BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27942_g1_i1 len=1756 path=[1734:0-1755]

Length=1756
                                                                      Score     E

ref|XP_011098060.1|  PREDICTED: heat stress transcription factor ...    281   9e-85   
ref|XP_009611948.1|  PREDICTED: heat stress transcription factor ...    270   7e-80   
ref|XP_009769104.1|  PREDICTED: heat stress transcription factor ...    267   8e-79   
gb|EYU30742.1|  hypothetical protein MIMGU_mgv1a020913mg                265   9e-79   
emb|CDP18749.1|  unnamed protein product                                263   7e-78   
ref|XP_007048764.1|  Winged-helix DNA-binding transcription facto...    263   4e-77   
ref|XP_002278037.1|  PREDICTED: heat stress transcription factor ...    262   9e-77   Vitis vinifera
ref|XP_011082962.1|  PREDICTED: heat stress transcription factor ...    256   2e-74   
ref|XP_006449558.1|  hypothetical protein CICLE_v10015472mg             252   1e-73   
ref|XP_009352719.1|  PREDICTED: heat stress transcription factor ...    252   3e-73   
ref|XP_006467594.1|  PREDICTED: heat stress transcription factor ...    251   3e-73   
emb|CBI22041.3|  unnamed protein product                                248   7e-73   
ref|XP_010916598.1|  PREDICTED: heat stress transcription factor ...    251   7e-73   
ref|XP_006348918.1|  PREDICTED: heat stress transcription factor ...    251   8e-73   
gb|KDP39800.1|  hypothetical protein JCGZ_03936                         249   4e-72   
emb|CAN80282.1|  hypothetical protein VITISV_017449                     248   6e-72   Vitis vinifera
ref|XP_002522270.1|  Heat shock factor protein, putative                246   2e-71   Ricinus communis
ref|XP_010529215.1|  PREDICTED: heat stress transcription factor ...    246   3e-71   
ref|XP_009365270.1|  PREDICTED: heat stress transcription factor ...    246   5e-71   
ref|XP_004243245.1|  PREDICTED: heat stress transcription factor ...    244   1e-70   
ref|XP_004303209.1|  PREDICTED: heat stress transcription factor ...    244   3e-70   
ref|XP_008364170.1|  PREDICTED: heat stress transcription factor ...    242   1e-69   
gb|KDP21146.1|  hypothetical protein JCGZ_21617                         242   1e-69   
ref|XP_009351725.1|  PREDICTED: heat stress transcription factor ...    242   1e-69   
gb|ADL36729.1|  HSF domain class transcription factor                   242   1e-69   
ref|XP_006448027.1|  hypothetical protein CICLE_v10015413mg             240   5e-69   
gb|AGJ83756.1|  heat stress transcription factor A-4a-like protein      240   6e-69   
ref|XP_007213840.1|  hypothetical protein PRUPE_ppa006534mg             240   7e-69   
ref|XP_002316809.1|  heat shock transcription factor family protein     239   9e-69   Populus trichocarpa [western balsam poplar]
ref|XP_002525885.1|  Heat shock factor protein, putative                241   1e-68   Ricinus communis
gb|KHG25080.1|  Heat stress transcription factor A-4a -like protein     239   1e-68   
ref|XP_008381180.1|  PREDICTED: heat stress transcription factor ...    239   1e-68   
ref|XP_008383593.1|  PREDICTED: heat stress transcription factor ...    240   1e-68   
ref|XP_011039379.1|  PREDICTED: heat stress transcription factor ...    238   3e-68   
ref|XP_002321069.1|  hypothetical protein POPTR_0014s13780g             239   3e-68   Populus trichocarpa [western balsam poplar]
ref|XP_010242159.1|  PREDICTED: heat stress transcription factor ...    239   3e-68   
ref|XP_010518819.1|  PREDICTED: heat stress transcription factor ...    238   3e-68   
ref|XP_010665682.1|  PREDICTED: heat stress transcription factor ...    238   4e-68   
gb|KDO58614.1|  hypothetical protein CISIN_1g015162mg                   238   4e-68   
ref|XP_011033721.1|  PREDICTED: heat stress transcription factor ...    238   6e-68   
ref|XP_008225237.1|  PREDICTED: heat stress transcription factor ...    237   9e-68   
ref|XP_002305052.2|  hypothetical protein POPTR_0004s06090g             236   1e-67   Populus trichocarpa [western balsam poplar]
ref|XP_009370956.1|  PREDICTED: heat stress transcription factor ...    237   2e-67   
ref|NP_001281032.1|  heat stress transcription factor A-4b-like         236   3e-67   
ref|XP_008228879.1|  PREDICTED: heat stress transcription factor ...    236   4e-67   
ref|XP_008342767.1|  PREDICTED: heat stress transcription factor ...    236   4e-67   
ref|XP_007025290.1|  HSF domain class transcription factor              234   1e-66   
ref|XP_009354248.1|  PREDICTED: heat stress transcription factor ...    234   1e-66   
ref|XP_007216966.1|  hypothetical protein PRUPE_ppa015468mg             233   2e-66   
ref|XP_010248394.1|  PREDICTED: heat stress transcription factor ...    234   3e-66   
ref|XP_006358092.1|  PREDICTED: heat stress transcription factor ...    233   3e-66   
ref|XP_009592186.1|  PREDICTED: heat stress transcription factor ...    233   3e-66   
ref|XP_010655549.1|  PREDICTED: heat stress transcription factor ...    233   5e-66   
gb|KHN06431.1|  Heat stress transcription factor A-4a                   232   5e-66   
ref|XP_003524978.1|  PREDICTED: heat stress transcription factor ...    232   6e-66   
ref|XP_009796383.1|  PREDICTED: heat stress transcription factor ...    232   6e-66   
ref|XP_010109197.1|  Heat stress transcription factor A-4b              232   8e-66   
ref|XP_008776668.1|  PREDICTED: heat stress transcription factor ...    233   1e-65   
ref|XP_003546045.1|  PREDICTED: heat stress transcription factor ...    230   2e-65   
ref|XP_010057144.1|  PREDICTED: heat stress transcription factor ...    231   3e-65   
ref|XP_004233050.1|  PREDICTED: heat stress transcription factor ...    229   5e-65   
ref|XP_006585179.1|  PREDICTED: heat stress transcription factor ...    228   1e-64   
ref|XP_010441677.1|  PREDICTED: heat stress transcription factor ...    226   2e-64   
gb|AAL12248.1|  heat shock transcription factor                         227   4e-64   Phaseolus acutifolius
ref|XP_010441676.1|  PREDICTED: heat stress transcription factor ...    226   5e-64   
ref|XP_007159491.1|  hypothetical protein PHAVU_002G242000g             226   6e-64   
gb|KHG20424.1|  Heat stress transcription factor A-4a -like protein     224   2e-63   
ref|XP_010052968.1|  PREDICTED: heat stress transcription factor ...    226   2e-63   
ref|XP_004309634.1|  PREDICTED: heat stress transcription factor ...    227   4e-63   
ref|XP_011101446.1|  PREDICTED: heat stress transcription factor ...    225   4e-63   
ref|XP_003542993.1|  PREDICTED: heat stress transcription factor ...    224   4e-63   
gb|KHN47390.1|  Heat stress transcription factor A-4a                   224   4e-63   
gb|AHZ44767.1|  heat shock factor A4c                                   225   5e-63   
emb|CDO96874.1|  unnamed protein product                                223   8e-63   
ref|XP_009590974.1|  PREDICTED: heat stress transcription factor ...    223   2e-62   
ref|XP_004485934.1|  PREDICTED: heat stress transcription factor ...    222   2e-62   
ref|XP_003629847.1|  Heat stress transcription factor A-4a              223   2e-62   
dbj|BAJ93519.1|  predicted protein                                      223   3e-62   
gb|AHZ44768.1|  heat shock factor A4e                                   223   3e-62   
ref|XP_002440121.1|  hypothetical protein SORBIDRAFT_09g026440          223   7e-62   Sorghum bicolor [broomcorn]
ref|XP_007147994.1|  hypothetical protein PHAVU_006G171700g             220   9e-62   
ref|XP_008656477.1|  PREDICTED: heat stress transcription factor ...    222   1e-61   
emb|CBI30730.3|  unnamed protein product                                218   2e-61   
ref|XP_010317423.1|  PREDICTED: heat stress transcription factor ...    219   2e-61   
gb|AFW82556.1|  hypothetical protein ZEAMMB73_407508                    221   3e-61   
gb|AFK44257.1|  unknown                                                 219   3e-61   
ref|XP_006398255.1|  hypothetical protein EUTSA_v10000950mg             217   4e-61   
gb|EMT25826.1|  Heat stress transcription factor A-4d                   222   5e-61   
ref|XP_011010913.1|  PREDICTED: heat stress transcription factor ...    219   5e-61   
ref|XP_006356094.1|  PREDICTED: heat stress transcription factor ...    218   1e-60   
ref|XP_008792312.1|  PREDICTED: heat stress transcription factor ...    219   1e-60   
ref|XP_004143229.1|  PREDICTED: heat stress transcription factor ...    214   2e-60   
ref|XP_004147389.1|  PREDICTED: heat stress transcription factor ...    218   2e-60   
ref|XP_004162154.1|  PREDICTED: LOW QUALITY PROTEIN: heat stress ...    214   2e-60   
ref|XP_009406764.1|  PREDICTED: heat stress transcription factor ...    218   3e-60   
ref|XP_009785427.1|  PREDICTED: heat stress transcription factor ...    216   4e-60   
gb|EYU28124.1|  hypothetical protein MIMGU_mgv1a020225mg                216   6e-60   
ref|XP_008443546.1|  PREDICTED: heat stress transcription factor ...    216   7e-60   
ref|XP_004163351.1|  PREDICTED: heat stress transcription factor ...    215   1e-59   
ref|XP_004134595.1|  PREDICTED: heat stress transcription factor ...    215   1e-59   
ref|XP_004161196.1|  PREDICTED: heat stress transcription factor ...    215   2e-59   
ref|XP_004961415.1|  PREDICTED: heat stress transcription factor ...    216   2e-59   
ref|XP_010924707.1|  PREDICTED: heat stress transcription factor ...    214   5e-59   
ref|XP_009415179.1|  PREDICTED: heat stress transcription factor ...    213   8e-59   
ref|XP_006644706.1|  PREDICTED: heat stress transcription factor ...    214   9e-59   
ref|XP_006654692.1|  PREDICTED: heat stress transcription factor ...    213   1e-58   
ref|XP_008456389.1|  PREDICTED: heat stress transcription factor ...    209   1e-58   
ref|XP_010481538.1|  PREDICTED: heat stress transcription factor ...    210   2e-58   
ref|NP_199383.1|  heat stress transcription factor A-4c                 210   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280755.1|  hypothetical protein CARUB_v10026722mg             209   6e-58   
gb|EMS46878.1|  Heat stress transcription factor A-4d                   210   7e-58   
ref|XP_008649894.1|  PREDICTED: heat stress transcription factor ...    211   1e-57   
ref|XP_004969950.1|  PREDICTED: heat stress transcription factor ...    210   2e-57   
ref|XP_010088011.1|  Heat stress transcription factor A-4a              209   3e-57   
emb|CDY09259.1|  BnaC03g62890D                                          207   5e-57   
gb|ACA58566.1|  heat shock transcription factor                         209   5e-57   Cenchrus americanus [bulrush millet]
ref|XP_003568041.1|  PREDICTED: LOW QUALITY PROTEIN: heat stress ...    208   7e-57   
ref|XP_008649893.1|  PREDICTED: heat stress transcription factor ...    211   7e-57   
ref|XP_008439712.1|  PREDICTED: heat stress transcription factor ...    209   8e-57   
ref|XP_002865228.1|  AT-HSFA4C                                          205   1e-56   
ref|XP_006854048.1|  hypothetical protein AMTR_s00048p00075850          208   3e-56   
gb|EEC71476.1|  hypothetical protein OsI_03736                          206   6e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_010494690.1|  PREDICTED: heat stress transcription factor ...    203   8e-56   
ref|XP_003569811.1|  PREDICTED: heat stress transcription factor ...    205   9e-56   
ref|XP_009415941.1|  PREDICTED: heat stress transcription factor A-5    205   2e-55   
emb|CAM32756.1|  heat shock factor A4d                                  205   2e-55   Oryza sativa Indica Group [Indian rice]
emb|CCO62016.1|  HSFA4a protein                                         203   2e-55   
gb|EAY98789.1|  hypothetical protein OsI_20732                          205   2e-55   Oryza sativa Indica Group [Indian rice]
ref|NP_001056127.1|  Os05g0530400                                       205   2e-55   Oryza sativa Japonica Group [Japonica rice]
emb|CDY13041.1|  BnaA09g17760D                                          201   2e-55   
ref|XP_010449453.1|  PREDICTED: heat stress transcription factor ...    203   3e-55   
ref|NP_001044247.1|  Os01g0749300                                       204   3e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002456359.1|  hypothetical protein SORBIDRAFT_03g034630          204   4e-55   Sorghum bicolor [broomcorn]
ref|XP_009108396.1|  PREDICTED: heat stress transcription factor ...    201   5e-55   
gb|ACN93796.2|  HsfA4a                                                  203   6e-55   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009392447.1|  PREDICTED: heat stress transcription factor ...    203   7e-55   
ref|XP_008657226.1|  PREDICTED: heat stress transcription factor ...    203   7e-55   
ref|XP_010434484.1|  PREDICTED: heat stress transcription factor ...    202   8e-55   
dbj|BAK02319.1|  predicted protein                                      202   1e-54   
ref|XP_009114395.1|  PREDICTED: heat stress transcription factor ...    199   1e-54   
emb|CDX76506.1|  BnaA08g08940D                                          200   2e-54   
ref|XP_003531216.1|  PREDICTED: heat stress transcription factor ...    201   8e-54   
dbj|BAB71739.1|  spl7 protein                                           200   1e-53   Oryza sativa Japonica Group [Japonica rice]
emb|CDY23108.1|  BnaC09g18620D                                          197   2e-53   
ref|XP_009108394.1|  PREDICTED: heat stress transcription factor ...    197   3e-53   
gb|AAF37579.1|AF235958_1  heat shock transcription factor               197   4e-53   Medicago sativa [alfalfa]
ref|XP_009346396.1|  PREDICTED: heat stress transcription factor ...    200   4e-53   
ref|XP_009340197.1|  PREDICTED: heat stress transcription factor ...    200   4e-53   
ref|XP_006283847.1|  hypothetical protein CARUB_v10004953mg             197   6e-53   
emb|CAA58117.1|  heat shock factor                                      194   9e-53   Zea mays [maize]
ref|XP_009132283.1|  PREDICTED: heat stress transcription factor ...    196   1e-52   
emb|CBH32510.1|  heat shock factor, putative, expressed                 197   1e-52   
gb|EPS63036.1|  hypothetical protein M569_11750                         192   1e-52   
ref|XP_004298212.1|  PREDICTED: heat stress transcription factor ...    197   2e-52   
ref|XP_006349912.1|  PREDICTED: heat stress transcription factor ...    197   2e-52   
ref|XP_009612973.1|  PREDICTED: heat stress transcription factor A-5    196   4e-52   
ref|NP_001051938.1|  Os03g0854500                                       197   4e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009373551.1|  PREDICTED: heat stress transcription factor A-5    196   4e-52   
gb|EPS72622.1|  hypothetical protein M569_02138                         192   5e-52   
ref|XP_003524927.1|  PREDICTED: heat stress transcription factor ...    196   5e-52   
ref|XP_010943416.1|  PREDICTED: heat stress transcription factor ...    197   5e-52   
ref|XP_002867969.1|  AT-HSFA4A                                          194   6e-52   
gb|AEB26589.1|  heat shock factor A4b                                   187   8e-52   
ref|XP_010276853.1|  PREDICTED: heat shock factor protein HSF8          196   1e-51   
ref|XP_008340741.1|  PREDICTED: heat stress transcription factor ...    196   1e-51   
ref|XP_004300222.1|  PREDICTED: heat shock factor protein HSF8-like     196   1e-51   
ref|XP_009783144.1|  PREDICTED: heat stress transcription factor A-5    195   1e-51   
emb|CDX78902.1|  BnaA01g09690D                                          196   1e-51   
ref|XP_008813276.1|  PREDICTED: heat stress transcription factor ...    194   2e-51   
ref|XP_008238205.1|  PREDICTED: heat shock factor protein HSF8          195   3e-51   
gb|EPS68530.1|  hypothetical protein M569_06240                         184   3e-51   
ref|XP_004504369.1|  PREDICTED: heat stress transcription factor ...    194   3e-51   
ref|XP_007146362.1|  hypothetical protein PHAVU_006G034200g             194   4e-51   
ref|XP_011003631.1|  PREDICTED: heat stress transcription factor ...    194   5e-51   
gb|KDO77936.1|  hypothetical protein CISIN_1g015635mg                   190   5e-51   
ref|XP_002265319.2|  PREDICTED: heat stress transcription factor A-5    194   5e-51   Vitis vinifera
ref|XP_010913096.1|  PREDICTED: heat stress transcription factor ...    193   7e-51   
gb|EYU32713.1|  hypothetical protein MIMGU_mgv1a006911mg                192   7e-51   
gb|KHG05169.1|  Heat shock factor HSF8                                  194   8e-51   
gb|KDP39324.1|  hypothetical protein JCGZ_01081                         193   8e-51   
ref|XP_010245198.1|  PREDICTED: heat stress transcription factor A-1    194   8e-51   
ref|XP_010908496.1|  PREDICTED: heat stress transcription factor A-1    193   1e-50   
ref|NP_193623.1|  heat stress transcription factor A-4a                 191   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008380467.1|  PREDICTED: heat stress transcription factor ...    192   1e-50   
ref|XP_008802552.1|  PREDICTED: heat stress transcription factor ...    192   2e-50   
gb|KDP30379.1|  hypothetical protein JCGZ_17108                         193   2e-50   
gb|AEO91550.1|  heat shock transcription factor                         192   2e-50   
ref|XP_006368372.1|  heat shock transcription factor family protein     192   2e-50   
ref|XP_009350928.1|  PREDICTED: heat stress transcription factor ...    192   2e-50   
gb|AAC31792.1|  heat shock transcription factor 21                      190   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007040659.1|  Heat shock transcription factor A1D isoform 1      192   2e-50   
ref|XP_006414044.1|  hypothetical protein EUTSA_v10025409mg             189   2e-50   
ref|XP_006485538.1|  PREDICTED: heat shock factor protein HSF8-li...    192   2e-50   
gb|KFK28556.1|  hypothetical protein AALP_AA7G011600                    189   2e-50   
ref|XP_011018512.1|  PREDICTED: heat stress transcription factor ...    192   3e-50   
ref|XP_002527650.1|  Heat shock factor protein HSF8, putative           192   3e-50   Ricinus communis
ref|NP_001236740.1|  heat shock factor protein hsf8-related             192   3e-50   
ref|XP_002303429.2|  heat shock transcription factor family protein     192   3e-50   Populus trichocarpa [western balsam poplar]
ref|XP_006492535.1|  PREDICTED: heat stress transcription factor ...    191   3e-50   
ref|XP_002452118.1|  hypothetical protein SORBIDRAFT_04g020050          191   5e-50   Sorghum bicolor [broomcorn]
ref|XP_008803687.1|  PREDICTED: heat stress transcription factor ...    191   6e-50   
gb|AII99901.1|  heat shock transcription factor                         191   6e-50   
ref|XP_009361739.1|  PREDICTED: heat stress transcription factor ...    191   7e-50   
ref|XP_008438315.1|  PREDICTED: heat stress transcription factor A-5    190   7e-50   
ref|XP_009354811.1|  PREDICTED: heat stress transcription factor ...    191   7e-50   
gb|KHG03434.1|  Heat shock factor HSF8                                  191   8e-50   
emb|CAN71266.1|  hypothetical protein VITISV_017888                     190   9e-50   Vitis vinifera
ref|XP_008390927.1|  PREDICTED: heat stress transcription factor ...    190   1e-49   
ref|XP_010908034.1|  PREDICTED: heat stress transcription factor ...    189   1e-49   
gb|EAY85930.1|  hypothetical protein OsI_07290                          189   1e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_011084620.1|  PREDICTED: heat stress transcription factor ...    189   1e-49   
ref|XP_003631489.1|  PREDICTED: heat shock factor protein HSF8          190   1e-49   
ref|XP_008338589.1|  PREDICTED: heat stress transcription factor ...    189   1e-49   
ref|XP_004134371.1|  PREDICTED: heat stress transcription factor ...    189   1e-49   
ref|XP_008222805.1|  PREDICTED: heat stress transcription factor A-5    189   2e-49   
ref|XP_008800101.1|  PREDICTED: heat stress transcription factor ...    189   2e-49   
ref|XP_007209949.1|  hypothetical protein PRUPE_ppa004782mg             189   2e-49   
gb|EMT02670.1|  Heat stress transcription factor A-2e                   185   2e-49   
ref|XP_004166114.1|  PREDICTED: heat stress transcription factor ...    189   2e-49   
ref|NP_001046889.1|  Os02g0496100                                       189   2e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007163811.1|  hypothetical protein PHAVU_001G266300g             188   2e-49   
ref|XP_010439797.1|  PREDICTED: heat stress transcription factor ...    187   2e-49   
ref|XP_004952518.1|  PREDICTED: heat stress transcription factor ...    189   2e-49   
ref|NP_001147891.1|  heat shock factor protein HSF30                    186   3e-49   Zea mays [maize]
dbj|BAJ86783.1|  predicted protein                                      188   3e-49   
ref|XP_008373593.1|  PREDICTED: heat shock factor protein HSF8-like     189   4e-49   
gb|AFQ02689.1|  heat stress transcription factor A-5-like protein       187   4e-49   
emb|CDX99415.1|  BnaC01g11370D                                          186   4e-49   
ref|XP_009136968.1|  PREDICTED: heat stress transcription factor ...    186   4e-49   
ref|XP_002298675.2|  Heat Stress Transcription Factor family protein    188   4e-49   Populus trichocarpa [western balsam poplar]
ref|XP_010246534.1|  PREDICTED: heat stress transcription factor A-5    188   5e-49   
gb|EMT08035.1|  Heat stress transcription factor A-5                    187   5e-49   
ref|XP_009406338.1|  PREDICTED: heat stress transcription factor ...    187   6e-49   
ref|XP_010909933.1|  PREDICTED: heat stress transcription factor ...    188   6e-49   
dbj|BAJ86136.1|  predicted protein                                      188   6e-49   
ref|XP_002466300.1|  hypothetical protein SORBIDRAFT_01g005250          184   6e-49   Sorghum bicolor [broomcorn]
ref|XP_010530018.1|  PREDICTED: heat stress transcription factor ...    188   7e-49   
gb|EYU45384.1|  hypothetical protein MIMGU_mgv1a027027mg                187   7e-49   
gb|AIG20080.1|  HSF13                                                   187   7e-49   
ref|XP_011079918.1|  PREDICTED: heat stress transcription factor ...    184   8e-49   
gb|ADX69244.1|  heat shock transcription factor A4a                     185   8e-49   
gb|AEB26582.1|  heat shock factor A1a                                   187   9e-49   
ref|XP_010673379.1|  PREDICTED: heat stress transcription factor A-5    187   9e-49   
ref|XP_010540760.1|  PREDICTED: heat stress transcription factor ...    187   9e-49   
emb|CDY69818.1|  BnaAnng31620D                                          185   1e-48   
gb|EPS70260.1|  hypothetical protein M569_04499                         181   1e-48   
ref|NP_001141978.1|  uncharacterized protein LOC100274128               187   1e-48   Zea mays [maize]
ref|XP_002522803.1|  DNA binding protein, putative                      187   1e-48   Ricinus communis
ref|XP_009396840.1|  PREDICTED: heat stress transcription factor ...    187   1e-48   
ref|XP_004955620.1|  PREDICTED: heat stress transcription factor ...    184   1e-48   
gb|KGN56706.1|  hypothetical protein Csa_3G129630                       188   1e-48   
ref|XP_011028139.1|  PREDICTED: heat shock factor protein HSF8-like     187   1e-48   
ref|XP_011013884.1|  PREDICTED: heat shock factor protein HSF8-like     187   2e-48   
ref|XP_007156403.1|  hypothetical protein PHAVU_003G283300g             186   2e-48   
ref|XP_006373092.1|  Heat Stress Transcription Factor family protein    186   2e-48   
ref|XP_007200596.1|  hypothetical protein PRUPE_ppa010224mg             180   2e-48   
ref|XP_011003633.1|  PREDICTED: heat stress transcription factor ...    186   2e-48   
ref|XP_010096952.1|  Heat shock factor protein HSF8                     187   2e-48   
ref|XP_001758292.1|  predicted protein                                  180   2e-48   
gb|AFW71478.1|  heat shock transcription factor like protein            187   2e-48   
dbj|BAJ89362.1|  predicted protein                                      183   2e-48   
ref|XP_004512501.1|  PREDICTED: heat shock factor protein HSF8-li...    186   3e-48   
emb|CDP03674.1|  unnamed protein product                                182   3e-48   
gb|EAZ02967.1|  hypothetical protein OsI_25107                          183   3e-48   Oryza sativa Indica Group [Indian rice]
ref|NP_001059028.1|  Os07g0178600                                       183   4e-48   Oryza sativa Japonica Group [Japonica rice]
gb|KEH39541.1|  heat shock transcription factor A8                      181   4e-48   
gb|AEB26587.1|  heat shock factor A2e                                   179   5e-48   
ref|XP_011012492.1|  PREDICTED: heat stress transcription factor ...    185   5e-48   
ref|XP_003559114.1|  PREDICTED: heat stress transcription factor ...    186   5e-48   
gb|AFW66936.1|  hypothetical protein ZEAMMB73_123353                    185   5e-48   
ref|XP_006280753.1|  hypothetical protein CARUB_v10026722mg             180   6e-48   
ref|XP_004290633.1|  PREDICTED: heat stress transcription factor ...    182   7e-48   
gb|AAP92754.1|  heat stress protein                                     181   1e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002466076.1|  hypothetical protein SORBIDRAFT_01g000730          185   1e-47   Sorghum bicolor [broomcorn]
gb|AFQ02690.1|  heat stress transcription factor A-1 like protein       183   1e-47   
ref|XP_008226279.1|  PREDICTED: heat stress transcription factor ...    184   1e-47   
ref|XP_002273949.1|  PREDICTED: heat stress transcription factor ...    184   1e-47   Vitis vinifera
ref|XP_009395312.1|  PREDICTED: heat stress transcription factor ...    184   1e-47   
ref|XP_004148748.1|  PREDICTED: heat stress transcription factor ...    185   1e-47   
ref|XP_007211834.1|  hypothetical protein PRUPE_ppa004559mg             184   1e-47   
ref|XP_010023648.1|  PREDICTED: heat stress transcription factor A-5    184   1e-47   
gb|KHG10899.1|  Heat stress transcription factor A-5 -like protein      184   1e-47   
ref|XP_009781208.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock f...    184   1e-47   
ref|XP_010677345.1|  PREDICTED: heat shock factor protein HSF8-like     184   1e-47   
emb|CDY01562.1|  BnaC07g35520D                                          182   1e-47   
gb|AIG20085.1|  HSF18                                                   183   2e-47   
gb|AES64060.2|  heat shock transcription factor A4A                     181   2e-47   
ref|XP_008448660.1|  PREDICTED: heat shock factor protein HSF8-like     184   2e-47   
ref|XP_009395311.1|  PREDICTED: heat stress transcription factor ...    184   2e-47   
ref|XP_008776696.1|  PREDICTED: heat stress transcription factor ...    184   2e-47   
gb|ABJ09070.1|  heat shock transcription factor 1                       184   2e-47   
ref|XP_006414192.1|  hypothetical protein EUTSA_v10025116mg             183   3e-47   
gb|EMS65565.1|  Heat stress transcription factor A-4b                   181   3e-47   
ref|XP_006650726.1|  PREDICTED: heat stress transcription factor ...    180   3e-47   
gb|ABJ09073.1|  heat shock transcription factor 1                       183   3e-47   
ref|XP_010450142.1|  PREDICTED: heat stress transcription factor ...    182   3e-47   
ref|XP_003574986.1|  PREDICTED: heat stress transcription factor A-5    182   3e-47   
ref|XP_003612845.1|  Heat stress transcription factor A-1d              183   3e-47   
ref|XP_003597659.1|  Heat stress transcription factor A-5               181   3e-47   
gb|ABJ09071.1|  heat shock transcription factor 1                       183   3e-47   
ref|XP_009371190.1|  PREDICTED: heat stress transcription factor ...    184   3e-47   
gb|AAV73838.1|  heat shock factor 1b                                    183   3e-47   
ref|NP_001146716.1|  uncharacterized protein LOC100280318               180   3e-47   
gb|ABJ09072.1|  heat shock transcription factor 1                       183   3e-47   
ref|XP_007158271.1|  hypothetical protein PHAVU_002G138500g             183   4e-47   
ref|XP_003557472.1|  PREDICTED: heat stress transcription factor ...    179   4e-47   
ref|XP_010450121.1|  PREDICTED: heat stress transcription factor A-5    182   4e-47   
ref|XP_010435206.1|  PREDICTED: heat stress transcription factor ...    182   4e-47   
ref|XP_011073785.1|  PREDICTED: heat stress transcription factor A-5    182   4e-47   
gb|EPS69073.1|  hypothetical protein M569_05693                         181   8e-47   
ref|NP_001142316.1|  uncharacterized protein LOC100274485               181   8e-47   
ref|XP_009350364.1|  PREDICTED: heat stress transcription factor ...    179   9e-47   
ref|XP_004981438.1|  PREDICTED: LOW QUALITY PROTEIN: heat stress ...    179   9e-47   
ref|XP_011082584.1|  PREDICTED: heat stress transcription factor ...    177   9e-47   
gb|ABJ09074.1|  heat shock transcription factor 1 variant c             183   9e-47   
ref|XP_008777830.1|  PREDICTED: heat stress transcription factor ...    182   9e-47   
ref|XP_009405945.1|  PREDICTED: heat stress transcription factor ...    179   9e-47   
ref|XP_001766380.1|  predicted protein                                  176   1e-46   
ref|XP_009350363.1|  PREDICTED: heat stress transcription factor ...    179   1e-46   
ref|XP_009413903.1|  PREDICTED: heat stress transcription factor ...    178   1e-46   
gb|AHZ44764.1|  heat shock factor A1c                                   181   1e-46   
gb|AEB26591.1|  heat shock factor A5                                    176   1e-46   
ref|XP_010933440.1|  PREDICTED: heat stress transcription factor ...    182   1e-46   
ref|XP_004980999.1|  PREDICTED: heat stress transcription factor ...    182   1e-46   
ref|XP_009114894.1|  PREDICTED: heat stress transcription factor ...    181   1e-46   
emb|CDX93842.1|  BnaA09g24420D                                          181   1e-46   
emb|CDX78797.1|  BnaA01g08640D                                          180   1e-46   
ref|XP_008383020.1|  PREDICTED: heat stress transcription factor ...    182   1e-46   
ref|XP_010097956.1|  Heat stress transcription factor A-5               181   1e-46   
gb|KFK22685.1|  hypothetical protein AALP_AAs42556U000700               180   2e-46   
ref|XP_010671101.1|  PREDICTED: heat stress transcription factor ...    181   2e-46   
tpg|DAA52562.1|  TPA: hypothetical protein ZEAMMB73_453413              182   2e-46   
ref|XP_009370758.1|  PREDICTED: heat stress transcription factor ...    178   2e-46   
ref|XP_007034213.1|  Winged-helix DNA-binding transcription facto...    181   2e-46   
ref|XP_003593809.1|  Heat stress transcription factor A-4a              180   2e-46   
ref|XP_009344306.1|  PREDICTED: heat stress transcription factor ...    181   2e-46   
ref|XP_003597660.1|  Heat stress transcription factor A-5               179   2e-46   
emb|CDY01288.1|  BnaC05g24440D                                          181   2e-46   
ref|XP_002459419.1|  hypothetical protein SORBIDRAFT_02g004370          177   2e-46   
ref|XP_003592534.1|  Heat stress transcription factor A-5               176   3e-46   
gb|AES67911.2|  heat shock transcription factor A8                      179   3e-46   
ref|XP_002893716.1|  ATHSFA1D                                           179   4e-46   
ref|XP_008235357.1|  PREDICTED: heat stress transcription factor ...    176   5e-46   
ref|XP_006414835.1|  hypothetical protein EUTSA_v10025090mg             179   5e-46   
ref|XP_008386414.1|  PREDICTED: heat stress transcription factor ...    177   6e-46   
gb|AAF81328.1|AC007767_8  Strong similarity to heat shock factor ...    179   7e-46   
ref|XP_010038059.1|  PREDICTED: heat stress transcription factor ...    176   7e-46   
gb|KDP39519.1|  hypothetical protein JCGZ_02539                         179   7e-46   
ref|NP_174511.2|  heat stress transcription factor A-1d                 179   8e-46   
ref|XP_007029602.1|  Heat shock factor protein HSF8, putative           179   8e-46   
emb|CDO99109.1|  unnamed protein product                                176   1e-45   
ref|XP_004154162.1|  PREDICTED: heat stress transcription factor ...    175   1e-45   
ref|XP_010679125.1|  PREDICTED: heat stress transcription factor ...    176   1e-45   
ref|XP_004145415.1|  PREDICTED: heat stress transcription factor ...    175   1e-45   
gb|AII99902.1|  heat shock transcription factor                         176   1e-45   
ref|XP_002302091.2|  hypothetical protein POPTR_0002s04900g             174   1e-45   
ref|XP_009600492.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock f...    178   2e-45   
emb|CDP11185.1|  unnamed protein product                                178   2e-45   
ref|XP_002306796.2|  hypothetical protein POPTR_0005s23640g             175   2e-45   
gb|KHG10098.1|  Heat stress transcription factor A-1                    178   2e-45   
ref|NP_001051552.1|  Os03g0795900                                       175   2e-45   
ref|XP_009623591.1|  PREDICTED: heat stress transcription factor ...    178   2e-45   
ref|XP_010646120.1|  PREDICTED: heat stress transcription factor ...    175   2e-45   
emb|CDY60785.1|  BnaCnng36910D                                          176   2e-45   
ref|XP_007050485.1|  DNA binding protein, putative isoform 3            174   2e-45   
gb|ABD65622.1|  heat shock factor, putative                             176   3e-45   
ref|XP_001760365.1|  predicted protein                                  171   3e-45   
gb|KHG15258.1|  Heat stress transcription factor A-1b -like protein     177   3e-45   
ref|XP_010055283.1|  PREDICTED: heat shock factor protein HSF8 is...    177   4e-45   
ref|XP_007050483.1|  DNA binding protein, putative isoform 1            174   4e-45   
gb|AII99904.1|  heat shock transcription factor                         177   4e-45   
ref|XP_009139571.1|  PREDICTED: heat stress transcription factor A-5    177   4e-45   
ref|XP_006652039.1|  PREDICTED: heat stress transcription factor ...    176   5e-45   
ref|XP_002868323.1|  AT-HSFA5                                           176   5e-45   
gb|AHZ44763.1|  heat shock factor A1b                                   177   6e-45   
ref|XP_010549838.1|  PREDICTED: heat stress transcription factor ...    176   6e-45   
ref|XP_007145912.1|  hypothetical protein PHAVU_007G278200g             172   6e-45   
ref|XP_009130935.1|  PREDICTED: heat stress transcription factor ...    175   7e-45   
ref|NP_567415.1|  heat stress transcription factor A-5                  176   8e-45   
gb|AII99898.1|  heat shock transcription factor                         176   8e-45   
ref|XP_010527455.1|  PREDICTED: heat stress transcription factor A-5    176   9e-45   
ref|XP_008813499.1|  PREDICTED: heat stress transcription factor ...    173   9e-45   
gb|AEB26584.1|  heat shock factor A2b                                   172   9e-45   
ref|XP_002868040.1|  heat shock factor                                  176   9e-45   
ref|XP_010326419.1|  PREDICTED: heat stress transcription factor ...    173   1e-44   
ref|XP_004247199.1|  PREDICTED: heat stress transcription factor ...    173   1e-44   
ref|XP_009790324.1|  PREDICTED: heat stress transcription factor ...    176   1e-44   
ref|XP_011026101.1|  PREDICTED: heat stress transcription factor ...    172   1e-44   
ref|XP_009392772.1|  PREDICTED: heat stress transcription factor ...    176   1e-44   
ref|XP_010326415.1|  PREDICTED: heat stress transcription factor ...    173   1e-44   
ref|XP_010326412.1|  PREDICTED: heat stress transcription factor ...    173   1e-44   
ref|XP_006349723.1|  PREDICTED: heat stress transcription factor ...    172   1e-44   
ref|XP_006349720.1|  PREDICTED: heat stress transcription factor ...    172   1e-44   
ref|XP_008449368.1|  PREDICTED: LOW QUALITY PROTEIN: heat stress ...    171   2e-44   
ref|XP_006443978.1|  hypothetical protein CICLE_v10020718mg             172   2e-44   
emb|CDY12723.1|  BnaC04g29180D                                          175   2e-44   
ref|XP_010326411.1|  PREDICTED: heat stress transcription factor ...    173   2e-44   
ref|XP_010279247.1|  PREDICTED: heat stress transcription factor ...    172   2e-44   
ref|XP_009785117.1|  PREDICTED: heat stress transcription factor ...    172   2e-44   
ref|XP_010935646.1|  PREDICTED: heat stress transcription factor ...    172   2e-44   
ref|XP_010024221.1|  PREDICTED: heat stress transcription factor ...    172   2e-44   
emb|CDY01180.1|  BnaA04g06390D                                          174   2e-44   
ref|XP_002517070.1|  Heat shock factor protein HSF30, putative          172   2e-44   
ref|XP_010278227.1|  PREDICTED: heat stress transcription factor A-3    175   3e-44   
dbj|BAJ90333.1|  predicted protein                                      173   3e-44   
ref|XP_006381313.1|  hypothetical protein POPTR_0006s11680g             174   3e-44   
ref|XP_006347585.1|  PREDICTED: heat stress transcription factor ...    174   3e-44   
ref|XP_009631619.1|  PREDICTED: heat stress transcription factor ...    171   3e-44   
ref|XP_003629611.1|  Heat stress transcription factor A-5               174   4e-44   
ref|XP_006283672.1|  hypothetical protein CARUB_v10004729mg             174   4e-44   
ref|XP_006848522.1|  hypothetical protein AMTR_s00013p00262410          174   4e-44   
ref|XP_009631618.1|  PREDICTED: heat stress transcription factor ...    171   4e-44   
ref|XP_006367447.1|  PREDICTED: heat shock factor protein HSF8-like     175   4e-44   
gb|AHZ44765.1|  heat shock factor A2b                                   172   5e-44   
emb|CBI25043.3|  unnamed protein product                                171   5e-44   
ref|XP_007034864.1|  Heat stress transcription factor A-6b, putative    171   5e-44   
ref|XP_007162466.1|  hypothetical protein PHAVU_001G154700g             171   5e-44   
ref|XP_010326410.1|  PREDICTED: heat stress transcription factor ...    172   5e-44   
ref|XP_004241039.1|  PREDICTED: heat stress transcription factor ...    170   5e-44   
gb|EYU33433.1|  hypothetical protein MIMGU_mgv1a005500mg                174   6e-44   
ref|XP_010326409.1|  PREDICTED: heat stress transcription factor ...    172   6e-44   
ref|XP_010107707.1|  Heat stress transcription factor A-6b              171   6e-44   
gb|EMS65029.1|  Heat stress transcription factor A-5                    172   6e-44   
ref|XP_010087101.1|  Heat stress transcription factor A-6b              171   6e-44   
ref|XP_004235322.1|  PREDICTED: heat stress transcription factor A-1    174   6e-44   
ref|XP_003534283.1|  PREDICTED: heat shock factor protein HSF8-li...    174   7e-44   
ref|XP_011012276.1|  PREDICTED: heat stress transcription factor ...    170   7e-44   
ref|XP_009797496.1|  PREDICTED: heat stress transcription factor ...    171   7e-44   
ref|XP_006307334.1|  hypothetical protein CARUB_v10008952mg             173   8e-44   
ref|XP_009619930.1|  PREDICTED: heat shock factor protein HSF8-like     173   9e-44   
ref|XP_011016541.1|  PREDICTED: heat stress transcription factor A-3    174   9e-44   
ref|XP_008451318.1|  PREDICTED: heat stress transcription factor ...    171   9e-44   
gb|KFK45015.1|  hypothetical protein AALP_AA1G333600                    173   1e-43   
ref|XP_004983078.1|  PREDICTED: heat stress transcription factor ...    170   1e-43   
ref|XP_010461051.1|  PREDICTED: heat stress transcription factor ...    173   1e-43   
ref|XP_008451314.1|  PREDICTED: heat stress transcription factor ...    170   1e-43   
ref|XP_010478656.1|  PREDICTED: heat stress transcription factor ...    173   1e-43   
gb|KCW82060.1|  hypothetical protein EUGRSUZ_C03431                     170   1e-43   
gb|AHZ44766.1|  heat shock factor A2h                                   171   1e-43   
ref|XP_008813517.1|  PREDICTED: heat stress transcription factor ...    170   1e-43   
ref|XP_006857901.1|  hypothetical protein AMTR_s00069p00130920          172   1e-43   
ref|XP_002279339.1|  PREDICTED: heat stress transcription factor ...    169   1e-43   
dbj|BAF01210.1|  heat shock transcription factor HSF1                   172   2e-43   
emb|CAA53761.1|  heat shock factor                                      172   2e-43   
ref|XP_004244400.1|  PREDICTED: heat shock factor protein HSF8          173   2e-43   
ref|NP_001140998.1|  uncharacterized protein LOC100273077               172   2e-43   
ref|XP_006400223.1|  hypothetical protein EUTSA_v10013428mg             172   2e-43   
ref|NP_193510.1|  heat stress transcription factor A-1a                 172   2e-43   
ref|XP_004146995.1|  PREDICTED: heat stress transcription factor ...    169   2e-43   
ref|XP_010558628.1|  PREDICTED: heat stress transcription factor ...    172   2e-43   
ref|XP_004296577.1|  PREDICTED: heat stress transcription factor ...    169   2e-43   
ref|XP_006347336.1|  PREDICTED: heat stress transcription factor ...    172   3e-43   
gb|EMS61929.1|  Heat stress transcription factor A-2b                   173   3e-43   
emb|CAB10177.1|  heat shock transcription factor like protein           175   3e-43   
ref|XP_003555351.1|  PREDICTED: heat stress transcription factor ...    169   3e-43   
ref|XP_011032638.1|  PREDICTED: heat stress transcription factor ...    168   3e-43   
emb|CDY10361.1|  BnaCnng02620D                                          169   4e-43   
gb|AEB26588.1|  heat shock factor A3                                    168   4e-43   
ref|XP_003517005.1|  PREDICTED: heat shock factor protein HSF8-like     171   4e-43   
ref|XP_002520943.1|  DNA binding protein, putative                      168   4e-43   
ref|NP_001064617.1|  Os10g0419300                                       168   4e-43   
ref|XP_002467215.1|  hypothetical protein SORBIDRAFT_01g021490          168   4e-43   
ref|XP_011070307.1|  PREDICTED: heat shock factor protein HSF8          171   4e-43   
emb|CDX70290.1|  BnaA10g26390D                                          168   5e-43   
ref|XP_006349727.1|  PREDICTED: heat stress transcription factor ...    167   5e-43   
ref|XP_006349726.1|  PREDICTED: heat stress transcription factor ...    168   6e-43   
ref|XP_009122679.1|  PREDICTED: heat stress transcription factor A-3    169   6e-43   
emb|CDY38085.1|  BnaC02g06880D                                          170   6e-43   
gb|KFK29528.1|  hypothetical protein AALP_AA7G146100                    167   7e-43   
gb|KDO80137.1|  hypothetical protein CISIN_1g016091mg                   168   7e-43   
emb|CDX92026.1|  BnaC03g33280D                                          170   7e-43   
ref|XP_006349724.1|  PREDICTED: heat stress transcription factor ...    167   7e-43   
ref|XP_006450864.1|  hypothetical protein CICLE_v10008617mg             168   7e-43   
gb|AHZ44769.1|  heat shock factor A6e                                   167   8e-43   
ref|XP_010228292.1|  PREDICTED: heat stress transcription factor ...    170   8e-43   
ref|XP_011073463.1|  PREDICTED: heat stress transcription factor ...    167   9e-43   
ref|XP_010499777.1|  PREDICTED: heat stress transcription factor ...    170   9e-43   
ref|XP_010538384.1|  PREDICTED: LOW QUALITY PROTEIN: heat stress ...    171   9e-43   
ref|XP_003536509.1|  PREDICTED: heat stress transcription factor ...    167   9e-43   
gb|AHM92897.1|  heat stress transcription factor A-6b                   167   9e-43   
ref|NP_001147968.1|  heat shock factor protein 2                        170   1e-42   
ref|XP_008220492.1|  PREDICTED: heat shock factor protein HSF30 i...    167   1e-42   
ref|XP_010049464.1|  PREDICTED: heat shock factor protein HSF30-like    171   1e-42   
ref|XP_008220491.1|  PREDICTED: heat shock factor protein HSF30 i...    167   1e-42   
ref|XP_003538654.1|  PREDICTED: heat stress transcription factor ...    169   1e-42   
ref|XP_009134718.1|  PREDICTED: heat stress transcription factor ...    169   1e-42   
ref|XP_006662360.1|  PREDICTED: heat stress transcription factor ...    167   1e-42   
gb|KHN03824.1|  Heat stress transcription factor A-6b                   167   1e-42   
ref|NP_001276249.1|  heat stress transcription factor A-6b-like         166   1e-42   
ref|XP_007157072.1|  hypothetical protein PHAVU_002G040500g             169   1e-42   
gb|KEH43791.1|  heat shock transcription factor A3                      166   1e-42   
ref|XP_002878928.1|  ATHSFA2                                            166   1e-42   
ref|NP_180184.1|  heat stress transcription factor A-2                  166   2e-42   
ref|XP_004242136.1|  PREDICTED: heat stress transcription factor ...    169   2e-42   
gb|KDO80138.1|  hypothetical protein CISIN_1g016091mg                   167   2e-42   
ref|XP_002311642.1|  Heat Stress Transcription Factor family protein    166   2e-42   
gb|KHN02751.1|  Heat stress transcription factor A-6b                   167   2e-42   
emb|CDX74228.1|  BnaA03g28190D                                          169   2e-42   
dbj|BAJ89673.1|  predicted protein                                      167   2e-42   
ref|XP_009376015.1|  PREDICTED: heat stress transcription factor ...    166   2e-42   



