVSS  467

Query  702   LMRHFETKKDVEGAERVLGNLKK  634
             ++R  E ++D +  E ++  LK+
Sbjct  468   ILRLCEQEEDTQSKEALMEVLKQ  490



>ref|XP_008810293.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial-like isoform X1 [Phoenix dactylifera]
Length=429

 Score =   266 bits (681),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 150/368 (41%), Positives = 227/368 (62%), Gaps = 2/368 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGL-ENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEK  1699
             LYR+L   GG  E      L+++          ++ + ++ LR+ + +  A+++   MEK
Sbjct  41    LYRRLSALGGAPEGRVTATLDQWEMEGWRMTALQLMKHIRELRKYRRHEHALEMMHWMEK  100

Query  1698  RGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAE  1519
             R M        + +DL++K KG+ +AE YF NLPE +KN  TYGAL NCYC   MT++A 
Sbjct  101   RSMEMPNGYHAVRLDLISKVKGVRSAEEYFSNLPEPAKNQRTYGALFNCYCSGKMTDRAV  160

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
             AL+EKMKEL      + YN+LM+LY + GQ E +P + QE+K  +++PDS TY I M++ 
Sbjct  161   ALLEKMKELKFASNVLIYNNLMSLYMKLGQLEMVPILFQEMKASNVLPDSCTYRIIMKSY  220

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
             A++ D+  VERV  EM+ + R A D  TY +LAS+Y   GL +KAE ALK+ E       
Sbjct  221   ASVSDMVSVERVTQEME-ESRGASDCLTYCHLASLYNSVGLFEKAETALKKAELVLGSHE  279

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
             L+ ++ LI+ Y   GNL EV R+W S +   P+  N +YL M+Q L  L+DM G ++CF+
Sbjct  280   LSPFRLLISSYAAAGNLSEVSRVWNSFKARVPRPTNTNYLIMLQALRKLDDMDGLKRCFE  339

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWESG   YDIR+ N +I AY ++G++ +AK L+++A + G   +  T+ +F+D+YLK+ 
Sbjct  340   EWESGCVNYDIRLVNTVIEAYLRKGMVDEAKLLQEKADQKGEWSDVHTFVLFIDHYLKSR  399

Query  798   EISSAVDC  775
             E+  A  C
Sbjct  400   ELELARKC  407



>ref|XP_006375170.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|ERP52967.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=539

 Score =   270 bits (689),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 164/480 (34%), Positives = 262/480 (55%), Gaps = 7/480 (1%)
 Frame = -2

Query  1992  NESRQYQKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNE  1813
             +++  Y+K    + S  Q  +  T +  +R   K+    +YR++      E  +G  LN 
Sbjct  34    HQTVNYKKLPVIICSISQVHNYGTVDYERRPMIKW--NGIYRRISLMENPELGSGSVLNR  91

Query  1812  FLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKS  1639
             +    K   KWE+ R VK LR+ K Y  A+++ + M+ R      + SD  I +DL+AK 
Sbjct  92    WENEGKRLTKWELCRVVKELRKYKRYQQALEVYDWMKNRQERFRLSPSDAAIQLDLIAKV  151

Query  1638  KGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNS  1459
             +G++ AE +F++LP T K+   YGALLN Y +  M EKAE L ++M++      ++P+N 
Sbjct  152   RGVSTAEDFFLSLPNTFKDRRVYGALLNAYVQNRMREKAETLFDEMRDKGYVTHALPFNV  211

Query  1458  LMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDG  1279
              MTLY    + +K+  +I E+ E +I  D ++YNIW+ +  + G    +E+V ++MK D 
Sbjct  212   TMTLYMNIKEYDKVDLMISEMNEKNIKLDIYSYNIWLSSCGSQGSADKMEQVYEQMKSDR  271

Query  1278  RVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEV  1099
              +  +WTT+S +A++Y   G  +KAE  L+ +E + T R+   Y +L++LYG +GN  EV
Sbjct  272   SINPNWTTFSTMATMYIKMGQFEKAEDCLRRVESRITGRDRIPYHYLLSLYGNVGNKEEV  331

Query  1098  YRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGA  919
             YR+W   +  FP   N+ Y  +I  LV L+D+ GAEK F+EW S +T+YD R+AN  I A
Sbjct  332   YRVWNIYKSIFPSIPNLGYHAIISSLVRLDDIEGAEKIFEEWLSIKTSYDPRIANLFIAA  391

Query  918   YAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDG  739
             Y  QG L +AK         G KPN+ TWEI    ++     S A+ C+++A  T     
Sbjct  392   YVYQGNLDEAKSFFDHMLEDGGKPNSNTWEILAQGHISERRTSEALSCLKEAFVT--PGS  449

Query  738   QKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTST  559
             + W P+P  V    +  E + D+   E + G L++S  HL  +   SL+       + ST
Sbjct  450   KSWKPNPANVTSFFKLCEEEADMANKEALEGFLRQS-GHLKDKAYASLLGMPVTGDELST  508



>ref|XP_008343638.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
isoform X1 [Malus domestica]
Length=535

 Score =   270 bits (689),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 155/419 (37%), Positives = 241/419 (58%), Gaps = 6/419 (1%)
 Frame = -2

Query  1878  ALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEK  1699
             A+YRK+      E  +   LN++ K  +   KWE+ R VK LR+ K Y  A+++ + M  
Sbjct  71    AIYRKISLTEDPEVRSADMLNQWEKEGRKLTKWELCRVVKELRKYKRYDRALEVYDWMSN  130

Query  1698  RG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
             RG     +TSD  I +DL AK +G+A+AE YF++LP+T K+   YGALLN Y +  M +K
Sbjct  131   RGERFRISTSDAAIQLDLFAKVRGVASAENYFLSLPDTLKDRRIYGALLNAYVRARMKQK  190

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             AEAL+EKM+     L S+P+N +MTLY      +K+ +II E+ E +I  D ++YNIW+ 
Sbjct  191   AEALLEKMRTKGHALQSLPFNVMMTLYMNLRDYDKVDSIISEMIEKNIQLDIYSYNIWLS  250

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             +  + G    +E V ++MK D  +  +WTT+S +A++Y   G  DKAE  L+++E + T 
Sbjct  251   SRGSQGSAERMEEVFEKMKVDRTINPNWTTFSTMATMYIKMGQLDKAEACLRKVESRITS  310

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             R+   Y +L++LYG +G   E YR+W   + +FP   N+ Y  +I  L+ L D+ G+EK 
Sbjct  311   RDWIPYHYLLSLYGSVGKKEEAYRVWNVYKASFPTIPNLGYHAIISSLLRLGDVEGSEKL  370

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             ++EW + ++TYD R+AN  I  Y K+G    A+         G KPN+ TWE   + +++
Sbjct  371   YEEWLTVKSTYDPRIANLFITFYIKEGDFDSAQSFYNHMVDVGGKPNSSTWESLTEGHME  430

Query  804   NGEISSAVDCIEKAITTGRGDGQK-WVPSPVIVGELMRHFETKKDVEGAERVLGNLKKS  631
                IS A+ C ++A +    +G K W P PV V   +   E + D    E  +G L +S
Sbjct  431   ERRISEALSCWKEAFS---AEGSKSWRPKPVNVSAFLELCEQEADSVSKEVFMGLLSQS  486



>ref|XP_002457728.1| hypothetical protein SORBIDRAFT_03g012450 [Sorghum bicolor]
 gb|EES02848.1| hypothetical protein SORBIDRAFT_03g012450 [Sorghum bicolor]
Length=530

 Score =   269 bits (687),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 165/470 (35%), Positives = 269/470 (57%), Gaps = 10/470 (2%)
 Frame = -2

Query  1875  LYRKLLKEG-GLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM-E  1702
             LYR+L   G   E S  + LN++++   +    E+ + VK LR+ K ++ A+++ + M  
Sbjct  66    LYRRLSALGIAGEGSVSRVLNKWVREGGAPRSEELVKHVKELRKYKRHAHALEVMDWMVN  125

Query  1701  KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKA  1522
              RGMN + ++  I +DL+ K +G+ AAE YF NLP+ +KNH TYGALL+CYC   M EKA
Sbjct  126   ARGMNMSITNHAIRLDLIYKVRGLEAAENYFANLPDPAKNHRTYGALLSCYCSAKMEEKA  185

Query  1521  EALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRA  1342
               L  +M EL     ++P N+LM+LY +  Q  K+ ++ +E+K  +I PDS T  I M +
Sbjct  186   TYLYRQMDELGFWSGTLPINNLMSLYMKLDQHRKVDSLFEEMKVKNIKPDSLTCCILMTS  245

Query  1341  LAALGDISGVERVIDEM-KRDGRVAEDWTTYSNLASIYADAG-LSDkaekalkelekKNT  1168
              AA   I  +E ++ EM ++D  V+  W+ YS LASIY +AG +        K       
Sbjct  246   YAASNKIDAIEELLKEMVEKD--VSLGWSAYSTLASIYVNAGQVEKAESALKKLEGLIGA  303

Query  1167  PRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEK  988
                   + FL++LY  +GNL E+ R+W  ++  F    NISYL M+  L  LND+   ++
Sbjct  304   EDGRQPFDFLMSLYASLGNLSEINRVWDVIKAKFSTVTNISYLGMLHALYKLNDIDRMKQ  363

Query  987   CFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYL  808
              + EWES   TYD+R+ N +I  + + G+ ++A+ LR++A+  G + ++KT E+FLD+Y+
Sbjct  364   IYMEWESNYQTYDVRLTNMMIRGHLRLGMSEEAETLREKAKEKGVEFDSKTCELFLDHYM  423

Query  807   KNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSE  628
               G+++SA++ +E      +  G+        + +  ++FE  KD + AER   N  +  
Sbjct  424   GKGDMNSALNWVENMTKLPKKAGK---LDQDRIYKFQKYFEEHKDADSAER-FCNCLRML  479

Query  627   DHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
               +  +  ESL+RTY AAGK S  +R+++K +  E+  +  KLL  +  E
Sbjct  480   GCIDGKAYESLLRTYLAAGKKSCSLRQQIKNDKIEICYDIGKLLKRLGDE  529



>ref|XP_004307244.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Fragaria vesca subsp. vesca]
Length=541

 Score =   269 bits (688),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 165/456 (36%), Positives = 262/456 (57%), Gaps = 10/456 (2%)
 Frame = -2

Query  1986  SRQYQKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKL-LKEGGLENSAGKNLNEF  1810
             S  YQ+ LT  +S  Q  +  T +  +R   K+   A+YRK+ L     E +A   LN++
Sbjct  36    SINYQR-LTISSSISQVHNYGTVDYERRPIVKW--NAIYRKISLLADDPELNASSVLNQW  92

Query  1809  LKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSK  1636
              K  K   KWE+ R VK LR+ K Y  A+++ + M  R      ++SD  I +DLV K +
Sbjct  93    EKEGKKLSKWELCRVVKELRKFKRYGRALEVYDWMINRAERFRFSSSDAAIQLDLVGKVR  152

Query  1635  GIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSL  1456
             G+++AE YF++LP+  K+   YGALLN Y +  M EKAE+L++KM+     L  +P+N +
Sbjct  153   GVSSAENYFLSLPDNLKDKRIYGALLNAYVRAKMQEKAESLLDKMRSKGHALHPLPFNVM  212

Query  1455  MTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGR  1276
             MTLY    + EK+ +II E+ E +I  D ++YNIW+ +  + G    +E+V ++MK D  
Sbjct  213   MTLYMNLKEYEKVESIISEMMEKNIQLDIYSYNIWLSSRGSQGSAERMEQVFEQMKLDRT  272

Query  1275  VAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVY  1096
             +  +WTT+S +A++Y   GL +KAE  LK++E + T R+   Y +L++LYG +GN  E+Y
Sbjct  273   INPNWTTFSTMATMYIKMGLFEKAEACLKKVESRITGRDRIPYHYLLSLYGGVGNKDEIY  332

Query  1095  RIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAY  916
             R+W   + +FP   N+ Y  +I  L+ + D+ GAEK F+EW + + +YD R+ N  I +Y
Sbjct  333   RVWNVYKSSFPSIPNLGYHAIIAALIRVGDVEGAEKIFEEWLTVKPSYDPRIVNLFIVSY  392

Query  915   AKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQ  736
              ++G   KA+        +G KPN+ TWE   + +++   IS A+ C ++A      +G 
Sbjct  393   IEEGDFDKAQSFFDNMVEAGGKPNSSTWEALAEGHIEEKRISEALSCWKEAFM---AEGS  449

Query  735   K-WVPSPVIVGELMRHFETKKDVEGAERVLGNLKKS  631
             K W P PV V       E + D+   E  LG L++S
Sbjct  450   KSWRPKPVNVTTFYEFCEQEGDLRSKEIFLGLLRQS  485



>ref|XP_004133941.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Cucumis sativus]
 ref|XP_004169913.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Cucumis sativus]
 gb|KGN56639.1| hypothetical protein Csa_3G127020 [Cucumis sativus]
Length=537

 Score =   268 bits (685),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 159/447 (36%), Positives = 249/447 (56%), Gaps = 8/447 (2%)
 Frame = -2

Query  1965  LTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAY  1786
             L+   S  Q  S  T +  +R   K+   A+YR++      E  +   LN++    K+  
Sbjct  44    LSVTCSISQVHSYGTVDFERRPMFKW--NAIYRRISLMENPELGSASVLNQWENEGKNIT  101

Query  1785  KWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKGIAAAEAY  1612
             KWE+ R VK LR+ K +  A+++ + M  R      TTSD  I +DL++K +GI +AE Y
Sbjct  102   KWELSRVVKELRKYKRFERALEIYDWMSNREERFRLTTSDAAIQLDLISKVRGIKSAEEY  161

Query  1611  FINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTG  1432
             F+ LP   K+   YGALLN Y K    EKAE L+EKM+    T   +P+N +MTLY    
Sbjct  162   FLRLPNHLKDRRIYGALLNAYAKGRQREKAENLLEKMRTKGFTTHPLPFNVMMTLYMNVK  221

Query  1431  QPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTY  1252
             + EK+ +++ E+ E  I  D ++YNIW+ +    G    +E V ++MK+D  +  +WTT+
Sbjct  222   EYEKVESLVSEMTENSIQLDIYSYNIWLSSCGLQGSTEKMEEVYEQMKQDRTINANWTTF  281

Query  1251  SNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRL  1072
             S +A++Y   GL +KAE+ L+ +E +   R+   Y +LI+LYG +GN  E+YR+W   + 
Sbjct  282   STMATMYIKMGLMEKAEECLRRVESRIVGRDRIPYHYLISLYGSVGNKEEMYRVWNIYKN  341

Query  1071  AFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkk  892
              FP   N+ Y  +I  L+ + D+ GAEK ++EW + ++TYD R+AN  IG Y K+G   K
Sbjct  342   VFPTIPNLGYHAIISALIRVGDVEGAEKIYEEWLTVKSTYDPRIANLFIGWYVKEGNTSK  401

Query  891   akelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQK-WVPSPV  715
             A+         G KPN+ TWEI +D + K G +S A+   ++A +    +G K W P P 
Sbjct  402   AESFFDHMVEVGGKPNSSTWEILVDRHTKEGRVSDALASWKEAFS---AEGSKSWRPKPY  458

Query  714   IVGELMRHFETKKDVEGAERVLGNLKK  634
              V       E + D+   E ++G L++
Sbjct  459   NVLAYFDLCEKEGDIASKEVLVGLLRQ  485



>ref|NP_001288478.1| uncharacterized protein LOC103635083 [Zea mays]
 gb|ACN31600.1| unknown [Zea mays]
Length=515

 Score =   266 bits (681),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 160/463 (35%), Positives = 270/463 (58%), Gaps = 8/463 (2%)
 Frame = -2

Query  1875  LYRKLLKEGGL-ENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM-E  1702
             LYR+L   G   E S  + LN++++   +    ++ + VK LR+ K ++ A++L + M  
Sbjct  50    LYRRLSALGSAGEGSVSRVLNKWVREGGATRSDDLVKHVKELRKYKRHAHALELMDWMVN  109

Query  1701  KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKA  1522
              RGMN + ++  I ++L+ K +G+ AAE YF NLP+ +KNH TYG+LL+CYC   M EKA
Sbjct  110   ARGMNMSHTNHAIRLELIYKVRGLEAAENYFANLPDPAKNHRTYGSLLSCYCSAKMEEKA  169

Query  1521  EALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRA  1342
               L  +M EL +  +++P N+LM+LY +  Q  K+ ++ +E+K  ++ P+S T  I M +
Sbjct  170   TNLYRQMDELGIWSSTLPINNLMSLYMKLDQYRKVVSLFEEMKLKNVKPNSLTCCILMTS  229

Query  1341  LAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAG-LSDkaekalkelekKNTP  1165
              AAL  I  +E ++ EM  +  V   W+ YS LASIY +AG          K     +  
Sbjct  230   YAALNKIDDIEELLKEMV-EKDVTLGWSAYSTLASIYVNAGQFGKAESALKKLEGLISAH  288

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
              +   + FL++LY  +GNL EV R+W  ++  F K  N SYL M+  L  LND+   ++ 
Sbjct  289   DDRQPFDFLLSLYASLGNLSEVNRVWNVIKSKFSKVTNTSYLGMLHALYKLNDIDRMKQI  348

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             + EWES   T+D+++ N +I ++ K G+ ++A+ L ++ + +GA+ + KT E+FLD+Y+ 
Sbjct  349   YMEWESNYETFDVKLTNMMIRSHLKVGMTEEAEMLVEKVKENGAEFDTKTCELFLDHYMG  408

Query  804   NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSED  625
               +++SA++ +E  +T      +K     +   +  ++FE  KD +GAER   N  ++  
Sbjct  409   TEDMNSALNWLEN-MTKLSKKAEKLDQDRIY--KFQKYFEEHKDADGAER-FCNCLRTLG  464

Query  624   HLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
              +  +  ESL+RTY AAGK S  +R+++K +  E+  +  KLL
Sbjct  465   CIDGKAYESLLRTYLAAGKKSCSLRQQIKNDKVEICYDIGKLL  507



>ref|XP_009375366.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Pyrus x bretschneideri]
Length=534

 Score =   266 bits (679),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 154/419 (37%), Positives = 241/419 (58%), Gaps = 6/419 (1%)
 Frame = -2

Query  1878  ALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEK  1699
             A+YRK+      E  +   LN++ K  +   KWE+ R VK LR+ K Y  A+++ + M  
Sbjct  71    AIYRKISLTEDPEVRSADVLNQWEKEGRKLTKWELCRVVKELRKYKRYDRALEVYDWMSN  130

Query  1698  RG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
             RG     +TSD  I +DL AK +G+A+AE YF++LP+T K+   YGALLN Y    M EK
Sbjct  131   RGERFRISTSDAAIQLDLFAKVRGVASAENYFLSLPDTLKDRRIYGALLNAYVWARMKEK  190

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             AEAL++KM+     L S+P+N +MTLY      +K+ +II E+ E +I  D ++YNIW+ 
Sbjct  191   AEALLDKMRTKGHALQSLPFNVMMTLYMNLKDYDKVDSIISEMIEKNIQLDIYSYNIWLS  250

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             +  + G    +E V ++MK D  +  +WTT+S +A++Y   G  DKAE  L+++E + T 
Sbjct  251   SRGSQGSAERMEEVFEKMKVDRTINPNWTTFSTMATMYIKMGKLDKAEACLRKVESRITG  310

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             R+   Y +L++LYG +G   + YR+W   +  FP   N+ Y  ++  L+ L D+ GAEK 
Sbjct  311   RDRIPYHYLLSLYGSVGKKEDAYRVWNVYKAIFPSIPNLGYHAIMSSLLRLGDVEGAEKL  370

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             ++EW + ++TYD R+AN  I  Y K+G    A+         G KPN+ TWE   + +++
Sbjct  371   YEEWLTVKSTYDPRIANLFIVFYIKEGDFDSAQSFYDHMVDVGGKPNSSTWESLAEGHME  430

Query  804   NGEISSAVDCIEKAITTGRGDGQK-WVPSPVIVGELMRHFETKKDVEGAERVLGNLKKS  631
                IS A+ C ++A +    +G K W P PV V   +   E + D    E ++G L++S
Sbjct  431   EKRISEALSCWKEAFS---AEGSKSWRPKPVNVSAFLELCEQESDSVSKEVLMGLLRQS  486



>ref|XP_003536907.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Glycine max]
Length=516

 Score =   265 bits (677),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 158/468 (34%), Positives = 269/468 (57%), Gaps = 9/468 (2%)
 Frame = -2

Query  1881  EALYRKLLKEGGLENSAGKNLNEFLKS-HKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM  1705
             + L R+LL     + SA   +N++ +  H+   K+++ R V+ LR+ K Y  A+++ E M
Sbjct  44    DTLGRRLLSLVYPKRSAVVAINKWKEEGHEPPRKYQLNRIVRELRKDKRYKHALEVCEWM  103

Query  1704  E-KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTE  1528
               ++ M     D  +H+DL+ K +G+ +AE +F +LP+  +   T  ALL+ Y +  + +
Sbjct  104   TLQKDMKLVQGDYAVHLDLITKVRGLNSAEKFFEDLPDRMRGKQTCSALLHAYVQNNLVD  163

Query  1527  KAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWM  1348
             KAEAL+ KM E +L +  +PYN +++LY   G+ EK+P IIQE+K  +  PD  T+N+W+
Sbjct  164   KAEALMLKMSECDLLINPLPYNHMISLYISNGKLEKVPKIIQELK-MNTSPDIVTFNLWL  222

Query  1347  RALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNT  1168
              A A+  D+   ERV+ E+K+  ++  DW TYS L ++Y      +KA   +KE+E + +
Sbjct  223   AACASQNDVETAERVLLELKK-AKIDPDWVTYSTLTNLYIKNASLEKAGATVKEMENRTS  281

Query  1167  PRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEK  988
              +   AY  L++L+  +GN  +V RIW  ++ +F K  +  Y+ MI  L+ L D  GAE 
Sbjct  282   RKTRVAYSSLLSLHTNMGNKDDVNRIWEKMKASFRKMNDNEYICMISSLLKLGDFAGAED  341

Query  987   CFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYL  808
              ++EWES   T D+RV+N L+G+Y  Q  ++ A++   +  + G  P   TWE+F   YL
Sbjct  342   LYREWESVSGTNDVRVSNILLGSYINQDQMEMAEDFCNQIVQKGVIPCYTTWELFTWGYL  401

Query  807   KNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSE  628
             K  ++   +D   KAI++      KW P   +V E  +  E +   +GAE++L  L+ + 
Sbjct  402   KRKDVEKFLDYFSKAISS----VTKWSPDQRLVQEAFKIIEEQAHTKGAEQLLVILRNA-  456

Query  627   DHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVIS  484
              H+   +    ++TYA AGK   ++  R++ +N +L EE ++LLD+ S
Sbjct  457   GHVNTNIYNLFLKTYATAGKMPMIVAERMRKDNVKLDEETRRLLDLTS  504



>ref|NP_001053460.2| Os04g0544400 [Oryza sativa Japonica Group]
 dbj|BAF15374.2| Os04g0544400 [Oryza sativa Japonica Group]
Length=571

 Score =   266 bits (679),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 151/417 (36%), Positives = 245/417 (59%), Gaps = 7/417 (2%)
 Frame = -2

Query  1878  ALYRKL-LKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETME  1702
             +LYR++ +  GG     G+ L  + +  +   KWE+ R  + LR+ + ++ A+++ + M 
Sbjct  77    SLYRRIAVGHGG--RPVGRTLGAWDEGERRLDKWELCRIARELRKFRRFNLALQVYDWMT  134

Query  1701  KRG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTE  1528
             +R    + ++SD  I +DL+AK +G++ AE YF  LP+  K+  TYG+LLN Y + +M E
Sbjct  135   ERRDRFSLSSSDMAIQLDLIAKVRGVSHAEEYFEELPDPLKDKRTYGSLLNVYAQAMMKE  194

Query  1527  KAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWM  1348
             K E+  E+M++      ++P+N LM  Y    + EK+  +I E+ E ++  D  TYNIW+
Sbjct  195   KTESTFEQMRKKGFATDTLPFNVLMNFYVDAEEAEKVSILIDEMMERNVAFDVCTYNIWI  254

Query  1347  RALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNT  1168
             ++ AA+ D   +E+V ++M RD  V  +WTTY+ LAS++   G S+KAE++LKE EK+ T
Sbjct  255   KSCAAMQDADAMEQVFNQMIRDETVVANWTTYTTLASMHIKLGNSEKAEESLKEAEKRTT  314

Query  1167  PRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEK  988
              R    + +L+TLY  +G   EVYR+W   +  FP   N+ Y  ++  LV L D+ GAE 
Sbjct  315   GREKKCFHYLMTLYSHLGKKEEVYRVWNWYKATFPTIHNLGYQEVLSALVRLGDIEGAEL  374

Query  987   CFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYL  808
              ++EW S  +++D +  N L+  YA++G + KA++   R    G  P   TWEI    YL
Sbjct  375   LYEEWASKSSSFDPKTMNILLAWYAREGFVTKAEQTLNRFVEKGGNPKPNTWEILGTAYL  434

Query  807   KNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLK  637
             K+G+ S A+ C+EKA  T      KW P P  V  L+ +F+ K D E A+R++  L+
Sbjct  435   KDGQSSEALSCLEKA--TAVASPSKWRPRPTNVESLLANFKEKNDAESADRLMNVLR  489



>ref|XP_009390562.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial [Musa acuminata subsp. malaccensis]
 ref|XP_009390570.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial [Musa acuminata subsp. malaccensis]
Length=514

 Score =   264 bits (675),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 160/441 (36%), Positives = 258/441 (59%), Gaps = 11/441 (2%)
 Frame = -2

Query  1779  EVGRSVKLLRQRKLYSPAIKLSETME-KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFIN  1603
             E+   ++ LR+R+ Y  A+++SE M+ K+ +   +SD  +H+DL+ +  G+++AE+YF N
Sbjct  77    ELQHVIRELRKRRRYKQALEVSEWMKGKQKIQFMSSDHAVHLDLIGQVHGLSSAESYFNN  136

Query  1602  LPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPE  1423
             + E  KN  TYGALLNCY +E + EK+ + I+KMKEL L  + +PYN +M LYT TGQ E
Sbjct  137   MRENDKNEKTYGALLNCYVRERLVEKSLSHIQKMKELGLVSSPLPYNDIMCLYTNTGQHE  196

Query  1422  KIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNL  1243
             K+P++++++K   ++PD+F+Y I + +   + DI+G+E +++EM+   ++  DW TYS +
Sbjct  197   KVPSVLEDMKTNGVLPDNFSYRICINSYGTMSDINGMEMILEEMEHQPQIVVDWNTYSVV  256

Query  1242  ASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFP  1063
             A+IY  A ++DKA  ALK+ E+K   RN   Y  LI+LY ++GN  E+ R+W   ++   
Sbjct  257   ANIYIKASITDKASSALKKAEEKLDKRNALGYNHLISLYSQLGNKSEMQRLWELQKVNCK  316

Query  1062  KTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkake  883
             K  N  Y  M+  LV L ++  AE   KEWES     D RV N L+  Y K GLL+KA+ 
Sbjct  317   KFINKDYTTMLGGLVKLGEVEEAEVLMKEWESSGNALDWRVPNVLLVGYKKMGLLEKAEA  376

Query  882   lrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGE  703
             +     + G  P A +W I    Y +   +  A + ++ A+         W P+P IV  
Sbjct  377   MLDDFLKKGKTPAASSWGIVATGYAEKDMMDKAYELMKNALCVYISSA-GWEPNPTIVKS  435

Query  702   LMRHF---ETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKME  532
             ++ +       KDVE   ++L    K    +  ++  +LI+TY   GK  + + +R+K +
Sbjct  436   ILHYLGDNSQSKDVETFIQLL----KFAMPIDRDMYHTLIKTYIREGKEVSELMQRMKSD  491

Query  531   NAELSEEAKKLLDVISAE*HS  469
               + +EE KK+LD  SA  HS
Sbjct  492   GIKENEETKKILD--SASKHS  510



>gb|KDP28877.1| hypothetical protein JCGZ_14648 [Jatropha curcas]
Length=528

 Score =   264 bits (674),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 159/446 (36%), Positives = 250/446 (56%), Gaps = 12/446 (3%)
 Frame = -2

Query  1878  ALYRK--LLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM  1705
             ++YRK  L++  GL   AG  LN+  K+ K   KWE+ R VK LR+ K Y  A+++ + M
Sbjct  71    SIYRKISLMENPGL--GAGTVLNQIEKNGKKLTKWELCRVVKELRKFKRYKQALEVYDWM  128

Query  1704  EKRG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMT  1531
               R      + SD  I +DL+AK +G+ +AE +F  LP++ K+   YGALLN Y +  M 
Sbjct  129   NNREERFRVSASDAAIQLDLIAKVRGVYSAEDFFFRLPDSVKDRRIYGALLNAYVRAKMR  188

Query  1530  EKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIW  1351
             EKAE  I+ M+       ++P+N +MTLY    + +K+  +I E+ E +I  D ++YNIW
Sbjct  189   EKAECWIDDMRNKGYANQALPFNVMMTLYMNLKEYDKVDMLISEMVEKNIRLDLYSYNIW  248

Query  1350  MRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKN  1171
             + +  + G +  +E V  +MK D  V  +WTT+S +A++Y   G  +KAE +L+ +E + 
Sbjct  249   LSSRGSQGSVERMEEVFQQMKLDKNVTPNWTTFSTMATMYIKMGQLEKAEDSLRRVESRI  308

Query  1170  TPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAE  991
             T R+   Y +L++LYG +GN  EVYR+W   +  FP   N+ Y  +I  L+ + D+ GAE
Sbjct  309   TGRDRMPYHYLLSLYGNVGNKEEVYRVWNIYKSVFPNIPNLGYHAIISSLIRVGDIEGAE  368

Query  990   KCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYY  811
             K ++EW   +T+YD R+ N L+  Y K+G   KA+        +G KPNA TWEI  D  
Sbjct  369   KTYEEWLPIKTSYDPRIGNLLMSWYVKEGNFDKAENFFNHMADAGGKPNANTWEILADGQ  428

Query  810   LKNGEISSAVDCIEKA-ITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKK  634
             +K   +  A+ C ++A I  G      W P PV+V       E K D+  ++ V  +L +
Sbjct  429   IKEKRVPEALSCFKEAFIAEG---ASSWKPKPVLVSAFFNLCEEKADM-ASKGVFEDLLR  484

Query  633   SEDHLGAELLESLIR-TYAAAGKTST  559
                +L  E   SL++ +  ++ K ST
Sbjct  485   QSGYLEDETYASLLKLSITSSNKLST  510



>ref|XP_010556784.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Tarenaya hassleriana]
Length=512

 Score =   263 bits (672),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 154/439 (35%), Positives = 257/439 (59%), Gaps = 8/439 (2%)
 Frame = -2

Query  1797  KSAYKWEVGRSVKLLRQRKLYSPAIKLSETME-KRGMNKTTSDQGIHVDLVAKSKGIAAA  1621
             ++  K+E+ R V+ LR+ K Y  A+++ E M  +  +     D  +H+DL+ K +G+ +A
Sbjct  76    RTVRKYELNRIVRELRKLKRYKHALEICEWMVLQEDIKLQPGDYAVHLDLITKIRGLNSA  135

Query  1620  EAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYT  1441
             E +F ++P+  ++H    +LL+ Y +  +++KAEAL EKM E     + +PYN L+++Y 
Sbjct  136   EKFFEDIPDRMRDHSVCTSLLHTYVQSKLSDKAEALFEKMSECGFLKSPLPYNHLISMYI  195

Query  1440  RTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDW  1261
               GQ +K+P +IQE+K+ ++ PD  TYN+W+ ALA+  D+  VE+V  ++K+  ++  DW
Sbjct  196   SKGQLDKVPVLIQELKK-NVTPDIVTYNLWLTALASENDVEAVEKVYLKLKQ-AKLDPDW  253

Query  1260  TTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRS  1081
              T+S LA++Y      +KA+ ALKE+EK  + +N  AY  LI+LYG IG+   V + W+ 
Sbjct  254   VTFSVLANLYTKNDCLEKAKLALKEMEKLVSKKNRVAYASLISLYGNIGDKDGVNQTWKR  313

Query  1080  LRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGl  901
             +R  F K  +  YL+ I  LV L     A+  + EWES   T D R+ N ++  +  +G 
Sbjct  314   MRSCFRKMNDAEYLSKISALVKLGQFAEAKDIYDEWESVSGTGDARIPNLILAEHMNRGE  373

Query  900   lkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPS  721
             +   +   +R    G  P+  TWEI    YLK+ ++   +DC +KAI    G  ++W P+
Sbjct  374   MHLGETFFQRVVEKGISPSYSTWEILTWAYLKHKDLDKVLDCFKKAI----GSVKEWTPN  429

Query  720   PVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRV  541
               +V E+ +  E + +VEGAE +L  L+K+  +   +L  SL+RTYA AGK + ++  R+
Sbjct  430   LRLVREVCKELEDQGNVEGAEELLNVLRKA-GYTNTQLYNSLLRTYAKAGKMALIVEERM  488

Query  540   KMENAELSEEAKKLLDVIS  484
               +N EL EE   L+ + S
Sbjct  489   AKDNIELDEETHDLMRLTS  507



>ref|XP_004495896.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Cicer arietinum]
Length=481

 Score =   262 bits (670),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 163/438 (37%), Positives = 256/438 (58%), Gaps = 10/438 (2%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LY++L +      S  + LN+++   K+  K E+ + V+ LR+ + +  A ++ E M  R
Sbjct  33    LYKRLSELEKTGESVSQTLNQYIMGGKAVGKSELEKCVQELRKYRRFQHAFEIMEWMVMR  92

Query  1695  GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEA  1516
              +N + ++  + +DLV+K KG+  AE YF +L   +KN +TYG+LLNCYCKELM +KA A
Sbjct  93    KINFSWNNYAVQLDLVSKVKGLIEAENYFNSLSSPAKNKYTYGSLLNCYCKELMLDKALA  152

Query  1515  LIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALA  1336
                 M EL   LTS+ + +LMTLY + GQP K+  ++ ++K+  I   +F Y +WM + A
Sbjct  153   HFNTMDELGY-LTSLSFTNLMTLYMKLGQPLKVLDLVNDMKQRKIPMTAFAYIVWMNSCA  211

Query  1335  ALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNL  1156
              L D+ GVE V +EM R+     +WTTYSNLA+IY  AG  +KAE  LK+LE+   P+  
Sbjct  212   ELNDLDGVESVYEEMGREDEDKINWTTYSNLAAIYVKAGHFEKAELMLKKLEEIVRPQER  271

Query  1155  TAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKE  976
               Y  L++LYG  GN+ EVYR+W++L+   P T N SYL M+  L  LNDM G  K FKE
Sbjct  272   ETYHCLLSLYGGTGNVKEVYRVWKTLKTVSPVT-NKSYLIMLSTLRRLNDMEGIIKIFKE  330

Query  975   WESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGE  796
             WES   +YD R+    + AY  Q + ++A  + + A +    P  +  E+F+   L+  +
Sbjct  331   WESRHVSYDTRLVGVAVFAYLSQNMEEEAVLIFEEALKRCRGPFYRIREMFVVSLLEKRQ  390

Query  795   ISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLG  616
                A+  +E A+ +   DG+ + PSP +V  L+++++ + D++G E +   L+       
Sbjct  391   FDGAMTHLETAL-SDVADGE-YCPSPQVVSALLKYYKEETDLDGVEELCKILR------S  442

Query  615   AELLESLIRTYAAAGKTS  562
                 ES I+T  AA ++S
Sbjct  443   HNFDESRIKTCIAASESS  460



>ref|XP_004229730.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Solanum lycopersicum]
Length=545

 Score =   263 bits (673),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 154/450 (34%), Positives = 258/450 (57%), Gaps = 8/450 (2%)
 Frame = -2

Query  1974  QKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHK  1795
               ++   +S  Q  S  T +  +R   K+   A+Y+++    G E  +   LN++    K
Sbjct  52    HHSVISCSSTSQVHSYGTVDYERRPIVKW--NAIYKRISMNDGPERGSVSVLNQWENEGK  109

Query  1794  SAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKGIAAA  1621
                KWE+ R +K LR+ + Y  A ++ E M  R      TTSD  I +DL+AK  GI++A
Sbjct  110   KVTKWELSRVIKELRKFRRYKLAFEVYEWMNNRPERFRLTTSDTAIQLDLIAKVHGISSA  169

Query  1620  EAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYT  1441
             E YF  LP+T K+   YG+LLN + +    E+AE+L++KM+    T  ++P+N +MTLY 
Sbjct  170   EEYFDKLPDTLKDKRIYGSLLNAFVRSRKKEQAESLLDKMRNRGYTDHALPFNVMMTLYM  229

Query  1440  RTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDW  1261
                  +K+ +++ E+KE  I  D ++YNIW+ +  + G I  +E+V+++M  D  +  +W
Sbjct  230   NLKDYDKVESVVSEMKEKRIPLDIYSYNIWLSSCGSQGSIEKMEKVLEQMNLDTDINPNW  289

Query  1260  TTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRS  1081
             TT+S +A++Y   G   KAE +LK +E + T R+   Y +LI+LYG +G   +V RIW++
Sbjct  290   TTFSTMATMYIKLGQMKKAEDSLKSVESRITGRDRIPYHYLISLYGSLGKKEDVLRIWKT  349

Query  1080  LRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGl  901
              +  FP   N+ Y ++I  LV L+D+ GAEK + EW   +  YD R+ N L+G Y ++G 
Sbjct  350   YQSQFPNIPNLGYHSVISSLVRLDDIEGAEKIYDEWLPVKVHYDPRIGNLLLGYYVRKGF  409

Query  900   lkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQK-WVP  724
             + KA     +   +G KPN+ T EI  + ++++  IS A+ C++ A+++   +G K W P
Sbjct  410   VDKASAFFDQMIGAGGKPNSMTCEILAEGHIRDRRISEALSCLKDAVSS---EGSKSWRP  466

Query  723   SPVIVGELMRHFETKKDVEGAERVLGNLKK  634
              P  V  ++R  E + D++  E +L  LK+
Sbjct  467   KPATVSSILRLCEQEDDIQNKEVLLEVLKQ  496



>ref|XP_006347992.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Solanum tuberosum]
Length=545

 Score =   263 bits (673),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 156/450 (35%), Positives = 256/450 (57%), Gaps = 8/450 (2%)
 Frame = -2

Query  1974  QKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHK  1795
               ++   +S  Q  S  T +  +R   K+   A+Y+++    G E  +   LN++    K
Sbjct  52    HHSVISCSSTPQVHSYGTVDYERRPIVKW--NAIYKRISMNDGPERGSVSVLNQWENEGK  109

Query  1794  SAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKGIAAA  1621
                KWE+ R +K LR+ + Y  A ++ E M  R      TTSD  I +DL+AK  GI++A
Sbjct  110   KVTKWELSRVIKELRKFRRYKLAFEVYEWMNNRPERFRLTTSDTAIQLDLIAKVHGISSA  169

Query  1620  EAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYT  1441
             E YF  LP+T K+   YG+LLN + +    E+AE+L++KM+    T  ++P+N +MTLY 
Sbjct  170   EEYFEKLPDTLKDKRIYGSLLNAFVRSRKKEQAESLLDKMRNRGYTDHALPFNVMMTLYM  229

Query  1440  RTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDW  1261
                   K+ +++ E+KE  I  D ++YNIW+ +  + G I  +E+V+++M  D  +  +W
Sbjct  230   NLKDYNKVESVVSEMKEKKIPLDIYSYNIWLSSCGSQGSIEKMEKVLEQMNLDTDINPNW  289

Query  1260  TTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRS  1081
             TT+S +A++Y   G   KAE +LK +E + T R+   Y +LI+LYG +G   EV RIW++
Sbjct  290   TTFSTMATMYIKLGELKKAEDSLKSVESRITGRDRIPYHYLISLYGSLGKKEEVLRIWKT  349

Query  1080  LRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGl  901
              +  FP   N+ Y ++I  LV L+D+ GAEK + EW   +  YD R+ N L+G Y ++G 
Sbjct  350   YQSQFPNIPNLGYHSVISSLVRLDDIEGAEKIYDEWLPVKVHYDPRIGNLLLGYYVRKGF  409

Query  900   lkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQK-WVP  724
             + KA     +   +G KPN+ T EI  + ++++  IS A+ C++ A++T   +G K W P
Sbjct  410   VDKASAFFDQMIGAGGKPNSMTCEILAEGHIRDRRISEALSCLKDAVST---EGSKSWRP  466

Query  723   SPVIVGELMRHFETKKDVEGAERVLGNLKK  634
              P  V  ++R  E + D +  E +L  LK+
Sbjct  467   KPATVSSILRLCEQEDDTQNKEALLEVLKQ  496



>dbj|BAJ85010.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   261 bits (668),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 157/438 (36%), Positives = 247/438 (56%), Gaps = 8/438 (2%)
 Frame = -2

Query  1878  ALYRKL-LKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETME  1702
             +LYR++ +  GG     G+ L ++ +  +   KWE+ R  + LR+ + ++ A+++ + M 
Sbjct  69    SLYRRVAVGHGG--RPVGRTLADWDEGERRLDKWELCRIARELRKFRRFNLALEVYDWMT  126

Query  1701  KRG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTE  1528
              R    + ++SD  I +DL+AK +G+  AE YF  LP+  K+  TYG+LLN Y +  M E
Sbjct  127   DRRDRFSLSSSDMAIQLDLIAKVRGVPDAEEYFEKLPDPLKDKRTYGSLLNVYAQARMKE  186

Query  1527  KAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWM  1348
             K E   E+M++      ++P+N LM  Y    +PEK+  +  E+K+ +I  D  TYNIW+
Sbjct  187   KTEYTFEQMRKKGFATDTLPFNVLMNFYVDVAEPEKVSTVTDEMKQRNISFDVCTYNIWI  246

Query  1347  RALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNT  1168
             +  AA+ D   +ERV+++M  D  V  +WTTY+ LAS++      +KAE+ LKE EK+ T
Sbjct  247   KCCAAMKDADAMERVLNQMTADESVVANWTTYTTLASMHIKLENFEKAEECLKEAEKRAT  306

Query  1167  PRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEK  988
              R+   + FLITLY  +    EVYRIW   +  F    N+ Y  ++  LV L D+ GAE 
Sbjct  307   GRDKKCFHFLITLYSHLQKKEEVYRIWNWYKATFKTIHNLGYQEVLSALVRLGDIEGAEL  366

Query  987   CFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYL  808
              ++EW S  +++D +  N L+  Y+++G + KA++   R    G  P   TWEI    YL
Sbjct  367   LYEEWASKSSSFDPKTMNILLAWYSREGFVVKAQQTLNRFVEKGGNPKPNTWEILATAYL  426

Query  807   KNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSE  628
             K+ ++S A+ C+EKA  T      KW P P  V  L+ +F+ K D E  +R++  L +S 
Sbjct  427   KDNQLSEALSCLEKA--TAVKSASKWRPRPTNVETLLAYFKEKNDTESVDRLMSVL-RSR  483

Query  627   DHLGAELLESLIRTYAAA  574
                  E  +SLI TYA A
Sbjct  484   GCAENEEYKSLIDTYALA  501



>ref|XP_006878583.1| hypothetical protein AMTR_s00011p00250030 [Amborella trichopoda]
 gb|ERM94728.1| hypothetical protein AMTR_s00011p00250030 [Amborella trichopoda]
Length=413

 Score =   258 bits (660),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 161/397 (41%), Positives = 235/397 (59%), Gaps = 8/397 (2%)
 Frame = -2