>ref|XP_011098060.1| PREDICTED: heat stress transcription factor A-4b-like [Sesamum 
indicum]
Length=403

 Score =   281 bits (720),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 181/390 (46%), Positives = 227/390 (58%), Gaps = 72/390 (18%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MDG+ G S SPAPFL KTYE+VDD   +++VSWS  G SFVVWNPPEFARDLLPKYFKHN
Sbjct  1     MDGSNGSSNSPAPFLLKTYEMVDDPLTNSIVSWSHTGHSFVVWNPPEFARDLLPKYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
             NFSSFIRQLNTYGFRK+D +QWEFAN+EFIRGQ HLLKNIHRRKPIHSHS Q N  VPL+
Sbjct  61    NFSSFIRQLNTYGFRKVDPDQWEFANEEFIRGQRHLLKNIHRRKPIHSHSGQGNP-VPLT  119

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             + ER EFE +IE+LKQE   L+ E+DR EQENR   ++ +SL   LQ+ID+RQRQ++  +
Sbjct  120   DSERDEFENQIEKLKQEKLLLQSEVDRYEQENRGYEYQLRSLGQALQNIDQRQRQLMVTL  179

Query  899   AQLSLKP----DLLHHLEVHNKKRK---------------------------PSVSNGHL  985
             AQL  KP     ++ + E ++KKR+                            S+   ++
Sbjct  180   AQLLQKPGYTSSIMENAESYSKKRRLLALHFLQDKANLGENQSLTVMENLSNLSLPLLNV  239

Query  986   ELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAP--------SGDSRFSSP------  1123
             E V  LDSS+T  +  ++ I        +   LP  P        SGDS  + P      
Sbjct  240   EQVEKLDSSLTFWENFMHVIDQIPSEDSHDFRLPPPPVITEMAASSGDSDLNVPPRSPGY  299

Query  1124  -------------------STQTDTPEISSL-----HTKHPGADGNAKAAWNCAAVDVDR  1231
                                ST  D+P ISS+      ++ P   G           DV+ 
Sbjct  300   HMSVSPPHNCHSSPERAASSTYVDSPAISSICIDLDFSEKPAPSGIDVNMSPNKIPDVEM  359

Query  1232  LKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
              KDR E  ++ ++VP VG NDVFWQQFLTE
Sbjct  360   PKDR-EQDATISSVP-VGANDVFWQQFLTE  387



>ref|XP_009611948.1| PREDICTED: heat stress transcription factor A-4b-like [Nicotiana 
tomentosiformis]
Length=438

 Score =   270 bits (690),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 229/378 (61%), Gaps = 58/378 (15%)
 Frame = +2

Query  359   MDGTQGGSAS-PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKH  535
             M+   GGS+S PAPFL+KTYELVDD   + VVSW+  GRSFVVWNPPEFARDLLPKYFKH
Sbjct  6     MENCNGGSSSSPAPFLSKTYELVDDPYTNPVVSWNHNGRSFVVWNPPEFARDLLPKYFKH  65

Query  536   NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGV-P  712
             NNFSSFIRQLNTYGFRK+D EQWEFAN+EF+RGQ HLLKNI+RRKPIHSHSA  +  V P
Sbjct  66    NNFSSFIRQLNTYGFRKVDPEQWEFANEEFLRGQRHLLKNIYRRKPIHSHSATGSQSVAP  125

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             L++ ER+E+EEEIERLK+ENS L+   ++ E+ N+E  F  +S++ RL +I  RQ ++++
Sbjct  126   LTDSERQEYEEEIERLKRENSLLQSSAEKHEKFNQEYEFGVKSMEQRLHNIVHRQGKLIS  185

Query  893   LVAQLSLKP----DLLHHLEVHNKKRKPSVSNG----------------HLELVNNLDSS  1012
             L+AQL  +P    D +     ++KKR+  VSN                  LE+V  LDSS
Sbjct  186   LLAQLLQRPEFSSDFIECTNNNSKKRRLLVSNYLIEEENTTNSIVVPKLDLEVVKKLDSS  245

Query  1013  ITVCQKILNGI--SNGEEAYGNFE---------------TL-------------PQAPSG  1102
             I   ++ L GI  +  E+   +FE               TL             P +PSG
Sbjct  246   INFWERFLYGIQKTPTEDQMCDFEHTQPLPSPIVIHEMDTLSDDSGKRNSPIDHPSSPSG  305

Query  1103  DSRFSSPSTQTDTPEISSLHTK-----HPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTA  1267
             D + S       +P ISS++        P    N       + + +D +K+++E  + T+
Sbjct  306   DIQSSPELGGPLSPVISSIYINLECQLKPSDQSNTNTKI-TSTLSIDAMKNQVESNTDTS  364

Query  1268  AVPVVGGNDVFWQQFLTE  1321
                   GNDVFWQQFLTE
Sbjct  365   KSVSNSGNDVFWQQFLTE  382



>ref|XP_009769104.1| PREDICTED: heat stress transcription factor A-4b-like [Nicotiana 
sylvestris]
Length=438

 Score =   267 bits (682),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 228/378 (60%), Gaps = 58/378 (15%)
 Frame = +2

Query  359   MDGTQGGSAS-PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKH  535
             MD    GS+S PAPFL+KTYELVDD   + VVSW+  GRSFVVWNPPEFARDLLPKYFKH
Sbjct  6     MDNCNSGSSSAPAPFLSKTYELVDDPYTNPVVSWNHNGRSFVVWNPPEFARDLLPKYFKH  65

Query  536   NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGV-P  712
             NNFSSFIRQLNTYGFRK+D EQWEFAN+EF+RGQ HLLKNI+RRKPIHSHSA  +  V P
Sbjct  66    NNFSSFIRQLNTYGFRKVDPEQWEFANEEFLRGQRHLLKNIYRRKPIHSHSATGSQSVAP  125

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             L++ ER+E+EEEIERLK+ENS L+   ++ E+ N+E  F  +S++ RLQ+I +RQ ++++
Sbjct  126   LTDSERQEYEEEIERLKRENSLLQSSAEKHEKFNQEYEFGVKSMEQRLQTIVQRQGKLIS  185

Query  893   LVAQLSLKP----DLLHHLEVHNKKRKPSVSNG----------------HLELVNNLDSS  1012
             L+AQL  +P    D + +   ++KKR+  VSN                  +E+V  L+SS
Sbjct  186   LLAQLLQRPEFSSDFIQYTNNNSKKRRLLVSNYLIEEENATNSIVGPKLDIEIVKKLESS  245

Query  1013  ITVCQKILNGI--SNGEEAYGNFETLPQAP-----------SGDS--------RFSSPST  1129
             I   ++ L GI  +  E+   +FE     P           S DS          SSPS 
Sbjct  246   INFWERFLYGIRKTPTEDQMYDFEHTQPLPSPIVIREMDTSSDDSGKRNSPIDHSSSPSR  305

Query  1130  QTD---------TPEISSLHTK-----HPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTA  1267
                         +P ISS++        P    NA      + + +D  K++ EG +  +
Sbjct  306   DIQSSPELGGPLSPVISSIYINLECHLKPSDQTNANTKI-TSTMSIDATKNQAEGNTDMS  364

Query  1268  AVPVVGGNDVFWQQFLTE  1321
                   GNDVFWQQFLTE
Sbjct  365   KSVSNSGNDVFWQQFLTE  382



>gb|EYU30742.1| hypothetical protein MIMGU_mgv1a020913mg [Erythranthe guttata]
Length=387

 Score =   265 bits (678),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 173/378 (46%), Positives = 223/378 (59%), Gaps = 66/378 (17%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MDG+ GG+ S APFL KTYE+VDD   S+VVSWS  G SFVVWNPP+FARDLLP YFKHN
Sbjct  1     MDGSNGGNNSAAPFLVKTYEMVDDPKTSSVVSWSPTGLSFVVWNPPDFARDLLPNYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
             NFSSFIRQLNTYGFRKID +QWEFAN+EFIRGQ HLLKNI+RRKPIHSHS Q N+    +
Sbjct  61    NFSSFIRQLNTYGFRKIDPDQWEFANEEFIRGQRHLLKNIYRRKPIHSHSGQANASS-FT  119

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
               ER ++E+EIE++ QE +SL+ +++R +QENR   ++ +SL+  LQSID+RQ+Q++A +
Sbjct  120   NSEREDYEKEIEKMNQEKNSLQSQIERHKQENRGYEYQLRSLEQTLQSIDQRQQQLMATL  179

Query  899   AQLSLKPDLLHHLEVHNKKRKP---------------------SVSNG-------HLELV  994
             AQL   P L H    HNKKR+                      +V+N         LE V
Sbjct  180   AQLLQTPRLEHS---HNKKRRLLALHFLHGECKHVGEPKSTTFTVNNTSDSLPLLDLEQV  236

Query  995   NNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHP  1174
               LDSS++  +  L+GI   ++     E +  A SGDS   +P     +P +  +   H 
Sbjct  237   EKLDSSLSFWETFLDGI---DQTLSEDEFM-VASSGDSDLRAPPPPPFSPVVRHMSASH-  291

Query  1175  GADGNAKA--------AWNCAAVDVD-RLKDRL------------------EGRSSTAAV  1273
               D N+ +        A +   +D+D R K  L                  E   S  A 
Sbjct  292   SRDCNSSSSNYDVDSPAISSICIDMDSRQKPTLGIDVNLSPTKTPDAEMPNEREISGGAA  351

Query  1274  PVV--GGNDVFWQQFLTE  1321
             P +  G NDVFWQQFLTE
Sbjct  352   PSLPAGANDVFWQQFLTE  369



>emb|CDP18749.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   263 bits (673),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 170/356 (48%), Positives = 213/356 (60%), Gaps = 62/356 (17%)
 Frame = +2

Query  419   LVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYGFRKIDAE  598
             +V+D   +++VSWSR G SF+VWNPPEFARDLLPKYFKHNNFSSFIRQLNTYGFRK D +
Sbjct  1     MVEDPMTNSIVSWSRSGLSFIVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYGFRKSDPD  60

Query  599   QWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeierLKQENSS  778
             QWEF N++FIRGQ HLL+NI+RRKPIHSHS Q NS VPL   ER+ F+EEIERLK E + 
Sbjct  61    QWEFLNEDFIRGQRHLLRNIYRRKPIHSHSVQGNSAVPLGNAERQSFQEEIERLKGEKNL  120

Query  779   LRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKP----DLLHHLEVH  946
             L+ EL+R +QE+RE   E  SL  RL++ID RQRQ++A +AQL  KP     L+   E H
Sbjct  121   LQSELERHKQESREFETEVNSLAERLRNIDNRQRQLMACLAQLLQKPGFASGLMQQSENH  180

Query  947   NKKRKPSVSNG---------HLELVNNLDSSITVCQKILNGI--SNGEEAYGNFETLPQA  1093
             NK+R+  +SN          + EL+  LD+S+   +  L G+  S+ EE YG F  LP  
Sbjct  181   NKRRRLLISNYLYDEANIVLNAELIEKLDASVNFWETFLYGMCSSSAEEMYG-FACLPHP  239

Query  1094  P----------SGDSRF-------------------SSP-----STQTDTPEISS-----  1156
             P          SGDS                     SSP     S   D+P  SS     
Sbjct  240   PPLTITGPLASSGDSDVNVQPCSSNSLRSSPSGEFHSSPELVVSSNHVDSPATSSPCLDM  299

Query  1157  -LHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                +K  G D N   A     ++++  KDR+   S++A     G NDVFWQQFLTE
Sbjct  300   DSRSKSSGIDVNTSPA---TIMEIETSKDRVGSVSASAP---AGANDVFWQQFLTE  349



>ref|XP_007048764.1| Winged-helix DNA-binding transcription factor family protein, 
putative [Theobroma cacao]
 gb|EOX92921.1| Winged-helix DNA-binding transcription factor family protein, 
putative [Theobroma cacao]
Length=447

 Score =   263 bits (672),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 170/395 (43%), Positives = 230/395 (58%), Gaps = 77/395 (19%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MDG+QG S +P PFL KTYE+VDD   +++V WS  G SF+VWNPP+F+RDLLP+YFKHN
Sbjct  1     MDGSQGSSNAPPPFLTKTYEMVDDPMTNSLVGWSATGYSFIVWNPPDFSRDLLPRYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS--AQPNSGVP  712
             NFSSF+RQLNTYGFRKID +QWEFAN+EFIRG+ HLLKNIHRRKPIHSHS   Q NSG+P
Sbjct  61    NFSSFVRQLNTYGFRKIDPDQWEFANEEFIRGEKHLLKNIHRRKPIHSHSLVQQGNSGLP  120

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             L+E E++EFE EI+RL Q+ S L+++L R ++EN+E +F+ + L  R +++++RQRQV+ 
Sbjct  121   LTEIEKKEFEGEIKRLSQDKSRLQLQLQRHQKENQEFQFQIRLLSERFKNMEDRQRQVMV  180

Query  893   LVAQLSLKPDLLHHL----EVHNKKRK----------------------------PSVSN  976
              VAQL  KP  +       E HNKKRK                            PS   
Sbjct  181   FVAQLIHKPHFVSMFNQKSEFHNKKRKLLNFNHFIDGYNTVEHHSLTSQDANLGAPSAPV  240

Query  977   GHLELVNNLDSSITVCQKILNGI--SNGEEAYG-NFETLP--------QAPSG----DSR  1111
              +LE +  LDSSI   + + +GI  +  E+ Y     + P        Q  SG    D  
Sbjct  241   LNLEQIEKLDSSIKRWETLFHGIGETMDEKVYDFGISSRPSPIDVTELQTSSGDYDIDGE  300

Query  1112  FSSPST---------------------QTDTPEISS---LHTKHPGADGNAKAAWNCAAV  1219
               SPS+                     + D+P I S   +   +P + G    + +    
Sbjct  301   LCSPSSHPCSPHSTDINSSPELAVSVYKADSPPIPSFDHIANLNPKSFGIGVTSKHATPP  360

Query  1220  DVDRLKDRLEGRSSTAAVPVVGG-NDVFWQQFLTE  1321
             + + LK++++   +TA   V G  NDVFW+QFLTE
Sbjct  361   ETEALKEQVK---ATADHSVPGKVNDVFWEQFLTE  392



>ref|XP_002278037.1| PREDICTED: heat stress transcription factor A-4b [Vitis vinifera]
Length=442

 Score =   262 bits (669),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 167/390 (43%), Positives = 217/390 (56%), Gaps = 72/390 (18%)
 Frame = +2

Query  359   MDGTQGGSA-SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKH  535
             M+ +Q  S+ SP PFL KTYE+VDD    ++VSWS+ G SFVVWNPPEFA+DLLPKYFKH
Sbjct  1     MEASQSTSSNSPPPFLTKTYEMVDDPITDSIVSWSQAGHSFVVWNPPEFAKDLLPKYFKH  60

Query  536   NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG-VP  712
             NNFSSF+RQLNTYGFRK D EQWEFAN+EFIRGQ HLLKNIHRRKPIHSHS Q   G  P
Sbjct  61    NNFSSFVRQLNTYGFRKADPEQWEFANEEFIRGQRHLLKNIHRRKPIHSHSTQNQVGSAP  120

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             L E E++EFE EIERLK +  +L  EL R +QEN+   F+ QSL  R+ +++ RQR+++A
Sbjct  121   LPESEKQEFEAEIERLKHDKGALLSELQRYKQENQFFEFQTQSLGKRVFNMELRQRKMMA  180

Query  893   LVAQLSLKP----DLLHHLEVHNKKR-------------------------KP---SVSN  976
              +AQ+  KP     L+   E+HNKKR                         KP   SV  
Sbjct  181   YLAQVLQKPGFTSSLMAQSEIHNKKRRLLMPNYLFNEANVEENMVVTFQKEKPDTISVQG  240

Query  977   GHLELVNNLDSSITVCQKILNGISNGE----EAYGNF-----------------------  1075
              ++E++ +L+SS+   +  L GI  G     + +G                         
Sbjct  241   ENVEMIESLESSLNFWENFLYGIGQGSADVMDGFGTLSQPSPLIITEMHSSSDPDTSTQP  300

Query  1076  ---ETLPQAPSGDSRFSSP-----STQTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDR  1231
                ++ P +P      SSP     +   D+P ISS++    G   + +   N    +   
Sbjct  301   CSPKSYPSSPHSRDIHSSPELARATNHADSPAISSIYLNIDGCPKSLRIDVNSEPTNASE  360

Query  1232  LKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
             ++   E    T A    G NDVFW QFLTE
Sbjct  361   VEASKECEGGTTA---AGANDVFWAQFLTE  387



>ref|XP_011082962.1| PREDICTED: heat stress transcription factor A-4b-like [Sesamum 
indicum]
Length=447

 Score =   256 bits (653),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 173/395 (44%), Positives = 225/395 (57%), Gaps = 81/395 (21%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MDG+ G S SPAPFL KTYE+VDD   + +VSWS  G SFVVWNPPEFA +LLPKYFKHN
Sbjct  8     MDGSNGSSNSPAPFLLKTYEMVDDPLTNPIVSWSHTGHSFVVWNPPEFAGELLPKYFKHN  67

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
             NFSSFIRQLNTYGFRK+D +QWEFAN+EFIRG+ HLLKNIHRRKPIHSHS Q N  VPL+
Sbjct  68    NFSSFIRQLNTYGFRKVDPDQWEFANEEFIRGERHLLKNIHRRKPIHSHSGQGN-AVPLT  126

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             + ER EFE+EIE+LKQE  SL  E++R ++ENR    +  SL   L+ ID+RQ+Q++  +
Sbjct  127   DSEREEFEKEIEKLKQEKLSLHSEVERHKEENRGYEHQLGSLAQVLRVIDQRQQQLVVTL  186

Query  899   AQLSLKP----DLLHHLEVHNKKRK---------------------------PSVSNGHL  985
             AQL  KP     +   +E  NKKR+                            S+   +L
Sbjct  187   AQLLQKPGYASSVDEKMEPQNKKRRFSALQYLYDEANLDENLKNTFQENLSPSSLPLLNL  246

Query  986   ELVNNLDSSITVCQKILNGISN-GEEAYGNFETLPQAP-----------SGDS-------  1108
             E++  LDSS+T  +K ++G++    E   +F+ LP  P           SGDS       
Sbjct  247   EVIEKLDSSLTFWEKFVHGVNQISTEDSHDFD-LPLLPPEVANTETPLSSGDSDKNVPFC  305

Query  1109  ------------------RFSSPSTQTDTPEISSL------HTKHPGADGNAKAAWNCAA  1216
                               + ++ S   D+P +SS+        K  G D N         
Sbjct  306   TTECHTSAPTPQDCYSSHKLAASSAYIDSPAVSSICIDPDSRHKSSGVDVNMSPT---KD  362

Query  1217  VDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
             +D++  K++ +  S  +  P V  NDVFWQQFLTE
Sbjct  363   LDIELAKEQEQYSSIPSVQPTV--NDVFWQQFLTE  395



>ref|XP_006449558.1| hypothetical protein CICLE_v10015472mg [Citrus clementina]
 gb|ESR62798.1| hypothetical protein CICLE_v10015472mg [Citrus clementina]
Length=403

 Score =   252 bits (644),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 164/415 (40%), Positives = 222/415 (53%), Gaps = 78/415 (19%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD  QG S S  PFLAKTYE+VDD + ++ VSWS   +SF+VWNPP+FARDLLPKYFKHN
Sbjct  1     MDDGQGSSNSLPPFLAKTYEMVDDPSTNSTVSWSSSNKSFIVWNPPDFARDLLPKYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQP--NSGVP  712
             NFSSFIRQLNTYGFRK+D EQWEFAN++F+RGQ   LKNIHRRKP+HSHS Q     G P
Sbjct  61    NFSSFIRQLNTYGFRKVDPEQWEFANEDFVRGQPERLKNIHRRKPVHSHSNQNLHGQGTP  120

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             L+E ER+  +++IERLK+E   L +EL R EQE +    + Q L  R Q +++RQ+++++
Sbjct  121   LTESERQGLKDDIERLKKEKEILLLELQRHEQERQGFESQMQLLRERFQLMEQRQQKMVS  180

Query  893   LVAQLSLKPDLLH----HLEVHNKKRK-----------------------------PSVS  973
              V +   KP L      HLE H++KR+                               +S
Sbjct  181   FVGRALQKPGLESNFGVHLENHDRKRRLPRIDYFYDEANIEDNPMGTSQIVGGADSADIS  240

Query  974   NGHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEIS  1153
             + ++E    L+SS+T  + I+  +  G+  +         P+        ++  D+P IS
Sbjct  241   SSNMEKFEQLESSMTFWENIVQDV--GQSCF--------QPNSSLELDESTSCADSPAIS  290

Query  1154  SLHT------KHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGG-NDVFWQQF  1312
              +        K PG D N++ A   A   V   +       +   +PV  G NDVFW+QF
Sbjct  291   CIQLNVDARPKSPGIDMNSEPAVTAATEPVPSKEPE-----TATTIPVQAGVNDVFWEQF  345

Query  1313  LTEEVeserreigirngreC---------------------MIVFAEQMGHFTPA  1414
             LTE   S   +      +EC                     +   AEQMGH TPA
Sbjct  346   LTENPGSSDAQEVQSERKECDGKKNENKPADHGKFWWNMRNVNSLAEQMGHLTPA  400



>ref|XP_009352719.1| PREDICTED: heat stress transcription factor A-4c-like [Pyrus 
x bretschneideri]
Length=423

 Score =   252 bits (643),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 155/375 (41%), Positives = 216/375 (58%), Gaps = 61/375 (16%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             M+  QGG++S  PFL+KTYE+VDD +  ++VSWS   +SF+VWNPPEFARDLLPK+FKHN
Sbjct  1     MEEVQGGTSSLPPFLSKTYEMVDDASTDSIVSWSASNKSFIVWNPPEFARDLLPKFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ----PNSG  706
             NFSSFIRQLNTYGFRKID EQWEFAND+FIRGQ H++KNI RRKP+HSHS Q       G
Sbjct  61    NFSSFIRQLNTYGFRKIDPEQWEFANDDFIRGQPHIMKNIRRRKPVHSHSLQNLQVQGQG  120

Query  707   VPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQV  886
               LSE ER+  + EIERLK E   L VE+ R EQE      + Q L  RLQ ++++Q+ +
Sbjct  121   TSLSEAERQSMKVEIERLKHEKERLGVEVQRHEQERHGLELQMQFLMDRLQDMEKQQQTM  180

Query  887   LALVAQLSLKPDL----LHHLEVHNKKRK-PSVS----------------------NGHL  985
              A VA++  KP +    +  LEV  +KR+ P +S                      +G +
Sbjct  181   AAFVARVLQKPGIASNPVPQLEVRERKRRLPRISWSFDDANSGYNQMVSSQAVIRESGSM  240

Query  986   ELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHT  1165
             E +  L+S +T  +  ++ +S+     G+     ++ SG+   +  S Q +    + + +
Sbjct  241   EKLEQLESFLTFWEDTIHDVSHNNIQVGSNREADESTSGNESTALSSIQLN----ADIRS  296

Query  1166  KHPGADGNAK-----------------------AAWNCAAVDVDRLKDRLEGRSSTAAVP  1276
             K PG D NA+                       A+    A+     K++ +G +++AA  
Sbjct  297   KSPGIDMNAEPPASVAPKPAASQSSKEQTAGIAASAPTTALIQQTSKEKTDGTTASAA--  354

Query  1277  VVGGNDVFWQQFLTE  1321
               G NDVFW+QFLTE
Sbjct  355   -TGVNDVFWEQFLTE  368



>ref|XP_006467594.1| PREDICTED: heat stress transcription factor A-4a-like isoform 
X1 [Citrus sinensis]
 ref|XP_006467595.1| PREDICTED: heat stress transcription factor A-4a-like isoform 
X2 [Citrus sinensis]
 ref|XP_006467596.1| PREDICTED: heat stress transcription factor A-4a-like isoform 
X3 [Citrus sinensis]
 ref|XP_006467597.1| PREDICTED: heat stress transcription factor A-4a-like isoform 
X4 [Citrus sinensis]
 ref|XP_006467598.1| PREDICTED: heat stress transcription factor A-4a-like isoform 
X5 [Citrus sinensis]
 ref|XP_006467599.1| PREDICTED: heat stress transcription factor A-4a-like isoform 
X6 [Citrus sinensis]
 gb|KDO77937.1| hypothetical protein CISIN_1g015635mg [Citrus sinensis]
 gb|KDO77938.1| hypothetical protein CISIN_1g015635mg [Citrus sinensis]
 gb|KDO77939.1| hypothetical protein CISIN_1g015635mg [Citrus sinensis]
 gb|KDO77940.1| hypothetical protein CISIN_1g015635mg [Citrus sinensis]
 gb|KDO77941.1| hypothetical protein CISIN_1g015635mg [Citrus sinensis]
 gb|KDO77942.1| hypothetical protein CISIN_1g015635mg [Citrus sinensis]
 gb|KDO77943.1| hypothetical protein CISIN_1g015635mg [Citrus sinensis]
Length=403

 Score =   251 bits (641),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 164/414 (40%), Positives = 219/414 (53%), Gaps = 76/414 (18%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD  QG S S  PFLAKTYE+VDD +    VSWS   +SF+VWNPP+FARDLLPKYFKHN
Sbjct  1     MDDGQGSSNSLPPFLAKTYEMVDDSSTDLTVSWSSSNKSFIVWNPPDFARDLLPKYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQP--NSGVP  712
             NFSSFIRQLNTYGFRK+D EQWEFAN++F+RGQ   LKNIHRRKP+HSHS Q     G P
Sbjct  61    NFSSFIRQLNTYGFRKVDPEQWEFANEDFVRGQPERLKNIHRRKPVHSHSNQNLHGQGTP  120

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             L+E ER+  +++IERLK+E   L +EL R EQE +    + Q L  R Q +++RQ+++++
Sbjct  121   LTESERQGLKDDIERLKKEKEILLLELQRHEQERQGFESQMQLLRERFQLMEQRQQKMVS  180

Query  893   LVAQLSLKPDLLH----HLEVHNKKRK-----------------------------PSVS  973
              V +   KP L      HLE H++KR+                               +S
Sbjct  181   FVGRALQKPGLESNFGAHLENHDRKRRLPRIDYFYDEANIEDNPMGTSQIVAGADSADIS  240

Query  974   NGHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEIS  1153
             + ++E    L+SS+T  + I+  +  G+  +         P+        ++  D+P IS
Sbjct  241   SSNMEKFEQLESSMTFWENIVQDV--GQSCF--------QPNSSLELDESTSCADSPAIS  290

Query  1154  SLHT------KHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFL  1315
              +        K PG D N++ A   A   V       E  ++T      G NDVFW+QFL
Sbjct  291   CIQLNVDARPKSPGIDMNSEPAVTAATEPV----PSKEPETATTIPLQAGVNDVFWEQFL  346

Query  1316  TEEVeserreigirngreC---------------------MIVFAEQMGHFTPA  1414
             TE   S   +      +EC                     +   AEQMGH TPA
Sbjct  347   TENPGSSDAQEVQSERKECDGKKNENKPADHGKFWWNMRNVNSLAEQMGHLTPA  400



>emb|CBI22041.3| unnamed protein product [Vitis vinifera]
Length=348

 Score =   248 bits (634),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 193/312 (62%), Gaps = 30/312 (10%)
 Frame = +2

Query  419   LVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYGFRKIDAE  598
             +VDD    ++VSWS+ G SFVVWNPPEFA+DLLPKYFKHNNFSSF+RQLNTYGFRK D E
Sbjct  1     MVDDPITDSIVSWSQAGHSFVVWNPPEFAKDLLPKYFKHNNFSSFVRQLNTYGFRKADPE  60

Query  599   QWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG-VPLSeperrefeeeierLKQENS  775
             QWEFAN+EFIRGQ HLLKNIHRRKPIHSHS Q   G  PL E E++EFE EIERLK +  
Sbjct  61    QWEFANEEFIRGQRHLLKNIHRRKPIHSHSTQNQVGSAPLPESEKQEFEAEIERLKHDKG  120

Query  776   SLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKP----DLLHHLEV  943
             +L  EL R +QEN+   F+ QSL  R+ +++ RQR+++A +AQ+  KP     L+   E+
Sbjct  121   ALLSELQRYKQENQFFEFQTQSLGKRVFNMELRQRKMMAYLAQVLQKPGFTSSLMAQSEI  180

Query  944   HNKKRKPSVSN------GHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGD  1105
             HNKKR+  + N       ++E++ +L+SS+   +  L GI  G              S D
Sbjct  181   HNKKRRLLMPNYLFNEANNVEMIESLESSLNFWENFLYGIGQG--------------SAD  226

Query  1106  SRFSSPSTQTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVG  1285
                +  +   D+P ISS++    G   + +   N    +   ++   E    T A    G
Sbjct  227   --LARATNHADSPAISSIYLNIDGCPKSLRIDVNSEPTNASEVEASKECEGGTTA---AG  281

Query  1286  GNDVFWQQFLTE  1321
              NDVFW QFLTE
Sbjct  282   ANDVFWAQFLTE  293



>ref|XP_010916598.1| PREDICTED: heat stress transcription factor A-4b-like [Elaeis 
guineensis]
Length=451

 Score =   251 bits (642),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 175/401 (44%), Positives = 227/401 (57%), Gaps = 85/401 (21%)
 Frame = +2

Query  359   MDGTQGGSAS--PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFK  532
             M+G+QGGSAS  P PFL KTYE+VDD + +++VSWS    SF+VWNPPEF+RDLLPKYFK
Sbjct  1     MEGSQGGSASNSPPPFLTKTYEMVDDPSTNSIVSWSPSNSSFIVWNPPEFSRDLLPKYFK  60

Query  533   HNNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSA--QPNSG  706
             HNNFSSF+RQLNTYGFRKID +QWEFAN+EFIRGQ HLLKNIHRRKPIHSHS   Q NSG
Sbjct  61    HNNFSSFVRQLNTYGFRKIDPDQWEFANEEFIRGQRHLLKNIHRRKPIHSHSLHHQGNSG  120

Query  707   VPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQV  886
              PL+E ERRE E+EIERLK E   L  EL +  Q++     + QSL+ RL +++ RQR +
Sbjct  121   -PLAESERRELEDEIERLKCEKGLLLSELQKHAQQHHGMEQQMQSLEERLHAMENRQRNM  179