Query  1674  DQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKE  1495
             D  +H+DLVAK +G+A+AE +F +LPE  K   TY +LLN Y +  ++ KAEAL+ KM E
Sbjct  13    DYALHLDLVAKVRGLASAEKFFEDLPEKMKEKSTYTSLLNAYVQNKLSTKAEALMAKMSE  72

Query  1494  LNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISG  1315
               L  + +PYN ++ LY   GQ EKIP ++Q++K   ++PD FTYNIWM A A+  DI G
Sbjct  73    CGLLKSPLPYNHMLNLYVSNGQFEKIPLLVQKLK-AHVLPDLFTYNIWMSAYASKNDIKG  131

Query  1314  VERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLI  1135
              E V+ E+KR  ++  DW TYS LASIY  A   +KA  ALKE+E + + +   AY  L+
Sbjct  132   AESVLLELKR-TKLHADWVTYSILASIYIKANDLNKAADALKEMELRVSRKERVAYCSLL  190

Query  1134  TLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTT  955
             TL   +G+  +VYRIW+ ++L F K  +  Y  M+  LV L D+ GAE  F EWES   T
Sbjct  191   TLNTNLGS-KDVYRIWKKMKLTFRKLNDSEYTCMLVSLVKLGDIEGAENVFSEWESVSGT  249

Query  954   YDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDC  775
              D RV+N L+ AY +  + +KA+E  K     G  P+  TWE     YL+  +I  A+D 
Sbjct  250   RDSRVSNVLLSAYVRNDMSEKAEEFHKCTVERGTIPSYTTWETLAWGYLREKKIVMALDS  309

Query  774   IEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESL  595
             ++ A+++ +    KW P+  +V E  +  E   D E AE  L  L +  +++   +  S+
Sbjct  310   LKNAVSSVK----KWEPNRGLVREFSKTLEESGDTENAENFLL-LLRDVNYVSTAIYNSV  364

Query  594   IRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVIS  484
             +RTYA+AGK   ++  R++ +  E  EE  KLL V S
Sbjct  365   LRTYASAGKMPLIILERMRNDKVEPDEETHKLLKVTS  401



>ref|XP_002526471.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF35862.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=533

 Score =   262 bits (669),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 158/443 (36%), Positives = 249/443 (56%), Gaps = 7/443 (2%)
 Frame = -2

Query  1878  ALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEK  1699
             ++YR++      E  A   LNE  K  K   KWE+ R VK LR+ K +  A+++ + M  
Sbjct  70    SVYRRISLMEKPELGAATVLNEMEKDGKKLTKWELCRVVKELRKYKRHKQALEVYDWMNN  129

Query  1698  RG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
             R      + SD  I +DLVAK +G+++AE YF+ L +  K+   YGALLN Y K  M EK
Sbjct  130   REERFRLSASDAAIQLDLVAKVRGVSSAEDYFMRLSDNVKDRRVYGALLNSYVKARMREK  189

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             AE+LIEKM++ + T  ++P+N +MTLY    + +K+  +I E+   +I  D ++YNIW+ 
Sbjct  190   AESLIEKMRKKDYTTHALPFNVMMTLYMNLKEYDKVDMMISEMMAKNIRLDIYSYNIWLS  249

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             +  + G I  +E V ++MK D  +  +WTT+S +A++Y   G  +KAE  L+ +E + T 
Sbjct  250   SRGSQGSIERMEEVYEQMKLDSTINPNWTTFSTMATMYIKMGQLEKAEDCLRRVESRITG  309

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             R+   Y +L++LYG +GN  E+YR+W   +  F    N+ Y  +I  LV ++D+ GAEK 
Sbjct  310   RDRIPYHYLLSLYGNVGNKEEIYRVWNIYKSIFATIPNLGYHAIISSLVRMDDIEGAEKI  369

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             ++EW   +++YD R+ N L+G Y + G L KA+         G KPN+ TWEI  D + +
Sbjct  370   YEEWLPVKSSYDPRIGNLLMGWYVRGGNLDKAESFFDHMMEVGGKPNSSTWEILADGHTR  429

Query  804   NGEISSAVDCIEKAITTGRGDGQK-WVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSE  628
                IS A+ C ++A       G K W P PVI+    +  E + D+  +  VL +L    
Sbjct  430   EKRISEALSCFKEAFL---AQGSKSWKPKPVIISSFFKLCEEEADM-ASTGVLEDLLAQS  485

Query  627   DHLGAELLESLIRTYAAAGKTST  559
              +L  +   SLI +   + + ST
Sbjct  486   GYLEDKTYASLIGSSVPSNELST  508



>ref|XP_006444085.1| hypothetical protein CICLE_v10019771mg [Citrus clementina]
 ref|XP_006479730.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Citrus sinensis]
 gb|ESR57325.1| hypothetical protein CICLE_v10019771mg [Citrus clementina]
 gb|KDO68751.1| hypothetical protein CISIN_1g010458mg [Citrus sinensis]
Length=510

 Score =   261 bits (668),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 161/467 (34%), Positives = 261/467 (56%), Gaps = 8/467 (2%)
 Frame = -2

Query  1881  EALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETME  1702
             + L R+LL     + SA   + ++ +   + +K+E+ R V+ LR+ K Y  A+++ E ME
Sbjct  39    DTLGRRLLSLVYAKRSAAITMRKWKEEGHTVHKYELNRIVRELRKLKRYKHALEVCEWME  98

Query  1701  -KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
              +  +   + D  +H+DL++K +G+++AE +F NLP+  +   T  ALL+ Y +   + +
Sbjct  99    LQYDIKLVSGDYAVHLDLISKIRGLSSAENFFENLPDKMRGPDTCSALLHSYVQNKKSAE  158

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             AEAL+EKM E       +PYN ++ LY   GQ +K+P ++QE+K+ +  PD  TYN+W+ 
Sbjct  159   AEALMEKMSECGFLKCPLPYNHMLNLYISNGQLDKVPQMLQELKK-NTSPDVVTYNLWLA  217

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             A A+  D    E+   E+K+  ++  DW +YS L S+Y    L +KA   LKE+EK+   
Sbjct  218   ACASQNDKETAEKAFLELKKT-KIDPDWISYSTLTSLYIKMELPEKAATTLKEMEKRTCR  276

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             +N  AY  L++LY  +G   EV RIW+ +   F K  +  Y  +I  LV L +   AE  
Sbjct  277   KNRVAYSSLLSLYTNMGYKDEVLRIWKKMMSLFAKMNDAEYTCVISSLVKLGEFEKAENI  336

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             + EWES   T D RV N L+ AY  +  L+ A+    R    G KP   TWE+    YLK
Sbjct  337   YDEWESISGTGDPRVPNILLAAYINRNQLEMAESFYNRLVTKGIKPCYTTWELLTWGYLK  396

Query  804   NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSED  625
              G++   ++C +KAI    G  +KWVP   ++       E + D++GAE +L  L+ +  
Sbjct  397   KGQMEKVLECFKKAI----GSVRKWVPDHRLITAAYNKLEEQGDIDGAEHLLVTLRNA-G  451

Query  624   HLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVIS  484
             H+  E+  SL+RTYA AGK   ++  R++ +N ++  E +K+L + S
Sbjct  452   HVSTEIYNSLLRTYAKAGKMPLIIVERMQKDNVQMDAETQKVLKITS  498



>ref|XP_006445447.1| hypothetical protein CICLE_v10019658mg [Citrus clementina]
 ref|XP_006464406.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Citrus sinensis]
 gb|ESR58687.1| hypothetical protein CICLE_v10019658mg [Citrus clementina]
 gb|KDO85468.1| hypothetical protein CISIN_1g009424mg [Citrus sinensis]
Length=535

 Score =   261 bits (668),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 156/452 (35%), Positives = 251/452 (56%), Gaps = 8/452 (2%)
 Frame = -2

Query  1980  QYQKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKS  1801
             Q QK      S  Q  S  T +  +R   K+   A++RKL      +  +   LN++ K 
Sbjct  43    QRQKLPVIKCSMSQIHSYGTVDFERRPMIKW--NAIFRKLSLMDNPQLGSASVLNDWEKG  100

Query  1800  HKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKGIA  1627
              +S  KWE+ R VK LR+ + Y  A+++ + M  RG     + SD  I +DL+AK  G+A
Sbjct  101   GRSLTKWELCRVVKELRKFRRYKHALEVYDWMNNRGERFRLSASDAAIQLDLIAKVHGVA  160

Query  1626  AAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTL  1447
             +AE +F++LP+T K+   YGALLN Y +  M   AE LI+KM++    + S+PYN +MTL
Sbjct  161   SAEDFFLSLPDTLKDRRVYGALLNAYVRARMRGNAELLIDKMRDKGYAVHSLPYNVMMTL  220

Query  1446  YTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAE  1267
             Y +  + +++ +++ E+KE  I  D ++YNIW+ +  + G    +E V + MK D  V  
Sbjct  221   YMKIKEYDEVESMVSEMKEKGIRLDVYSYNIWLSSCGSQGSTEKMEGVFELMKVDKAVNP  280

Query  1266  DWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIW  1087
             +WTT+S +A++Y   G  +KAE++L+ +E + T R+   Y +L++LYG +G   EVYR+W
Sbjct  281   NWTTFSTMATMYIKMGQVEKAEESLRRVESRITGRDRVPYHYLLSLYGSVGKKEEVYRVW  340

Query  1086  RSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQ  907
                R  FP   N+ Y  MI  L  + D+ G EK F+EW S +++YD R+AN ++  Y K+
Sbjct  341   NLYRSVFPGVTNLGYHAMISSLARIGDIEGMEKIFEEWLSVKSSYDPRIANLMMSWYVKE  400

Query  906   GllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQK-W  730
             G   KA+         G KPN+ +WE   + +++   I  A+ C++ A      +G K W
Sbjct  401   GNFDKAEAFFNSIIEEGGKPNSTSWETLAEGHIRERRILEALSCLKGAFA---AEGAKSW  457

Query  729   VPSPVIVGELMRHFETKKDVEGAERVLGNLKK  634
              P PV V    +  E + D+   E  +  L++
Sbjct  458   RPKPVNVINFFKACEEESDMGSKEAFVALLRQ  489



>ref|XP_010693618.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Beta vulgaris subsp. vulgaris]
Length=528

 Score =   261 bits (667),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 165/469 (35%), Positives = 270/469 (58%), Gaps = 8/469 (2%)
 Frame = -2

Query  1884  EEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM  1705
             ++ L R+LL     + SA   + ++ +      K+E+ R V+ LR+ K +  A+++ E M
Sbjct  56    KDTLGRRLLSLIQPKRSAVITIRKWKEEGHFVRKYELNRIVRELRRLKRFKHALEICEWM  115

Query  1704  EKRG-MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTE  1528
               +  +     D  +H+DL+AK +G+ +A  +F ++PE  +   T  ALL+ Y +    +
Sbjct  116   RTQDDIKLLPGDYAVHLDLIAKLRGLDSAVKFFEDMPEMMRAEPTLSALLHTYVQCRAYD  175

Query  1527  KAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWM  1348
             +AEAL+EKM E     + +P+N +M++Y   G+ EKIP +I+E+K+ +  PD  TYNIW+
Sbjct  176   EAEALMEKMSECGYVKSPLPFNHMMSMYMEVGKLEKIPELIKELKK-NSKPDLVTYNIWL  234

Query  1347  RALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNT  1168
                 +  D+   E V+ EM    ++  DW TYS L S+Y    + DKAE +LKE+EK+ +
Sbjct  235   TMCQSQNDVEAAENVLLEMT-SAKIEPDWMTYSILTSLYTKKEMVDKAESSLKEMEKRIS  293

Query  1167  PRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEK  988
              +N +AY  LI+LY  +G    V++ W++++  F K  ++ YL MI  LV L ++  AEK
Sbjct  294   RKNRSAYSSLISLYTGLGKKTGVHKTWKNMKSLFHKLNDVEYLCMIASLVKLGELETAEK  353

Query  987   CFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYL  808
              + EWES  TT D RV N LIGAY K   + KA +   R  + G KP+  TWE+    YL
Sbjct  354   FYNEWESVSTTGDTRVPNLLIGAYLKTNQMDKATKFFDRFTQKGIKPSYTTWELLTFGYL  413

Query  807   KNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSE  628
             K  +I   +DC EKA+T+ R    KW P+   + E+ +  E ++D++GAE++L  L ++ 
Sbjct  414   KLKQIDRVLDCFEKAVTSVR----KWEPNLTFIKEVYKLLEEQEDIKGAEKMLSVL-RNV  468

Query  627   DHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISA  481
              ++  E+   L++TYA AGK   ++  R+  +   L EE K+L+ + S 
Sbjct  469   GYVTTEIYNMLLQTYAKAGKMPPIIEERMTNDEVMLDEETKELIRLTST  517



>dbj|BAK02297.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   260 bits (664),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 156/438 (36%), Positives = 246/438 (56%), Gaps = 8/438 (2%)
 Frame = -2

Query  1878  ALYRKL-LKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETME  1702
             +LYR++ +  GG     G+ L ++ +  +   KWE+ R  + LR+ + ++ A+++ + M 
Sbjct  69    SLYRRVAVGHGG--RPVGRTLADWDEGERRLDKWELCRIARELRKFRRFNLALEVYDWMT  126

Query  1701  KRG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTE  1528
              R    + ++SD  I +DL+AK +G+   E YF  LP+  K+  TYG+LLN Y +  M E
Sbjct  127   DRRDRFSLSSSDMAIQLDLIAKVRGVPDTEEYFEKLPDPLKDKRTYGSLLNVYAQARMKE  186

Query  1527  KAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWM  1348
             K E   E+M++      ++P+N LM  Y    +PEK+  +  E+K+ +I  D  TYNIW+
Sbjct  187   KTEYTFEQMRKKGFATDTLPFNVLMNFYVDVAEPEKVSTVTDEMKQRNISFDVCTYNIWI  246

Query  1347  RALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNT  1168
             +  AA+ D   +ERV+++M  D  V  +WTTY+ LAS++      +KAE+ LKE EK+ T
Sbjct  247   KCCAAMKDADAMERVLNQMTADESVVANWTTYTTLASMHIKLENFEKAEECLKEAEKRAT  306

Query  1167  PRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEK  988
              R+   + FLITLY  +    EVYRIW   +  F    N+ Y  ++  LV L D+ GAE 
Sbjct  307   GRDKKCFHFLITLYSHLQKKEEVYRIWNWYKATFKTIHNLGYQEVLSALVRLGDIEGAEL  366

Query  987   CFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYL  808
              ++EW S  +++D +  N L+  Y+++G + KA++   R    G  P   TWEI    YL
Sbjct  367   LYEEWASKSSSFDPKTMNILLAWYSREGFVVKAQQTLNRFVEKGGNPKPNTWEILATAYL  426

Query  807   KNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSE  628
             K+ ++S A+ C+EKA  T      KW P P  V  L+ +F+ K D E  +R++  L +S 
Sbjct  427   KDNQLSEALSCLEKA--TAVKSASKWRPRPTNVETLLAYFKEKNDTESVDRLMSVL-RSR  483

Query  627   DHLGAELLESLIRTYAAA  574
                  E  +SLI TYA A
Sbjct  484   GCAENEEYKSLIDTYALA  501



>gb|KDP21467.1| hypothetical protein JCGZ_21938 [Jatropha curcas]
Length=515

 Score =   260 bits (664),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 162/467 (35%), Positives = 270/467 (58%), Gaps = 8/467 (2%)
 Frame = -2

Query  1881  EALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM-  1705
             + L R+L      + SA   + ++     S  K+++ R V+ LR+ K Y  A+++ E M 
Sbjct  44    DTLGRRLFSLAYAKRSAVIAIQKWKSEGHSVQKYQLNRIVRELRKLKRYKHALEVCEWMT  103

Query  1704  EKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
             ++R +     D  +H+DL+AK +G+ +AE +F +LP+  +   T  ALL+ Y +  +  K
Sbjct  104   QEREIKLLPGDYAVHLDLIAKVRGLNSAEKFFEDLPDEMRGWHTCTALLHTYVQFKLLSK  163

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             AEAL+EKM E       +PYN ++TLY    Q EKIP II+E+K+ +  PD  TYN+W+R
Sbjct  164   AEALMEKMAECGFMKNPLPYNHMLTLYVANEQFEKIPGIIKELKK-NTSPDVVTYNLWLR  222

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
               A+  DI   + V+ E+K+  ++  DW TYS L+++Y    L + A   LKE+EK+   
Sbjct  223   VCASQNDIKTAKEVLLELKK-AKIDPDWITYSTLSNLYIKNELLEDAASTLKEMEKRAWR  281

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             +N  AY  L++L+  +GN   ++RIW  ++  F K  +  Y+ MI  LV L ++  AEK 
Sbjct  282   KNRLAYSSLLSLHTSMGNKDGLHRIWNKMKSLFRKMNDAEYICMISSLVKLEEIEKAEKL  341

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             + EWES   T D +V+N L+ AY  +  +++A++ ++R  + G +P   TWE+    +LK
Sbjct  342   YSEWESVSGTCDPQVSNILLAAYINRNRMEEAEKFQQRMVQKGIRPCYTTWELLTWGHLK  401

Query  804   NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSED  625
             + ++ + +D  +KAI++ +    KW     +VGE+ ++ E + DVEGAE  L  L+ +  
Sbjct  402   DKQMENVLDYFKKAISSVK----KWSLDKRLVGEIFKNLEERGDVEGAEEFLVMLRNA-G  456

Query  624   HLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVIS  484
             H+  E+  SL+RTYA AG    ++  R+  +N EL+EE  +L+   S
Sbjct  457   HVSTEIYNSLLRTYAKAGVMPLIIAERMGKDNVELNEETHRLIQTTS  503



>ref|XP_010242929.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial [Nelumbo nucifera]
Length=500

 Score =   259 bits (662),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 161/435 (37%), Positives = 252/435 (58%), Gaps = 13/435 (3%)
 Frame = -2

Query  1881  EALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM-  1705
             + LYR++   G   +S    L++++K  K+  +  + R +K LR  + Y  A+++S+ M 
Sbjct  35    DTLYRRISPAGDPRDSIVPVLDQWIKEGKTFTRDYLQRIIKRLRHYRRYKHALEISQWMT  94

Query  1704  EKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
             ++R  + +  D  I +DL+ K  G+  AE YF  +P   +   TYGALLNCY  E   +K
Sbjct  95    DQRYFDLSAGDAAIRLDLITKVHGLGEAEKYFDYIPTQLRVFQTYGALLNCYTHEKSVDK  154

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             AEAL +KMKEL    T + YN ++ LY++ GQ EK+  ++QE+++  I  D FT +I M 
Sbjct  155   AEALFQKMKELGFAKTVLTYNVMLNLYSQMGQHEKLDPLMQEMEDRGIGHDKFTLSIRMS  214

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             A +A  D+ G+E+++  M+ D  +  DW  Y  +A+ Y  AGL+DKA   LK+ E   T 
Sbjct  215   AYSAAADVDGMEKILTRMEADPSIIVDWNAYFLMANGYMKAGLTDKALTMLKKSEALITG  274

Query  1164  RN-LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEK  988
             R    A  +L+T+Y  IG   E+YRIW + + A  K  N +Y+ M+  LV L+D+ GAEK
Sbjct  275   RQRRVAVDYLLTMYAGIGKKDELYRIWNTYK-ASEKIYNSTYICMLSSLVKLDDIEGAEK  333

Query  987   CFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYL  808
              F EWE G T+YD RV N LI AY K+GLL+KA+ +  +A   G KP + TW++    Y 
Sbjct  334   IFGEWELGGTSYDFRVPNRLISAYCKKGLLEKAEAIISKAIEKGKKPLSSTWDLLASGYY  393

Query  807   KNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAE---RVLGNLK  637
             +N +I +AV+ ++KAI   R     W P+   +   + +++ ++DVEGA    R+LGN  
Sbjct  394   ENNQILNAVETLKKAIMASR---PGWRPNHATLAGCLEYYKEQRDVEGARKLIRLLGN--  448

Query  636   KSEDHLGAELLESLI  592
                 H   ++ + L+
Sbjct  449   --SGHFSTDVCDRLL  461



>ref|XP_008438222.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Cucumis melo]
Length=537

 Score =   260 bits (665),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 156/447 (35%), Positives = 248/447 (55%), Gaps = 8/447 (2%)
 Frame = -2

Query  1965  LTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAY  1786
             L+   S  Q  S  T +  +R   K+   A+YR++      E  +   LN++    K+  
Sbjct  44    LSVTCSISQVHSYGTVDFERRPMVKW--NAIYRRISLMENPELGSASVLNQWENEGKNLT  101

Query  1785  KWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKGIAAAEAY  1612
             KWE+ R VK LR+ K +  A+++ + M  R      TTSD  I +DL++K +GI +AE Y
Sbjct  102   KWELSRVVKELRKYKRFERALEIYDWMSNREERFRLTTSDAAIQLDLISKVRGIKSAEDY  161

Query  1611  FINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTG  1432
             F+ LP+  K+   YGALLN Y K    EKAE L+ KM+        +P+N +MTLY    
Sbjct  162   FLRLPDNLKDRRIYGALLNAYAKARQREKAENLLAKMRTKGYATHPLPFNVMMTLYMNVK  221

Query  1431  QPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTY  1252
             + EK+ +++ E+ E  I  D ++YNIW+ +    G    +E V ++MK+D  +  +WTT+
Sbjct  222   EYEKVDSLVSEMTEKSIQLDIYSYNIWLSSCGLQGSTDKMEEVYEQMKQDKTINANWTTF  281

Query  1251  SNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRL  1072
             S +A++Y   GL +KAE+ L+++E +   R+   Y +LI+LYG +GN  E+YR+W   + 
Sbjct  282   STMATMYIKMGLIEKAEECLRKVESRIVGRDRIPYHYLISLYGSVGNKEEMYRVWNIYKN  341

Query  1071  AFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkk  892
              FP   N+ Y  +I  L+ + D+ GAEK ++EW + + TYD R+AN  IG Y K+  + K
Sbjct  342   VFPTIPNLGYHAIISALIRVGDVEGAEKIYEEWLTVKATYDPRIANLFIGWYVKEANMSK  401