Query  887   LALVAQLSLKPDLLHHL----EVHNKKR----------------------------KPSV  970
             +A + Q+  KP  L +     E H KKR                            K  +
Sbjct  180   MAFLTQVMQKPGFLSNCVQQSEFHTKKRRLPKANYFCEDSNMEENRIISFQGMSSEKSDI  239

Query  971   SNGH---LELVNNLDSSITVCQKILNGIS--NGEEAYGNFETLPQAPSG-----------  1102
             ++ H   +E    ++SS+   +    G+S  +GE+ Y +   LP  PSG           
Sbjct  240   ASMHALDIEPFEKMESSLNSLENFFRGVSQASGEDMYYD-SALPSLPSGVVIMEMNASSG  298

Query  1103  --DSRFSSPSTQT-----------DTPEI--SSLHTKHPG-------ADGNAKAAW----  1204
               D    SPS +             +PE+  S+ + + P        AD  +KA+     
Sbjct  299   DTDVNLQSPSPKLHPSSPCLGDIHSSPELAESTSYAESPALPITEIHADIRSKASEIDVN  358

Query  1205  -NCAAVDVDRLKDRLEGRSSTAAVPVVGG-NDVFWQQFLTE  1321
                AA + D  +D   G + TAA  +  G NDVFW+QFLTE
Sbjct  359   SAPAAPECDSSRD---GAAGTAACTMAAGVNDVFWEQFLTE  396



>ref|XP_006348918.1| PREDICTED: heat stress transcription factor A-4b-like [Solanum 
tuberosum]
Length=417

 Score =   251 bits (640),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 160/351 (46%), Positives = 222/351 (63%), Gaps = 34/351 (10%)
 Frame = +2

Query  371   QGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSS  550
             +  S+SPAPFL KTYELVDD   + VVSW+  GRSFVVWNPPEFARDLLPKYFKHNNFSS
Sbjct  12    RSSSSSPAPFLLKTYELVDDTYTNPVVSWNHNGRSFVVWNPPEFARDLLPKYFKHNNFSS  71

Query  551   FIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeper  730
             FIRQLNTYGFRK+D EQWEFAN+EF+RGQ HLLKNI+RRKPIHSHSA   S   L++ ER
Sbjct  72    FIRQLNTYGFRKVDPEQWEFANEEFLRGQRHLLKNIYRRKPIHSHSATGQSVAALTDSER  131

Query  731   refeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLS  910
             +E+E+EIERLK+ENS L+   + +E+ N E     +S++ RLQ++  RQ ++++L+AQL 
Sbjct  132   QEYEDEIERLKRENSMLQSSAENQEKFNMEYESGIKSMEQRLQNVAHRQGKLISLLAQLL  191

Query  911   LKP----DLLHHLEVHNKKRKPSVSNG-----------------HLELVNNLDSSITVCQ  1027
              +P    D +     ++KKR+  VSN                   +E+V  LDSSI   +
Sbjct  192   QRPGFSSDFIQCANNNSKKRRLLVSNYLTEEENAATNSVVAPKLDMEMVKKLDSSINFWE  251

Query  1028  KILNG--ISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGAD--GNAK  1195
             + L G  ++  E+   +F+     PS        ++  D+ + +S     P +   G   
Sbjct  252   RFLYGTRMNPTEDQTCDFDHTQPLPSPIVIREMDTSSDDSGKRNSPIDHSPSSSELGGGP  311

Query  1196  AAWNCAAVDVD---RLK-----DRLEGRSS-TAAVPVVGGNDVFWQQFLTE  1321
              +   +++ V+   +LK     +++EG+++ T+ +    GNDVFWQQFLTE
Sbjct  312   LSPVISSIYVNLECQLKPSDQVNQVEGKTTKTSELVSNSGNDVFWQQFLTE  362



>gb|KDP39800.1| hypothetical protein JCGZ_03936 [Jatropha curcas]
Length=425

 Score =   249 bits (636),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 221/377 (59%), Gaps = 59/377 (16%)
 Frame = +2

Query  359   MDGTQGGSAS-PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKH  535
             MD + G S+S PAPFL KTYE+VDD   +++VSWS  G SFVVWNPPEFA+DLLPKYFKH
Sbjct  1     MDISHGSSSSAPAPFLIKTYEMVDDPLTNSIVSWSHSGCSFVVWNPPEFAQDLLPKYFKH  60

Query  536   NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ-PNSGVP  712
             NNFSSF+RQLNTYGFRKID +QWEFAN+EFIRGQ HLL NI RRKPIHSHS Q  N+   
Sbjct  61    NNFSSFVRQLNTYGFRKIDPDQWEFANEEFIRGQRHLLSNIRRRKPIHSHSLQNQNNVTS  120

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             L+  E+REFEE+I++LK + S L++EL R E E +    +  SL  RLQS+++RQ QV++
Sbjct  121   LTVTEKREFEEKIKKLKHDKSLLQLELKRNETEKQAYECQIMSLCERLQSMEKRQIQVIS  180

Query  893   LVAQLSLKPD----LLHHLEVHNKKRK----------------------------PSVSN  976
              + QL+ KPD    ++   E +NKKR+                               S 
Sbjct  181   FLTQLAKKPDFASIIVQQSEYNNKKRRLLEFDHFNDEYNIEENQNLSFPKEDTNGSPAST  240

Query  977   GHLELVNNLDSSITVCQKILNGISN--GEEAYGNFETLPQAPSGDSR-FSSPSTQTDTPE  1147
              + ELV  LDSSI   +  L G+    GE+  GNF +  Q  S   R  S+ S   +T  
Sbjct  241   LNFELVEQLDSSIKCFENFLYGVRETLGED-MGNFGSASQPSSVIVRELSASSLDCETCS  299

Query  1148  ISSLHT----KHPGA-----DGNAKAAW-----NC-----AAVDVDRLKDRLEGRSSTAA  1270
             ++S+      + P       D N +  +     +C     A ++ + +K+     ++T+A
Sbjct  300   LNSMDIASSPELPACITNLDDSNVQPCFATYEEDCKAASAAVIEEEAVKEPAVEIANTSA  359

Query  1271  VPVVGGNDVFWQQFLTE  1321
              P  G ND FW+ FLTE
Sbjct  360   QP--GANDHFWEYFLTE  374



>emb|CAN80282.1| hypothetical protein VITISV_017449 [Vitis vinifera]
Length=409

 Score =   248 bits (633),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 161/383 (42%), Positives = 211/383 (55%), Gaps = 72/383 (19%)
 Frame = +2

Query  359   MDGTQGGSA-SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKH  535
             M+ +Q  S+ SP PFL KTYE+VDD    ++VSWS+ G SFVVWNPPEFA+DLLPKYFKH
Sbjct  1     MEASQSTSSNSPPPFLTKTYEMVDDPITDSIVSWSQAGHSFVVWNPPEFAKDLLPKYFKH  60

Query  536   NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG-VP  712
             NNFSSF+RQLNTYGFRK D EQWEFAN+EFIRGQ HLLKNIHRRKPIHSHS Q   G  P
Sbjct  61    NNFSSFVRQLNTYGFRKADPEQWEFANEEFIRGQRHLLKNIHRRKPIHSHSTQNQVGSAP  120

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             L E E++EFE EIERLK +  +L  EL R +QEN+   F+ QSL  R+ +++ RQR+++A
Sbjct  121   LPESEKQEFEAEIERLKHDKGALLSELQRYKQENQFFEFQTQSLGKRVFNMELRQRKMMA  180

Query  893   LVAQLSLKP----DLLHHLEVHNKKR-------------------------KP---SVSN  976
              +AQ+  KP     L+   E+HNKKR                         KP   SV  
Sbjct  181   YLAQVLQKPGFTSSLMAQSEIHNKKRRLLMPNYLFNEANVEENMVVTFQKEKPDTISVQG  240

Query  977   GHLELVNNLDSSITVCQKILNGISNGE----EAYGNF-----------------------  1075
              ++E++ +L+SS+   +  L GI  G     + +G                         
Sbjct  241   ENVEMIESLESSLNFWENFLYGIGQGSADVMDGFGTLSQPSPJIITEMHSSSDPDTSTQP  300

Query  1076  ---ETLPQAPSGDSRFSSP-----STQTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDR  1231
                ++ P +P      SSP     +   D+P ISS++    G   + +   N    +   
Sbjct  301   CSPKSYPSSPHSXDIHSSPELARATNHADSPAISSIYLNIDGXPKSLRIDVNSEPTNASE  360

Query  1232  LKDRLEGRSSTAAVPVVGGNDVF  1300
             ++   E    T A    G NDVF
Sbjct  361   VEASKECEGGTTA---AGANDVF  380



>ref|XP_002522270.1| Heat shock factor protein, putative [Ricinus communis]
 gb|EEF40128.1| Heat shock factor protein, putative [Ricinus communis]
Length=402

 Score =   246 bits (628),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 168/411 (41%), Positives = 233/411 (57%), Gaps = 71/411 (17%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD +QG S S  PFL+KTYE+VDD + ++VVSWS+  +SF+VWNPPEFARDLLP++FKHN
Sbjct  1     MDESQGSSNSLPPFLSKTYEMVDDPSTNSVVSWSQSNKSFIVWNPPEFARDLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGV---  709
             NFSSFIRQLNTYGFRK+D EQWEFAN++FIRGQ HL+KNIHRRKP+HSHS Q   G    
Sbjct  61    NFSSFIRQLNTYGFRKVDPEQWEFANEDFIRGQPHLMKNIHRRKPVHSHSLQNLQGQGSN  120

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
             PL+E ER+  +++IERLK E  +L +EL R+E++ +    + Q+L  +LQ ++ RQ+ ++
Sbjct  121   PLTESERQSLKDDIERLKHEKEALVLELKRQERQRQGFEMQMQTLKEKLQQMERRQQTMV  180

Query  890   ALVAQLSLKP----DLLHHLEV-HNKKRK-PSVSNGHLELVNNLDSSITVCQKIL--NGI  1045
             + VA++  KP    +L+  +E  H++KR+ P +   + E      +SI  CQ I   N  
Sbjct  181   SFVARVLQKPGLALNLMSQMEPGHDRKRRLPRIGYFYDE------ASIEDCQTIARENAD  234

Query  1046  SNGEEAYGNFETLPQAPSGDSRFSS-------------------PSTQTDTPEISS----  1156
             SN   A  N E   Q  S  + + S                    ++  ++P IS     
Sbjct  235   SNS-VALSNVEQFEQLESSLTLWESIRDDVQTNIQRDSTMELDESTSCAESPAISCVPLN  293

Query  1157  --LHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVV--GGNDVFWQQFLTEE  1324
               +  K P  D N++ A   +A + D  K++  G     A P V  G NDVFW+QFLTE 
Sbjct  294   IDIRPKSPTIDMNSEPA-AASAPEPDPPKEQAAG----TAPPTVATGVNDVFWEQFLTEN  348

Query  1325  VeserreigirngreC---------------------MIVFAEQMGHFTPA  1414
               S   +      ++                      +   AEQMGH TPA
Sbjct  349   PGSTDTQEVQSERKDSNDRKNEIKPSDQEKFWWNMRNVNNLAEQMGHLTPA  399



>ref|XP_010529215.1| PREDICTED: heat stress transcription factor A-4a-like [Tarenaya 
hassleriana]
Length=402

 Score =   246 bits (628),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 149/356 (42%), Positives = 216/356 (61%), Gaps = 48/356 (13%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD  QGGS+S  PFLAKTYE+VDD +  ++VSWS G +SF+VWNPPEF+RDLLP++FKHN
Sbjct  1     MDENQGGSSSLPPFLAKTYEMVDDPSTDSIVSWSHGNKSFIVWNPPEFSRDLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGV-PL  715
             NFSSFIRQLNTYGFRKID E+WEFAND F+RGQ HLLKNIHRRKP+HSHS Q   G   L
Sbjct  61    NFSSFIRQLNTYGFRKIDPEKWEFANDGFVRGQPHLLKNIHRRKPVHSHSLQNLQGQNTL  120

Query  716   SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
             +E ER+  +++IERL++EN  L  EL ++EQE +    +   +  RLQ +++RQ+ +++ 
Sbjct  121   TESERQIMKDQIERLEKENEGLLAELHKKEQERKGFELQVNLMKDRLQHMEQRQKSMVSF  180

Query  896   VAQLSLKPDLLHHL----EVHNKKRK-PSV---------------------------SNG  979
             V+Q+  KP L  +L    E +++KR+ P +                           S  
Sbjct  181   VSQVLQKPGLALNLSPNFETNDRKRRFPGIGYLHDEPGKEENQACTAQRTGRENSPPSPL  240

Query  980   HLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSL  1159
             H E V  LDSS+ + + +++ +          ++L ++ S D      ++  ++P IS L
Sbjct  241   HAEQVEQLDSSLALWENLVSDVG---------DSLVRS-SMDLEVDESASCAESPSISCL  290

Query  1160  HTKHPGADGNAKAAWNCAAVDVDR--LKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                    +  +K+  +   +D++   +  + +   +T A P  G NDVFW+QFLTE
Sbjct  291   AV---NVESRSKSPRSPRIIDMNSEPISSKEQPAGNTTAPPPSGVNDVFWEQFLTE  343



>ref|XP_009365270.1| PREDICTED: heat stress transcription factor A-4b-like [Pyrus 
x bretschneideri]
Length=436

 Score =   246 bits (629),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 159/382 (42%), Positives = 215/382 (56%), Gaps = 62/382 (16%)
 Frame = +2

Query  359   MDGTQGGSA-SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKH  535
             MDG+QGGS  +PAPFL KTY+LVDD +++ +VSWS  G SFVVW+P EFA+++LP YFKH
Sbjct  1     MDGSQGGSGGAPAPFLTKTYDLVDDPSSNHMVSWSETGSSFVVWDPTEFAKEMLPMYFKH  60

Query  536   NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPN--SGV  709
             NNFSSF+RQLNTYGFRKID EQWEFAN+EF+RG  HLLKNIHRRKPIHSHS Q +  S V
Sbjct  61    NNFSSFVRQLNTYGFRKIDPEQWEFANEEFLRGGRHLLKNIHRRKPIHSHSLQNHEYSSV  120

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
             PL++ ER E+E++I RL  + S L +E+ R ++EN+E  F+ Q L  +LQ+++ RQRQ  
Sbjct  121   PLTDTEREEYEKKINRLNHDKSLLELEVQRHQRENQEFEFQIQILREQLQNMENRQRQYT  180

Query  890   ALVAQLSLKPD----LLHHLEVHNKKRKPSVSNG---------------------HLELV  994
             A +AQL  KP     L+   E+H+KKR+   SN                       L+ +
Sbjct  181   AFLAQLVQKPGFASVLVQQSEIHSKKRRLLKSNDFPDDFGMEDLTLNPQKETLGIKLDQL  240

Query  995   NNLDSSITVCQKILNGISNG-EEAYGNFETLPQA----------PSGDSRFSSPSTQTDT  1141
               ++SS+   +  L+G+     E   +   L QA           S +SR  SP +   +
Sbjct  241   EKMESSLNFWEDFLHGVGEAMPEEVNDIGPLSQASPIIVTEIQDTSMNSRPCSPRSHISS  300

Query  1142  PEISSLHTKHPGADGNAK------AAWNCAAVDVDRLKDRLEGRSSTAAVPVVG------  1285
             P   + H+  P   G+A           C  VD       ++  S   + P +       
Sbjct  301   PNSMNAHS-FPEVAGSANLFDILTITSMCHTVDFRSKSSAIDMNSKPDSAPALDSSKENV  359

Query  1286  ----------GNDVFWQQFLTE  1321
                        NDVFW+Q LTE
Sbjct  360   AEVKNAEPAKANDVFWEQCLTE  381



>ref|XP_004243245.1| PREDICTED: heat stress transcription factor A-4c-like [Solanum 
lycopersicum]
Length=388

 Score =   244 bits (622),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 153/327 (47%), Positives = 208/327 (64%), Gaps = 22/327 (7%)
 Frame = +2

Query  389   PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
             PAPFL KTYELVDD   + VVSWS  GRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN
Sbjct  13    PAPFLLKTYELVDDSYTNPVVSWSHNGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  72

Query  569   TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG---VPLSeperref  739
             TYGFRK+D EQWEFAN++F+RG+ HLLKNI+RRKPIHSHSA   +G    PL++ ER+E+
Sbjct  73    TYGFRKVDPEQWEFANEDFLRGRRHLLKNIYRRKPIHSHSAAAGTGQSVAPLTDSERQEY  132

Query  740   eeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKP  919
             E+EIERLK+ENS L+   + + + N E     +S++ RLQ++  RQ ++++L+AQL   P
Sbjct  133   EDEIERLKRENSLLQSSAENQLKFNGEYESGIKSMEQRLQNVAHRQGKLISLLAQLLQTP  192

Query  920   DLLHHL-EVHNKKRKPSVSNG----------HLELVNNLDSSITVCQKILNGISNGEEAY  1066
                    +  ++KR+  +SN            LE+V  LDSSI   ++ L G+   +  +
Sbjct  193   GFSSDFTQSASRKRRLLISNYLIDEENSPKFDLEMVKKLDSSINFWERFLYGVQTQDFEH  252

Query  1067  GNFETLPQAPSGDS-RFSSPSTQTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDRLKDR  1243
              +   +    S DS + +SP     +P  S L   +P       + +      +    ++
Sbjct  253   THSPIVTHTSSNDSAKRNSPIDH--SPSSSELGPLNPV----MSSTYENLERQLKPSDNQ  306

Query  1244  LEGRSS-TAAVPVVGGNDVFWQQFLTE  1321
             +E ++S T+ +    GNDVFWQQFLTE
Sbjct  307   IECKTSKTSELVSNSGNDVFWQQFLTE  333



>ref|XP_004303209.1| PREDICTED: heat stress transcription factor A-4b-like [Fragaria 
vesca subsp. vesca]
Length=439

 Score =   244 bits (624),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 168/392 (43%), Positives = 220/392 (56%), Gaps = 77/392 (20%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MDG+QGGS +PAPFL+KTY+LVDD + + VVSWS  G SFVVW+P EFA+DLLP YFKHN
Sbjct  1     MDGSQGGSNAPAPFLSKTYDLVDDPSTNHVVSWSETGGSFVVWDPTEFAKDLLPMYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPN--SGVP  712
             NFSSF+RQLNTYGFRK+D EQWEFAN+EF+RG  HLLKNIHRRKPIHSHS Q +  S VP
Sbjct  61    NFSSFVRQLNTYGFRKVDPEQWEFANEEFLRGGRHLLKNIHRRKPIHSHSMQNHEYSSVP  120

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             LSE ER E+E++I RL  + + L +EL R ++EN+E  F+ + L+ +LQ ++ RQRQ   
Sbjct  121   LSETEREEYEKKINRLINDKNLLELELQRHQRENQEFEFQMKLLNEQLQKMELRQRQYTT  180

Query  893   LVAQLSLKPD----LLHHLEVHNKKR---KP------------------------SVSNG  979
              +AQ+  KP     L+   E HNKKR   KP                        S S  
Sbjct  181   FLAQVLQKPGFASLLMQQSENHNKKRRLLKPNLFPDEFSMEGLNLNSQKENLDSVSTSTS  240

Query  980   HLELVNNLDSSITVCQKILNGISNG-EEAYGNFETLPQAP-----------------SGD  1105
               E +  ++SS+   +  + GI     E   +   + +A                  S  
Sbjct  241   KSERLEKMESSLNFWEDFIRGIGEAMPEEVNDIGPMSEASPIIVSEIQDLGMNSRPCSPI  300

Query  1106  SRFSSPSTQT--DTPE------------ISSLHT------KHPGADGNAKAAWNCAAVDV  1225
             S  SSP++     +PE            ISS++       K  G D N+K     +A  +
Sbjct  301   SNLSSPTSMNVHSSPEVAGSANLFDILAISSMYQSGDFRPKSSGLDMNSKPD---SAPAI  357

Query  1226  DRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
             +  K+R+     TAA P    NDVFW+Q LTE
Sbjct  358   EAPKERV--VEMTAAEP-AAANDVFWEQCLTE  386



>ref|XP_008364170.1| PREDICTED: heat stress transcription factor A-4c-like [Malus 
domestica]
 ref|XP_008364171.1| PREDICTED: heat stress transcription factor A-4c-like [Malus 
domestica]
Length=420

 Score =   242 bits (618),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 154/374 (41%), Positives = 206/374 (55%), Gaps = 62/374 (17%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             M+  QGG++S  PFL KTYE+VDD +  ++VSWS   +SF+VWNPPEFARDLLPK+FKHN
Sbjct  1     MEEAQGGTSSLPPFLCKTYEMVDDASXDSIVSWSASNKSFIVWNPPEFARDLLPKFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ------PN  700
             NFSSFIRQLNTYGFRKID EQWEFAND+FIRGQ HL+KNIHRRKP+HSHS Q        
Sbjct  61    NFSSFIRQLNTYGFRKIDPEQWEFANDDFIRGQPHLMKNIHRRKPVHSHSLQNLQVQGQG  120

Query  701   SGVPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQR  880
              G  LSE ER+  ++EI+RLK E   L VEL R EQE      + Q L  RLQ ++ +Q+
Sbjct  121   QGTSLSEAERQSMKDEIKRLKHEKERLAVELQRHEQERHGLELQMQFLKDRLQHMEGQQQ  180

Query  881   QVLALVAQLSLKPDL----LHHLEVHNKKRK-PSVS----------------------NG  979
              + A VA++  KP++    +  LEV  +KR+ P  S                      NG
Sbjct  181   TMAAFVARVLQKPEIASNPVPQLEVRERKRRLPRTSWPFDDANNGNNQMVSSEAVIRENG  240

Query  980   HLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSL  1159
              LE +  L+S +T  +  ++ +      + N   + ++ SG+   +  S Q +      +
Sbjct  241   GLEKLEQLESFLTFWEDTIHDV-----GHNNIPLVDESTSGNESTAVSSIQLNV----DI  291

Query  1160  HTKHPGADGNAKAAW--------------NCAAVDVDRLKDRL------EGRSSTAAVPV  1279
              +K P  D N++ A                 A +        L      E  + T+    
Sbjct  292   QSKSPKIDMNSEPAAFVAPEPAASQSSIEXTAGIAASAPTTTLIQQPSNEKPAGTSTSAP  351

Query  1280  VGGNDVFWQQFLTE  1321
              G ND FW+QFLTE
Sbjct  352   TGVNDGFWEQFLTE  365



>gb|KDP21146.1| hypothetical protein JCGZ_21617 [Jatropha curcas]
Length=406

 Score =   242 bits (617),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 156/411 (38%), Positives = 229/411 (56%), Gaps = 67/411 (16%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD +QG S S  PFL+KTYE+VDD +  ++VSWS+  +SF+VW+PPEF+RDLLP++FKHN
Sbjct  1     MDESQGSSNSLPPFLSKTYEMVDDPSTDSIVSWSQTNKSFIVWSPPEFSRDLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGV---  709
             NFSSFIRQLNTYGFRK D EQWEFAN++F+RG+ HL+KNIHRRKP+HSHS Q   G    
Sbjct  61    NFSSFIRQLNTYGFRKADPEQWEFANEDFVRGKPHLMKNIHRRKPVHSHSMQNLQGQGSN  120

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
             PL++ ER+  +++++RLK E   L +EL R + E +    + Q+L  +LQ ++ RQ+ ++
Sbjct  121   PLTDSERQALKDDVDRLKNEKEVLILELQRHDCERQGFELQMQALKEKLQQMERRQQTMV  180

Query  890   ALVAQLSLKP----DLLHHLEV-HNKKRKPSVSNGHLELVNNLDSSITVCQKILNG----  1042
             + V+++  KP    +L+  LE  H++KR+        E  +  D+ +  CQ + NG    
Sbjct  181   SFVSRVLQKPGLALNLMSELETGHDRKRRLPRIGYFYEEASIEDNQMATCQGLANGSADI  240

Query  1043  ----ISNGEEAYGNFETLPQAPS----------------GDSRFSSPSTQTDTPEISSLH  1162
                 +SN E+    FE L  + +                  S      +  ++P IS + 
Sbjct  241   TSTPLSNTEQ----FEQLESSLTFWETTVNDVQTNIQRNSTSELDESISCGESPAISCVQ  296

Query  1163  ------TKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTEE  1324
                    K P  D N++ A   +A + D  K+++ G + TAA    G NDVFW+QFLTE 
Sbjct  297   FNVDVRPKSPAIDMNSEPAV-ASAPEPDPPKEQVSGTAPTAA---TGVNDVFWEQFLTEN  352

Query  1325  VeserreigirngreC---------------------MIVFAEQMGHFTPA  1414
               +   +      ++                      +   AEQMGH TPA
Sbjct  353   PGATDAQEVQSERKDSGDRKNEIKPSEQGKFWWNMRNVNNLAEQMGHLTPA  403



>ref|XP_009351725.1| PREDICTED: heat stress transcription factor A-4c-like [Pyrus 
x bretschneideri]
 ref|XP_009351732.1| PREDICTED: heat stress transcription factor A-4c-like [Pyrus 
x bretschneideri]
Length=420

 Score =   242 bits (617),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 155/369 (42%), Positives = 206/369 (56%), Gaps = 52/369 (14%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             M+  QGG++S  PFL+KTYE+VDD +  ++VSWS   +SF+VWNPP+FARDLLPK+FKHN
Sbjct  1     MEEAQGGTSSLPPFLSKTYEMVDDASTDSIVSWSASDKSFIVWNPPDFARDLLPKFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ------PN  700
             NFSSFIRQLNTYGFRKID EQWEFAND+FIRGQ HL+KNIHRRKP+HSHS Q        
Sbjct  61    NFSSFIRQLNTYGFRKIDPEQWEFANDDFIRGQPHLMKNIHRRKPVHSHSLQNLQVQGQG  120