Query  891   akelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQK-WVPSPV  715
             A+         G KPN+ TWEI  D + K G +S A+   ++A ++   +G K W P P 
Sbjct  402   AEGFFDHMVEVGGKPNSSTWEILADGHTKEGRVSDALASWKEAFSS---EGSKSWRPKPY  458

Query  714   IVGELMRHFETKKDVEGAERVLGNLKK  634
              V       E + D+   E ++G L++
Sbjct  459   NVLAYFDLCEKEGDIASKEVLVGFLRQ  485



>emb|CDP03624.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   259 bits (662),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 169/484 (35%), Positives = 269/484 (56%), Gaps = 15/484 (3%)
 Frame = -2

Query  1932  SSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLL  1753
             SSK  + G R T       L R+LL     + SA   + ++ +      K+E+ R V+ L
Sbjct  34    SSKITSTGGRDT-------LGRRLLSLVYTKRSAVIAIRKWKEEGHVVQKYELNRIVREL  86

Query  1752  RQRKLYSPAIKLSETME-KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHF  1576
             R+ K Y  A+++ E M  +  +   + D  +H+DL+AK +G+ +AE +F +LP+  K+H 
Sbjct  87    RKLKRYKHALEVCEWMRIQENVKLLSGDYAVHLDLIAKVRGMNSAEKFFEDLPDKMKDHT  146

Query  1575  TYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEI  1396
             T  +LL+ Y +   + KAEALIEKM E     + +PYN ++TLY  TG+ EK+ A+IQ +
Sbjct  147   TCSSLLHTYAQHKESAKAEALIEKMSECGFLKSPLPYNHMLTLYISTGKLEKVSAMIQVL  206

Query  1395  KECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGL  1216
             K+ +  PD  TYN+W+   A   D+   E+V  E++++  +  DW TYS L +IY    L
Sbjct  207   KK-NTSPDVVTYNLWLSVCALQNDVETAEKVFLELQKET-LDPDWVTYSTLTNIYIKNSL  264

Query  1215  SDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLN  1036
               KA   L E+EK+ + +   AY  LI+L+  + +  EVY IW+ ++  F K  +  Y+ 
Sbjct  265   KKKAASTLGEMEKRISKKVRPAYSSLISLHTSLEHKDEVYWIWKKMKSMFHKLNDSEYMC  324

Query  1035  MIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSG  856
             MI  LV L+++  AEK + EW S   T D R+ N L+ AY   G ++ A++  K+    G
Sbjct  325   MIASLVKLHELCKAEKLYMEWSSISPTGDSRIPNILLAAYINDGHMEMAEKFYKQMVEKG  384

Query  855   AKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKK  676
               P+  TWE+    YLK  ++   +DC  KAI    G  +KW P   +V E+    E   
Sbjct  385   MTPSYTTWELLTWGYLKLKKVERVLDCFNKAI----GSVKKWEPDVKMVKEVSGMLEASG  440

Query  675   DVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
             ++EGAE++L  L+ +  HL   +  SL+RTYA AGK   V+  R+K +N +  E+ ++L+
Sbjct  441   NIEGAEKLLVTLRHA-GHLNTGIYNSLLRTYAKAGKMPVVVAERMKKDNVQPDEDTRQLI  499

Query  495   DVIS  484
              + S
Sbjct  500   QLTS  503



>gb|KDP27040.1| hypothetical protein JCGZ_20975 [Jatropha curcas]
Length=506

 Score =   258 bits (660),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 150/444 (34%), Positives = 246/444 (55%), Gaps = 4/444 (1%)
 Frame = -2

Query  1821  LNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRGMNK-TTSDQGIHVDLVA  1645
             L+++++    A  + + R+++ LR RK Y  A++++E M  +G+N  + SD  + +DL+ 
Sbjct  55    LDKWVEEGNKAKNFNLQRAIRSLRARKRYGQALEVAEWMSGKGINTLSPSDHAVQLDLIG  114

Query  1644  KSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPY  1465
             + +G+ +AE+YF NL +  K   TYGALLNCY +E + EK+   ++KMKEL    TS+ Y
Sbjct  115   RVRGLESAESYFRNLDDKDKVDKTYGALLNCYVREGLVEKSLDHMQKMKELGFASTSLNY  174

Query  1464  NSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKR  1285
             N LM+LY  TGQPEK+P ++ E+KE  + P+ F+Y I M + AA  D+  V+++++EM+ 
Sbjct  175   NDLMSLYANTGQPEKVPDVLLEMKENGVTPNIFSYRICMSSFAARSDLGAVDKILEEMEN  234

Query  1284  DGRVAEDWTTYSNLASIYADAGLSDka-ekalkelekKNTPRNLTAYQFLITLYGRIGNL  1108
                ++ DW TYS  ASIY  AGL +KA     K  E+ N   N   Y  LI+LY  +GN 
Sbjct  235   QPHISMDWITYSTAASIYIKAGLKEKALACLKKCEEEVNKNANALGYNHLISLYASLGNK  294

Query  1107  VEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANAL  928
              E+ R+W   +    K  N  Y+ M+  LV L +   AEK  +EWES   TYD RV N L
Sbjct  295   DEIIRLWGLSKAKCQKQFNRDYITMLGSLVKLGEFEEAEKLLQEWESSCETYDSRVPNVL  354

Query  927   IGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGR  748
             +  Y ++GL++KA+ + +   +        +W I  + Y+    +  A  C+++A+    
Sbjct  355   LIGYCQKGLIEKAEAMLRDIGKRQKTVTPNSWSIMAEGYVNKQNMEKAFQCMKEAVNVA-  413

Query  747   GDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGK  568
              + + W P P ++  ++       DVE  E  + +L+        E+  +LI+ Y   GK
Sbjct  414   SENKGWRPKPNLISVILSWLGDNGDVEEVEAFVSSLETVVQK-NREMYRTLIKAYIRGGK  472

Query  567   TSTVMRRRVKMENAELSEEAKKLL  496
                 +   +K +  ++ EE K +L
Sbjct  473   EVDGLLESMKADKIDIDEETKTIL  496



>ref|XP_009770415.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial [Nicotiana sylvestris]
Length=495

 Score =   258 bits (658),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 158/462 (34%), Positives = 261/462 (56%), Gaps = 3/462 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LY K+   G    S    L+E++   K     E+ R +  LR+RK ++ A++ SE M+  
Sbjct  29    LYSKISPLGDPNYSVTNELDEWVCKGKKVRFAELQRIILDLRKRKRFNQALEASEWMKSS  88

Query  1695  GM-NKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAE  1519
             G+   ++++  + +DL+ K  G  AAE+YF NL E  KN  TYGALL+CY ++   +KA 
Sbjct  89    GIFTFSSTEHAVQLDLIGKVHGFHAAESYFNNLNEEDKNDKTYGALLHCYVRQGDIKKAL  148

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
               ++ M+E  L+L+S+ +N +M+LYTRTG+ EKIP +++ +KE  + PD+ +Y I + + 
Sbjct  149   THLKMMQEKGLSLSSVAFNDIMSLYTRTGEYEKIPDVLRHMKEIGVRPDNLSYRICINSY  208

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
              A  DI G+ERV++EM+    +  DW TY+ +A+IY  +GL+DKA   LK+ E+K   + 
Sbjct  209   GARSDIEGMERVLNEMENQSYIVMDWNTYAAVANIYVKSGLNDKANSFLKKAEEKIDNKE  268

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
                Y +LI++Y R+GN  EV R+W   + A  +  N  Y+NM++ LV L+ +  AE+  K
Sbjct  269   GLGYNYLISVYSRLGNRDEVIRLWFLEKSALKRCINRDYINMLEALVRLDALEEAEQLLK  328

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWE+    YDIRV   +I  Y  + L +KA+ + +     G       W      YL  G
Sbjct  329   EWETSDNCYDIRVPYIVIIGYIDKKLYEKAETMLEDLSTKGKTLTPNIWGRLAAGYLDKG  388

Query  798   EISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHL  619
             +  SAV CI+ A++  + D + W P P ++ +++        V+ AE  L +L+     +
Sbjct  389   KFESAVKCIKVALSL-KKDSKGWKPDPKVIMKILSLLGENGSVDDAESFLSSLRPVVS-V  446

Query  618   GAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLD  493
               E+   L+++Y A GK    +   ++ +N + +EE K LL+
Sbjct  447   NREMYHVLLKSYIAGGKEVERLLNSMRADNIDENEETKVLLE  488



>ref|XP_010496689.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Camelina sativa]
Length=447

 Score =   256 bits (655),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 151/419 (36%), Positives = 241/419 (58%), Gaps = 5/419 (1%)
 Frame = -2

Query  1842  ENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQ  1669
             E  AG  LN++ K  +   KWE+ R VK LR+ K  + A+++ + M  RG     + SD 
Sbjct  5     ELGAGSVLNQWEKGGRKLTKWELCRVVKELRKYKRPNQALEVYDWMNNRGERFRLSASDA  64

Query  1668  GIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELN  1489
              I +DL+ K +GI+ AE +F+ LPE  K+   YG+LLN Y +    EKAE+L+  M+E  
Sbjct  65    AIQLDLIGKVRGISDAEEFFLTLPENFKDRRVYGSLLNAYVRAKSREKAESLLSTMREKG  124

Query  1488  LTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVE  1309
               L  +P+N +MTLY    + +K+ A++ E+K+ DI  D ++YNIW+ +  +LG +  +E
Sbjct  125   YALHPLPFNVMMTLYMNLREFDKVDAMVFEMKQKDIRLDIYSYNIWLSSCGSLGSVEKME  184

Query  1308  RVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITL  1129
              V  +MK D  +  +WTT+S +A++Y   G +DKAE AL+++E + T RN   Y +L++L
Sbjct  185   LVYQQMKSDVAINPNWTTFSTMATMYIKMGETDKAEDALRKVEARITGRNRIPYHYLLSL  244

Query  1128  YGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYD  949
             YG +GN  E+YR+W   +   P   N+ Y  ++  LV + D+ GAEK ++EW   +++YD
Sbjct  245   YGSVGNKKELYRVWNVYKSVAPSIPNLGYHALVSSLVRMGDIEGAEKVYEEWLPVKSSYD  304

Query  948   IRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIE  769
              R+ N L+ AY K   L+KA+ L       G KP++ TWEI  D + +   I  A+ C+ 
Sbjct  305   PRIPNLLMNAYVKNDQLEKAEGLFDHMVEMGGKPSSSTWEILADGHTRKRCIPEALTCLR  364

Query  768   KAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLI  592
             KA +        W P  +++    +  E + DV   E VL  L++S  HL  +  ++LI
Sbjct  365   KAFSA--EGSSNWRPKVLMLSGFFKLCEEESDVTSKEAVLELLRQS-GHLQDKSYQALI  420



>ref|XP_010662164.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial isoform X1 [Vitis vinifera]
 ref|XP_010662165.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial isoform X1 [Vitis vinifera]
 emb|CBI26594.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   258 bits (659),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 161/463 (35%), Positives = 261/463 (56%), Gaps = 8/463 (2%)
 Frame = -2

Query  1881  EALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETME  1702
             + L R+LL     + SA   +  + +   +  K+E+ R V+ LR+ K Y  A+++ E M 
Sbjct  56    DTLGRRLLSLVYAKRSAVIAIQRWREEGHTVRKYELNRIVRELRKLKRYKHALEICEWMT  115

Query  1701  KR-GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
             K+  +     D  +H+DL+AK +G+A+AE +F +L +  K   T  ALL+ Y +  ++EK
Sbjct  116   KQHDIKLLAGDYAVHLDLIAKIRGLASAEKFFEDLSDKMKGQPTCTALLHTYVQNKVSEK  175

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             AEAL+EKM E       +PYN +++LY   GQ EK+P +IQE+K+ +  PD  TYN+W+ 
Sbjct  176   AEALMEKMSECGFLKCPLPYNHMISLYISDGQLEKVPGMIQELKK-NTSPDVVTYNLWLT  234

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
               A+  D+   E+V+ E+K+  ++  DW TYS+L ++Y   GL DKA   L E+EK+ + 
Sbjct  235   VCASQNDVETAEKVLLEIKK-AKIDPDWVTYSSLTNLYIKKGLLDKAATTLNEMEKRTSR  293

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             +   AY  LI+L+  + +   V+RIW+ L+  F K  +  Y  MI  LV L +   AE  
Sbjct  294   KGRIAYSSLISLHTNMQDKDGVHRIWKKLKSIFHKMNDAEYTCMISSLVKLGEFEEAENL  353

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             + EW S   T D RV N L+ AY  +  ++ A++   +    G  P+  TWE+    YLK
Sbjct  354   YSEWTSVSPTGDSRVPNILLAAYINKNEMEMAEKFYNQMVERGITPSYTTWELLTWGYLK  413

Query  804   NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSED  625
               ++   +D  EKA+    G  +KW P   +V E+ ++ E + ++EGAE+VL  L+K+  
Sbjct  414   KKQMEKVLDYFEKAV----GSVKKWNPDEKLVREVYKNLEEQGNIEGAEKVLVILRKA-G  468

Query  624   HLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
             H+  E+   L+R YA AGK   ++   +K +  E+ EE  +L+
Sbjct  469   HVSTEIYNWLLRAYAKAGKMPLIVAEWMKKDKVEMDEETHRLI  511



>ref|XP_006644107.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial-like [Oryza brachyantha]
Length=507

 Score =   257 bits (657),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 160/463 (35%), Positives = 259/463 (56%), Gaps = 7/463 (2%)
 Frame = -2

Query  1866  KLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRGMN  1687
             +L    G   +  + L  +L+  +   + ++   V   R+ K    A++L + ME RG+N
Sbjct  44    QLAATAGSSGTVAEELGRWLRERRPLSEEQLLFCVHRFRKFKQNRHALELMDWMEARGVN  103

Query  1686  KTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIE  1507
                    + +DLV+K  GI AA+ YF +LP+  ++  TY  LLNCY +  M +K   L E
Sbjct  104   LQLKHHALRLDLVSKVNGIHAAQEYFWSLPDVFRSVKTYCTLLNCYAEHGMADKGLELFE  163

Query  1506  KMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALG  1327
              MK +N+    + YN+LM L+ +TGQPEKIP    +++E  +  ++F+Y +   +   + 
Sbjct  164   NMKAMNMVSDILVYNNLMCLFLKTGQPEKIPTTFVKLQESGMEANNFSYFVLTESYIMMN  223

Query  1326  DISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAY  1147
             DI   E+V+ E+++   V   W+ Y+ +A+ Y      DKAE ALK+ E+     +  ++
Sbjct  224   DIESAEKVLKELQKMNSVP--WSLYTTIANGYIKLQQYDKAELALKKAEEVLDKHDAVSW  281

Query  1146  QFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWES  967
              FL++LY R GNL EV RIW +L+ AF K  N SYL M++ L  L+D    ++ F+EWES
Sbjct  282   HFLLSLYARSGNLSEVKRIWENLKSAFKKCTNRSYLVMLKALKRLDDFDSMQQIFQEWES  341

Query  966   GQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISS  787
              Q  YD+ + N +I AY  +G+  KA+ +R+ +   G   N  T+ IF ++YL+  +I+ 
Sbjct  342   SQEQYDMNIPNVIIQAYLDKGMTDKAEAMRQTSMSQG-HSNYGTFFIFAEFYLEKSKINE  400

Query  786   AVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAEL  607
             A+     A    +  GQ WVPS  +V   ++HFE  KD +G E     L+K  D L AE 
Sbjct  401   ALQVWRDAKNMLK--GQNWVPSK-LVSRFLKHFEDSKDADGMEAFCECLRKL-DWLDAEA  456

Query  606   LESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVISAE  478
              E+LIRTY +AG+T+  + +R++ +  ++  E  +LL  +S E
Sbjct  457   YEALIRTYISAGRTNPSIVQRIEDDRVDIRPEMVELLRAVSTE  499



>ref|XP_008810294.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
isoform X2 [Phoenix dactylifera]
Length=422

 Score =   254 bits (650),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 147/368 (40%), Positives = 223/368 (61%), Gaps = 9/368 (2%)
 Frame = -2

Query  1875  LYRKLLKEGGL-ENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEK  1699
             LYR+L   GG  E      L+++          ++ + ++ LR+ + +  A++       
Sbjct  41    LYRRLSALGGAPEGRVTATLDQWEMEGWRMTALQLMKHIRELRKYRRHEHALE-------  93

Query  1698  RGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAE  1519
             R M        + +DL++K KG+ +AE YF NLPE +KN  TYGAL NCYC   MT++A 
Sbjct  94    RSMEMPNGYHAVRLDLISKVKGVRSAEEYFSNLPEPAKNQRTYGALFNCYCSGKMTDRAV  153

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
             AL+EKMKEL      + YN+LM+LY + GQ E +P + QE+K  +++PDS TY I M++ 
Sbjct  154   ALLEKMKELKFASNVLIYNNLMSLYMKLGQLEMVPILFQEMKASNVLPDSCTYRIIMKSY  213

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
             A++ D+  VERV  EM+ + R A D  TY +LAS+Y   GL +KAE ALK+ E       
Sbjct  214   ASVSDMVSVERVTQEME-ESRGASDCLTYCHLASLYNSVGLFEKAETALKKAELVLGSHE  272

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
             L+ ++ LI+ Y   GNL EV R+W S +   P+  N +YL M+Q L  L+DM G ++CF+
Sbjct  273   LSPFRLLISSYAAAGNLSEVSRVWNSFKARVPRPTNTNYLIMLQALRKLDDMDGLKRCFE  332

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWESG   YDIR+ N +I AY ++G++ +AK L+++A + G   +  T+ +F+D+YLK+ 
Sbjct  333   EWESGCVNYDIRLVNTVIEAYLRKGMVDEAKLLQEKADQKGEWSDVHTFVLFIDHYLKSR  392

Query  798   EISSAVDC  775
             E+  A  C
Sbjct  393   ELELARKC  400



>ref|XP_006827770.1| hypothetical protein AMTR_s00009p00264540 [Amborella trichopoda]
 gb|ERM95186.1| hypothetical protein AMTR_s00009p00264540 [Amborella trichopoda]
Length=503

 Score =   256 bits (655),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 166/464 (36%), Positives = 259/464 (56%), Gaps = 4/464 (1%)
 Frame = -2

Query  1884  EEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM  1705
             ++++++++   G    S    L E+++  +  +K ++   VK +R+ + Y  A+++   M
Sbjct  33    QDSIFKRISPLGDPGTSVVPLLEEWVREGRKVHKSDLQSLVKEMRRYRRYKHALEICRWM  92

Query  1704  -EKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTE  1528
              ++R    + SD  I +DL++K  G+  AE YF N+ + +K   TYGALLNCY +E   E
Sbjct  93    SDRRYHYLSPSDHAIRLDLISKVHGLEQAEQYFGNITKQAKTFETYGALLNCYAQERSVE  152

Query  1527  KAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWM  1348
             KAE++ EKMKEL    +++ YN+LMTLYT+TG+ +K+  +I+E++E  I PD+FT NI M
Sbjct  153   KAESIAEKMKELGFFNSALSYNALMTLYTQTGEVDKLDILIKEMEEKAIRPDNFTNNIRM  212

Query  1347  RALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNT  1168
             +A A   DI  +++ +  ++ D  V   W  Y+  A+ Y  AGL D A   LK++E    
Sbjct  213   KAYAKALDIERMDKFLQTLEHDPLVTLHWNIYTMAANAYIRAGLIDNAMAMLKKVEALCG  272

Query  1167  PRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEK  988
              ++   Y  L+TLY  +G   EV RIW  ++  F K  N SY   I  L+ L D+  A+K
Sbjct  273   GKHQLVYDCLLTLYASVGQKAEVQRIWGHIKTPFNKPLNSSYRCFISSLLKLGDVEEADK  332

Query  987   CFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYL  808
              F+EW+S    YD RV N L+  Y   G L+KA+E+ K A          TWEI    YL
Sbjct  333   VFREWDSHHEIYDFRVLNVLLYFYCNNGFLEKAEEIIKIALERQKVLTFNTWEILAGGYL  392

Query  807   KNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSE  628
             KN +IS AVD ++KA++  +  G++ +P    V   +  F    DVEG E  +  L+   
Sbjct  393   KNNQISMAVDAMKKALSLHQ--GRRRLPDSGNVAAGLEFFRQNSDVEGIEEFISLLRPVV  450

Query  627   DHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
               L  E+   L+RTY +AG+    +  R+K EN E  EE + +L
Sbjct  451   P-LTREVYHELLRTYISAGRPVETVIERMKGENIEPDEETEVIL  493



>emb|CBI16683.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   254 bits (648),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 154/410 (38%), Positives = 239/410 (58%), Gaps = 10/410 (2%)
 Frame = -2

Query  1821  LNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLV  1648
             LN++    K   KWE+ R VK LR+ K +  A+++ E M  RG     ++SD  I +DL+
Sbjct  12    LNQWENEGKRLTKWELCRVVKELRKFKRFKMALEVYEWMNNRGERFRLSSSDAAIQLDLI  71

Query  1647  AKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMP  1468
             AK  G+++AE YF  LP+T K+   YGALLN Y +  M +KAE LIEK++      T +P
Sbjct  72    AKVCGVSSAEDYFSRLPDTLKDKRIYGALLNAYVQAKMRDKAEILIEKLRNKGYATTPLP  131

Query  1467  YNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMK  1288
             +N +MTLY    + +K+ ++I E+   +I  D ++YNIW   L++      +E+V ++MK
Sbjct  132   FNVMMTLYMNLKELDKVQSMISEMMNKNIQLDIYSYNIW---LSSCESTERMEQVFEQMK  188

Query  1287  RDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNL  1108
              +  +  +WTT+S +A++Y   G  +KAE+ LK++E + T R+   Y +LI+LYG  GN 
Sbjct  189   LERTINPNWTTFSTMATMYIKLGQFEKAEECLKKVESRITNRDRMPYHYLISLYGSTGNK  248

Query  1107  VEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANAL  928
              EVYR W   +  FP   N+ Y  +I  LV + D+ GAEK ++EW S +++YD R+ N L
Sbjct  249   AEVYRAWNIYKSKFPNIPNLGYHALISSLVRVGDLEGAEKIYEEWLSVKSSYDPRIGNLL  308

Query  927   IGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGR  748
             +G Y K+G L+KA+        +G KPN+ TWEI  +      +IS A+ C ++A+    
Sbjct  309   LGCYVKEGFLEKAEGFLDHMIEAGGKPNSTTWEILAEGNTGVKKISDALSCFKRAVLAEG  368

Query  747   GDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKS--EDHLGAELL  604
              +G  W P PV V   +   E + D    E ++G L++   ED  GAE+L
Sbjct  369   SNG--WKPKPVNVSAFLDLCEEEADTATKEALMGLLRQMGYEDD-GAEML  415



>ref|XP_010108203.1| hypothetical protein L484_014529 [Morus notabilis]
 gb|EXC18128.1| hypothetical protein L484_014529 [Morus notabilis]
Length=494

 Score =   256 bits (653),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 151/463 (33%), Positives = 261/463 (56%), Gaps = 4/463 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LY K+   G    S    L+++++  K     E+ R +  LR+RK +S A+++SE M K+
Sbjct  30    LYYKISPLGDPGRSVAPELDDWVQKGKKVRVAELQRIIHDLRKRKRFSQALEVSEWMNKK  89

Query  1695  GMNK-TTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAE  1519
             G+   ++++  + +DL+ + +G  +AE YF NL ET K   TYGALLNCY ++  T+K+ 
Sbjct  90    GVCIFSSTEHAVQLDLIGRVRGFDSAERYFNNLRETDKTEKTYGALLNCYVRQRQTDKSL  149

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
             + ++KMKE+     ++ YN +M LY   GQ EK+P ++ E+KE  + PD+F+Y I M + 
Sbjct  150   SHLQKMKEMGFASLALTYNDIMCLYVNLGQHEKVPDVLTEMKENKVFPDNFSYRICMNSY  209

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
                 D+ G+E+V+ EM+    +  DW TYS  A+ Y  AG ++KA  ALK+ E++   ++
Sbjct  210   GVRSDLEGMEKVLKEMEAQSNIVMDWNTYSVAANFYVKAGQTEKATNALKKSEERLDKKD  269

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
                +  LI+LY R+    EV R+W   + A  +  N  Y+ M++ L  L ++  AEK   
Sbjct  270   GIGFNHLISLYSRLRKKEEVLRLWELQKSACKRCINKDYIVMLESLARLCELEEAEKVLG  329

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EW+S +  YD RV NAL+  YA++GL  KA+ L K     G    + +W +    YL+ G
Sbjct  330   EWQSSENCYDFRVLNALVIGYAEKGLCGKAEALLKDLTAKGKATTSNSWGVVASKYLEKG  389

Query  798   EISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHL  619
             E+  AV+C++ A++  R  G+ W P+P ++  ++     K  V+  E  + +L ++   +
Sbjct  390   EMEKAVECMQAALS--RYLGKDWKPNPKVIRRMLEWLGDKGSVKDVEAFVKSL-ETVVTV  446

Query  618   GAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDV  490
               ++  +L++ +  AGK    +   +K +  +  EE KK++ +
Sbjct  447   NKQMYHALLKAHIRAGKEVDSLLESMKTDKIDEDEETKKIVAI  489



>ref|XP_010496474.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Camelina sativa]
Length=521

 Score =   256 bits (655),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 158/463 (34%), Positives = 259/463 (56%), Gaps = 7/463 (2%)
 Frame = -2

Query  1974  QKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHK  1795
             +KT   + S  Q +   T +  +R   ++   A+Y+K+      E  AG  LN++ K  +
Sbjct  36    KKTAAIVCSISQVYGYGTVDYERRPIIQW--NAIYKKISLMEKPELGAGSVLNQWEKGGR  93

Query  1794  SAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKGIAAA  1621
                KWE+ R VK LR+ K  + A+++ + M  RG     + SD  I +DL+ K +GI+ A
Sbjct  94    KLTKWELCRVVKELRKYKRPNQALEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGISDA  153

Query  1620  EAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYT  1441
             E +F+ LPE  K+   YG+LLN Y +    EKAE+L+  M+E    L  +P+N +MTLY 
Sbjct  154   EEFFLTLPENFKDRRVYGSLLNAYVRAKSREKAESLLSTMREKGYALHPLPFNVMMTLYM  213

Query  1440  RTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDW  1261
                + +K+ A++ E+K+ DI  D ++YNIW+ +  +LG +  +E V  +MK D  +  +W
Sbjct  214   NLREFDKVDAMVFEMKQKDIRLDIYSYNIWLSSCGSLGSVEKMELVYQQMKSDVAINPNW  273

Query  1260  TTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRS  1081
             TT+S +A++Y   G ++KAE AL+++E + T RN   Y +L++LYG +GN  E+YR+W  
Sbjct  274   TTFSTMATMYIKMGETEKAEDALRKVEARITGRNRIPYHYLLSLYGSVGNKKELYRVWHV  333

Query  1080  LRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGl  901
              +   P   N+ Y  ++  LV + D+ GAEK ++EW   +++YD R+ N L+ AY K   
Sbjct  334   YKSVAPSVPNLGYHALVSSLVRMGDIEGAEKVYEEWLPVKSSYDPRIPNLLMNAYVKNDQ  393

Query  900   lkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPS  721
             L+KA+ L       G KP++ TWEI  D + +   I  A+ C+ KA +        W P 
Sbjct  394   LEKAEGLFDHMVEMGGKPSSSTWEILADGHTRKRCIPEALTCLRKAFSA--EGSSNWRPK  451

Query  720   PVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLI  592
              +++    +  E +  V   E VL  L++S  HL  +  ++LI
Sbjct  452   VLMLSGFFKLCEEESAVTSKEAVLELLRQS-GHLQDKSYQALI  493



>ref|XP_006418504.1| hypothetical protein EUTSA_v10007383mg [Eutrema salsugineum]
 gb|ESQ36857.1| hypothetical protein EUTSA_v10007383mg [Eutrema salsugineum]
Length=517

 Score =   256 bits (654),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 151/431 (35%), Positives = 247/431 (57%), Gaps = 5/431 (1%)
 Frame = -2

Query  1878  ALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEK  1699
             A+Y+K+      E  A   LN++ K  +   KWE+ R VK LR+ K  + A+++ + M  
Sbjct  66    AIYKKISLMEKPELGAASVLNQWEKGGRKLTKWELCRVVKELRKYKRPNQALEVYDWMNN  125

Query  1698  RG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
             RG     + SD  I +DL+ K +GI+ AE +F++LPE  K+   YG+LLN Y +    EK
Sbjct  126   RGERFRLSASDAAIQLDLIGKVRGISDAEEFFLSLPENFKDRRVYGSLLNAYVRAKSREK  185

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             AEALI+KM+E    L  +P+N +MTLY    + +K+ A++ E+K+ DI  D ++YNIW+ 
Sbjct  186   AEALIDKMREKGYALHPLPFNVMMTLYMNLREYDKVDAMVYEMKQKDIRLDIYSYNIWLS  245

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             +  + G +  +E+V  +MK D  +  +WTT+S +A++Y   G ++KAE AL+++E + T 
Sbjct  246   SCGSHGSVEKMEQVYQQMKSDVSINPNWTTFSTMATMYIKMGENEKAEDALRKVEARITG  305

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             RN   Y +L++LYG +GN  E+YR+W   +   P   N+ Y  ++  LV + D+ GAEK 
Sbjct  306   RNRIPYHYLLSLYGSVGNKKELYRVWNVYKSVVPSIPNLGYHALVSSLVRMGDIQGAEKV  365

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             ++EW   +++YD R+ N L+  Y K   L KA+ L       G KP++ TWEI    + +
Sbjct  366   YEEWLPVKSSYDPRIPNLLMNVYVKNDQLDKAEGLFDHMIEMGGKPSSSTWEILAHGHTR  425

Query  804   NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSED  625
                I+ A+ C+++A +        W P   ++    +  E + DV   E VL  L++S  
Sbjct  426   KRNITEALTCLKEAFSA--EGSSNWRPKVFMLSGFFKLCEEESDVASKEAVLELLRQS-G  482

Query  624   HLGAELLESLI  592
             HL  +  ++LI
Sbjct  483   HLQDKSYQALI  493



>ref|XP_007134411.1| hypothetical protein PHAVU_010G045500g [Phaseolus vulgaris]
 gb|ESW06405.1| hypothetical protein PHAVU_010G045500g [Phaseolus vulgaris]
Length=542

 Score =   257 bits (656),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 144/419 (34%), Positives = 245/419 (58%), Gaps = 4/419 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             +YR++      + S+ + LN +    K   KWE+ R VK LR+ K +  A+++ + +  R
Sbjct  73    VYRRITLNPDPDMSSAEVLNRWENEGKHLTKWELSRVVKELRKYKKFRRALEVYDWINNR  132

Query  1695  G--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKA  1522
                   + SD  I +DL+AK +G ++AE +F++L +  KN  TYGALLN Y    + EKA
Sbjct  133   PERFRVSESDAAIQLDLIAKVRGFSSAEVFFLSLEDQLKNKRTYGALLNVYVHSRLKEKA  192

Query  1521  EALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRA  1342
             E+L + M+     + ++P+N +MTLY    +  K+  ++ E+ E  I  D +TYNIW+ +
Sbjct  193   ESLFDTMRSKGYVVHALPFNVMMTLYMNVKEYVKVDMLVSEMMEKKIQLDIYTYNIWLSS  252

Query  1341  LAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPR  1162
               + G I  +E+V ++M++D  +  +W+T+S +AS+Y     ++KAE+ L+++E +   R
Sbjct  253   SGSQGSIEKMEQVFEQMEKDATIIPNWSTFSTMASMYIRMDQTEKAEECLRKVESRIKGR  312

Query  1161  NLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPK-TANISYLNMIQVLVNLNDMPGAEKC  985
             +   + +L++LYGR+ N  EVYR+W S +  FPK T N+ Y  +I  LV L+D+ GAEK 
Sbjct  313   DRIPFHYLLSLYGRVRNKDEVYRVWNSYKTVFPKNTPNLGYHAIIASLVKLDDIAGAEKL  372

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             ++EW S +++YD RV N L+G Y + G + KA    K+ +  G  PN+ TWEI  + Y+ 
Sbjct  373   YQEWVSVKSSYDPRVGNLLLGWYVEAGDIHKALSFFKQMKEDGGFPNSNTWEILSEGYIA  432

Query  804   NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSE  628
             +  IS A+ C++ A      + + W P P+ +   +   + + D+E AE  +  LK S+
Sbjct  433   DKRISEALSCLKDAFMVA-DNSRSWRPKPLNLSAFLELCQEQGDMESAETFIVLLKLSK  490



>ref|XP_008368855.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Malus domestica]
Length=511

 Score =   256 bits (653),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 156/469 (33%), Positives = 263/469 (56%), Gaps = 8/469 (2%)
 Frame = -2

Query  1887  LEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSET  1708
             + + L R+LL     + SA   + ++ +   +  K+E+ R V+ LR+ K Y  A+++ E 
Sbjct  38    VRDTLGRRLLSLVFPKRSAVITIRKWKEEGHTVRKYELNRIVRELRKLKRYKHALEVCEW  97

Query  1707  ME-KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMT  1531
             M  ++ +   + D  +H+DL+AK +G+ +AE +F +LP    +  T  ALL+ Y +  +T
Sbjct  98    MTLQQDLKLVSGDYAVHLDLIAKVRGMNSAEKFFEDLPLQMTDRATCTALLHTYVQNKVT  157

Query  1530  EKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIW  1351
             +KAEALI KM E       + YN +++LY   GQ +++P +IQE+K  +  PD  TYN+W
Sbjct  158   DKAEALIAKMSECGFMKHPLAYNHMLSLYISNGQLDRVPELIQELKS-NTSPDVVTYNLW  216

Query  1350  MRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKN  1171
             +   A+  D+   ERV  E+K+  ++  DW T S L ++Y    L++KA   LKE+E   
Sbjct  217   LTVCASQNDVETAERVFLELKK-AKLNPDWVTCSTLTNLYIKNSLTEKAAVTLKEMENLV  275

Query  1170  TPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAE  991
             + +N  AY  L++L+  IG+   V RIW+ ++  FPK  +  Y  M+  LV L     AE
Sbjct  276   SQKNRVAYSSLLSLHTNIGDKEGVRRIWKKVKSLFPKMNDAEYTCMLSSLVKLKQFEEAE  335

Query  990   KCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYY  811
             K + EWES   T+D RV+N L+ AY  +  +++A+    R  ++  KP   TWE+    Y
Sbjct  336   KLYTEWESVSGTHDPRVSNILLAAYINEDQMRRAETFHNRMVQNDIKPCYSTWELLTWGY  395

Query  810   LKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKS  631
             L+       ++  +KA+    G  ++W P   ++GE+    + + D++GAE +L  L+ +
Sbjct  396   LQQKHTEKVLEYFKKAV----GSVKRWDPDKRLIGEVFNRLKEEGDIQGAEELLVFLRNA  451

Query  630   EDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVIS  484
               H+  E+  SLIR YA AGK   V+  R++ +N +L +E +KL+ + S
Sbjct  452   -GHVSTEIYNSLIRIYAEAGKMPLVIAERMEKDNVQLDDETRKLIKITS  499



>gb|EAZ31514.1| hypothetical protein OsJ_15655 [Oryza sativa Japonica Group]
Length=531

 Score =   256 bits (654),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 143/368 (39%), Positives = 219/368 (60%), Gaps = 3/368 (1%)
 Frame = -2

Query  1683  TTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEK  1504
             ++SD  I +DL+AK +G++ AE YF  LP+  K+  TYG+LLN Y + +M EK E+  E+
Sbjct  163   SSSDMAIQLDLIAKVRGVSHAEEYFEELPDPLKDKRTYGSLLNVYAQAMMKEKTESTFEQ  222

Query  1503  MKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGD  1324
             M++      ++P+N LM  Y    + EK+  +I E+ E ++  D  TYNIW+++ AA+ D
Sbjct  223   MRKKGFATDTLPFNVLMNFYVDAEEAEKVSILIDEMMERNVAFDVCTYNIWIKSCAAMQD  282

Query  1323  ISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQ  1144
                +E+V ++M RD  V  +WTTY+ LAS++   G S+KAE++LKE EK+ T R    + 
Sbjct  283   ADAMEQVFNQMIRDETVVANWTTYTTLASMHIKLGNSEKAEESLKEAEKRTTGREKKCFH  342

Query  1143  FLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESG  964
             +L+TLY  +G   EVYR+W   +  FP   N+ Y  ++  LV L D+ GAE  ++EW S 
Sbjct  343   YLMTLYSHLGKKEEVYRVWNWYKATFPTIHNLGYQEVLSALVRLGDIEGAELLYEEWASK  402

Query  963   QTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSA  784
              +++D +  N L+  YA++G + KA++   R    G  P   TWEI    YLK+G+ S A
Sbjct  403   SSSFDPKTMNILLAWYAREGFVTKAEQTLNRFVEKGGNPKPNTWEILGTAYLKDGQSSEA  462

Query  783   VDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELL  604
             + C+EKA  T      KW P P  V  L+ +F+ K D E A+R++ N+ +S      E  
Sbjct  463   LSCLEKA--TAVASPSKWRPRPTNVESLLANFKEKNDAESADRLM-NVLRSRRCEENEEY  519

Query  603   ESLIRTYA  580
             +SLI TYA
Sbjct  520   KSLINTYA  527



>gb|ABA99305.2| pentatricopeptide, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG94881.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94387.1| unnamed protein product [Oryza sativa Japonica Group]
Length=514

 Score =   256 bits (653),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 153/467 (33%), Positives = 262/467 (56%), Gaps = 8/467 (2%)
 Frame = -2

Query  1881  EALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETME  1702
             + L R+LLK    + SA   L  + +  ++  K+++ R V+ LR+ + +  A+++ E M 
Sbjct  43    DTLGRRLLKLIYPKRSAAVVLRRWAEEGRTVQKYQLNRVVRELRKYRRFKHALEICEWMR  102

Query  1701  KRG-MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
              +  M     D  +H+DLVAK +G+ +AE +F ++PE +K   T  ALL+ Y +    +K
Sbjct  103   TQPEMRLLPGDHAVHLDLVAKVRGLPSAEKFFEDMPERAKGPSTCNALLHAYVQHGRRDK  162

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             AEA++E+M +      ++P+N +M+LY  +G+ EK+P +I+E++   I PD  TYNIW+ 
Sbjct  163   AEAMLEEMAKAGYLTCALPFNHMMSLYMSSGELEKVPEMIKELRRYTI-PDLVTYNIWLT  221

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
               +    +   E+V D MK D RV  DW T+S L SIY +AGL  K   AL E+EK+ + 
Sbjct  222   YCSKKNSVKAAEKVYDLMK-DERVVPDWMTFSLLGSIYINAGLHVKGRDALVEMEKRASR  280

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             +   AY  L+TLY  + +   + R+WR +R  F K ++  Y  M+  L    D+  AE  
Sbjct  281   KERAAYSSLLTLYASLSDRGNLDRVWRKMRETFRKFSDTEYKCMLTSLTRFGDIAEAESF  340

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             + EWES   T D R+ N ++  Y K G+++KA+       + G KP+  TWE+F+  YL 
Sbjct  341   YSEWESASGTRDSRIPNTILAFYIKNGMMEKAEGFLDHIVQKGVKPSYSTWELFVWGYLS  400

Query  804   NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSED  625
             +G +   ++C++KA++      +KW P+P +   +    E K D+E AE++L   +++  
Sbjct  401   DGRMDKVLECLKKALSC----LEKWDPNPQLATAIYSQIEEKGDIEAAEKLLVMFREA-G  455

Query  624   HLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVIS  484
             ++  E+  S++RTYA A     ++  R+  +   + +E + LL + S
Sbjct  456   YVTTEIYNSVLRTYAKAELMPLIVDERMDQDKVSMDDETRSLLRLTS  502



>ref|XP_010255941.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Nelumbo nucifera]
Length=513

 Score =   255 bits (652),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 163/463 (35%), Positives = 266/463 (57%), Gaps = 8/463 (2%)
 Frame = -2

Query  1869  RKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETME-KRG  1693
             R+LL     + SA   + ++ +  K+  K+E+ R V+ LR+ K Y  A+++ E M  +  
Sbjct  45    RRLLTLIYPKRSAVVTIRKWTEEGKTVRKYELNRVVRELRKLKRYKHALEICEWMTVQPD  104

Query  1692  MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEAL  1513
             +     D  +H+DLVAK +G  +AE +F +LPE  K   TY ALL+ Y +  ++EKAEAL
Sbjct  105   IKLLPGDYALHLDLVAKVRGWVSAEKFFEDLPEHMKGEPTYSALLHTYVQHNLSEKAEAL  164

Query  1512  IEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAA  1333
             ++KM E   +   +PYN +++LY   GQ  K+  +IQE+K+ +  PD  TYN+W+   A 
Sbjct  165   MKKMSECGFSRNVLPYNHMLSLYISNGQLGKVLEVIQELKK-NTSPDVVTYNLWLNVCAL  223

Query  1332  LGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLT  1153
               D+   E+V  E+K+  ++  DW TYS L ++Y      +KA   LKE+EK+ + +N  
Sbjct  224   QNDVEDAEKVFLELKK-AKIDADWVTYSVLTNLYIKKDQLEKATSTLKEMEKRVSRKNRV  282

Query  1152  AYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEW  973
             AY  L++L+  +G+   VYRIW+ ++  F K  +  Y  +I  LV L ++  AE  + EW
Sbjct  283   AYSSLVSLHTSMGDKEGVYRIWKKIKSTFHKMNDAEYTCLIASLVKLGELKEAENVYAEW  342

Query  972   ESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEI  793
             E    T D R+ N L+ AY  QG + KA++  +R  + G  P+  TWE+F   YLK  ++
Sbjct  343   EVVSGTGDSRIPNLLLAAYINQGQMDKAEKFCERMVQKGITPSYTTWELFAWGYLKMKKM  402

Query  792   SSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGA  613
                +D  +KAI + +    +W P+  IV E+  + E + ++ GAE+ L  L +S  ++  
Sbjct  403   DKVLDYFKKAIESVK----EWDPTDRIVREVFDNLEKEGNIAGAEQFLVIL-RSAGYVTT  457

Query  612   ELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVIS  484
             ++  SL+RTYA AGK   ++  R+K +N EL EE ++L+ + S
Sbjct  458   QIYNSLLRTYAKAGKMPLIVAERMKNDNVELDEETRQLIKLTS  500



>ref|XP_010272479.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X1 [Nelumbo nucifera]
Length=502

 Score =   254 bits (650),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 163/465 (35%), Positives = 262/465 (56%), Gaps = 10/465 (2%)
 Frame = -2

Query  1881  EALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM-  1705
             ++LY ++   G  + S    L +++   +S  K E+   ++ L+  + +  A+++S+ M 
Sbjct  33    DSLYERIAVTGDPKISVVPVLEKWVDEGRSVNKVELNLLIRKLKFLRKFKHALEISQWMT  92

Query  1704  EKRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
              +R    + SD  + +DL++K  G+  AE YF ++    K   TYGALLNCY +E   EK
Sbjct  93    NRRYFELSPSDAAMRLDLISKVHGLEHAEKYFASISNKLKALKTYGALLNCYVREKSVEK  152

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             AEAL++ MK +    TS PYN L+ LY +TGQ EKI  ++QE+KE  I+ D FT N  + 
Sbjct  153   AEALVQNMKSMGFATTSFPYNMLIILYFQTGQHEKIDILMQEMKEKGILHDQFTLNNQLS  212

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSD-kaekalkelekKNT  1168
             A A+  ++ G+E  +++M++D  +  DW TY+ +A+ Y  AGL D       K      T
Sbjct  213   AFASASNVRGMEETLNQMEKDPYITIDWNTYAIIANGYIKAGLFDNALAMLKKMERIIIT  272