Query  701   SGVPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQR  880
              G  LSE ER+  ++EI+ LK E   L VEL R EQE      + Q L  RLQ ++ +Q+
Sbjct  121   QGTSLSEAERQSMKDEIKSLKHEKERLAVELQRHEQERHGLELQMQFLKDRLQHMEGQQQ  180

Query  881   QVLALVAQLSLKPDL----LHHLEVHNKKRK-PSVS----------------------NG  979
              + A VA++  KP +    +  LEV  +KR+ P  S                      NG
Sbjct  181   TMAAFVARVLQKPGIASNPVPQLEVRERKRRLPRTSWPFDDANNGNNQMVSSEAVIRENG  240

Query  980   HLELVNNLDSSITVCQKILNGISNG------EEAYGNFETLPQAPSGDSRFSSPSTQTD-  1138
              LE +  L+S +T  +  ++ + +       E   GN  T   +   +    S S Q D 
Sbjct  241   GLEKLEQLESFLTFWEDTIHDVGHNNIPLVDESTSGNESTAVSSMQLNVDIQSKSPQIDM  300

Query  1139  --------TPEISSLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGND  1294
                      PE ++  +      G A +A   A +      ++  G +S+A     G ND
Sbjct  301   NSEPAAFVAPEPAASQSSMEQTAGIAASAPTTALIQQPS-NEKPAGTTSSAP---TGVND  356

Query  1295  VFWQQFLTE  1321
              FW+QFLTE
Sbjct  357   GFWEQFLTE  365



>gb|ADL36729.1| HSF domain class transcription factor [Malus domestica]
Length=420

 Score =   242 bits (617),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 207/374 (55%), Gaps = 62/374 (17%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             M+  QGG++S  PFL KTYE+VDD +  ++VSWS   +SF+VWNPPEFARDLLPK+FKHN
Sbjct  1     MEEAQGGTSSLPPFLCKTYEMVDDASIDSIVSWSASNKSFIVWNPPEFARDLLPKFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ------PN  700
             NFSSFIRQLNTYGFRKID EQWEFAND+FIRGQ HL+KNIHRRKP+HSHS Q        
Sbjct  61    NFSSFIRQLNTYGFRKIDPEQWEFANDDFIRGQPHLMKNIHRRKPVHSHSLQNLQVQGQG  120

Query  701   SGVPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQR  880
              G  LSE ER+  ++EI+RLK E   L VEL R EQE      + Q L  RLQ ++ +Q+
Sbjct  121   QGTSLSEAERQSMKDEIKRLKHEKERLAVELQRHEQERHGLELQMQFLKDRLQHMEGQQQ  180

Query  881   QVLALVAQLSLKPDL----LHHLEVHNKKRK-PSVS----------------------NG  979
              + A VA++  KP++    +  LEV  +KR+ P  S                      NG
Sbjct  181   TMAAFVARVLQKPEIASNPVPQLEVRERKRRLPRTSWPFDDANNGNNQMVSSEAVIRENG  240

Query  980   HLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSL  1159
              LE +  L+S +T  +  ++ +      + N   + ++ SG+   +  S Q +      +
Sbjct  241   GLEKLEQLESFLTFWEDTIHDV-----GHNNIPLVDESTSGNESTAVSSIQLNV----DI  291

Query  1160  HTKHPGADGNA------------------KAAWNCAAVDVDRLKDRL--EGRSSTAAVPV  1279
              +K P  D N+                  K A   A+     L  +   E  + T+    
Sbjct  292   QSKSPKIDMNSEPAAFVAPEPAASQSSIEKTAGIAASAPTTTLIQQPSNEKPAGTSTSAP  351

Query  1280  VGGNDVFWQQFLTE  1321
              G ND FW+QFLTE
Sbjct  352   TGVNDGFWEQFLTE  365



>ref|XP_006448027.1| hypothetical protein CICLE_v10015413mg [Citrus clementina]
 ref|XP_006492257.1| PREDICTED: heat stress transcription factor A-4b-like [Citrus 
sinensis]
 gb|ESR61267.1| hypothetical protein CICLE_v10015413mg [Citrus clementina]
Length=412

 Score =   240 bits (613),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 156/201 (78%), Gaps = 6/201 (3%)
 Frame = +2

Query  371  QGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSS  550
            QG S SPAPFL KTYE+VDD   +++VSWS+ G SF+VWNPP+FA+DLLP+YFKHNNFSS
Sbjct  7    QGSSNSPAPFLIKTYEMVDDPLTNSLVSWSQSGGSFIVWNPPDFAKDLLPQYFKHNNFSS  66

Query  551  FIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeper  730
            F+RQLNTYGFRKID +QWEFAN+EFIRGQ HLLKNIHRRKP+HSHS Q  S  PL+E ER
Sbjct  67   FVRQLNTYGFRKIDPDQWEFANEEFIRGQRHLLKNIHRRKPVHSHSTQ--SPTPLTETER  124

Query  731  refeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLS  910
             EFE +IERLK+ENS L++EL RRE  N E  +  QS+  RL+ ++ RQ Q++A +A L 
Sbjct  125  NEFEAKIERLKKENSLLQLELRRREGGNHEFEYHVQSVRERLRYLENRQTQMIACLANLL  184

Query  911  LKPD----LLHHLEVHNKKRK  961
             KP     L    EVH+KKR+
Sbjct  185  KKPGFSSALNQQAEVHSKKRR  205



>gb|AGJ83756.1| heat stress transcription factor A-4a-like protein [Caragana 
korshinskii]
Length=402

 Score =   240 bits (612),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 147/357 (41%), Positives = 208/357 (58%), Gaps = 44/357 (12%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD  QG S+S  PFLAKTYE+VDD ++  +VSWS   +SF+VWNPPEFAR LLP++FKHN
Sbjct  1     MDEAQGSSSSLPPFLAKTYEMVDDPSSDPIVSWSVTNKSFIVWNPPEFARVLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQP-NSGVPL  715
             NFSSFIRQLNTYGFRK+D EQWEFAND+FIRG+ HL+KNIHRRKP+HSHS Q   S VPL
Sbjct  61    NFSSFIRQLNTYGFRKVDPEQWEFANDDFIRGKPHLMKNIHRRKPVHSHSLQNLQSQVPL  120

Query  716   SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
             SE ER+   +E+E+LKQ+   L +EL R +QE +    +      RL+ ++++Q+++++ 
Sbjct  121   SESERQSLNDEVEKLKQDKERLLMELKRYQQEWQTYEIQIHCSKDRLEKLEQKQQKMVSS  180

Query  896   VAQLSLKP----DLLHHLEVHNKKRK------------------------------PSVS  973
             V+Q+  KP    +LL   E  ++KR+                               SV 
Sbjct  181   VSQVLQKPVIALNLLPLTETMDRKRRLPRSGYFNNEANTEDAAETSQMFPRENAEGTSVL  240

Query  974   NGHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEIS  1153
                +E ++ L+SS+   + + + + +      +   L ++ S     S    Q D     
Sbjct  241   TSSMERLDQLESSMVFWETVAHEVGDKYVHIHSNMDLDESTSCADSLSISCVQLDV----  296

Query  1154  SLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTEE  1324
              +  K PG D N++ A   AAV  + +  + +    T A    G NDVFW+QFLTE+
Sbjct  297   EVRPKSPGIDMNSEPA---AAVVPEPIASKEQPVGITTA--ATGVNDVFWEQFLTED  348



>ref|XP_007213840.1| hypothetical protein PRUPE_ppa006534mg [Prunus persica]
 gb|EMJ15039.1| hypothetical protein PRUPE_ppa006534mg [Prunus persica]
Length=407

 Score =   240 bits (612),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 158/363 (44%), Positives = 212/363 (58%), Gaps = 53/363 (15%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD  QGG++S  PFL+KTY++VDD +  ++VSWS   +SF+VWNPPEFARDLLPK+FKHN
Sbjct  1     MDEVQGGASSLPPFLSKTYDMVDDASTDSIVSWSASNKSFIVWNPPEFARDLLPKFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ----PNSG  706
             NFSSFIRQLNTYGFRKID EQWEFAND+FIRGQ HL+KNIHRRKP+HSHS Q      +G
Sbjct  61    NFSSFIRQLNTYGFRKIDPEQWEFANDDFIRGQPHLMKNIHRRKPVHSHSLQNLQVQGNG  120

Query  707   VPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQV  886
               LSE ER+  ++EIERLK E   L VEL R EQE +    + Q L  RLQ ++ +Q+ +
Sbjct  121   TSLSESERQSMKDEIERLKHEKERLGVELQRHEQERQGLELQIQFLKERLQHMERQQQTM  180

Query  887   LALVAQLSLKPDL----LHHLEVHNKKRK-PSV-------SNGH---------------L  985
                VA++  KP +    +  LE+H +KR+ P +       SNG+               +
Sbjct  181   AGFVARVLQKPGIASNPVPQLEIHGRKRRLPRIGWSYDEASNGNNQVASSQAGIRENADM  240

Query  986   ELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHT  1165
             E +  L+S +T  +  +  +          ET  Q  S +      ++  ++  ISS+  
Sbjct  241   EKLEQLESFLTFWEDTIFDVG---------ETHIQVVS-NVELDESTSCVESAVISSIQL  290

Query  1166  ------KHPGADGNAK-----AAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQF  1312
                   K PG D N++     A    AAV  +    + +    TA+ P  G NDVFW+ F
Sbjct  291   NVDAQPKSPGIDMNSEPDVVVAPEPAAAVPPEPTSSKEQTSGITASAP-TGVNDVFWEHF  349

Query  1313  LTE  1321
             LTE
Sbjct  350   LTE  352



>ref|XP_002316809.1| heat shock transcription factor family protein [Populus trichocarpa]
 gb|EEE97421.1| heat shock transcription factor family protein [Populus trichocarpa]
Length=406

 Score =   239 bits (611),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 149/365 (41%), Positives = 215/365 (59%), Gaps = 58/365 (16%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD +QG S S  PFLAK YE+VDD ++ ++VSWS+  +SFVVWNPPEFARDLLP++FKHN
Sbjct  1     MDESQGTSNSLPPFLAKAYEMVDDPSSDSIVSWSQNNKSFVVWNPPEFARDLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVP--  712
             NFSSFIRQLNTYGFRKID EQWEFAN++FIRGQ HL+KNIHRRKP+HSHS Q   G    
Sbjct  61    NFSSFIRQLNTYGFRKIDPEQWEFANEDFIRGQPHLMKNIHRRKPVHSHSMQNLQGQGSN  120

Query  713   -LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
              L++ ER+  +++IE+LK++  +L +EL ++EQE +    + + L  +LQ  +  Q+ ++
Sbjct  121   LLTDSERQSMKDDIEKLKRDKQALILELQKQEQERKGFEMQIEGLKEKLQQTECIQQTIV  180

Query  890   ALVAQLSLKP----DLLHHLEVHNKKRK-------------------------------P  964
             + VA++  KP    +++  LE  ++KR+                                
Sbjct  181   SFVARVLPKPGLALNIMPQLEGRDRKRRLPRIGYLYSEASNEDNQMVTSQALSRENADSN  240

Query  965   SVSNGHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTP  1144
             SV+  ++E    L+SS+T  + +++ I  G+    N  T+             ++   +P
Sbjct  241   SVALLNMEQFEQLESSLTFWENMVHDI--GQTYNYNNSTI--------EMDDSTSGAQSP  290

Query  1145  EISSLHT------KHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQ  1306
              IS +H       K PG D N++ +   A   V   K++L G + T A    G NDVFW+
Sbjct  291   AISCVHLNVDFRPKSPGIDMNSEPSAAVAPEPVSP-KEQLAGTAPTVA---TGVNDVFWE  346

Query  1307  QFLTE  1321
             QFLTE
Sbjct  347   QFLTE  351



>ref|XP_002525885.1| Heat shock factor protein, putative [Ricinus communis]
 gb|EEF36489.1| Heat shock factor protein, putative [Ricinus communis]
Length=464

 Score =   241 bits (615),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 160/374 (43%), Positives = 214/374 (57%), Gaps = 65/374 (17%)
 Frame = +2

Query  386   SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQL  565
             +PAPFL KTYE+VDD + S++VSWS  G SFVVWNPPEFA+DLLPKYFKHNNFSSF+RQL
Sbjct  43    APAPFLIKTYEMVDDPSTSSIVSWSHTGCSFVVWNPPEFAQDLLPKYFKHNNFSSFVRQL  102

Query  566   NTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG--VPLSeperref  739
             NTYGFRKID +QWEF N+EFIRGQ HLL NI RRKPIHSHS Q N G   PL++ E+RE+
Sbjct  103   NTYGFRKIDPDQWEFGNEEFIRGQRHLLSNIRRRKPIHSHSLQ-NQGNTSPLTDLEKREY  161

Query  740   eeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKP  919
             EE+I+RLK + S L++E+ R E E +    +  SL  RL S++ RQ Q+++ +AQL+ KP
Sbjct  162   EEKIKRLKHDKSLLQMEVQRNEMEKQAFECQIMSLGERLVSMERRQMQLVSCLAQLAKKP  221

Query  920   D----LLHHLEVHNKKR----------------------------KPSVSNGHLELVNNL  1003
                  L+   + HNKKR                            +   S  + E+V+ L
Sbjct  222   GFASALMQQSDYHNKKRRLLEFNHFSSECNTEDNPGWRLAKENPDRSPASTLNFEIVDKL  281

Query  1004  DSSITVCQKILNGI--SNGEEAYGNFETLPQAPSGDSRFSSPSTQTDT------------  1141
             DSSI   +  L G+  ++ ++ +      P +P    + S+ S   DT            
Sbjct  282   DSSIKCFENFLLGVKETSAQDMHDFRIVSPPSPVIFRQLSASSLDADTCSPRSLPSSPHS  341

Query  1142  ------PEIS-------SLHTKHPG-ADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPV  1279
                   PE++       +L T  P  +D +A     CA VD    +  +E  + TAA P 
Sbjct  342   MDIPSSPELAGCINPVDNLKTSPPSFSDHDADFKPACAPVDEAVQESAVEATNPTAARP-  400

Query  1280  VGGNDVFWQQFLTE  1321
              G ND FW+ +LTE
Sbjct  401   -GVNDHFWEYYLTE  413



>gb|KHG25080.1| Heat stress transcription factor A-4a -like protein [Gossypium 
arboreum]
Length=403

 Score =   239 bits (610),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 169/404 (42%), Positives = 227/404 (56%), Gaps = 56/404 (14%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD  QG S+S  PFLAKTYE+VDD +  ++VSWS   +SFVVWNPPEFARDLLP++FKHN
Sbjct  1     MDDAQGSSSSLPPFLAKTYEMVDDPSTDSIVSWSASDKSFVVWNPPEFARDLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG---V  709
             NFSSFIRQLNTYGFRKID EQWEFAND+FIRGQ HLLKNIHRRKP+HS+S Q + G    
Sbjct  61    NFSSFIRQLNTYGFRKIDPEQWEFANDDFIRGQPHLLKNIHRRKPVHSYSMQSHLGQGAS  120

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
              L+E ER+   +EIERLK E   L +EL R EQE +  + + + L  RLQ ++ RQ+ ++
Sbjct  121   SLTESERQNLRDEIERLKNEKELLALELKRHEQERQGFQLQMRLLRERLQDMERRQQIMM  180

Query  890   ALVAQLSLKP----DLLHHLEVHNKKRK--------------PSVSNGHLELVNNLDSS-  1012
             + VA++  KP    +L   LE +++KR+               S +   L    N+DS+ 
Sbjct  181   SSVARVLQKPGGAINLTPQLETNDRKRRLTRIAYLYDEAGIEDSQTGNSLIARENVDSTS  240

Query  1013  ---ITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLH------T  1165
                +   +++ + +   E A  +F         +      ++  DTP IS +        
Sbjct  241   LSNMEPFEQLESSMVFWENAVHDFGQTNIQHESNLELDESTSCVDTPAISCIQLNIDARL  300

Query  1166  KHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE--------  1321
             K PG D N++ A+    V V       E  + T A    G ND+FW+QFLTE        
Sbjct  301   KSPGIDMNSEPAF----VVVSEPITAREQTAGTTAPATTGVNDIFWEQFLTENPGSTDTQ  356

Query  1322  EVeserreigirn-------------greCMIVFAEQMGHFTPA  1414
             EV+SER++                    + +   AEQMGH TPA
Sbjct  357   EVQSERKDSDASKNESKPGDHGKFWWNTKNVNNLAEQMGHLTPA  400



>ref|XP_008381180.1| PREDICTED: heat stress transcription factor A-4b-like [Malus 
domestica]
Length=420

 Score =   239 bits (611),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 159/382 (42%), Positives = 213/382 (56%), Gaps = 62/382 (16%)
 Frame = +2

Query  359   MDGTQGGSA-SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKH  535
             MDG+QGGS  +PAPFL KTY+LVDD +++ +VSWS  G SFVVW+P EFA+++LP YFKH
Sbjct  1     MDGSQGGSGGAPAPFLTKTYDLVDDPSSNHMVSWSETGSSFVVWDPTEFAKEMLPMYFKH  60

Query  536   NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPN--SGV  709
             NNFSSF+RQLNTYGFRKID EQWEFAN+EF+RG  HLL NIHRRKPIHSHS Q +  S V
Sbjct  61    NNFSSFVRQLNTYGFRKIDPEQWEFANEEFLRGGRHLLTNIHRRKPIHSHSLQNHEYSSV  120

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
             PL++ ER E+E++I RL  + S L +E+ R ++E++E  F+ Q L  +LQ+++ RQRQ  
Sbjct  121   PLTDTEREEYEKKINRLNHDKSLLELEVQRHQRESQEFEFQIQILREQLQNMENRQRQYT  180

Query  890   ALVAQLSLKPD----LLHHLEVHNKKRKPSVSN------GHLELVNN-------------  1000
             A +AQL  KP     L+   E+H+KKR+   SN      G  +L  N             
Sbjct  181   AFLAQLVQKPGFASVLVQQSEIHSKKRRLLKSNHFPDDFGMEDLTLNPQKETLGIKLDQX  240

Query  1001  --LDSSITVCQKILNGISNG-EEAYGNFETLPQA----------PSGDSRFSSPSTQTDT  1141
               ++SS+      L+G+     E   +   L QA           S +SR  SP +   +
Sbjct  241   EKMESSLNFWXDFLHGVGEAMPEEVNDIGPLSQASPIIVTEIQDTSMNSRPCSPRSHISS  300

Query  1142  PEISSLHTKHPGADGNAK------AAWNCAAVDVDRLKDRLEGRSSTAAVPVVG------  1285
             P   + H+  P   G+A           C  VD       ++  S     P +       
Sbjct  301   PNSMNAHS-FPEVAGSANLFDILAITSMCHTVDFRSKSSGIDMNSKPDXAPALDSSKENV  359

Query  1286  ----------GNDVFWQQFLTE  1321
                        NDVFW+Q LTE
Sbjct  360   VQVKNAEPAKANDVFWEQCLTE  381



>ref|XP_008383593.1| PREDICTED: heat stress transcription factor A-4c-like [Malus 
domestica]
Length=425

 Score =   240 bits (612),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 153/377 (41%), Positives = 211/377 (56%), Gaps = 63/377 (17%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             M+  QGG++S  PFL+KTYE+VDD    ++VSWS   +SF+VWNPPEFARDLLPK+FKHN
Sbjct  1     MEEVQGGTSSLPPFLSKTYEMVDDALTDSIVSWSASNKSFIVWNPPEFARDLLPKFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ----PNSG  706
             NFSSFIRQLNTYGFRKID EQWEF ND+FIRGQ H++K I RRKP+HSHS Q       G
Sbjct  61    NFSSFIRQLNTYGFRKIDPEQWEFXNDDFIRGQPHIMKKIRRRKPVHSHSLQNLQVQGQG  120

Query  707   VPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQV  886
               LSE ER+  ++EIERLK E   L VE+ R EQE      + Q L  RLQ ++++Q+ +
Sbjct  121   TSLSEAERQSMKDEIERLKHEKERLGVEVQRHEQERHXLELQMQFLMDRLQHMEKQQQSM  180

Query  887   LALVAQLSLKPDL----LHHLEVHNKKRK-PSVS----------------------NGHL  985
              A VA++  KP +    +  LEV  +KR+ P +S                      NG  
Sbjct  181   AAFVARVLHKPGIASNPVPQLEVRERKRRLPRISWSFDDAXSGYNQMVTSQAVIRENGGT  240

Query  986   ELVNNLDSSITVCQKILNGISNGEEAYGNFET--LPQAPSGDSRFSSPSTQTDTPEISSL  1159
             E +  L+S +T  +  ++ + +     G+       ++ SG+   +  S Q +    + +
Sbjct  241   EKLEQLESFLTFWEDTIHDVGHNNVQVGSTSNREADESTSGNESTALSSIQLN----ADI  296

Query  1160  HTKHPGADGNAK-----------------------AAWNCAAVDVDRLKDRLEGRSSTAA  1270
              +K PG D NA+                       A+    A+     K++  G  +TA+
Sbjct  297   RSKSPGIDMNAEPPASVAPKPAASQSSKEQTAGIAASAPTTALTQQTSKEKXAG--TTAS  354

Query  1271  VPVVGGNDVFWQQFLTE  1321
              P  G ND+FW+QFLTE
Sbjct  355   AP-TGVNDIFWEQFLTE  370



>ref|XP_011039379.1| PREDICTED: heat stress transcription factor A-4a [Populus euphratica]
Length=404

 Score =   238 bits (607),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 148/353 (42%), Positives = 210/353 (59%), Gaps = 36/353 (10%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD +QG S S  PFLAK YE+VDD +  ++VSWS+  +SFVVWNPPEFARDLLP++FKHN
Sbjct  1     MDESQGTSNSLPPFLAKAYEMVDDPSTDSIVSWSQNNKSFVVWNPPEFARDLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVP--  712
             NFSSFIRQLNTYGFRKID EQWEFAN++FIRGQ HL+KNIHRRKP+HSHS Q   G    
Sbjct  61    NFSSFIRQLNTYGFRKIDPEQWEFANEDFIRGQPHLMKNIHRRKPVHSHSMQNLQGQGSN  120

Query  713   -LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
              L++ ER+  +++IE+LK+E  +L +EL ++EQE +    + + L  +LQ  +  Q+ ++
Sbjct  121   LLTDSERQSMKDDIEKLKREKQALILELQKQEQERKGFDMQIEGLKEKLQQTECIQQTIV  180

Query  890   ALVAQLSLKP----DLLHHLEVHNKKRK-PSVSNGHLELVNNLDSSITVCQKILNGISNG  1054
             + VA++  KP    +++  LE  ++KR+ P +   + E  N  +  +T          + 
Sbjct  181   SFVARVLPKPGLALNIMPQLEGQDRKRRLPRIGYLYSEASNEDNQMVTSHALSRENADSN  240

Query  1055  EEAYGNFETLPQAPSG-----------DSRFSSPSTQTD-------TPEISSLHT-----  1165
               A  N E   Q  S               +++ + + D       +P IS +H      
Sbjct  241   SVALLNMEQFEQLESSLTFWENMVHDIGQTYNNSTIEMDDSTSGAQSPAISCVHLNVDFR  300

Query  1166  -KHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
              K PG D N++ +   AA +    K++  G + T A    G NDVFW+QFLTE
Sbjct  301   PKSPGIDMNSEPS-AAAAPEPVSPKEQPAGTAPTVA---TGVNDVFWEQFLTE  349



>ref|XP_002321069.1| hypothetical protein POPTR_0014s13780g [Populus trichocarpa]
 gb|EEE99384.1| hypothetical protein POPTR_0014s13780g [Populus trichocarpa]
Length=443

 Score =   239 bits (610),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 159/208 (76%), Gaps = 8/208 (4%)
 Frame = +2

Query  359  MDGTQGGSA-SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKH  535
            MDG+Q  S+ +P PFL KTY++VDD   ++VVSWS  G SFVVWNPPEFA+DLLPKYFKH
Sbjct  1    MDGSQSNSSNAPPPFLTKTYDMVDDPLTNSVVSWSHSGCSFVVWNPPEFAQDLLPKYFKH  60

Query  536  NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGV--  709
            NNFSSF+RQLNTYGFRKID +QWEF N+EFIRGQ H+LKNIHRRKP+HSHS Q N G+  
Sbjct  61   NNFSSFVRQLNTYGFRKIDPDQWEFGNEEFIRGQRHILKNIHRRKPVHSHSMQ-NHGIIS  119

Query  710  PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
            PL+E E++E+E+EI RLK + + L +EL R E E +   F+  SL  RLQS++ RQ+Q++
Sbjct  120  PLAETEKQEYEKEINRLKHDKNELELELQRNEAEKQGFEFQIVSLGERLQSMECRQKQLM  179

Query  890  ALVAQLSLKPD----LLHHLEVHNKKRK  961
            + + QL  KP+    L+   E HNKKRK
Sbjct  180  SFLGQLMRKPEFASLLMQQSEYHNKKRK  207



>ref|XP_010242159.1| PREDICTED: heat stress transcription factor A-4b-like [Nelumbo 
nucifera]
Length=446

 Score =   239 bits (610),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 164/397 (41%), Positives = 221/397 (56%), Gaps = 82/397 (21%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MDG+QG S  P PFL KTYE+VDD + ++VVSWS   RSF+VWNPPEF+RDLLPKYFKHN
Sbjct  1     MDGSQGSSNVPPPFLTKTYEMVDDPSTNSVVSWSPNNRSFIVWNPPEFSRDLLPKYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG--VP  712
             NFSSF+RQLNTYGFRK+D +QWEFAN++FIRGQ HLLKNI+RRKP+HSHS Q N G    
Sbjct  61    NFSSFVRQLNTYGFRKVDPDQWEFANEDFIRGQRHLLKNIYRRKPVHSHSQQ-NQGNSTG  119

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             LSE ER++ EEEIERLK E S L ++L +  QE++    +  SL+  L  +   QRQ+++
Sbjct  120   LSESERQDLEEEIERLKHEKSMLVMDLQKHTQEHQGIELQMLSLEQHLHKLQHHQRQIIS  179

Query  893   LVAQLSLKP----DLLHHLEVHNKKRK-PSVSNGH-------------------------  982
              ++Q+  KP    +L+   E + KKR+ P +   +                         
Sbjct  180   FLSQILQKPGFDSNLMQEPENYKKKRRLPKLDYLYDEADVEENQVLTFQKEKSDVISMPV  239

Query  983   --LELVNNLDSSITVCQKILN--GISNGEEA---------YGNFETLPQAPSGD------  1105
               +E    L+SS+   +  L   G ++GEE          Y    T   A SGD      
Sbjct  240   IDIEPFERLESSLNSWENFLQDVGQASGEEMSPVGAVLQPYTVVFTEIDASSGDPNIDVE  299

Query  1106  -------------------SRFSSPSTQTDTPEISS------LHTKHPGADGNAKAAWNC  1210
                                S  +   + +++P ISS      L ++  G D N+K A   
Sbjct  300   TQSPKLHPSSPHSRDIYSSSELAGSRSHSESPVISSVQFSADLQSRASGIDMNSKPA---  356

Query  1211  AAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
             AA +V   K+++ G  ++A    V  NDVFW+QFLTE
Sbjct  357   AASEVLESKEQVVGMKTSAVPKRV--NDVFWEQFLTE  391



>ref|XP_010518819.1| PREDICTED: heat stress transcription factor A-4a [Tarenaya hassleriana]
Length=391

 Score =   238 bits (606),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 152/345 (44%), Positives = 203/345 (59%), Gaps = 36/345 (10%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD  QGGS+S  PFLAKTYE+VDD +  +VVSWS+G +SFVVWNPPEF+RDLLP++FKHN
Sbjct  1     MDENQGGSSSLPPFLAKTYEMVDDPSTDSVVSWSQGNKSFVVWNPPEFSRDLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGV-PL  715
             NFSSFIRQLNTYGFRKID E+WEFAN++F+RGQ HLLKNIHRRKP+HSHS     G  PL
Sbjct  61    NFSSFIRQLNTYGFRKIDPEKWEFANNDFVRGQPHLLKNIHRRKPVHSHSLHNLQGQNPL  120

Query  716   SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
             +E ER+  +++IERL +E   L  EL ++EQE +    + + L  RLQ +++ Q+ +++ 
Sbjct  121   AESERQSMKDQIERLTKEKEGLLAELHKQEQERQGFELQVKLLKDRLQHLEQLQKTMVSS  180

Query  896   VAQLSLKPDLLHHL----EVHNKKRK-PSVSNGHLELVNNLDSSITV-CQKILNGISNG-  1054
             VAQ+  KP L   L    E +++KR+ P +  G+ +    L+ + T   Q+I    S G 
Sbjct  181   VAQVLQKPGLALKLSPKSETNDRKRRLPRI--GYFQDETGLEENQTCNSQRIGRENSPGP  238

Query  1055  ---------EEAYGNFETLPQAPSGDSRFSSPSTQTD-------TPEISSLHTKHPGADG  1186
                      E +   +E L     G    SS + + D       +P IS L         
Sbjct  239   SHAEQVEQLESSLAFWENLVSDVDGSLAQSSMNLEVDESTSCAESPSISCLELNIDARPK  298

Query  1187  NAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
             + +   N   V                A P  G NDVFW+QFLTE
Sbjct  299   SPRIDMNSEPV----------ASKEQPAAPPTGVNDVFWEQFLTE  333



>ref|XP_010665682.1| PREDICTED: heat stress transcription factor A-4c [Beta vulgaris 
subsp. vulgaris]
Length=409

 Score =   238 bits (607),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 148/355 (42%), Positives = 206/355 (58%), Gaps = 36/355 (10%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD  QGGS +  PFL KTYE+VDD +  ++VSWS   +SFVV NPPEF+R LLP++FKHN
Sbjct  2     MDELQGGSNALPPFLTKTYEMVDDPSTDSIVSWSSSNKSFVVLNPPEFSRILLPRFFKHN  61

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-----AQPNS  703
             NFSSFIRQLNTYGFRK+D EQWEFAND+FIRGQ+HLLKNIHRRKP+HSHS      Q NS
Sbjct  62    NFSSFIRQLNTYGFRKVDPEQWEFANDDFIRGQSHLLKNIHRRKPVHSHSLTNLHGQVNS  121

Query  704   GVPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQ  883
               PL++ ER++++++IERLK E   L +E  R+ QE ++   + Q L  RLQ +++RQ  
Sbjct  122   N-PLTDSERQKYKDDIERLKHEREFLLLESQRQRQEEQDIELQVQPLRERLQHMEQRQHT  180

Query  884   VLALVAQLSLKPDLLHHLEVHNKKRKPSVSN-----------------------GHLELV  994
              ++  AQL  KP+L    ++ N+ RK  VS+                       G  +  
Sbjct  181   FVSYFAQLLQKPELALEPQLENQDRKRRVSSRPEHFNDETSNEDSMCTVRTSRKGSPDYA  240

Query  995   NNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEIS--SLHTK  1168
             + LD    + +++ + +S  E    +   L    +     +  ++   +P IS   L+  
Sbjct  241   SGLDLDTELLERMESSLSFWETVVEDIGGLSVQRNSSIELAESTSCVQSPAISYTQLNID  300

Query  1169  HPG----ADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
              P      D N++ +   + V  DR+    E  + TA     G NDVFW+QFLTE
Sbjct  301   VPSNSSRIDMNSEPSVTASVVAPDRVPQE-EQEAGTAPAAPQGVNDVFWEQFLTE  354



>gb|KDO58614.1| hypothetical protein CISIN_1g015162mg [Citrus sinensis]
Length=412

 Score =   238 bits (607),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 155/201 (77%), Gaps = 6/201 (3%)
 Frame = +2

Query  371  QGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSS  550
            QG S SPAPFL KTYE+VDD   +++VSWS+ G SF+VWNPP+FA+DLLP YFKHNNFSS
Sbjct  7    QGSSNSPAPFLIKTYEMVDDPLTNSLVSWSQSGGSFIVWNPPDFAKDLLPLYFKHNNFSS  66

Query  551  FIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeper  730
            F+RQLNTYGFRKID +QWEFAN+EFIRGQ HLLKNIHRRKP+HSHS Q  S  P++E ER
Sbjct  67   FVRQLNTYGFRKIDPDQWEFANEEFIRGQRHLLKNIHRRKPVHSHSTQ--SPTPITETER  124

Query  731  refeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLS  910
             EFE +IERLK+ENS L++EL RRE  N E  +  QS+  RL+ ++ RQ Q++A +A L 
Sbjct  125  NEFEAKIERLKKENSLLQLELRRRESGNHEFEYHVQSVRERLRYLENRQTQMIACLANLL  184

Query  911  LKPD----LLHHLEVHNKKRK  961
             KP     L    EVH+KKR+
Sbjct  185  KKPGFSSALNQQAEVHSKKRR  205



>ref|XP_011033721.1| PREDICTED: heat stress transcription factor A-4b-like [Populus 
euphratica]
Length=444

 Score =   238 bits (608),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 158/208 (76%), Gaps = 8/208 (4%)
 Frame = +2

Query  359  MDGTQGGSA-SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKH  535
            MDG+Q  S+ +P PFL KTY++VDD   ++VVSWS  G SFVVWNPPEFA+DLLPKYFKH
Sbjct  1    MDGSQSNSSNAPPPFLTKTYDMVDDPLTNSVVSWSHSGCSFVVWNPPEFAQDLLPKYFKH  60

Query  536  NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGV--  709
            NNFSSF+RQLNTYGFRKID +QWEF N+EFIRGQ HLLKNIHRRKP+HSHS Q N G+  
Sbjct  61   NNFSSFVRQLNTYGFRKIDPDQWEFGNEEFIRGQRHLLKNIHRRKPVHSHSMQ-NHGIIS  119

Query  710  PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
            PL+E E++E+E EI RLK + + L ++L R E E +   F+  SL  RLQS++ RQ+Q++
Sbjct  120  PLAETEKQEYEREINRLKHDRNELELQLQRNEAEKQGFEFQIVSLGERLQSMECRQKQLM  179

Query  890  ALVAQLSLKPD----LLHHLEVHNKKRK  961
            + + QL  KP+    L+   E HNKKRK
Sbjct  180  SFLVQLMRKPEFASLLMQQSEYHNKKRK  207



>ref|XP_008225237.1| PREDICTED: heat stress transcription factor A-4c-like [Prunus 
mume]
Length=412

 Score =   237 bits (605),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 154/362 (43%), Positives = 207/362 (57%), Gaps = 46/362 (13%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD  QGG++S  PFL+KTY++VDD +  ++VSWS   +SF+VWNPPEFARDLLPK+FKHN
Sbjct  1     MDEVQGGASSLPPFLSKTYDMVDDASTDSIVSWSASNKSFIVWNPPEFARDLLPKFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ----PNSG  706
             NFSSFIRQLNTYGFRKID EQWEFAND+FIRGQ +L+KNIHRRKP+HSHS Q      +G
Sbjct  61    NFSSFIRQLNTYGFRKIDPEQWEFANDDFIRGQPNLMKNIHRRKPVHSHSLQNLQVQGNG  120

Query  707   VPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQV  886
               LSE ER+  ++EIERLK E   L VEL R EQE +    + Q L  RLQ ++ +Q+ +
Sbjct  121   TSLSESERQSMKDEIERLKHEKERLGVELQRLEQERQGLELQMQFLKERLQHMERQQQTM  180

Query  887   LALVAQLSLKPDL----LHHLEVHNKKRK-PSV-------SNGH---------------L  985
              + VA++  KP +    +  LE+H +KR+ P +       SNG+               +
Sbjct  181   TSFVARVLQKPGIASNPVPQLEIHGRKRRLPRIGWSYDEASNGNNQVASSQAGIRENADM  240

Query  986   ELVNNLDSSITVCQKILNGISNGE-EAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLH  1162
             E +  L+S +T  +  +  +     +   N E L ++ S     +  S Q +        
Sbjct  241   EKLEQLESFLTFWEDTIFDVGEAHIQVVSNVE-LDESTSCVESAAISSIQLNV----DAQ  295

Query  1163  TKHPGADGNAKAAWNCAAVDV---------DRLKDRLEGRSSTAAVPVVGGNDVFWQQFL  1315
              K PG D N++ A   A              + +   E  S   A    G NDVFW+ FL
Sbjct  296   PKSPGIDMNSEPAVVVAPEPAAAVPPEPASSKQQSSKEQTSGITASTPTGVNDVFWEHFL  355

Query  1316  TE  1321
             TE
Sbjct  356   TE  357



>ref|XP_002305052.2| hypothetical protein POPTR_0004s06090g [Populus trichocarpa]
 gb|EEE85563.2| hypothetical protein POPTR_0004s06090g [Populus trichocarpa]
Length=407

 Score =   236 bits (603),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 150/356 (42%), Positives = 211/356 (59%), Gaps = 39/356 (11%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD +QG   S  PFLAKTYE+VDD +   +VSWS+  +SF VW+PPEFARDLLP++FKHN
Sbjct  1     MDESQGSPNSLPPFLAKTYEMVDDPSTDPIVSWSQSNKSFTVWDPPEFARDLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVP--  712
             NFSSFIRQLNTYGFRKID EQWEFAN++FIRGQ  L+KNIHRRKP+HSHS Q   G    
Sbjct  61    NFSSFIRQLNTYGFRKIDPEQWEFANEDFIRGQPFLMKNIHRRKPVHSHSLQNLQGQGSN  120

Query  713   -LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
              L++ ER+  +++IERLK++  +L +EL  +EQE +    + + L  +LQ ++ RQ+ ++
Sbjct  121   LLTDSERQSMKDDIERLKRDKEALILELQMQEQERKGFEMQIEGLKEKLQQMERRQQTMV  180

Query  890   ALVAQLSLKP----DLLHHLEVHNKKRK-PSVSNGHLELVNNLDSSITVCQKILNGISNG  1054
             + V ++  KP    +L+  LE H++KR+ P +   H E  +N D+     Q +    ++G
Sbjct  181   SFVTRVMPKPGLALNLMPQLEGHDRKRRLPRIGCLHSEASSNEDNQTVTSQALSRENADG  240

Query  1055  EE-AYGNFETLPQAPSGDSRFS----------SPSTQT----------DTPEIS------  1153
                A  N E   Q  S  + +           S +T+T          ++P IS      
Sbjct  241   NSFALLNMEQFEQLESSLTFWENMVNDVVQTHSHNTKTIEMDESTSGAESPAISCAQLIF  300

Query  1154  SLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                 K PG D N++ +    AV  + +  + E  + TA     G NDVFW+QFLTE
Sbjct  301   DFRPKTPGIDMNSEPS---IAVVPEPVSPK-EQPAGTAPAVATGVNDVFWEQFLTE  352



>ref|XP_009370956.1| PREDICTED: heat stress transcription factor A-4c-like [Pyrus 
x bretschneideri]
 ref|XP_009370957.1| PREDICTED: heat stress transcription factor A-4c-like [Pyrus 
x bretschneideri]
 ref|XP_009370958.1| PREDICTED: heat stress transcription factor A-4c-like [Pyrus 
x bretschneideri]
 ref|XP_009370959.1| PREDICTED: heat stress transcription factor A-4c-like [Pyrus 
x bretschneideri]
Length=440

 Score =   237 bits (604),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 155/387 (40%), Positives = 211/387 (55%), Gaps = 66/387 (17%)
 Frame = +2

Query  359   MDGTQGGSA-SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKH  535
             M+G+QGGS  +PAPFL KTY+LVDD +++ +VSWS  G SFVVW+P EFA+++LP YFKH
Sbjct  1     MEGSQGGSGGAPAPFLTKTYDLVDDPSSNHMVSWSESGSSFVVWDPTEFAKEMLPMYFKH  60

Query  536   NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNS-GVP  712
             NNFSSF+RQLNTYGFRKID EQWEFAN+EF+RG  HLLKNIHRRKPIHSHS Q +   V 
Sbjct  61    NNFSSFVRQLNTYGFRKIDPEQWEFANEEFLRGGRHLLKNIHRRKPIHSHSMQNHEYTVA  120

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             L + ER E+E++I RL  + S L +EL R ++EN+E  F+ Q L  +LQ+++ RQ+Q  A
Sbjct  121   LRDTEREEYEKKISRLNHDKSLLELELQRHQRENQEFEFQVQILREQLQNMENRQKQYTA  180

Query  893   LVAQLSLKPD----LLHHLEVHNKKRKPSVSNG---------------------------  979
              +AQL  KP     L+   E+H+KKR+   SN                            
Sbjct  181   FLAQLVQKPGFASVLVQQSEIHSKKRRLLNSNHFPDDFGMEGLNLNPQKENLGSISTPII  240

Query  980   HLELVNNLDSSITVCQKILNGISNG-----------EEAYGNFETLPQAPSGDSRFSSPS  1126
              L+ +  ++SS+   +  ++GI               +A     T  Q  S +SR  SP 
Sbjct  241   KLDQLEKMESSLNFWEDFVHGIGEAMPEDVNDICPLSQASSIIVTEIQDTSMNSRPCSPR  300

Query  1127  TQTDTPEISSLHTKHPGADGNAKA------AWNCAAVDVDRLKDRLEGRSSTAAVPVVG-  1285
             +   +P   + H+    A G+A           C  VD       ++  S   + P +  
Sbjct  301   SHLSSPNSMNAHSFPEVAAGSANILDILAITSMCPTVDFRSKSSGIDMNSKPDSAPALAK  360

Query  1286  ---------------GNDVFWQQFLTE  1321
                             NDVFW+Q LTE
Sbjct  361   EMVVELEVKNAAPTKANDVFWEQCLTE  387



>ref|NP_001281032.1| heat stress transcription factor A-4b-like [Malus domestica]
 gb|ADL36730.1| HSF domain class transcription factor [Malus domestica]
Length=440

 Score =   236 bits (603),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 155/391 (40%), Positives = 215/391 (55%), Gaps = 74/391 (19%)
 Frame = +2

Query  359   MDGTQGGSA-SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKH  535
             M+G+QGGS  +PAPFL KTY+LVDD +++ +VSW+  G SFVVW+P EFA+++LP YFKH
Sbjct  1     MEGSQGGSGGAPAPFLTKTYDLVDDPSSNHMVSWTESGSSFVVWDPTEFAKEMLPMYFKH  60

Query  536   NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNS-GVP  712
             NNFSSF+RQLNTYGFRKID EQWEFAN+EF+RG  HLLKNIHRRKPIHSHS Q +   V 
Sbjct  61    NNFSSFVRQLNTYGFRKIDPEQWEFANEEFLRGGRHLLKNIHRRKPIHSHSMQNHEYTVA  120

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             LS+ ER E+E++I RL  + S L +EL R ++EN+E  F+ Q L  +LQ+++ RQ+Q  A
Sbjct  121   LSDTEREEYEKKISRLNHDKSLLELELQRHQRENQEFEFQVQILREQLQNMENRQKQYTA  180

Query  893   LVAQLSLKPD----LLHHLEVHNKKRKPSVSNG---------------------------  979
              +AQL  KP     L+   E+H+KKR+   SN                            
Sbjct  181   FLAQLVQKPGFASVLVQQSEIHSKKRRLLNSNNFPDDFGMEGLNLNPQKENLGSISTPII  240

Query  980   HLELVNNLDSSITVCQKILNGISNG-----------EEAYGNFETLPQAPSGDSRFSSPS  1126
              L+ +  ++SS+   +  L+GI               +A     T  Q  S +SR  SP 
Sbjct  241   KLDQLETMESSLNFWEDFLHGIGEAMPEDVNDIGPLSQASPIIVTETQDTSLNSRPCSPR  300

Query  1127  TQTDTP-------------------EISSLHTKHPGADGNAKAAWNCAAVDVDRLKDRLE  1249
             +   +P                   +I S+ +  P  D  +K+    + +D++   D   
Sbjct  301   SHLSSPNSMNAHSFPEVAAGSANILDILSITSMFPTVDFRSKS----SGIDMNSKPDSAP  356

Query  1250  GRSSTAAVPV-------VGGNDVFWQQFLTE  1321
               +    V +          NDVFW+Q LTE
Sbjct  357   ALAKEMVVELEVKNAEPTKANDVFWEQCLTE  387



>ref|XP_008228879.1| PREDICTED: heat stress transcription factor A-4b-like [Prunus 
mume]
Length=437

 Score =   236 bits (602),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 164/391 (42%), Positives = 219/391 (56%), Gaps = 76/391 (19%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             M+GTQGGS +PAPFL KTY+LVDD +++ VVSWS  G SFVVW+P EFA+++LP YFKHN
Sbjct  1     MEGTQGGSNAPAPFLTKTYDLVDDPSSNRVVSWSETGCSFVVWDPTEFAKEMLPMYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPN--SGVP  712
             NFSSF+RQLNTYGFRKID EQWEFAN+EF+RG  HLLK IHRRKPIHSHS Q +  S VP
Sbjct  61    NFSSFVRQLNTYGFRKIDPEQWEFANEEFLRGGRHLLKKIHRRKPIHSHSMQNHEYSSVP  120

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             LSE ER E+E++I RL  + S L +EL R ++EN+E  ++ Q L  +LQ ++ +Q+Q  +
Sbjct  121   LSETEREEYEKKINRLNHDKSLLELELQRHQRENQEFDYQIQILQEQLQKMEHQQKQYTS  180

Query  893   LVAQLSLKPD----LLHHLEVHNKKRKPSVS-----NGHLELVN----------------  997
             ++AQL  KP     L+   E+HNKKR+   S     +  +E++N                
Sbjct  181   VLAQLLQKPGLASILMQKSEIHNKKRRLLTSSHVTDDFKMEILNFNTQNENLGTISTPII  240

Query  998   ------NLDSSITVCQKILNGISNG-EEAYGNFETLPQAP-----------------SGD  1105
                    ++SS+   +  L+GI     E   +   L QA                  S  
Sbjct  241   KLDQLEKMESSLNFWEDFLHGIGEAMPEEVNDIGLLSQASPIIVTEIQDPGMNSRPCSPR  300

Query  1106  SRFSSP-STQTDTPEI-------------SSLHT-----KHPGADGNAKAAWNCAAVDVD  1228
             SR SSP S    +PE+             S+ H      K  G D N+K     AA  + 
Sbjct  301   SRLSSPNSMNVSSPEVVGSANFLDILAITSTCHNVDFRPKSSGIDMNSKPDTASAAEALK  360

Query  1229  RLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
              +   ++     AA      ND+FW+Q LTE
Sbjct  361   EMVQEMKNAEPAAA------NDMFWEQCLTE  385



>ref|XP_008342767.1| PREDICTED: heat stress transcription factor A-4b-like [Malus 
domestica]
Length=440

 Score =   236 bits (602),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 156/391 (40%), Positives = 216/391 (55%), Gaps = 74/391 (19%)
 Frame = +2

Query  359   MDGTQGGSA-SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKH  535
             M+G+QGGS  +PAPFL KTY+LVDD +++ +VSW+  G SFVVW+P EFA+++LP YFKH
Sbjct  1     MEGSQGGSGGAPAPFLTKTYDLVDDPSSNHMVSWTESGSSFVVWDPTEFAKEMLPMYFKH  60

Query  536   NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNS-GVP  712
             NNFSSF+RQLNTYGFRKID EQWEFAN+EF+RG  HLLKNIHRRKPIHSHS Q +   V 
Sbjct  61    NNFSSFVRQLNTYGFRKIDPEQWEFANEEFLRGGRHLLKNIHRRKPIHSHSMQNHEYTVA  120

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             LS+ ER E+E++I RL  + S L +EL R ++EN+E  F+ Q L  +LQ+++ RQ+Q  A
Sbjct  121   LSDTEREEYEKKISRLNHDKSLLELELQRHQRENQEFEFQVQILREQLQNMENRQKQYTA  180

Query  893   LVAQLSLKPD----LLHHLEVHNKKRKPSVSNG---------------------------  979
              +AQL  KP     L+   E+H+KKR+   SN                            
Sbjct  181   FLAQLVQKPGFASVLVQQSEIHSKKRRLLNSNXFPDDFGMEGLNLNPQKENLGSISTPII  240

Query  980   HLELVNNLDSSITVCQKILNGISNG-EEAYGNFETLPQA----------PSGDSRFSSPS  1126
              L+ +  ++SS+   +  L+GI     E   +   L QA           S +SR  SP 
Sbjct  241   KLDQLEXMESSLNFWEDFLHGIGEAMPEDVNDIGPLSQASPIIVTEXQDTSXNSRPCSPR  300

Query  1127  TQTDTP-------------------EISSLHTKHPGADGNAKAAWNCAAVDVDRLKDRLE  1249
             +   +P                   +I S+ +  P  D  +K+    + +D++   D   
Sbjct  301   SHLSSPNSMNAHSFPEVAAGSANILDILSITSMFPTVDFRSKS----SGIDMNSKPDSAP  356

Query  1250  GRSSTAAVPV-------VGGNDVFWQQFLTE  1321
               +    V +          NDVFW+Q LTE
Sbjct  357   ALAKEMVVELEVKNAEPTKANDVFWEQCLTE  387



>ref|XP_007025290.1| HSF domain class transcription factor [Theobroma cacao]
 gb|EOY27912.1| HSF domain class transcription factor [Theobroma cacao]
Length=405

 Score =   234 bits (597),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 152/356 (43%), Positives = 205/356 (58%), Gaps = 41/356 (12%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD  QG S+S  PFL KT+E+VDD +  +VVSWS   +SF+VWNPPEFARDLLP++FKHN
Sbjct  1     MDDAQGSSSSLPPFLTKTFEMVDDPSTDSVVSWSASDKSFIVWNPPEFARDLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG---V  709
             NFSSFIRQLNTYGFRK+D EQWEFAN++FIRGQ HLLKNIHRRKP+HSHS Q   G    
Sbjct  61    NFSSFIRQLNTYGFRKVDPEQWEFANEDFIRGQPHLLKNIHRRKPVHSHSMQNLLGQGAS  120

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
             PL+E ER+   +EIE LK E  SL +EL R EQE +    + + L  RLQ +++RQ+ ++
Sbjct  121   PLTESERQNLTDEIEGLKSEKESLVLELKRHEQERQGFEMQMRLLRERLQHMEQRQQIMV  180

Query  890   ALVAQLSLKP----DLLHHLEVHNKKRK----------------------------PSVS  973
             + VAQ+  KP    +L   LE +++KR+                             S S
Sbjct  181   SSVAQVLQKPGFAINLTPQLEANDRKRRLPRIAYLYDEAGIEDNQKGSSQIARENADSTS  240

Query  974   NGHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEIS  1153
               ++E    L+SS+   + +++          +   L ++ S      SP+       + 
Sbjct  241   LSNMEPFEQLESSMVFWENVVHDFGQTNIQLNSNLELDESTSC---AESPAISGMQLSVD  297

Query  1154  SLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
             + H K PG D N++ A   A+  V   +      +  AA    G NDVFW+QFLTE
Sbjct  298   AQH-KSPGIDMNSEPATVVASEPVTAKEQAAGSTAPAAAP--AGANDVFWEQFLTE  350



>ref|XP_009354248.1| PREDICTED: heat stress transcription factor A-4c-like [Pyrus 
x bretschneideri]
 ref|XP_009354249.1| PREDICTED: heat stress transcription factor A-4c-like [Pyrus 
x bretschneideri]
Length=440

 Score =   234 bits (598),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 155/387 (40%), Positives = 210/387 (54%), Gaps = 66/387 (17%)
 Frame = +2