Query  1167  PRNLTA-YQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAE  991
              R+ T    +L++LY  +G   E+YR+W   +L+  +  N SY  MI  L  L+D+ GAE
Sbjct  273   QRSTTVGLDYLLSLYSSMGRKDELYRVWNLYKLSGKR--NSSYCCMITSLAKLDDIKGAE  330

Query  990   KCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYY  811
               FKEWES    YD RV N L+ AY K GL  KA+ + ++A   G  P A TW I    Y
Sbjct  331   MIFKEWESNCAFYDFRVLNRLLVAYCKNGLFDKAELVLQKAV-VGRTPYASTWNILAMGY  389

Query  810   LKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKS  631
             ++N ++S AV+ ++KA+   R   + W P+   +   + + E K+DVEG E ++  L ++
Sbjct  390   VENKQMSKAVEMLKKAMLVAR---EGWRPNLATLVACLDYLEEKRDVEGVEDLV-RLFRA  445

Query  630   EDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
                L  +L   L+R Y AAGK S+ +  ++K++   ++EE + +L
Sbjct  446   TGPLSRDLYHRLLRIYLAAGKPSSSILDQMKVDGLPINEETQTIL  490



>ref|XP_010479321.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Camelina sativa]
Length=559

 Score =   256 bits (654),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 158/463 (34%), Positives = 259/463 (56%), Gaps = 7/463 (2%)
 Frame = -2

Query  1974  QKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHK  1795
             +KT   + S  Q +   T +  +R   ++   A+Y+K+      E  AG  LN++ K  +
Sbjct  74    KKTAAIVCSISQVYGYGTVDYERRPIIQW--NAIYKKISLMEKPELGAGSVLNQWEKGGR  131

Query  1794  SAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKGIAAA  1621
                KWE+ R VK LR+ K  + A+++ + M  RG     + SD  I +DL+ K +GI+ A
Sbjct  132   KLTKWELCRVVKELRKYKRPNQALEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGISDA  191

Query  1620  EAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYT  1441
             E +F+ LPE  K+   YG+LLN Y +    EKAE+L+  M+E    L  +P+N +MTLY 
Sbjct  192   EEFFLTLPENFKDRRVYGSLLNAYVRAKSREKAESLLSTMREKGYALHPLPFNVMMTLYM  251

Query  1440  RTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDW  1261
                + +K+ A++ E+K+ DI  D ++YNIW+ +  +LG +  +E V  +MK D  +  +W
Sbjct  252   NLREFDKVDAMVFEMKQKDIRLDIYSYNIWLSSCGSLGSVEKMELVYQQMKSDVAINPNW  311

Query  1260  TTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRS  1081
             TT+S +A++Y   G ++KAE AL+++E + T RN   Y +L++LYG +GN  E+YR+W  
Sbjct  312   TTFSTMATMYIKMGETEKAEDALRKVEARITGRNRIPYHYLLSLYGSVGNKKELYRVWHV  371

Query  1080  LRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGl  901
              +   P   N+ Y  ++  LV + D+ GAEK ++EW   +++YD R+ N L+ AY K   
Sbjct  372   YKSVAPSVPNLGYHALVSSLVRMGDIEGAEKVYEEWLPVKSSYDPRIPNLLMNAYVKNDQ  431

Query  900   lkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPS  721
             L+KA+ L       G KP++ TWEI  D + +   I  A+ C+ KA +        W P 
Sbjct  432   LEKAEGLFDHMVEMGGKPSSSTWEILADGHTRKRCIPEALTCLRKAFSA--EGSSNWRPK  489

Query  720   PVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLI  592
              +++    +  E +  V   E VL  L++S  HL  +  ++LI
Sbjct  490   VLMLSGFFKLCEEESAVTSKEAVLELLRQS-GHLQDKSYQALI  531



>gb|AAM19786.1| At1g02150/T7I23.8 [Arabidopsis thaliana]
 gb|AAO64747.1| At1g02150/T7I23.8 [Arabidopsis thaliana]
Length=524

 Score =   255 bits (652),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 154/452 (34%), Positives = 251/452 (56%), Gaps = 6/452 (1%)
 Frame = -2

Query  1974  QKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHK  1795
             +KT   + S  Q +   T +  +R   ++   A+Y+K+      E  A   LN++ K+ +
Sbjct  38    KKTAAIVCSISQVYGYGTVDYERRPIVQW--NAIYKKISLMEKPELGAASVLNQWEKAGR  95

Query  1794  SAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKGIAAA  1621
                KWE+ R VK LR+ K  + AI++ + M  RG     + SD  I +DL+ K +GI  A
Sbjct  96    KLTKWELCRVVKELRKYKRANQAIEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGIPDA  155

Query  1620  EAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYT  1441
             E +F+ LPE  K+   YG+LLN Y +    EKAEAL+  M++    L  +P+N +MTLY 
Sbjct  156   EEFFLQLPENFKDRRVYGSLLNAYVRAKSREKAEALLNTMRDKGYALHPLPFNVMMTLYM  215

Query  1440  RTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDW  1261
                + +K+ A++ E+K+ DI  D ++YNIW+ +  +LG +  +E V  +MK D  +  +W
Sbjct  216   NLREYDKVDAMVFEMKQKDIRLDIYSYNIWLSSCGSLGSVEKMELVYQQMKSDVSIYPNW  275

Query  1260  TTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRS  1081
             TT+S +A++Y   G ++KAE AL+++E + T RN   Y +L++LYG +GN  E+YR+W  
Sbjct  276   TTFSTMATMYIKMGETEKAEDALRKVEARITGRNRIPYHYLLSLYGSLGNKKELYRVWHV  335

Query  1080  LRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGl  901
              +   P   N+ Y  ++  LV + D+ GAEK ++EW   +++YD R+ N L+ AY K   
Sbjct  336   YKSVVPSIPNLGYHALVSSLVRMGDIEGAEKVYEEWLPVKSSYDPRIPNLLMNAYVKNDQ  395

Query  900   lkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPS  721
             L+ A+ L       G KP++ TWEI    + +   IS A+ C+  A +        W P 
Sbjct  396   LETAEGLFDHMVEMGGKPSSSTWEILAVGHTRKRCISEALTCLRNAFSA--EGSSNWRPK  453

Query  720   PVIVGELMRHFETKKDVEGAERVLGNLKKSED  625
              +++    +  E + DV   E VL  L++S D
Sbjct  454   VLMLSGFFKLCEEESDVTSKEAVLELLRQSGD  485



>ref|XP_002892022.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH68281.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=523

 Score =   255 bits (651),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 156/463 (34%), Positives = 257/463 (56%), Gaps = 7/463 (2%)
 Frame = -2

Query  1974  QKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHK  1795
             +KT   + S  Q +   T +  +R   ++   A+Y+K+      E  A   LN++ K  +
Sbjct  37    KKTAAIVCSISQVYGYGTVDYERRPIVQW--NAIYKKISLMEKPELGAASVLNQWEKGGR  94

Query  1794  SAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKGIAAA  1621
                KWE+ R VK LR+ K  + A+++ + M  RG     + SD  I +DL+ K +GI+ A
Sbjct  95    KLTKWELCRVVKELRKYKRPNQALEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGISDA  154

Query  1620  EAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYT  1441
             E +F+ LPE  K+   YG+LLN Y +    EKAEAL+  M++    L  +P+N +MTLY 
Sbjct  155   EQFFLTLPENFKDRRVYGSLLNAYVRAKSREKAEALLHTMRDKGYALHPLPFNVMMTLYM  214

Query  1440  RTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDW  1261
                + +K+ A++ E+K+ DI  D ++YNIW+ +  +LG +  +E V  +MK D  +  +W
Sbjct  215   NLREYDKVDAMVFEMKQKDIRLDIYSYNIWLSSCGSLGSVEKMELVYQQMKSDVSINPNW  274

Query  1260  TTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRS  1081
             TT+S +A++Y   G ++KAE AL+++E + T RN   Y +L++LYG +GN  E+YR+W  
Sbjct  275   TTFSTMATMYIKMGETEKAEDALRKVEARITGRNRIPYHYLLSLYGSVGNKKELYRVWNV  334

Query  1080  LRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGl  901
              +   P   N+ Y  ++  L  + D+ GAEK ++EW   +++YD R+ N L+  Y K   
Sbjct  335   YKSVVPSIPNLGYHALVSSLARMGDIEGAEKVYEEWLPVKSSYDPRIPNLLMNVYVKNDQ  394

Query  900   lkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPS  721
             L+KA+ L       G KP++ TWEI  D + +   I  A+ C+ KA +        W P 
Sbjct  395   LEKAEGLFDHMVEMGGKPSSSTWEILADGHTRKRCIPEALTCLRKAFSA--EGSSNWRPK  452

Query  720   PVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLI  592
              +++    +  E + DV   E VL  L++S  HL  +  ++LI
Sbjct  453   VLMLSGFFKLCEEESDVTSKEAVLELLRQS-GHLEDKAYQALI  494



>emb|CDP09418.1| unnamed protein product [Coffea canephora]
Length=457

 Score =   253 bits (646),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/399 (35%), Positives = 234/399 (59%), Gaps = 4/399 (1%)
 Frame = -2

Query  1821  LNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLV  1648
             LN++    K   KWE+ R VK LR+ K ++ A+++ E M  R      +TSD  I +DL+
Sbjct  12    LNQWENEGKKLTKWELSRVVKELRKFKRFNLALEVYEWMNNREERFRISTSDTAIQLDLI  71

Query  1647  AKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMP  1468
             +K  GI++AE YF+ LP+  K+   YGALLN Y +    E+AE+L++KM++      ++P
Sbjct  72    SKVHGISSAEDYFLKLPDPLKDKRIYGALLNAYGRARKKEEAESLMDKMRDRGYACHALP  131

Query  1467  YNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMK  1288
             +N +MTLY    + +K+ ++I E+ E +I  D ++YNIW+ +  A G +  +E V++ MK
Sbjct  132   FNVIMTLYMNLQEYDKVQSVISEMLEKNINLDIYSYNIWLSSCGAQGSVGDMEEVLERMK  191

Query  1287  RDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNL  1108
              D  +  +WTTYS +A++Y   G  +KAE  LK++E + T R+   Y +LI+LYG +G  
Sbjct  192   LDTTINPNWTTYSTMATLYIKLGEMEKAEDCLKKIESRITGRDRIPYHYLISLYGTVGKK  251

Query  1107  VEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANAL  928
              EVYR+W   +  F    N+ Y  +I  L+ + D+ GAEK + EW S ++ YD RV N L
Sbjct  252   EEVYRVWDLYKSIFSIIPNLGYHAVISSLIRVGDIEGAEKIYNEWLSVKSMYDPRVGNLL  311

Query  927   IGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGR  748
             +  Y + G   KA+         G + N+ TWEI  + ++++ +IS A+ C++ A++   
Sbjct  312   LACYVRNGFSDKAEAFFDEMIEVGGRANSVTWEILAEGHVRDRKISEALSCLKNAVSAEG  371

Query  747   GDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKS  631
               G  W P PV V  +++  E + D+   E ++G L+++
Sbjct  372   SQG--WRPKPVNVSSVLKLCEQEGDISSKEALMGVLRQA  408



>ref|XP_007198989.1| hypothetical protein PRUPE_ppa004422mg [Prunus persica]
 gb|EMJ00188.1| hypothetical protein PRUPE_ppa004422mg [Prunus persica]
Length=511

 Score =   254 bits (650),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 147/435 (34%), Positives = 252/435 (58%), Gaps = 8/435 (2%)
 Frame = -2

Query  1785  KWEVGRSVKLLRQRKLYSPAIKLSETME-KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYF  1609
             K+E+ R V+ LR+ K Y  A+++ E M  ++ M     D  +H+DL+AK +G+ +AE +F
Sbjct  72    KYELNRIVRELRKLKRYKHALEICEWMTLQQDMKLLPGDYAVHLDLIAKVRGLNSAEKFF  131

Query  1608  INLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQ  1429
              +LP+    H T  ALL+ Y +  +++KAEAL+ KM +       + YN +++LY   GQ
Sbjct  132   EDLPDQMTGHPTCTALLHTYVQNKLSDKAEALMAKMSQCGYMKHPLAYNHMLSLYVSNGQ  191

Query  1428  PEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYS  1249
              +K+P +IQE+K  +  PD  TYN+W+   A+  D+   E+V  E+K+  ++  DW T+S
Sbjct  192   FDKVPEVIQELKS-NTSPDVVTYNLWLTVCASQSDVETAEKVFLELKK-AKLNPDWVTFS  249

Query  1248  NLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLA  1069
              L ++Y  + L++KA   LKE+EK  + +N  AY  L++L+  IG+   V+RIW+ ++  
Sbjct  250   TLTNLYIKSLLTEKAAVTLKEMEKIASRKNRAAYSSLLSLHTNIGDEDGVWRIWKKMKSC  309

Query  1068  FPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkka  889
             F K  +  Y  M+  LV L +   AEK + EWES   T+D RV+N L+ AY  +  ++ A
Sbjct  310   FRKMNDAEYTCMLSSLVKLKEFEEAEKLYTEWESVSETHDARVSNILLAAYINKDQMEMA  369

Query  888   kelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIV  709
             +    R  ++G  P   TWE+    +LK       +D  +KA+    G  ++W P   ++
Sbjct  370   ETFHNRMVQNGITPCYSTWELLTWGFLKQKHTEKVLDNFKKAV----GSVKRWDPDKRLI  425

Query  708   GELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMEN  529
             GE+    + + +++GAE +L  L+ +  H+  E+  S++RTYA AGK   ++  R++ +N
Sbjct  426   GEVFNRLKEEGNIKGAEELLLFLRNA-GHVSTEIYNSVLRTYAEAGKMPLIVAERMEKDN  484

Query  528   AELSEEAKKLLDVIS  484
              +L EE ++L+ + S
Sbjct  485   VQLDEETRRLIKLTS  499



>ref|XP_008790994.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Phoenix dactylifera]
Length=533

 Score =   255 bits (652),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 162/467 (35%), Positives = 265/467 (57%), Gaps = 8/467 (2%)
 Frame = -2

Query  1881  EALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETME  1702
             + L R+LL     + SA   L ++ +  K   K+++ R V+ LR+ K +  A+++ E M 
Sbjct  62    DTLGRRLLSLIYPKRSAVVVLRKWAEEGKRVQKYQLNRVVRELRKYKRFKHALEICEWMT  121

Query  1701  KR-GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
              +  +     D  +H+DLVAK +G+A+AE +F +LPE  K   T  ALL+ Y +  ++ K
Sbjct  122   TQPDIKLLPGDYAVHLDLVAKVRGLASAEKFFEDLPERMKGQSTCTALLHTYVQSELSNK  181

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             AE+L+E+M    L    +PYN ++TLY   G+ +K+P +++E+K  +  PD  TYN+W+ 
Sbjct  182   AESLMEEMSIHGLLRCPLPYNHMLTLYISKGELDKVPKLVKELKR-NTKPDVVTYNLWLS  240

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             A A   D+ G E V+ EM+++ ++  DW TYS LA+IY  A  S+KA++AL E+EK+ + 
Sbjct  241   ACAKKDDVMGAEEVLREMEKE-KITTDWITYSMLATIYIKAVCSEKAKEALVEMEKRASR  299

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             +   AY  LI+L+  + +   VYRIW  ++  F K +++ Y  ++  L  L D+  AE  
Sbjct  300   KERAAYCSLISLHASLSDKENVYRIWNKIKSTFRKMSDVEYKCILSSLTKLGDIEEAESI  359

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             + EWES   T D RV N L+G Y K  ++ KA+   +   ++G KP+  TWE+    YL 
Sbjct  360   YSEWESVSGTRDSRVPNILLGYYIKNDMMDKAENFHEHTVQTGVKPSYTTWELLAWSYLS  419

Query  804   NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSED  625
                I   + C++ A +      +KW P+  I+  +    E   DVEGAE+ L  L+    
Sbjct  420   KKRIDKVLHCLKNAFSI----LEKWEPNVGIIRAVFSKLEMMGDVEGAEQFLVMLRDV-G  474

Query  624   HLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVIS  484
             ++  E+  SL+RTYA AGK   ++  R+K +  ++ EE + LL + S
Sbjct  475   YVTTEIYNSLLRTYAKAGKMPLIVAERMKKDGVQMDEETRGLLRLTS  521



>ref|XP_010246096.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Nelumbo nucifera]
Length=515

 Score =   254 bits (650),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 151/417 (36%), Positives = 239/417 (57%), Gaps = 4/417 (1%)
 Frame = -2

Query  1878  ALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEK  1699
             +LYR++      E  +   L+++ K  +   KW + R VK LR+ + Y  A+++ E M  
Sbjct  72    SLYRRISLMENPELGSSTVLDQWEKEGRKLSKWVLSRVVKELRKFRRYKFALEVYEWMTN  131

Query  1698  RG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
             +G      +SD  I +DL++K  GI+ AE YF  LPET K+  TYG+LLN Y +  M EK
Sbjct  132   QGDRFRVASSDAAIQLDLISKVHGISTAEDYFSRLPETLKDRRTYGSLLNAYAQSKMREK  191

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             AE +IE+M++       +PYN +MTLY    + EK  ++I E+ E  I  D ++YNIW+ 
Sbjct  192   AENVIEEMRKKGYANHPLPYNVMMTLYMNLNEYEKANSLISEMMEKKIPLDIYSYNIWLS  251

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             +  A+G +  +E+V ++M  DG +  +WTTYS +A++Y   G  +KA+  LK++E + T 
Sbjct  252   SCGAMGSMEKMEQVFEQMSLDGTINPNWTTYSTMATMYIKMGYFEKAKDCLKKVEIRITG  311

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             R+   Y +L++LYG IG+  EVYRIW   +  FP   N+ Y  MI  LV L D+ GAE  
Sbjct  312   RDRMPYHYLLSLYGGIGSKEEVYRIWNKYKSNFPSIPNLGYHAMIASLVRLGDISGAEII  371

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             ++EW S ++ YD R+ N LIG Y ++G L+KA+         G K N+ TWEI  + ++K
Sbjct  372   YEEWLSVRSNYDPRICNLLIGWYVREGSLEKAETFLSHVTEVGGKLNSNTWEIIAEGHIK  431

Query  804   NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKK  634
               +I  A+ C++KA +   G  + W P    V   +   E + D+   + ++  L++
Sbjct  432   KKQIVEALSCMKKA-SVAEG-AKNWRPKLTNVSAFLSLCEEESDIASKDALIEVLRQ  486



>ref|XP_006306047.1| hypothetical protein CARUB_v10011354mg [Capsella rubella]
 gb|EOA38945.1| hypothetical protein CARUB_v10011354mg [Capsella rubella]
Length=524

 Score =   254 bits (650),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 157/463 (34%), Positives = 258/463 (56%), Gaps = 7/463 (2%)
 Frame = -2

Query  1974  QKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHK  1795
             +KT   + S  Q +   T +  +R   ++   A+Y+K+      E  A   LN++ K  +
Sbjct  36    KKTAAIVCSISQVYGYGTVDYERRPIIQW--NAIYKKISLMEKPELGAASVLNQWEKGGR  93

Query  1794  SAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKGIAAA  1621
                KWE+ R VK LR+ K  + A+++ + M  RG     + SD  I +DL+ K +GI+ A
Sbjct  94    KLTKWELCRVVKELRKYKRPNQALEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGISDA  153

Query  1620  EAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYT  1441
             E +F+ LPET K+   YG+LLN Y +    EKAEAL+  M+E    L  +P+N +MTLY 
Sbjct  154   EEFFLTLPETFKDRRVYGSLLNAYVRAKSREKAEALLNTMREKGYALHPLPFNVMMTLYM  213

Query  1440  RTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDW  1261
                + +K+ A++ E+K+ DI  D ++YNIW+ +  +LG +  +E V  +MK D  +  +W
Sbjct  214   NLREYDKVDAMVFEMKQKDIRLDIYSYNIWLSSCGSLGSVEKMELVYQQMKSDVAINPNW  273

Query  1260  TTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRS  1081
             TT+S +A++Y   G  +KAE AL+++E + T RN   Y +L++LYG +GN  E+YR+W  
Sbjct  274   TTFSTMATMYIKMGEIEKAEDALRKVEARITGRNRIPYHYLLSLYGSVGNKKELYRVWNV  333

Query  1080  LRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGl  901
              +   P   N+ Y  ++  LV + D+ GAEK ++EW   +++YD R+ N L+  Y K   
Sbjct  334   YKSVAPSIPNLGYHALVSSLVRMGDIEGAEKVYEEWLPVKSSYDPRIPNLLMNVYVKNDQ  393

Query  900   lkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPS  721
             L+KA+ L       G KP++ TWEI  D + +   I  A+ C+ KA +        W P 
Sbjct  394   LEKAEGLFDHMVEMGGKPSSSTWEILADGHTRKRCIPEALTCLRKAFSA--EGSSNWRPK  451

Query  720   PVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLI  592
              +++    +  E + D+   E VL  L+++  HL  +  ++LI
Sbjct  452   VLMLSGFFKLCEEESDITSKEAVLELLRQA-GHLQDKSYQALI  493



>ref|XP_010227218.1| PREDICTED: uncharacterized protein LOC100829762 [Brachypodium 
distachyon]
Length=987

 Score =   263 bits (673),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 157/438 (36%), Positives = 249/438 (57%), Gaps = 6/438 (1%)
 Frame = -2

Query  1878  ALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEK  1699
             +LYR++    G     G+ L ++ +  +   KWE+ R  + LR+ + ++ A+++ + M +
Sbjct  553   SLYRRIAVGHG-RRPVGRTLADWDEGERRLDKWELCRVARELRKFRRFNLALQVYDWMTE  611

Query  1698  RG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
             R    + ++SD  I +DLVAK +G+  AE YF +LP+  K+  TYG+LLN Y +  M EK
Sbjct  612   RRDRFSLSSSDMAIQLDLVAKVRGVPHAEEYFESLPDPLKDKRTYGSLLNVYAQARMKEK  671

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
              E   E+M++      ++P+N LM  Y    +P+K+ A+  E+KE ++  D  TYNIW++
Sbjct  672   TEDTFEQMRKKGYASDTLPFNVLMNFYVDVEEPQKVSAVTDEMKERNVSFDVCTYNIWIK  731

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             + AA+ D  G++RV ++M  D  V  +WTTY+ LAS++   G  +KAE  LKE EK+ T 
Sbjct  732   SFAAMKDADGMDRVFNQMIADESVVANWTTYTTLASMHIKLGNFEKAEVCLKEAEKRTTG  791

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             R+   + FLITLY  +    EVYRIW   +  F    N+ Y  ++  LV L D+ GAE  
Sbjct  792   RDKKCFHFLITLYSYLQKKEEVYRIWNWYKATFSTIHNLGYQEVLSALVRLGDIEGAELL  851

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             ++EW S  +++D +  N L+  Y+++G + KA++   R    G  P   TWEI    YLK
Sbjct  852   YEEWASKSSSFDPKTMNILLAWYSREGFVVKAEQTLNRFVEKGGNPKPNTWEILASAYLK  911

Query  804   NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSED  625
             + ++S A+ C+EKA         +W P P  V  L+ +F+   D + A+R++G L  S  
Sbjct  912   DNQLSEALSCMEKAAAV--KSASRWRPRPSNVESLLAYFKENNDTDSADRLMGVL-TSRG  968

Query  624   HLGAELLESLIRTYAAAG  571
                 E  +SLI TYA AG
Sbjct  969   CAENEEYKSLINTYALAG  986



>ref|XP_002270492.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Vitis vinifera]
Length=527

 Score =   254 bits (650),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 158/442 (36%), Positives = 249/442 (56%), Gaps = 9/442 (2%)
 Frame = -2

Query  1953  ASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEV  1774
              S  Q  S  T +  +R   K+   A+YR++      E  +   LN++    K   KWE+
Sbjct  36    CSISQIHSYGTVDYERRPLVKW--NAVYRRISLMENPEMGSASVLNQWENEGKRLTKWEL  93

Query  1773  GRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINL  1600
              R VK LR+ K +  A+++ E M  RG     ++SD  I +DL+AK  G+++AE YF  L
Sbjct  94    CRVVKELRKFKRFKMALEVYEWMNNRGERFRLSSSDAAIQLDLIAKVCGVSSAEDYFSRL  153

Query  1599  PETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEK  1420
             P+T K+   YGALLN Y +  M +KAE LIEK++      T +P+N +MTLY    + +K
Sbjct  154   PDTLKDKRIYGALLNAYVQAKMRDKAEILIEKLRNKGYATTPLPFNVMMTLYMNLKELDK  213

Query  1419  IPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLA  1240
             + ++I E+   +I  D ++YNIW   L++      +E+V ++MK +  +  +WTT+S +A
Sbjct  214   VQSMISEMMNKNIQLDIYSYNIW---LSSCESTERMEQVFEQMKLERTINPNWTTFSTMA  270

Query  1239  SIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPK  1060
             ++Y   G  +KAE+ LK++E + T R+   Y +LI+LYG  GN  EVYR W   +  FP 
Sbjct  271   TMYIKLGQFEKAEECLKKVESRITNRDRMPYHYLISLYGSTGNKAEVYRAWNIYKSKFPN  330

Query  1059  TANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakel  880
               N+ Y  +I  LV + D+ GAEK ++EW S +++YD R+ N L+G Y K+G L+KA+  
Sbjct  331   IPNLGYHALISSLVRVGDLEGAEKIYEEWLSVKSSYDPRIGNLLLGCYVKEGFLEKAEGF  390

Query  879   rkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGEL  700
                   +G KPN+ TWEI  +      +IS A+ C ++A+     +G  W P PV V   
Sbjct  391   LDHMIEAGGKPNSTTWEILAEGNTGVKKISDALSCFKRAVLAEGSNG--WKPKPVNVSAF  448

Query  699   MRHFETKKDVEGAERVLGNLKK  634
             +   E + D    E ++G L++
Sbjct  449   LDLCEEEADTATKEALMGLLRQ  470



>ref|XP_010919766.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Elaeis guineensis]
Length=506

 Score =   254 bits (649),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 150/390 (38%), Positives = 227/390 (58%), Gaps = 5/390 (1%)
 Frame = -2

Query  1785  KWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKGIAAAEAY  1612
             KWE+ R VK LR+ + +  A+++ + M  +G     T+SD  I +DL+AK  GI+ AE +
Sbjct  104   KWELCRLVKELRKFRRFKLALEVYDWMTAQGERFTFTSSDMAIQLDLIAKVHGISHAEEH  163

Query  1611  FINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTG  1432
             F  LP+T K+   YGALLN Y +  M EKAE ++E M+    T  ++ +N LMTLY   G
Sbjct  164   FSKLPDTFKDRRAYGALLNVYGRAKMKEKAEDIVEVMRNKGYTTEALFFNVLMTLYMNVG  223

Query  1431  QPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTY  1252
             + EK+  II E+KE ++  D  +YNIW+   AA+GD   +ERV+  M  D  V  +WTTY
Sbjct  224   EHEKVNKIINEMKEKNVSFDICSYNIWITNCAAMGDTEDMERVVGMMTSDNGVIANWTTY  283

Query  1251  SNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRL  1072
             + LA++Y   G ++KA+  LK+ E + T R+  ++ +LI LY RIG   EVYRIW   + 
Sbjct  284   TTLATMYIRLGNTEKAQSCLKDAEIRVTGRDRASFHYLIGLYSRIGKKEEVYRIWNWYKS  343

Query  1071  AFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkk  892
             +FP   N+ Y  M+  L+ L D+ GAE  + EW S  ++YD R+ N L+G+YA++GL+ K
Sbjct  344   SFPSILNMGYQLMLSSLIRLGDVDGAEMIYGEWLSMTSSYDPRICNILLGSYAREGLVGK  403

Query  891   akelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVI  712
             AK +  R    G KP   TWEI  + Y+K  + S A+ CI++A + G  +   W P+P  
Sbjct  404   AKNVLDRFSEKGGKPKPITWEILAEGYIKEEQTSEALLCIKEAASYGVNN---WRPNPTN  460

Query  711   VGELMRHFETKKDVEGAERVLGNLKKSEDH  622
             +  L+   +   D      ++  L+    H
Sbjct  461   IENLLALCKRHNDFASVNMLMDALRMRGCH  490



>ref|XP_003520417.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Glycine max]
Length=555

 Score =   255 bits (651),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 139/418 (33%), Positives = 244/418 (58%), Gaps = 3/418 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             +YR++      +  + + LN++    +   KWE+ R VK LR+ K +  A+++ + M  R
Sbjct  82    VYRRISLNQNPQVGSAEVLNQWENEGRHLTKWELSRVVKELRKYKRFPRALEVYDWMNNR  141

Query  1695  G--MNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKA  1522
                   + SD  I +DL+AK +G+++AEA+F++L +  K+  TYGALLN Y      EKA
Sbjct  142   PERFRVSESDAAIQLDLIAKVRGVSSAEAFFLSLEDKLKDKRTYGALLNVYVHSRSKEKA  201

Query  1521  EALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRA  1342
             E+L + M+     + ++P N +MTLY    +  K+  +  E+ E +I  D +TYNIW+ +
Sbjct  202   ESLFDTMRSKGYVIHALPINVMMTLYMNLNEYAKVDMLASEMMEKNIQLDIYTYNIWLSS  261

Query  1341  LAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPR  1162
               + G +  +E+V ++M+RD  +  +W+T+S LAS+Y     ++KAEK L+++E +   R
Sbjct  262   CGSQGSVEKMEQVFEQMERDPTIVPNWSTFSTLASMYIRMNQNEKAEKCLRKVEGRIKGR  321

Query  1161  NLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCF  982
             +   + +L++LYG +G   EVYR+W + +  FP+  N+ Y  +I  LV L+D+ GAEK +
Sbjct  322   DRIPFHYLLSLYGSVGKKDEVYRVWNTYKSIFPRIPNLGYHAIISSLVKLDDIEGAEKLY  381

Query  981   KEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKN  802
             +EW S +++YD R+ N L+G Y K+    KA    ++    G  PN+ TWEI  + ++ +
Sbjct  382   EEWISVKSSYDPRIGNLLMGWYVKKDDTDKALSFFEQISNDGCIPNSNTWEILSEGHIAD  441

Query  801   GEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSE  628
               IS A+ C+++A     G  + W P P  +   +   + + D+E AE ++G L++S+
Sbjct  442   KRISEALSCLKEAFMVA-GGSKSWRPKPSYLSAFLELCQEQNDMESAEVLIGLLRQSK  498



>ref|XP_010692029.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Beta vulgaris subsp. vulgaris]
Length=535

 Score =   254 bits (650),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 162/467 (35%), Positives = 256/467 (55%), Gaps = 16/467 (3%)
 Frame = -2

Query  2067  SVAAQFFHSSSSAD*GFSVTDQN*TNESRQYQKTLTKMASFIQRFSSKTKNIGKRSTKKY  1888
             S    FF S S +   FS          R +   L+   S  Q +S  T +  KR   K+
Sbjct  20    SYCPSFFPSGSRSFISFS--------NGRPF--NLSIQCSVPQVYSYGTMDYEKRPMLKW  69

Query  1887  LEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSET  1708
             ++  +Y+++      +      LN+  K  K   KWE+ + V+ LR+ K +  A+++ E 
Sbjct  70    VD--IYKRISLMENPQIGVASVLNQCEKEGKKVNKWELCKIVRELRKFKRFKLALEVYEW  127

Query  1707  MEKR--GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELM  1534
             M  R      ++SD  I +DL+AK +G+++AE YF+ LP+T K+   YGALLN Y     
Sbjct  128   MNNRIERFRLSSSDTAIQLDLIAKVRGVSSAEDYFMRLPDTLKDKRIYGALLNAYVGAKE  187

Query  1533  TEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNI  1354
              EKAE+L+E+M+        +P+N +MTLY +    +K+  +I E+K+ +I  D ++YNI
Sbjct  188   REKAESLMERMRTKGYAQHPLPFNVMMTLYMKLNDYDKVDELISEMKQRNIHLDLYSYNI  247

Query  1353  WMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekK  1174
             W+ A  + G   G+E+V+DEMK    +  +WTT+S +AS+Y   G+ +KAE+ LK+LE +
Sbjct  248   WLSARGSQGSAEGMEQVLDEMKLVPTIIPNWTTFSTIASVYIKLGMFEKAEQCLKDLEAR  307

Query  1173  NTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGA  994
              T R+   Y +LI+LYG IGN  EV R+W + +  F    N  Y  MI  L+ L D+ GA
Sbjct  308   ITGRDRMPYHYLISLYGSIGNKEEVNRVWNTYKSTFSSIPNWGYHAMISALIRLGDIEGA  367

Query  993   EKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDY  814
             EK ++EW   +T+YD +VAN L+G Y ++   +KA+         GAKPN+ +WEI  + 
Sbjct  368   EKMYEEWLPVKTSYDPKVANLLMGWYIREEPFEKAQNFFNSMIEGGAKPNSGSWEILEEG  427

Query  813   YLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKD  673
             ++K G IS A+ C  +A+       + W P P  V   +   + + D
Sbjct  428   HIKEGRISEALSCFREAMLA--ETPKNWYPKPSNVSAFLELCDQEGD  472



>ref|NP_171717.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q8LPS6.2|PPR3_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g02150 
[Arabidopsis thaliana]
 gb|AAC24372.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE27393.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=524

 Score =   254 bits (649),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 153/452 (34%), Positives = 251/452 (56%), Gaps = 6/452 (1%)
 Frame = -2

Query  1974  QKTLTKMASFIQRFSSKTKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHK  1795
             +KT   + S  Q +   T +  +R   ++   A+Y+K+      E  A   LN++ K+ +
Sbjct  38    KKTAAIVCSISQVYGYGTVDYERRPIVQW--NAIYKKISLMEKPELGAASVLNQWEKAGR  95

Query  1794  SAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLVAKSKGIAAA  1621
                KWE+ R VK LR+ K  + A+++ + M  RG     + SD  I +DL+ K +GI  A
Sbjct  96    KLTKWELCRVVKELRKYKRANQALEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGIPDA  155

Query  1620  EAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYT  1441
             E +F+ LPE  K+   YG+LLN Y +    EKAEAL+  M++    L  +P+N +MTLY 
Sbjct  156   EEFFLQLPENFKDRRVYGSLLNAYVRAKSREKAEALLNTMRDKGYALHPLPFNVMMTLYM  215

Query  1440  RTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDW  1261
                + +K+ A++ E+K+ DI  D ++YNIW+ +  +LG +  +E V  +MK D  +  +W
Sbjct  216   NLREYDKVDAMVFEMKQKDIRLDIYSYNIWLSSCGSLGSVEKMELVYQQMKSDVSIYPNW  275

Query  1260  TTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRS  1081
             TT+S +A++Y   G ++KAE AL+++E + T RN   Y +L++LYG +GN  E+YR+W  
Sbjct  276   TTFSTMATMYIKMGETEKAEDALRKVEARITGRNRIPYHYLLSLYGSLGNKKELYRVWHV  335

Query  1080  LRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGl  901
              +   P   N+ Y  ++  LV + D+ GAEK ++EW   +++YD R+ N L+ AY K   
Sbjct  336   YKSVVPSIPNLGYHALVSSLVRMGDIEGAEKVYEEWLPVKSSYDPRIPNLLMNAYVKNDQ  395

Query  900   lkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPS  721
             L+ A+ L       G KP++ TWEI    + +   IS A+ C+  A +        W P 
Sbjct  396   LETAEGLFDHMVEMGGKPSSSTWEILAVGHTRKRCISEALTCLRNAFSA--EGSSNWRPK  453

Query  720   PVIVGELMRHFETKKDVEGAERVLGNLKKSED  625
              +++    +  E + DV   E VL  L++S D
Sbjct  454   VLMLSGFFKLCEEESDVTSKEAVLELLRQSGD  485



>ref|XP_003572464.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial-like [Brachypodium distachyon]
Length=546

 Score =   254 bits (650),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 162/449 (36%), Positives = 254/449 (57%), Gaps = 12/449 (3%)
 Frame = -2

Query  1821  LNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRGMNKTTSDQGIHVDLVAK  1642
             L+++L+  +   + ++   V+ LR  + Y  A++L + ME RG +       + + LV K
Sbjct  105   LDQWLRERRPLSEQQLFSYVRKLRSYRHYKRALELMDWMEARGASLQLGHHAVRLGLVCK  164

Query  1641  SKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYN  1462
               G+ AAE YF +LPE  K+  TY +LLNCY +    +K   L EKMK +N+T +++ YN
Sbjct  165   VNGLEAAEEYFWSLPEMFKSIKTYSSLLNCYAEHRKADKGLELFEKMKAMNITPSTLVYN  224

Query  1461  SLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRD  1282
             +LM LY +T QPEKIP   ++++E  +  DSFTY +  ++   + D+   E+ ++E+++ 
Sbjct  225   NLMDLYLKTDQPEKIPTTFEQMRENHVRTDSFTYYMLTQSYIMVNDLKSAEKFVEELEKS  284

Query  1281  GRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVE  1102
               V   W+ Y+ LA+ Y      DKA  ALK+ E+      ++A+  L++LY   GN  E
Sbjct  285   TPVP--WSLYTVLANNYNKLAQFDKAVLALKKAEEVMDRSEISAWHNLLSLYASSGNSSE  342

Query  1101  VYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIG  922
             V R+W SL+ AF K  N SYL M+  L  L+D    ++ F+EWES    YD+R+ N +I 
Sbjct  343   VKRVWESLKSAFTKCINRSYLVMLSALKKLDDFDSLQQLFQEWESTHERYDMRITNVMIE  402

Query  921   AYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDC---IEKAITTG  751
             AY  + +  +A+ LR+ A   G   N  T+ IF+  YL+    S A+D     EK + T 
Sbjct  403   AYLAKDMTDEAEALRQTAMAKG-HSNVTTFYIFVVSYLEKSRTSEALDIWRDAEKMVKT-  460

Query  750   RGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAG  571
                   WVP   +V   ++HFE  KDV+G E    +LKK    L AE   +LIRTYAAAG
Sbjct  461   ----PNWVPPKELVTRFLKHFEEAKDVDGMEAFWEHLKKL-GCLDAEAYGALIRTYAAAG  515

Query  570   KTSTVMRRRVKMENAELSEEAKKLLDVIS  484
             +T+T + RR++ +  E+  + ++LL  +S
Sbjct  516   RTNTSISRRIEEDRVEIGPDMEELLRGVS  544



>ref|XP_009612934.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial isoform X1 [Nicotiana tomentosiformis]
Length=495

 Score =   253 bits (646),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 155/462 (34%), Positives = 255/462 (55%), Gaps = 3/462 (1%)
 Frame = -2

Query  1875  LYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKR  1696
             LY K+   G    S    L+E++   K     E+ R +  LR+RK ++ A++ SE M+  
Sbjct  29    LYSKISPLGDPNYSVTNELDEWVCKGKKVRFAELQRIILDLRKRKRFNQALEASEWMKSS  88

Query  1695  GM-NKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAE  1519
             G+   ++++  + +DL+ K  G  +AE+YF NL E  KN  TYGALL+CY ++   EKA 
Sbjct  89    GIFTFSSTEHAVQLDLIGKVHGFHSAESYFNNLNEEDKNDKTYGALLHCYVRQCDIEKAL  148

Query  1518  ALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRAL  1339
               ++ M+E  L+L+S+ +N +M+LYT+TG+ EKIP ++  +KE  + PD+ +Y I + + 
Sbjct  149   THLQMMQEKGLSLSSVAFNDIMSLYTKTGEYEKIPEVLHHMKEIGVCPDNLSYRICINSY  208

Query  1338  AALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRN  1159
              A  DI G+ERV+ EM+    +  DW TY+ +A+IY  +GL DKA   LK+ E K   + 
Sbjct  209   GARSDIEGMERVLIEMENQSYIVMDWNTYAAVANIYVKSGLDDKANSFLKKAEAKIDNKE  268

Query  1158  LTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFK  979
                Y +LI++Y R+GN  EV R+W   + A  +  N  Y+NM++ LV L+ +  AE+  K
Sbjct  269   GLGYNYLISVYSRLGNKDEVIRLWFLEKSALKRCINRDYINMLESLVRLDALEEAEQLLK  328

Query  978   EWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNG  799
             EWE+    YDIRV   +I  Y  + L +KA+ + +     G       W      YL  G
Sbjct  329   EWETSDNCYDIRVPYIVIIGYIDKKLYEKAETMLEDLSTKGKTLTPNIWGRLAAGYLDKG  388

Query  798   EISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHL  619
             +  SAV CI+ A++  + D + W P P ++ +++           AE  L +L+     +
Sbjct  389   KFESAVKCIKVALSL-KKDSKGWKPDPKVIMKILSLLGENGSANDAESFLSSLRPVVS-V  446

Query  618   GAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLD  493
               E+   L+++Y A GK    +   ++ +N + +EE K +L+
Sbjct  447   NREMYHVLLKSYIAGGKEVERLLNSMRADNIDENEETKVILE  488



>emb|CAN64166.1| hypothetical protein VITISV_006333 [Vitis vinifera]
Length=506

 Score =   253 bits (647),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 157/470 (33%), Positives = 262/470 (56%), Gaps = 5/470 (1%)
 Frame = -2

Query  1899  TKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIK  1720
             T +Y + +LY K+   G    S    L+ ++++    +  E+ R +  LR+RK +S A++
Sbjct  33    TSRYGKISLYNKISPLGDPNTSVVPELDNWVQNGNKVWVAELQRIIHDLRKRKRFSQALE  92

Query  1719  LSETMEKRGMNK-TTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCK  1543
             +SE M K+G+   + ++  + +DL+ + +G  +AE+YF +L    K   TYGALLNCY +
Sbjct  93    ISEWMSKKGICAFSPTEHAVQLDLIGRVRGFLSAESYFNSLQNHDKTDKTYGALLNCYVR  152

Query  1542  ELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFT  1363
             +  T+K+ + ++KMKE+    + + YN +M LYT  GQ EK+P ++ E+K+  + PD+F+
Sbjct  153   QRQTDKSLSHLQKMKEMGFASSPLTYNDIMCLYTNVGQHEKVPDVLTEMKQSHVYPDNFS  212

Query  1362  YNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkel  1183
             Y I + + AA  DI G+E+V+ EM+R   +  DW TY+  A+ Y  AGL DKA +ALK+ 
Sbjct  213   YRICINSYAAQSDIQGMEKVLKEMERQPHIVMDWNTYAVAANFYIKAGLPDKAIEALKKS  272

Query  1182  ekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDM  1003
             E++   R+   Y  LI+LY  +GN  EV R+W   + A  +  N  Y+ M++ LV L ++
Sbjct  273   EERLDKRDGLGYNHLISLYASLGNKAEVLRLWSLEKSACKRNINRDYITMLESLVRLGEL  332

Query  1002  PGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIF  823
               AEK  +EWES    YD RV N +I  Y+++GL +KA+ + K     G      +W   
Sbjct  333   EEAEKVLREWESSGNCYDFRVPNIVIIGYSEKGLFEKAEAMLKELMEKGKITTPDSWGTV  392

Query  822   LDYYLKNGEISSAVDCIEKAITTGRGD-GQKWVPSPVIVGELMRHFETKKDVEGAERVLG  646
                Y+  GE+  AV+C++ AI+    + G+K  P+  ++  ++     K  VE  E  +G
Sbjct  393   ASGYMDEGEMEKAVECMKAAISLHVNNKGRK--PNSRVIAGILSWLGDKGRVEDVEAFVG  450

Query  645   NLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
             +L+     +   +  +LI     AGK    +   +K +     EE KK+L
Sbjct  451   SLRIVIP-MNRRMYHTLIMANIRAGKEVDGLLASMKADKIVEDEETKKIL  499



>gb|EYU40343.1| hypothetical protein MIMGU_mgv1a004109mg [Erythranthe guttata]
Length=543