Query  359   MDGTQGGSA-SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKH  535
             M+G+QGGS  +PAPFL KTY+LVDD +++ +VSWS  G SFVVW+P EFA+++LP YFKH
Sbjct  1     MEGSQGGSGGAPAPFLTKTYDLVDDPSSNHMVSWSESGSSFVVWDPTEFAKEMLPMYFKH  60

Query  536   NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNS-GVP  712
             NNFSSF+RQLNTYGFRKID EQWEFAN+EF+RG  HLLKNIHRRKPIHSHS Q +   V 
Sbjct  61    NNFSSFVRQLNTYGFRKIDPEQWEFANEEFLRGGRHLLKNIHRRKPIHSHSMQNHEYTVA  120

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             L + ER E+E++I RL  + S L +EL R ++EN+E  F+ Q L  +LQ+++ RQ+Q  A
Sbjct  121   LRDTEREEYEKKISRLNHDKSLLELELQRHQRENQEFEFQVQILREQLQNMENRQKQYTA  180

Query  893   LVAQLSLKPD----LLHHLEVHNKKRKPSVSNG---------------------------  979
              +AQL  KP     L+   E+H+KKR+   SN                            
Sbjct  181   FLAQLVQKPGFASVLVQQSEIHSKKRRLLNSNHFPDDFGMEGLNLNPQKENLGSISTPII  240

Query  980   HLELVNNLDSSITVCQKILNGISNGEEAYGN-----------FETLPQAPSGDSRFSSPS  1126
              L+ +  ++SS+   +  ++GI        N             T  Q  S +SR  SP 
Sbjct  241   KLDQLEKMESSLNFWEDFVHGIGEAMPEDVNDICPLSQISPVIVTEIQDTSMNSRPCSPR  300

Query  1127  TQTDTPEISSLHTKHPGADGNAKA------AWNCAAVDVDRLKDRLEGRSSTAAVPVVG-  1285
             +   +P   + H+    A G+A           C  VD       ++  S   + P +  
Sbjct  301   SHLSSPNSMNAHSFPEVAAGSANILDILAITSMCPTVDFRSKSSGIDMNSKPDSAPALAK  360

Query  1286  ---------------GNDVFWQQFLTE  1321
                             NDVFW+Q LTE
Sbjct  361   EMVVELEVKNAAPTKANDVFWEQCLTE  387



>ref|XP_007216966.1| hypothetical protein PRUPE_ppa015468mg, partial [Prunus persica]
 gb|EMJ18165.1| hypothetical protein PRUPE_ppa015468mg, partial [Prunus persica]
Length=417

 Score =   233 bits (595),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 159/390 (41%), Positives = 213/390 (55%), Gaps = 74/390 (19%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             M+GTQGGS +PAPFL KTY+LVDD +++ VVSWS  G SFVVW+P EFA+++LP YFKHN
Sbjct  1     MEGTQGGSNAPAPFLTKTYDLVDDPSSNRVVSWSETGCSFVVWDPTEFAKEMLPMYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPN--SGVP  712
             NFSSF+RQLNTYGFRKID EQWEFAN+EF+RG  HLLK IHRRKPIHSHS Q +  S VP
Sbjct  61    NFSSFVRQLNTYGFRKIDPEQWEFANEEFLRGGRHLLKKIHRRKPIHSHSMQNHEYSSVP  120

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             LSE ER E+E++I RL  + S L +EL R ++EN+E  ++ Q L  +LQ ++ +Q+Q   
Sbjct  121   LSETEREEYEKKINRLNHDKSLLELELQRHQRENQEFDYQIQILQEQLQKMEHQQKQYTT  180

Query  893   LVAQLSLKPD----LLHHLEVHNKKRK------------------------------PSV  970
              +AQL  KP     L+   E+HNKKR+                              P +
Sbjct  181   FLAQLLQKPGLASILMQKSEIHNKKRRLLTSSHFPDDFKMEILNLNTLNENLGTISTPII  240

Query  971   SNGHLELVNNLDSSITVCQKILNGISNG-EEAYGNFETLPQA----------PSGDSRFS  1117
                 LE    ++SS+   +  L+GI     E   +  +L QA          P  +SR  
Sbjct  241   KFDQLE---KMESSLNFWEDFLHGIGEAMPEELNDIGSLSQASPIIVTEIQDPGMNSRPC  297

Query  1118  SPSTQTDTPEISSLHTKHPGADGNAK------AAWNCAAVDVDRLKDRLEGRSSTAAVPV  1279
             SP ++  +P  +S++   P   G+A           C  VD       ++  S   + P 
Sbjct  298   SPRSRLSSP--NSMNVSSPEVVGSANFLDILAITSTCHNVDFRPKSSGIDMNSKPDSAPA  355

Query  1280  ----------------VGGNDVFWQQFLTE  1321
                                ND+FW+Q LTE
Sbjct  356   AEALKEMVQEMKNAEPAAANDMFWEQCLTE  385



>ref|XP_010248394.1| PREDICTED: heat stress transcription factor A-4b-like [Nelumbo 
nucifera]
Length=432

 Score =   234 bits (596),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 174/400 (44%), Positives = 224/400 (56%), Gaps = 87/400 (22%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MDG+QG S +P PFL KTYE+VDD   +++VSWS  G SFVVWNPPEFARDLLPKYFKHN
Sbjct  1     MDGSQGSSNAPPPFLTKTYEMVDDLPTNSIVSWSENGNSFVVWNPPEFARDLLPKYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG--VP  712
             NFSSF+RQLNTYGFRKID +QWEF N++FIRGQ HLLKNIHRRKPIHSHS Q   G    
Sbjct  61    NFSSFVRQLNTYGFRKIDPDQWEFGNEDFIRGQRHLLKNIHRRKPIHSHSQQNQHGNSTG  120

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             L E ER+E EEEIE+LK E S L ++L R  QE +    + QSL+ +L  + +RQRQ++A
Sbjct  121   LIESERQELEEEIEKLKHEKSKLILDLQRHTQEQQGIESQMQSLEQKLHQLQQRQRQMMA  180

Query  893   LVAQLSLKP----DLLHHLEVHNKKRK----------------------------PSVSN  976
              + Q+  KP    +L+   E +NKKR+                             S+  
Sbjct  181   FLCQILQKPGVASNLMKDSENYNKKRRLPKLDYLYGEADIEENQVVTFQRERPDAVSMPV  240

Query  977   GHLELVNNLDSSITVCQKILNGI--SNGEEAYGNFETLP---------QAPSGDSRFSSP  1123
              ++E    L+SS+   +  LNG+  ++GEE       L           + SGD      
Sbjct  241   INIEPFEKLESSLNSWETFLNGVGQASGEEMSPVGVALQPSTVVLTEMHSSSGDPDI---  297

Query  1124  STQTDTPEI--SSLHTKH--------------------------------PGADGNAKAA  1201
             + QT++PE+  SS H++                                 PG D N+K A
Sbjct  298   NMQTESPELCQSSPHSRDIHSSLELAGSTSHGESMVISSVQFNADTRSRAPGIDMNSKPA  357

Query  1202  WNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                AA +V    +R+ G S TAA P  G ND+FW+QFLTE
Sbjct  358   ---AASEVQASTERVTG-SMTAAQP-TGVNDLFWEQFLTE  392



>ref|XP_006358092.1| PREDICTED: heat stress transcription factor A-4a-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006358093.1| PREDICTED: heat stress transcription factor A-4a-like isoform 
X2 [Solanum tuberosum]
Length=408

 Score =   233 bits (594),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 166/418 (40%), Positives = 230/418 (55%), Gaps = 79/418 (19%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD     + +  PFLAKTYE+VDD +  A+VSWS   +SF+VWNPP+FARDLLP+YFKHN
Sbjct  1     MDEASCSTNALPPFLAKTYEMVDDPSCDAIVSWSSNNKSFIVWNPPDFARDLLPRYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDE-FIRGQTHLLKNIHRRKPIHSHSAQPNSGV--  709
             NFSSFIRQLNTYGFRKID E+WEFAN+  FIRGQ HLLKNIHRRKP+HSHSAQ   G+  
Sbjct  61    NFSSFIRQLNTYGFRKIDPEKWEFANESNFIRGQPHLLKNIHRRKPVHSHSAQNLHGLSS  120

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
             PL+E ER  ++E+I++L  EN SL ++L R +Q+++    + Q L  R+Q  + RQ+ +L
Sbjct  121   PLTESERHGYKEDIQKLMHENGSLHLDLQRHKQDHQGLELQMQVLTERVQHAEHRQKTML  180

Query  890   ALVAQLSLKP--DLLH--HLEVHNKKRK-------------------------------P  964
             + +AQ   KP  DL H   L+V+++KR+                                
Sbjct  181   SALAQTLDKPVMDLSHMPQLQVNDRKRRFPGNSCLYNESDLEDMRGISSRALSRENMNPS  240

Query  965   SVSNGHLELVNNLDSSITVCQKILNGISN-GEEAYGNFETLPQAPSGDSRFSSPSTQTDT  1141
             S+   + EL++ L+SS+T  + +L  +   G     + E               ++  D+
Sbjct  241   SLLTMNTELLDQLESSLTFWEDVLQDVDQAGIRQNCSLE-----------LDESTSCADS  289

Query  1142  PEIS------SLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFW  1303
             P IS       +  K  G D N++   N    +V   +D+     +   VP  G ND+FW
Sbjct  290   PAISYTQLNVDVGPKASGIDMNSEPNANTTP-EVAEPEDKAAVAETATNVP-TGVNDLFW  347

Query  1304  QQFLTE--------EVeserreigirngreCMI-------------VFAEQMGHFTPA  1414
             +QFLTE        EV+SER++IG +      +               AEQMGH TPA
Sbjct  348   EQFLTENPGSVDAPEVQSERKDIGSKKNESKPVDSGKYWWNMKSVNSLAEQMGHLTPA  405



>ref|XP_009592186.1| PREDICTED: heat stress transcription factor A-4c-like [Nicotiana 
tomentosiformis]
 dbj|BAA83711.1| heat shock factor [Nicotiana tabacum]
Length=408

 Score =   233 bits (593),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 148/363 (41%), Positives = 209/363 (58%), Gaps = 52/363 (14%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD     + +  PFL KTYE+VDD ++ A+VSWS   +SFVVWNPP+FARDLLP+YFKHN
Sbjct  1     MDEATCSTNALPPFLTKTYEMVDDPSSDAIVSWSSSNKSFVVWNPPDFARDLLPRYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFAN-DEFIRGQTHLLKNIHRRKPIHSHSAQPNSGV--  709
             NFSSFIRQLNTYGFRK+D E+WEFAN D F RGQ HLLKNIHRRKP+HSHSAQ   G+  
Sbjct  61    NFSSFIRQLNTYGFRKVDPEKWEFANEDNFFRGQPHLLKNIHRRKPVHSHSAQNLHGLSS  120

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
             PL+E ER+ ++E+I++LK EN SL ++L R +Q+ +    + Q    R+Q ++ RQ+ +L
Sbjct  121   PLTESERQGYKEDIQKLKHENESLHLDLQRHQQDRQGLELQMQVFTERVQHVEHRQKTML  180

Query  890   ALVAQLSLKP--DL--LHHLEVHNKKRK-------------------------------P  964
             + +A++  KP  DL  +  L+V+++KR+                                
Sbjct  181   SALARMLDKPVTDLSRMPQLQVNDRKRRLPGNSCLYNETDLEDTRAISSRALTWENMNPS  240

Query  965   SVSNGHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDT-  1141
             S+   + EL+N LDSS+T  + +L  +            L ++ S     +   TQ +  
Sbjct  241   SLLTINAELLNQLDSSLTFWENVLQDVDQAWIQQNCSLELDESTSCADSPAISYTQLNVD  300

Query  1142  --PEISSLHTK-HPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQF  1312
               P+ S +     P A+ N + A           +D+     +T  VP  G ND+FW+QF
Sbjct  301   VGPKASDIDMNSEPNANTNPEVA---------APEDQAAVAGTTTNVP-TGVNDIFWEQF  350

Query  1313  LTE  1321
             LTE
Sbjct  351   LTE  353



>ref|XP_010655549.1| PREDICTED: heat stress transcription factor A-4a [Vitis vinifera]
 ref|XP_010655550.1| PREDICTED: heat stress transcription factor A-4a [Vitis vinifera]
 ref|XP_010655551.1| PREDICTED: heat stress transcription factor A-4a [Vitis vinifera]
 ref|XP_010655552.1| PREDICTED: heat stress transcription factor A-4a [Vitis vinifera]
 ref|XP_010655553.1| PREDICTED: heat stress transcription factor A-4a [Vitis vinifera]
Length=448

 Score =   233 bits (595),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 164/400 (41%), Positives = 221/400 (55%), Gaps = 85/400 (21%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD + G S SP PFL KTYE+VDD    ++VSWS+  +SF+VWNP +F+RDLLP++FKHN
Sbjct  1     MDESPGSSNSPPPFLTKTYEMVDDPTTDSIVSWSQTNKSFIVWNPEDFSRDLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG----  706
             NFSSFIRQLNTYGFRKID+EQW FAN++FIRGQ HLL+NIHRRKP+HSHS Q   G    
Sbjct  61    NFSSFIRQLNTYGFRKIDSEQWAFANEDFIRGQPHLLRNIHRRKPVHSHSIQNQKGQGTS  120

Query  707   VPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQV  886
              PLSE +R  +  +IERLK +  +L +EL R +++ +    + Q L  RLQ +++RQ+ V
Sbjct  121   CPLSESDREGYRADIERLKHDKGALLLELQRHKEDRQGLELQMQHLKDRLQHMEQRQQTV  180

Query  887   LALVAQLSLKPDL----LHHLEVHNKKRKPSVSNGH------------------------  982
             ++ +A++  KP L    L  +E HN+KR+   SN                          
Sbjct  181   ISYLARMLQKPGLALSFLPSMETHNRKRRLLTSNCFYDESDVEENRIATSHTVNTEKLDA  240

Query  983   ---LELVNNLDSSITVCQKILNGI--SNGEEA----------YGNFETLPQAPSGD----  1105
                LELV  L+SS++  + IL+    ++GEE           +    T   A SGD    
Sbjct  241   TSVLELVEFLESSLSSWEDILDEFRPTSGEEVIYGVGVPAQPFAVVLTEIDASSGDADIN  300

Query  1106  --------------SRFSSPSTQTD-------TPEISSLH------TKHPGADGNAKAAW  1204
                           SR  + S + D       +P IS +       +K  G D N K A 
Sbjct  301   LQQQSPRLNLSSNCSRDVNSSVELDESMSCAESPGISYIQLNIDTRSKSTGIDMNCKPA-  359

Query  1205  NCAAVDVDRLKDRLEGRSSTAAVPV-VGGNDVFWQQFLTE  1321
                A +V  LK+++ G    AA PV  G NDVFW+QF TE
Sbjct  360   -ATAPEVTTLKEQVVG----AASPVPTGVNDVFWEQFFTE  394



>gb|KHN06431.1| Heat stress transcription factor A-4a [Glycine soja]
Length=402

 Score =   232 bits (591),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 149/354 (42%), Positives = 205/354 (58%), Gaps = 38/354 (11%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD  QG S+S  PFLAKTYE+VDD +  +VVSWS   +SF+VWNPPEFARDLLP++FKHN
Sbjct  1     MDDAQGSSSSLPPFLAKTYEMVDDPSTDSVVSWSVTSKSFIVWNPPEFARDLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQP-NSGVPL  715
             NFSSFIRQLNTYGFRK+D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS Q   +  P+
Sbjct  61    NFSSFIRQLNTYGFRKVDPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSLQNLQAQGPI  120

Query  716   SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
              E ER+ F +EIE+LK +   L VEL + + E +    +  S   RL+ +++ Q+++++ 
Sbjct  121   GEAERQSFTDEIEKLKHDKEQLLVELQKYQHEWQAYEIQMHSSKDRLEKLEQNQQKMVSS  180

Query  896   VAQLSLKP----DLLHHLEVHNKKRKPSVSNGHLELVNNLDSSITVCQKI-LNGISNGEE  1060
             V+ +  KP    ++L   E  ++KR+   S GH     +++ ++   Q +      N   
Sbjct  181   VSHVLQKPVISVNILPLTETMDRKRRLPRS-GHFYDEASVEDAMETSQMLPRENADNTTV  239

Query  1061  AYGNFETLPQAPS------------GDS--------RFSSPSTQTDTPEIS------SLH  1162
                N E L Q  S            GD+         F   ++  D+P IS       + 
Sbjct  240   LTLNVERLDQLESSMAFWEAIVHDIGDTFVQIQSNMDFDESTSCADSPSISCAQLDVEVR  299

Query  1163  TKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTEE  1324
              K PG D N++     AAV            ++ AA    G NDVFW+QFLTE+
Sbjct  300   PKSPGIDMNSEPT--TAAVPEPVASKEQPAGTTVAA---TGVNDVFWEQFLTED  348



>ref|XP_003524978.1| PREDICTED: heat stress transcription factor A-4a-like isoform 
X1 [Glycine max]
 ref|XP_006580179.1| PREDICTED: heat stress transcription factor A-4a-like isoform 
X2 [Glycine max]
Length=402

 Score =   232 bits (591),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 149/354 (42%), Positives = 205/354 (58%), Gaps = 38/354 (11%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD  QG S+S  PFLAKTYE+VDD +  +VVSWS   +SF+VWNPPEFARDLLP++FKHN
Sbjct  1     MDDAQGSSSSLPPFLAKTYEMVDDPSTDSVVSWSITSKSFIVWNPPEFARDLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQP-NSGVPL  715
             NFSSFIRQLNTYGFRK+D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS Q   +  P+
Sbjct  61    NFSSFIRQLNTYGFRKVDPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSLQNLQAQGPI  120

Query  716   SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
              E ER+ F +EIE+LK +   L VEL + + E +    +  S   RL+ +++ Q+++++ 
Sbjct  121   GEAERQSFTDEIEKLKHDKEQLLVELQKYQHEWQAYEIQMHSSKDRLEKLEQNQQKMVSS  180

Query  896   VAQLSLKP----DLLHHLEVHNKKRKPSVSNGHLELVNNLDSSITVCQKI-LNGISNGEE  1060
             V+ +  KP    ++L   E  ++KR+   S GH     +++ ++   Q +      N   
Sbjct  181   VSHVLQKPVISVNILPLTETMDRKRRLPRS-GHFYDEASVEDAMETSQMLPRENADNTTV  239

Query  1061  AYGNFETLPQAPS------------GDS--------RFSSPSTQTDTPEIS------SLH  1162
                N E L Q  S            GD+         F   ++  D+P IS       + 
Sbjct  240   LTLNVERLDQLESSMAFWEAIVHDIGDTFVQIQSNMDFDESTSCADSPSISCAQLDVEVR  299

Query  1163  TKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTEE  1324
              K PG D N++     AAV            ++ AA    G NDVFW+QFLTE+
Sbjct  300   PKSPGIDMNSEPT--TAAVPEPVASKEQPAGTTVAA---TGVNDVFWEQFLTED  348



>ref|XP_009796383.1| PREDICTED: heat stress transcription factor A-4c-like [Nicotiana 
sylvestris]
 ref|XP_009796384.1| PREDICTED: heat stress transcription factor A-4c-like [Nicotiana 
sylvestris]
Length=408

 Score =   232 bits (591),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 148/363 (41%), Positives = 210/363 (58%), Gaps = 52/363 (14%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD     + +  PFL KTYE+VDD ++ A+VSWS   +SF+VWNPP+FARDLLP+YFKHN
Sbjct  1     MDEATCSTNALPPFLTKTYEMVDDPSSDAIVSWSSSNKSFIVWNPPDFARDLLPRYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFAN-DEFIRGQTHLLKNIHRRKPIHSHSAQPNSGV--  709
             NFSSFIRQLNTYGFRKID E+WEFAN D F+RGQ HLLKNIHRRKP+HSHSAQ   G+  
Sbjct  61    NFSSFIRQLNTYGFRKIDPEKWEFANEDNFVRGQPHLLKNIHRRKPVHSHSAQNLHGLSS  120

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
             PL+E ER+ ++E+I++LK EN SL ++L R +Q+ +    + Q    R+Q ++ RQ+ +L
Sbjct  121   PLTESERQGYKEDIQKLKHENESLHLDLQRHQQDRQGLELQVQVFIERVQHVEHRQKTML  180

Query  890   ALVAQLSLKP--DL--LHHLEVHNKKRK-------------------------------P  964
             + +A++  KP  DL  +  L+V+++KR+                                
Sbjct  181   SALARMLDKPVTDLSGMPQLQVNDRKRRLPGNSCLYNETDLEDTRAISSRALTWENMNPS  240

Query  965   SVSNGHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDT-  1141
             S+   + EL++ LDSS+T  + +L  +            L ++ S     +   TQ +  
Sbjct  241   SLLTINAELLDQLDSSLTFWENVLQDVDQARIQQNCSLELDESTSCADSPAICYTQLNVD  300

Query  1142  --PEISSLHTK-HPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQF  1312
               P+ S +     P A+ N + A           +D+     +T  VP  G NDVFW+QF
Sbjct  301   VGPKASDIDMNSEPNANTNPEVA---------APEDQAAVAGTTTNVP-TGVNDVFWEQF  350

Query  1313  LTE  1321
             LTE
Sbjct  351   LTE  353



>ref|XP_010109197.1| Heat stress transcription factor A-4b [Morus notabilis]
 gb|EXC21269.1| Heat stress transcription factor A-4b [Morus notabilis]
Length=425

 Score =   232 bits (592),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 158/215 (73%), Gaps = 7/215 (3%)
 Frame = +2

Query  386   SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQL  565
             +PAPFL KTYELVDD+    +VSWS  G SFVVWNP EFA+DLLP YFKHNNFSSF+RQL
Sbjct  12    APAPFLLKTYELVDDQMTDPIVSWSPNGCSFVVWNPTEFAKDLLPMYFKHNNFSSFVRQL  71

Query  566   NTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSA--QPNSGVPLSeperref  739
             NTYGFRKID +QWEFAN+EFIRGQ HLL+NIHRRKP+HSHS+  Q  S VPL++ ER E+
Sbjct  72    NTYGFRKIDPDQWEFANEEFIRGQRHLLRNIHRRKPVHSHSSNNQGQSAVPLTDTERHEY  131

Query  740   eeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKP  919
             E+EI+ LK + +SL  EL R E+E +E   + Q L  R Q+I+ RQ+Q+   +A+L  KP
Sbjct  132   EKEIKALKHDKNSLHSELQRHERERQEFDLQIQLLHERFQNIEHRQKQLTVYLAELVQKP  191

Query  920   D----LLHHLEVHNKKRKPSVSNGHLELVNNLDSS  1012
                  LL   E+HNKKR+  +S+ H    +NL+ S
Sbjct  192   GLASILLQESEMHNKKRR-LLSSSHFCDESNLEES  225



>ref|XP_008776668.1| PREDICTED: heat stress transcription factor A-4b-like [Phoenix 
dactylifera]
 ref|XP_008776669.1| PREDICTED: heat stress transcription factor A-4b-like [Phoenix 
dactylifera]
Length=451

 Score =   233 bits (593),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 163/388 (42%), Positives = 215/388 (55%), Gaps = 81/388 (21%)
 Frame = +2

Query  389   PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
             P PFL KTY++VDD + +++VSWS    SF+VW PPEFARDLLPKYFKHNNFSSF+RQLN
Sbjct  13    PPPFLTKTYDMVDDPSTNSIVSWSPTNASFIVWKPPEFARDLLPKYFKHNNFSSFVRQLN  72

Query  569   TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSA--QPNSGVPLSeperrefe  742
             TYGFRKID +QWEFAN++FIRGQ HLLKNIHRRKPIHSHS   Q NSG PL+E ERRE E
Sbjct  73    TYGFRKIDPDQWEFANEDFIRGQRHLLKNIHRRKPIHSHSLQHQGNSG-PLAESERRELE  131

Query  743   eeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKP-  919
             EEIERL  E   L  EL    Q+      + QSL+ RL +++ RQR ++A + ++  KP 
Sbjct  132   EEIERLNCEKGLLISELQSHAQQQHGMEQQMQSLEERLHTMEHRQRHMMAFLTEIVQKPG  191

Query  920   ---DLLHHLEVHNKKR----------------------------KPSVSNGH---LELVN  997
                + +   E H+KKR                            K  +++ H   +E   
Sbjct  192   FFSNFVQQSEFHSKKRRLPKANYFCEDANMEEKRIMSFQGTSSEKSDIASMHAFDIEPFE  251

Query  998   NLDSSITVCQKILNGIS--NGEEAYGNFETLPQAPSG-------------DSRFSSPSTQ  1132
              ++SS+   + +  G+S  +GEE Y +   LP  PSG             D    SPS +
Sbjct  252   KMESSLNSLENLFRGVSQASGEEMYYD-SVLPSLPSGVVLTEMHASSGDTDVNLQSPSPK  310

Query  1133  T-----------DTPEI--SSLHTKHPG-------ADGNAKAA-----WNCAAVDVDRLK  1237
                          +PE+  S+ + + P         D  +KA+        AA + D  +
Sbjct  311   LHPSSPCLGDIGSSPELAESTSYAESPALPLTEIHTDIRSKASEIDVNAEPAAPECDSSR  370

Query  1238  DRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
             DR  G ++ + VP  G NDVFW+QFLTE
Sbjct  371   DRAAG-TAASTVP-TGVNDVFWEQFLTE  396



>ref|XP_003546045.1| PREDICTED: heat stress transcription factor A-4a-like [Glycine 
max]
 gb|KHN28643.1| Heat stress transcription factor A-4a [Glycine soja]
Length=392

 Score =   230 bits (586),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 151/366 (41%), Positives = 216/366 (59%), Gaps = 62/366 (17%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             M+  QG S+S  PFL KTYE+VDD + +++VSWS   RSF+VWNPPEF+RDLLPKYFKHN
Sbjct  2     MEEAQGNSSSLPPFLTKTYEMVDDPSTNSIVSWSATNRSFIVWNPPEFSRDLLPKYFKHN  61