 Score =   254 bits (649),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 147/399 (37%), Positives = 233/399 (58%), Gaps = 6/399 (2%)
 Frame = -2

Query  1821  LNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETMEKRG--MNKTTSDQGIHVDLV  1648
             LN+     K   KWE+ R VK LR+ K +  A+++ + M  R      TTSD  I +DL+
Sbjct  99    LNQVENDDKRLTKWELCRIVKELRKFKRFKYALEVYDWMNNRAERYRITTSDTAIQLDLI  158

Query  1647  AKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMP  1468
             AK  GIA+AE YF+ LP+  K+   YG+LLN Y +  M EK+E+L++ M+       ++P
Sbjct  159   AKVHGIASAEHYFLKLPDALKDKRIYGSLLNVYARSRMREKSESLMDIMRSKGYASHALP  218

Query  1467  YNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMK  1288
             +N +MTLY      EK+ ++I E+KE +I  D +TYNIW+ +  A G +  +E V + M 
Sbjct  219   FNVMMTLYMNLKDHEKLESLISELKEKNIALDIYTYNIWLSSCGAKGAVEKMEEVFELMS  278

Query  1287  RDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNL  1108
              D  +  +WTT+S +A++Y   G  +KAE  LK++E + T R+   Y +LI+LYG   N 
Sbjct  279   ADPAINPNWTTFSTMATVYIKLGHLEKAEDCLKKIESRVTGRDRLPYHYLISLYGSAHNK  338

Query  1107  VEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANAL  928
              EVYR+W   + +F    N+ Y  +I  L   ++M GAEK + EW S ++ +D R+ N L
Sbjct  339   DEVYRVWNLYKASFFNIPNLGYHTVISALARTDEMEGAEKIYDEWLSVKSFFDPRITNIL  398

Query  927   IGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGR  748
             + +Y ++GL +KA+ +  +   +G KPN+ TWEIF + +++N  IS A+ C+  A     
Sbjct  399   LSSYVRKGLSQKAETMFGQMIEAGGKPNSMTWEIFAEDHIRNTRISEALSCLNSATL---  455

Query  747   GDGQK-WVPSPVIVGELMRHFETKKDVEGAERVLGNLKK  634
              DG K W P+P  V  +++  E + DV   + +L  L++
Sbjct  456   ADGSKNWRPNPSNVSSILKICEQQADVASKDALLAILRR  494



>gb|KHN03794.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=414

 Score =   249 bits (637),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 140/406 (34%), Positives = 235/406 (58%), Gaps = 7/406 (2%)
 Frame = -2

Query  1701  KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKA  1522
             ++ M     D  +H+DL+ K +G+ +AE +F +LP+  +   T  ALL+ Y +  + +KA
Sbjct  4     QKDMKLVQGDYAVHLDLITKVRGLNSAEKFFEDLPDRMRGKQTCSALLHAYVQNNLVDKA  63

Query  1521  EALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRA  1342
             EAL+ KM E +L +  +PYN +++LY   G+ EK+P IIQE+K  +  PD  T+N+W+ A
Sbjct  64    EALMLKMSECDLLINPLPYNHMISLYISNGKLEKVPKIIQELK-MNTSPDIVTFNLWLAA  122

Query  1341  LAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTPR  1162
              A+  D+   ERV+ E+K+  ++  DW TYS L ++Y      +KA   +KE+E + + +
Sbjct  123   CASQNDVETAERVLLELKK-AKIDPDWVTYSTLTNLYIKNASLEKAGATVKEMENRTSRK  181

Query  1161  NLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCF  982
                AY  L++L+  +GN  +V RIW  ++ +F K  +  Y+ MI  L+ L D  GAE  +
Sbjct  182   TRVAYSSLLSLHTNMGNKDDVNRIWEKMKASFRKMNDNEYICMISSLLKLGDFAGAEDLY  241

Query  981   KEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKN  802
             +EWES   T D+RV+N L+G+Y  Q  ++ A++   +  + G  P   TWE+F   YLK 
Sbjct  242   REWESVSGTNDVRVSNILLGSYINQDQMEMAEDFCNQIVQKGVIPCYTTWELFTWGYLKR  301

Query  801   GEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDH  622
              ++   +D   KAI++      KW P   +V E  +  E +   +GAE++L  L+ +  H
Sbjct  302   KDVEKFLDYFSKAISS----VTKWSPDQRLVQEAFKIIEEQAHTKGAEQLLVILRNA-GH  356

Query  621   LGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVIS  484
             +   +    ++TYA AGK   ++  R++ +N +L EE ++LLD+ S
Sbjct  357   VNTNIYNLFLKTYATAGKMPMIVAERMRKDNVKLDEETRRLLDLTS  402



>ref|XP_010921943.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Elaeis guineensis]
Length=521

 Score =   253 bits (646),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 165/467 (35%), Positives = 263/467 (56%), Gaps = 8/467 (2%)
 Frame = -2

Query  1881  EALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETME  1702
             + L R+LL     + SA   L ++ +  KS  K+++ R V+ LR+ K +  A+++ E M 
Sbjct  50    DTLGRRLLSLIYPKRSAVVVLRKWAEEGKSVQKYQLNRVVRELRKYKRFKHALEICEWMT  109

Query  1701  KR-GMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEK  1525
              +  +     D  +H+DL+AK +G+A+AE +F +LPE  K   T  ALL+ Y +  ++ K
Sbjct  110   TQPNIKLLPGDYAVHLDLIAKVRGLASAEKFFEDLPERMKVQSTCTALLHTYVQNELSNK  169

Query  1524  AEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMR  1345
             AE+L+E+M    L    +PYN ++TLY   G+ +K+P +I+E K  +  PD  TYN+W+ 
Sbjct  170   AESLMEEMSTHGLLRCPLPYNHMLTLYISKGELDKVPKLIKESKR-NTKPDVVTYNLWLT  228

Query  1344  ALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkelekKNTP  1165
             A A   D+ G E V+ EMK++ ++  DW TYS LASIY  A  S+KA+KAL E+EK+ + 
Sbjct  229   ACAKKDDVMGAEEVLLEMKKE-KITTDWITYSMLASIYIKAACSEKAKKALAEMEKRASR  287

Query  1164  RNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKC  985
             +   AY  LI+L+  + +   VYR W  ++  F K +++ Y  ++  L  L D+  AE  
Sbjct  288   KERAAYCSLISLHASLLDNENVYRTWNKMKSTFRKMSDVEYKCILSSLTKLGDIEEAESI  347

Query  984   FKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLK  805
             + EWE    T D RV N L+G Y K  +  KA+   +   + G KP+  TWE+    YL 
Sbjct  348   YSEWEIVSGTRDSRVPNILLGYYIKNDMTDKAENFYEHMLQRGVKPSYTTWELLAWGYLS  407

Query  804   NGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSED  625
                +   +DC++KA ++     +KW P+  IV  +    E   DVEGAE+ L  L+    
Sbjct  408   KKRVDKVLDCLKKAFSS----LEKWEPNVGIVRAVFTKLEEMGDVEGAEQFLVMLRDV-G  462

Query  624   HLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLLDVIS  484
             ++  E+  SL++TYA AGK   ++  R+K +N ++ E    LL + S
Sbjct  463   YVTTEIYNSLLQTYAKAGKMPLIVAERMKKDNVQMDEGTHHLLRLTS  509



>ref|XP_003632962.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial [Vitis vinifera]
Length=506

 Score =   252 bits (643),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 156/470 (33%), Positives = 261/470 (56%), Gaps = 5/470 (1%)
 Frame = -2

Query  1899  TKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIK  1720
             T +Y + +LY K+   G    S    L+ ++++    +  E+ R +  LR+RK +S A++
Sbjct  33    TSRYGKISLYNKISPLGDPNTSVVPELDNWVQNGNKVWVAELQRIIHDLRKRKRFSQALE  92

Query  1719  LSETMEKRGMNK-TTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCK  1543
             +SE M K+G+   + ++  + +DL+ + +G  +AE+YF +L    K   TYGALLNCY +
Sbjct  93    ISEWMSKKGICAFSPTEHAVQLDLIGRVRGFLSAESYFNSLQNHDKTDKTYGALLNCYVR  152

Query  1542  ELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFT  1363
             +  T+K+ + ++KMKE+    + + YN +M LYT  GQ EK+P ++ E+K+ ++ PD+F+
Sbjct  153   QRQTDKSLSHLQKMKEMGFASSPLTYNDIMCLYTNVGQHEKVPDVLTEMKQSNVYPDNFS  212

Query  1362  YNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDkaekalkel  1183
             Y I + +  A  DI G+E V+ EM+R   +  DW TY+  A+ Y  AGL DKA +ALK+ 
Sbjct  213   YRICINSYGAQSDIQGMENVLKEMERQPHIVMDWNTYAVAANFYIKAGLPDKAIEALKKS  272

Query  1182  ekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDM  1003
             E++   R+   Y  LI+LY  +GN  EV R+W   + A  +  N  Y+ M++ LV L ++
Sbjct  273   EERLDKRDGLGYNHLISLYASLGNKAEVLRLWSLEKSACKRNINRDYITMLESLVRLGEL  332

Query  1002  PGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIF  823
               AEK  +EWES    YD RV N +I  Y+++GL +KA+ + K     G      +W   
Sbjct  333   EEAEKVLREWESSGNCYDFRVPNIVIIGYSEKGLFEKAEAMLKELMEKGKITTPNSWGTV  392

Query  822   LDYYLKNGEISSAVDCIEKAITTGRGD-GQKWVPSPVIVGELMRHFETKKDVEGAERVLG  646
                Y+  GE+  AV+C++ AI+    + G+K  P+  ++  ++     K  VE  E  +G
Sbjct  393   ASGYMDEGEMEKAVECMKAAISLHVNNKGRK--PNSRVIAGILSWLGDKGRVEDVEAFVG  450

Query  645   NLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
             +L+     +   +  +LI     AGK    +   +K +     EE KK+L
Sbjct  451   SLRIVIP-MNRRMYHTLIMANIRAGKEVDGLLASMKADKIVEDEETKKIL  499



>ref|XP_004495206.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Cicer arietinum]
Length=510

 Score =   251 bits (642),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 144/445 (32%), Positives = 252/445 (57%), Gaps = 13/445 (3%)
 Frame = -2

Query  1800  HKSAYKWEVGRSVKLLRQRKLYSPAIKLSETME-KRGMNKTTSDQGIHVDLVAKSKGIAA  1624
             H    K+++ R ++ LR+ K Y  A+++ E M+ +  +     D  +H+DL+ K +G+ +
Sbjct  61    HVLPRKYQLNRMIRELRKNKRYKHALEVCEWMKLQNDIKLVEGDYAVHLDLITKVRGLNS  120

Query  1623  AEAYFINLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLY  1444
             AE +F +LP+  +   T  ALL+ Y +  + +KAEA++ KM E     + +PYN +M+LY
Sbjct  121   AEKFFEDLPDKMRGQPTCTALLHAYVQNNLADKAEAIMLKMSECGFLQSPIPYNRMMSLY  180

Query  1443  TRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAED  1264
                G+ EK+P + +E+K  +  PD  T+N+ + A A++ D+   ERV+ E+K+  +V  D
Sbjct  181   ISNGKLEKVPKLFEELK-MNTSPDIVTFNLLLTACASVNDVETAERVLLELKK-AKVDPD  238

Query  1263  WTTYSNLASIYA-DAGLSDkaekalkelekKNTPRNL----TAYQFLITLYGRIGNLVEV  1099
             W T+S L ++Y  +A + D   +      K+   R       AY  L++L+  +GN+ EV
Sbjct  239   WVTFSTLTNLYIRNASIKDDCLEKAASTLKEMEKRTCRKTRVAYSSLLSLHTNMGNVDEV  298

Query  1098  YRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGA  919
              RIW  ++  F K  +  Y+ MI  L+ L D  G E  +KEWES   T D+RV+N L+ +
Sbjct  299   NRIWNKMKGCFRKMNDEEYICMISSLLKLGDFAGVENLYKEWESVSGTNDVRVSNLLLTS  358

Query  918   YAKQGllkkakelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDG  739
             Y  +GL++ A+    + ++ G   +  TWE+F   YLK  +++  +    KAI++ +   
Sbjct  359   YVDRGLMEMAEIFCNQLEQKGVSLSYTTWEVFTMGYLKKKDVNKFLYYFRKAISSVK---  415

Query  738   QKWVPSPVIVGELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTST  559
              KW+P+ ++V E     + +  +EGAE++L  L+ +  H+   +    ++TYAAAGK   
Sbjct  416   -KWIPNDMLVQEAFTVIQEQSHIEGAEQLLAILRDA-GHVNTNVYNLFLKTYAAAGKMPL  473

Query  558   VMRRRVKMENAELSEEAKKLLDVIS  484
             ++  R+K +N +L EE  +LLD+ S
Sbjct  474   IVTERMKKDNVQLDEETHRLLDLTS  498



>ref|XP_008655858.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At4g01990, mitochondrial-like [Zea mays]
Length=515

 Score =   251 bits (642),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 157/467 (34%), Positives = 267/467 (57%), Gaps = 16/467 (3%)
 Frame = -2

Query  1875  LYRKLLKEGGL-ENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQRKLYSPAIKLSETM-E  1702
             LYR+L   G   E S  + LN++++   +    ++ + VK LR+ K ++ A++L + M  
Sbjct  50    LYRRLSALGSAGEGSVSRVLNKWVREGGATRSDDLVKHVKELRKYKRHAHALELMDWMVN  109

Query  1701  KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYGALLNCYCKELMTEKA  1522
              RGMN + ++  I ++L+ K +G+ AAE YF NLP+ +KNH TYG+LL+CYC   M EKA
Sbjct  110   ARGMNMSHTNHAIRLELIYKVRGLEAAENYFANLPDPAKNHRTYGSLLSCYCSAKMEEKA  169

Query  1521  EALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKECDIMPDSFTYNIWMRA  1342
               L  +M EL +  +++P N+LM+LY +  Q  K+ ++ +E+K  ++ P+S T  I M +
Sbjct  170   TNLYRQMDELGIWSSTLPINNLMSLYMKLDQYRKVVSLFEEMKLKNVKPNSLTCCILMTS  229

Query  1341  LAALGDISGVERVIDEMKRDGRVAEDWT----TYSNLASIYADAG-LSDkaekalkelek  1177
              AAL  I  +E ++ EM     V +D T        LA+ Y +AG          K    
Sbjct  230   YAALNKIDDIEELLKEM-----VEKDVTLGMRLLQALAASYVNAGEFGKAXSALKKVEGL  284

Query  1176  KNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMIQVLVNLNDMPG  997
              +   +   + FL++LY  +GNL EV R+W  ++  F K  N SYL M+  L  LND+  
Sbjct  285   ISAHDDRQPFDFLLSLYASLGNLSEVNRVWNVIKSKFSKVTNTSYLGMLHALYKLNDIDR  344

Query  996   AEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAKPNAKTWEIFLD  817
              ++ + EWES   T+D+++ N +I ++ K G+ ++A+ L ++ + +GA+ + KT E+FLD
Sbjct  345   MKQIYMEWESNYETFDVKLTNMMIRSHLKVGMTEEAEMLVEKVKENGAEFDTKTCELFLD  404

Query  816   YYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDVEGAERVLGNLK  637
             +Y+   +++SA++ +E  +T      +K     +   +  ++FE  KD +GAER   N  
Sbjct  405   HYMGTEDMNSALNWLEN-MTKLSKKAEKLDQDRIY--KFQKYFEEHKDADGAER-FCNCL  460

Query  636   KSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMENAELSEEAKKLL  496
             ++   +  +  ESL+RTY AAGK S  +R+++K +  E+  +  KLL
Sbjct  461   RTLGCIDGKAYESLLRTYLAAGKKSCSLRQQIKNDKVEICYDIGKLL  507



>ref|XP_007144631.1| hypothetical protein PHAVU_007G171700g [Phaseolus vulgaris]
 gb|ESW16625.1| hypothetical protein PHAVU_007G171700g [Phaseolus vulgaris]
Length=511

 Score =   251 bits (641),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 143/435 (33%), Positives = 251/435 (58%), Gaps = 8/435 (2%)
 Frame = -2

Query  1785  KWEVGRSVKLLRQRKLYSPAIKLSETME-KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYF  1609
             K+++ R V+ LR+ K Y  A+++ E M  ++ +     D  +H+DL+ K +G+ +AE +F
Sbjct  72    KYQLNRIVRELRREKRYKHALEVCEWMTLQKDIKLVPGDYAVHLDLITKVRGLESAENFF  131

Query  1608  INLPETSKNHFTYGALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQ  1429
              +LP+  +   T  ALL+ Y +  + +KAEAL+ KM E +     +PYN ++TLY   G+
Sbjct  132   EDLPDRMRGQQTCSALLHSYVQNNLVDKAEALMLKMSECDFLRCPLPYNHMLTLYISNGK  191

Query  1428  PEKIPAIIQEIKECDIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYS  1249
              EK+P IIQE+K  +  PD  T+N+W+ A A+  D+   ERV+ E+K+  ++  DW TYS
Sbjct  192   LEKVPKIIQELK-MNTSPDVVTFNLWLTACASQNDVETAERVLLELKK-TKIDPDWVTYS  249

Query  1248  NLASIYADAGLSDkaekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLA  1069
              L ++Y  +   +KA   +KE+E + + +   A+  L++L+  +GN  +V RIW+ ++ +
Sbjct  250   TLTNLYIKSASIEKAGSTVKEMENRTSRKTRVAFSSLLSLHTNMGNKDDVNRIWKKMKAS  309

Query  1068  FPKTANISYLNMIQVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkka  889
             F K  +  Y+ +I  +V L D+ GAE  ++EWES   T D+RV+N L+ +Y  Q  ++ A
Sbjct  310   FRKMNDNEYICIISSMVKLGDIAGAEDLYREWESVSGTNDVRVSNILLASYINQDQMELA  369

Query  888   kelrkrAQRSGAKPNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIV  709
             +    +  + G  P   TWE+F   YLK  ++   +D   KAI++      KW     +V
Sbjct  370   ESFCNQIVQKGVIPCYTTWELFTWGYLKRKDVEKFLDYFSKAISS----VNKWRLDQRLV  425

Query  708   GELMRHFETKKDVEGAERVLGNLKKSEDHLGAELLESLIRTYAAAGKTSTVMRRRVKMEN  529
              E  +  E +   +GA+++L  L+ +  H+  ++    ++ YA AGK   ++  R++ +N
Sbjct  426   QEAFKIIEKQAHTQGADQLLVILRNA-GHVNTDIYNLFLKVYATAGKMPLIVAERMRKDN  484

Query  528   AELSEEAKKLLDVIS  484
              +L EE ++LLD+ S
Sbjct  485   VKLDEETQRLLDLTS  499



>ref|XP_004155477.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Cucumis sativus]
Length=493

 Score =   250 bits (639),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 146/434 (34%), Positives = 252/434 (58%), Gaps = 10/434 (2%)
 Frame = -2

Query  1923  TKNIGKRSTKKYLEEALYRKLLKEGGLENSAGKNLNEFLKSHKSAYKWEVGRSVKLLRQR  1744
             TK++   ST    E+ L+R++ + G    S  + L+++++  +   + ++   +K LR+ 
Sbjct  26    TKSLPSPST----EDTLFRRVYRAGDPRTSIVRVLDQWVEEGRQVKQSDLQTLIKQLRKF  81

Query  1743  KLYSPAIKLSETME-KRGMNKTTSDQGIHVDLVAKSKGIAAAEAYFINLPETSKNHFTYG  1567
               ++ A++L E +  +R    +T D  + + L++K++G+  AE YF ++ E+S++H  YG
Sbjct  82    GRFNQALQLCEWVRNERNQCLSTGDIAVELHLISKARGLEQAEKYFSSIGESSRDHKVYG  141

Query  1566  ALLNCYCKELMTEKAEALIEKMKELNLTLTSMPYNSLMTLYTRTGQPEKIPAIIQEIKEC  1387
             ALL+CY +    +KAEA+++KM+E+    T + YN+++ LY   G+ EK+  +++E++E 
Sbjct  142   ALLHCYVENKNLKKAEAIMQKMREVGFMKTPLSYNAMLNLYAHLGKHEKLAELLKEMEEM  201

Query  1386  DIMPDSFTYNIWMRALAALGDISGVERVIDEMKRDGRVAEDWTTYSNLASIYADAGLSDk  1207
              I PD FTYNI M A AA  DI+ +E+++ +M+ D  VA DW TY  + + Y  AGLS+ 
Sbjct  202   GIGPDRFTYNIRMNAYAAASDITNMEKLLSKMEADPLVATDWHTYFVVGNGYFKAGLSEN  261

Query  1206  a-ekalkelekKNTPRNLTAYQFLITLYGRIGNLVEVYRIWRSLRLAFPKTANISYLNMI  1030
             +     K  +     +   AYQ+L+TLY  IGN  EVYR+W +L     K  N  YL +I
Sbjct  262   SILMLKKAEQFIGDKQKWLAYQYLMTLYAAIGNKDEVYRVW-NLYTNLRKRFNSGYLCII  320

Query  1029  QVLVNLNDMPGAEKCFKEWESGQTTYDIRVANALIGAYAKQGllkkakelrkrAQRSGAK  850
               L+ L+D+ GAE+  KEWESG T++D R+ N +I +Y  +G + KA+    R   +G +
Sbjct  321   SSLMKLDDIDGAERILKEWESGDTSFDFRIPNMMINSYCMKGFVDKAEAYINRLIETGKE  380

Query  849   PNAKTWEIFLDYYLKNGEISSAVDCIEKAITTGRGDGQKWVPSPVIVGELMRHFETKKDV  670
             P A TW++    Y  NG  +   + ++KAI+        W P   I+   + + +T ++V
Sbjct  381   PEANTWDLLASGYHSNGLTNKVAETLKKAISVS---PPHWKPKYHILAACLEYLKTNENV  437

Query  669   EGAERVLGNLKKSE  628
             + AE ++G L K +
Sbjct  438   DLAEEIIGLLCKRD  451



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6358791405915