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG---V  709
             NFSSFIRQLNTYGFRKID EQWEFAND+F+RGQ HLLKNIHRRKP+HSHS Q   G    
Sbjct  62    NFSSFIRQLNTYGFRKIDPEQWEFANDDFVRGQPHLLKNIHRRKPVHSHSLQNIQGQGSS  121

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
              L+E ERR F++EIE+LK E   L  EL+R EQE +    + Q  +  L+ ++++Q  ++
Sbjct  122   LLTESERRSFKDEIEKLKHEKERLLRELERHEQEWKMYEVQLQHSNDCLEKLEKKQESLV  181

Query  890   ALVAQLSLKP----DLLHHLEVHNKKRK------------------------------PS  967
             + V+Q+  KP    +LL   E  ++KR+                               S
Sbjct  182   SSVSQVLQKPGIALNLLLLTENMDRKRRLPRSGLFSDDAGIEDHMETSPVLPRENADGSS  241

Query  968   VSNGHLELVNNLDSSITVCQKILNGISN-GEEAYGNFETLPQAPSGDSRFSSPSTQTDTP  1144
             + +   E ++ L+SS+T  + I + + +   +++ N +           F + ++  D+P
Sbjct  242   IFSSSTERLDLLESSMTFWEDITHDVGDIFVQSHLNLD-----------FDASTSCADSP  290

Query  1145  EISSLHT------KHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGG-NDVFW  1303
              IS +        K PG + N++ +   A  D+D  K++  G++     PV  G ND+FW
Sbjct  291   AISCVQLEVEDQPKSPGINMNSEPS-VVAVPDLDASKEQPVGKA-----PVTTGVNDIFW  344

Query  1304  QQFLTE  1321
             ++FLTE
Sbjct  345   ERFLTE  350



>ref|XP_010057144.1| PREDICTED: heat stress transcription factor A-4c-like [Eucalyptus 
grandis]
 ref|XP_010057145.1| PREDICTED: heat stress transcription factor A-4c-like [Eucalyptus 
grandis]
 ref|XP_010057147.1| PREDICTED: heat stress transcription factor A-4c-like [Eucalyptus 
grandis]
 gb|KCW74169.1| hypothetical protein EUGRSUZ_E02813 [Eucalyptus grandis]
Length=422

 Score =   231 bits (588),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 150/372 (40%), Positives = 212/372 (57%), Gaps = 56/372 (15%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD +  GS S  PFL KTYE+VD  +   VVSWS+G +SFVVWNPPEFARDLLPKYFKHN
Sbjct  1     MDESPSGSNSLPPFLVKTYEMVDAASTDPVVSWSQGSKSFVVWNPPEFARDLLPKYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ----PNSG  706
             NFSSFIRQLNTYGFRKID E+WEFAND+F+RGQ  LLKNIHRRKP+HSHS Q      S 
Sbjct  61    NFSSFIRQLNTYGFRKIDPERWEFANDDFVRGQPQLLKNIHRRKPVHSHSLQNLQNQGSS  120

Query  707   VPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQV  886
              PL++ ER+  +EE+ERLK +  SL++EL   E+E +    + Q+L +RL  ++ERQ+ +
Sbjct  121   SPLTDAERQGLKEEVERLKGDKESLQLELQVHEEERKGFEVQMQNLKARLLKMEERQKNM  180

Query  887   LALVAQLSLKP----DLLHHLEVHNKKRK-PSVSNGH-----------------------  982
             ++ +  +  KP    ++L   E ++KKR+ P +   H                       
Sbjct  181   VSNLGNVLQKPGLALNMLIESEFNDKKRRLPRIGYYHDEGHGEDNHAGTPQTLTRENIDG  240

Query  983   -------LELVNNLDSSITVCQKILN-----GISNGEEAYGNFETLPQAPS-------GD  1105
                    L+L   L+SS+T+ + I +     G  N    +    +   +P+        D
Sbjct  241   ASSLPSILDLYEQLESSLTIWEYIAHDCENIGQRNSTLDFDETTSCADSPAISCIQFNID  300

Query  1106  SRFSSPSTQTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVG  1285
             +R  SP+   ++ E ++     P     ++ A   A+   + +  + +  ++   VP  G
Sbjct  301   ARPRSPTIDMNS-EPTAATVFEPAVVTTSEPALTVAS---EPVSSKEQAVATAPNVP-AG  355

Query  1286  GNDVFWQQFLTE  1321
              NDVFW+QFLTE
Sbjct  356   VNDVFWEQFLTE  367



>ref|XP_004233050.1| PREDICTED: heat stress transcription factor A-4c [Solanum lycopersicum]
 ref|XP_010316854.1| PREDICTED: heat stress transcription factor A-4c [Solanum lycopersicum]
 ref|XP_010316855.1| PREDICTED: heat stress transcription factor A-4c [Solanum lycopersicum]
Length=408

 Score =   229 bits (585),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 163/411 (40%), Positives = 232/411 (56%), Gaps = 65/411 (16%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD     + +  PF+AKTYE+VDD +  A+VSWS   +SF+VWNPP+FARDLLP+YFKHN
Sbjct  1     MDEASCSTNALPPFIAKTYEMVDDPSCDAIVSWSSNNKSFIVWNPPDFARDLLPRYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFAND-EFIRGQTHLLKNIHRRKPIHSHSAQPNSGV--  709
             NFSSFIRQLNTYGFRKID E+WEFAN+  FIRGQ +LLKNIHRRKP+HSHSAQ   G+  
Sbjct  61    NFSSFIRQLNTYGFRKIDPEKWEFANEGNFIRGQPNLLKNIHRRKPVHSHSAQNLHGLSS  120

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
             PL+E ER+ ++E+I++L  EN SL ++L R +Q+++    + Q L  R+Q  + RQ+ ++
Sbjct  121   PLTESERQGYKEDIQKLMHENGSLHLDLQRHKQDHQGLELQMQVLTERVQHAEHRQKTMI  180

Query  890   ALVAQLSLKP--DLLH--HLEVHNKKRK-------------------------------P  964
             + +AQ   +P  DL H   L+V+++KR+                                
Sbjct  181   SALAQTLDRPVMDLSHMPQLQVNDRKRRFPGNSCLYNESDLEDMRGISSRALSRENMNPS  240

Query  965   SVSNGHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTP  1144
             S+   + EL++ L+SS+T  + +L  +   ++A      L Q     S   SP+      
Sbjct  241   SLLTMNAELLDQLESSLTFWEDVLQDV---DQAGMRPNCLLQLDESTSCADSPAISYTQL  297

Query  1145  EISSLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE-  1321
              I  +  K  G D N++   N    +V   +D+     ++  VP  G ND+FW+QFLTE 
Sbjct  298   NI-DVGPKASGIDMNSEPNANIMP-EVAEPEDKAAVAGTSTNVP-TGVNDLFWEQFLTEN  354

Query  1322  -------EVeserreigirngreCMI-------------VFAEQMGHFTPA  1414
                    EV+SER++IG +      +               AEQMGH TPA
Sbjct  355   PGSVDAPEVQSERKDIGSKKNESKPVDSGKYWWNMKSVNSLAEQMGHLTPA  405



>ref|XP_006585179.1| PREDICTED: heat stress transcription factor A-4a-like [Glycine 
max]
 gb|KHN48029.1| Heat stress transcription factor A-4a [Glycine soja]
Length=402

 Score =   228 bits (582),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 147/354 (42%), Positives = 204/354 (58%), Gaps = 38/354 (11%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD  QG S S  PFLAKTYE+VDD +  +VVSWS   +SF+VWNPPEFARDLLP++FKHN
Sbjct  1     MDDAQGSSNSLPPFLAKTYEMVDDPSTDSVVSWSVTSKSFIVWNPPEFARDLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQP-NSGVPL  715
             NFSSFIRQLNTYGF+K+D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS Q   +  PL
Sbjct  61    NFSSFIRQLNTYGFKKVDPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSLQNLQAQGPL  120

Query  716   SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
              E ER+ F +EIE+LK +   L VEL + + E +    +      RL+ +++ Q+++++ 
Sbjct  121   GESERQSFTDEIEKLKHDKEQLLVELQKYQHEWQAYEIQIHCSKDRLEKLEQNQQRMVSS  180

Query  896   VAQLSLKP----DLLHHLEVHNKKRKPSVSNGHLELVNNLDSSITVCQKILNGISNGEEA  1063
             V+ +  KP    ++L   E  ++KR+   S GH    + ++ +I  CQ +    ++    
Sbjct  181   VSHVLQKPVISVNILPLTETLDRKRRLPRS-GHFYDEDGVEDAIETCQMLPRENADHTTV  239

Query  1064  YG-NFETLPQAPS------------GDS--------RFSSPSTQTDTPEISS------LH  1162
                N E L Q  S            GD+             ++  D+P +S       + 
Sbjct  240   LTLNVERLDQLESSMAFWEAIVHDIGDTFVQIQSSMDLDESTSCADSPSLSCAQLDVEVR  299

Query  1163  TKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTEE  1324
              K PG D N++     AAV            ++ AA    G NDVFW+QFLTE+
Sbjct  300   HKSPGIDMNSEPT--TAAVPEPVASKEQPAGTTVAA---TGVNDVFWEQFLTED  348



>ref|XP_010441677.1| PREDICTED: heat stress transcription factor A-4c isoform X2 [Camelina 
sativa]
 ref|XP_010441678.1| PREDICTED: heat stress transcription factor A-4c isoform X2 [Camelina 
sativa]
 ref|XP_010441679.1| PREDICTED: heat stress transcription factor A-4c isoform X2 [Camelina 
sativa]
Length=349

 Score =   226 bits (577),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 142/332 (43%), Positives = 195/332 (59%), Gaps = 44/332 (13%)
 Frame = +2

Query  362   DGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNN  541
             + + GGS+S  PFL KTYE+VDD ++ +VVSWS   +SF+V NP EF+RDLLP++FKH N
Sbjct  3     ESSHGGSSSLPPFLTKTYEMVDDGSSDSVVSWSENNKSFIVKNPAEFSRDLLPRFFKHKN  62

Query  542   FSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-AQPNSGVPLS  718
             FSSFIRQLNTYGFRK+D E+WEF+ND+F+RG+ +L+KNIHRRKP+HSHS     +  PL+
Sbjct  63    FSSFIRQLNTYGFRKVDPEKWEFSNDDFVRGRPYLMKNIHRRKPVHSHSLVNLQTQNPLT  122

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             E ERR  E+ IERLK+E   L VEL  +EQE ++   +  +L  RLQ +++ Q+ ++A V
Sbjct  123   ESERRSMEDRIERLKKEKEGLLVELQSQEQERKDFEMQVTTLKDRLQQMEQHQKSIVAYV  182

Query  899   AQLSLKPDLLHHLEVHNKKRK-------PSVSNGHLELVNNLDSSITVCQKILNGISNGE  1057
             +Q+  KP L  +LE H ++++       PS S  H+E V NL+SS+T  + +++      
Sbjct  183   SQVLGKPGLSLNLENHERRKRRVPESSLPS-SRSHVEQVENLESSLTFWENLVS------  235

Query  1058  EAYGNFETLPQAPSGDSRFSSPSTQTDTPE----ISSLHTKHPGADGNAKAAWNCAAVDV  1225
             E+Y          SG    SS S   D  E    I     K    D N +          
Sbjct  236   ESY--------EKSGIQ--SSSSMDLDAAESSLSIGDTRPKSSKIDMNLEPPVTVTVA--  283

Query  1226  DRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                           A P  G ND FW+Q LTE
Sbjct  284   -------------VAAPKAGVNDDFWEQCLTE  302



>gb|AAL12248.1| heat shock transcription factor [Phaseolus acutifolius]
Length=402

 Score =   227 bits (578),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 206/356 (58%), Gaps = 42/356 (12%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD   G S S  PFLAKTYE+VDD + +++VSWS   +SF+VWNPPEFARDLLP++FKHN
Sbjct  1     MDEALGSSCSLPPFLAKTYEMVDDLSTNSIVSWSVSSKSFIVWNPPEFARDLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQP-NSGVPL  715
             NFSSFIRQLNTYGF+KID EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS Q   +  PL
Sbjct  61    NFSSFIRQLNTYGFKKIDPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSLQNLQAQGPL  120

Query  716   SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
              + ER+ F + IE+LK++   L VEL + + E +    +    + RL+ ++++Q ++++ 
Sbjct  121   GDSERQGFTDGIEKLKRDKERLLVELQKFQHEWQTYEIQIHCSNDRLEKLEQKQHKMVSS  180

Query  896   VAQLSLKP----DLLHHLEVHNKKRKPSVSNGHLELVNNLDSSITVCQKI-LNGISNGEE  1060
             ++ +  KP    ++L   E  ++KR+   S GH    ++++ +I   Q +      N   
Sbjct  181   ISHVLQKPVLAVNILPLTETMDRKRRLPRS-GHYYDESSIEDAIETSQMLPRENAENTTV  239

Query  1061  AYGNFETLPQAPS------------GDS--------RFSSPSTQTDTPEISS------LH  1162
                N E L Q  S            GD+         F   ++  D+P IS       + 
Sbjct  240   LTLNVERLDQLESSVAFWEAIAHDIGDNFAQIQSNMDFDESTSCADSPSISCAQLDVDVR  299

Query  1163  TKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPV--VGGNDVFWQQFLTEE  1324
              K  G D N++     AAV      D L  +   A + V   G NDVFW+QFLTE+
Sbjct  300   PKSSGIDMNSEPT--AAAV-----PDPLASKDQPAGITVAATGVNDVFWEQFLTED  348



>ref|XP_010441676.1| PREDICTED: heat stress transcription factor A-4c isoform X1 [Camelina 
sativa]
Length=369

 Score =   226 bits (575),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 142/332 (43%), Positives = 195/332 (59%), Gaps = 44/332 (13%)
 Frame = +2

Query  362   DGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNN  541
             + + GGS+S  PFL KTYE+VDD ++ +VVSWS   +SF+V NP EF+RDLLP++FKH N
Sbjct  23    ESSHGGSSSLPPFLTKTYEMVDDGSSDSVVSWSENNKSFIVKNPAEFSRDLLPRFFKHKN  82

Query  542   FSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-AQPNSGVPLS  718
             FSSFIRQLNTYGFRK+D E+WEF+ND+F+RG+ +L+KNIHRRKP+HSHS     +  PL+
Sbjct  83    FSSFIRQLNTYGFRKVDPEKWEFSNDDFVRGRPYLMKNIHRRKPVHSHSLVNLQTQNPLT  142

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             E ERR  E+ IERLK+E   L VEL  +EQE ++   +  +L  RLQ +++ Q+ ++A V
Sbjct  143   ESERRSMEDRIERLKKEKEGLLVELQSQEQERKDFEMQVTTLKDRLQQMEQHQKSIVAYV  202

Query  899   AQLSLKPDLLHHLEVHNKKRK-------PSVSNGHLELVNNLDSSITVCQKILNGISNGE  1057
             +Q+  KP L  +LE H ++++       PS S  H+E V NL+SS+T  + +++      
Sbjct  203   SQVLGKPGLSLNLENHERRKRRVPESSLPS-SRSHVEQVENLESSLTFWENLVS------  255

Query  1058  EAYGNFETLPQAPSGDSRFSSPSTQTDTPE----ISSLHTKHPGADGNAKAAWNCAAVDV  1225
             E+Y          SG    SS S   D  E    I     K    D N +          
Sbjct  256   ESY--------EKSGIQ--SSSSMDLDAAESSLSIGDTRPKSSKIDMNLEPPVTVTVA--  303

Query  1226  DRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                           A P  G ND FW+Q LTE
Sbjct  304   -------------VAAPKAGVNDDFWEQCLTE  322



>ref|XP_007159491.1| hypothetical protein PHAVU_002G242000g [Phaseolus vulgaris]
 gb|ESW31485.1| hypothetical protein PHAVU_002G242000g [Phaseolus vulgaris]
Length=403

 Score =   226 bits (577),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 147/356 (41%), Positives = 205/356 (58%), Gaps = 42/356 (12%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD   G S S  PFLAKTYE+VDD + +++VSWS   +SF+VWNPPEFARDLLP++FKHN
Sbjct  2     MDEALGSSCSLPPFLAKTYEMVDDLSTNSIVSWSVSSKSFIVWNPPEFARDLLPRFFKHN  61

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQP-NSGVPL  715
             NFSSFIRQLNTYGF+KID EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS Q   +  PL
Sbjct  62    NFSSFIRQLNTYGFKKIDPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSLQNLQAQGPL  121

Query  716   SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
              + ER+ F + IE+LK++   L VEL + + E +    +    + RL+ ++++Q ++++ 
Sbjct  122   QDSERQGFTDGIEKLKRDKERLLVELQKFQHEWQTYEIQIHCSNDRLEKLEQKQHKMVSS  181

Query  896   VAQLSLKP----DLLHHLEVHNKKRKPSVSNGHLELVNNLDSSITVCQKI-LNGISNGEE  1060
             V+ +  KP    ++L   E  ++KR+   S GH     +++ +I   Q +      N   
Sbjct  182   VSHVLQKPVIAVNILPLTETMDRKRRLPRS-GHYYDEASIEDAIETSQMLPRENAENTTL  240

Query  1061  AYGNFETLPQAPS------------GDS--------RFSSPSTQTDTPEISS------LH  1162
                N E L Q  S            GD+         F   ++  D+P IS       + 
Sbjct  241   LALNVERLDQLESSVAFWEAIAHDIGDNFAQIQSNMDFDESTSCADSPSISCAQLDVDVR  300

Query  1163  TKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPV--VGGNDVFWQQFLTEE  1324
              K  G D N++     AAV      D L  +   A + V   G NDVFW+QFLTE+
Sbjct  301   PKSSGIDMNSEPT--AAAV-----PDPLASKDQPAGITVAATGVNDVFWEQFLTED  349



>gb|KHG20424.1| Heat stress transcription factor A-4a -like protein [Gossypium 
arboreum]
Length=384

 Score =   224 bits (572),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 147/347 (42%), Positives = 195/347 (56%), Gaps = 45/347 (13%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD  Q  S+S  PFL KTYE+VDD +  ++VSWS   RSF+VWNP EFARDLLP++FKHN
Sbjct  1     MDDAQSSSSSLPPFLTKTYEMVDDHSTDSIVSWSASNRSFIVWNPLEFARDLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG---V  709
             NFSSFIRQLNTYGFRK D EQWEFAND+FIRGQ HLLKNIHRRKP+HSHS Q   G    
Sbjct  61    NFSSFIRQLNTYGFRKSDPEQWEFANDDFIRGQPHLLKNIHRRKPVHSHSMQNLLGQGAS  120

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
             PL+E ER+ F +EIERLK E  SL +EL R E+E +    + Q L  RLQ+++ RQ+ ++
Sbjct  121   PLTESERQSFRDEIERLKSEKMSLVLELKRHEEERQGFEMQMQILRERLQTMERRQQSMV  180

Query  890   ALVAQLSLKP----DLLHHLEVHNKKRK-------------------PSVSNGHLELVNN  1000
             + VA+   +P    D     E H +KR+                    + S  + +    
Sbjct  181   SNVARALKRPGFPIDPTPQFEAHVRKRRLPRIAYLYDESRIEDNPNPDTASMSNTDPFEQ  240

Query  1001  LDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGA  1180
             L+SS+   +  ++        +    + P++PS  S   +  TQ  +P+I          
Sbjct  241   LESSMVFWENAIHDFGRA-NVFDESTSCPESPSISSIQLNIETQPKSPQI----------  289

Query  1181  DGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
             D N++ +       V          +   A P  G ND FW+QFLTE
Sbjct  290   DMNSEPSTVVTPEPV--------TSTEQPAPPPAGVNDGFWEQFLTE  328



>ref|XP_010052968.1| PREDICTED: heat stress transcription factor A-4b-like [Eucalyptus 
grandis]
 gb|KCW89675.1| hypothetical protein EUGRSUZ_A01948 [Eucalyptus grandis]
Length=438

 Score =   226 bits (576),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 154/392 (39%), Positives = 213/392 (54%), Gaps = 80/392 (20%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MDG+QG S +PAPFL KTYE+VDD     +VSWS  G SFVVW+PPEF+ +LLPKYFKHN
Sbjct  1     MDGSQGKSNAPAPFLVKTYEMVDDPQTDFLVSWSENGSSFVVWSPPEFSGELLPKYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
             NFSSF+RQLNTYGFRKID +QWEFAN+EFIRG+ HLL NI+RRKPIHSHS Q   G  LS
Sbjct  61    NFSSFVRQLNTYGFRKIDPDQWEFANEEFIRGEKHLLNNIYRRKPIHSHSGQ---GARLS  117

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             + E++ +EEEI+RL+ E SSL+ EL R + +N++  F+ Q L  + Q+++++Q  ++ ++
Sbjct  118   DSEKQMYEEEIKRLRHEKSSLQSELQRYQGDNQDVDFQIQLLRKQFQNMEQKQTHLITVL  177

Query  899   AQLSLKPDL-------------------LHHLE-------VHNKKRKPSVSNG------H  982
             AQL  KP                     L HL        + + K +    NG       
Sbjct  178   AQLMQKPVFASLFTQQSDSPTKKRRLAELDHLHDSDDKSGLESLKFQKEKFNGVPFSLLD  237

Query  983   LELVNNLDSSITVCQKILNGISNGEEA----YGNFETLPQAPSGDSRFSSPSTQTD----  1138
             L+ V  L+ S+   + +L G+ N   A    +G   +LP  P+G +        +D    
Sbjct  238   LDSVEKLEQSLHFLENLLQGVDNTSGAEQHDFGAI-SLP-WPAGFTERKESLDDSDRHIR  295

Query  1139  ---------------TPEISSLHTKHPGADGNAKAAWN----------------CAAVDV  1225
                            +PE+ +L T H  +   +    N                    DV
Sbjct  296   PWSPGSPPSPKDVALSPEL-ALGTDHLESPETSSVCLNMDISLKSSVIDVNMEPVCVPDV  354

Query  1226  DRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
             + LK+++  +   A   V   NDVFW+QFLTE
Sbjct  355   ENLKEQILEKMPGAPTAV---NDVFWEQFLTE  383



>ref|XP_004309634.1| PREDICTED: heat stress transcription factor A-4a-like [Fragaria 
vesca subsp. vesca]
Length=497

 Score =   227 bits (578),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 150/210 (71%), Gaps = 9/210 (4%)
 Frame = +2

Query  359  MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
            MD  QG + S  PFL+KTYE+VDD +  ++VSWS G +SF+VWNPPEFARDLLPKYFKHN
Sbjct  1    MDEVQGITGSLPPFLSKTYEMVDDSSTDSIVSWSAGDKSFIVWNPPEFARDLLPKYFKHN  60

Query  539  NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-----AQPNS  703
            NFSSFIRQLNTYGFRKID EQWEFAND+F+RGQ  L+K+IHRRKP+HSHS      Q   
Sbjct  61   NFSSFIRQLNTYGFRKIDPEQWEFANDDFVRGQPQLMKSIHRRKPVHSHSLPNLQVQEQG  120

Query  704  GVPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQ  883
               LSE ER+  ++EIERL  E   L VEL R EQE +    + Q L  RLQ + E+Q+ 
Sbjct  121  SSSLSEAERKSMKDEIERLNHEKECLAVELQRHEQERQGMELQMQFLKDRLQHMQEQQQS  180

Query  884  VLALVAQLSLKPDL----LHHLEVHNKKRK  961
            ++A VA++  +P+L    +   E+ ++KR+
Sbjct  181  MVAFVARVLQRPELASNPVPQFELRDRKRR  210



>ref|XP_011101446.1| PREDICTED: heat stress transcription factor A-4a [Sesamum indicum]
 ref|XP_011101447.1| PREDICTED: heat stress transcription factor A-4a [Sesamum indicum]
Length=427

 Score =   225 bits (573),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 149/382 (39%), Positives = 211/382 (55%), Gaps = 72/382 (19%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD     S S  PFLAKTYE+VDD ++ +VVSWS+  RSF+VWNPPEF+RDLLP++FKHN
Sbjct  2     MDEAPCSSNSLPPFLAKTYEMVDDPSSDSVVSWSQNNRSFIVWNPPEFSRDLLPRFFKHN  61

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVP-L  715
             NFSSFIRQLNTYGFRK+D EQWEFAN++F+RGQ HLLKNIHRRKP+HSHS    + +P L
Sbjct  62    NFSSFIRQLNTYGFRKVDPEQWEFANEDFVRGQPHLLKNIHRRKPVHSHSTPNLASLPAL  121

Query  716   SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
             +E ER+ ++++IE+LK +  SL+ EL R ++E +  + + ++L  R+Q+++ R   +L+ 
Sbjct  122   TEFERKGYKDDIEKLKSDKESLQAELQRHKEEQQGLKVQMKALTERVQNVEHRHANMLSS  181

Query  896   VA----QLSLKPDLLHHLEVHNKKRK-PSVS--------------NGHLELVNNLD----  1006
             +A    Q S+  DL+  +EVH++KR+ P  S                 +  + +LD    
Sbjct  182   LAKTVHQPSISLDLMPQVEVHDRKRRFPGNSYLGDETSTEDNQRAASQITTIEDLDANLL  241

Query  1007  ------------SSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEI  1150
                         SS+T  +KI   I  G         L Q P+        ++   +P +
Sbjct  242   LTLNKELLEQLESSLTFWEKIAFEIGEG---------LVQPPNSSLELVESTSCAPSPSM  292

Query  1151  SS------LHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSS--TAAVPVV--------  1282
                     + +K  G D N+      A +DV      ++      TA  P V        
Sbjct  293   CCAQLNIDVGSKASGVDMNSDP--KTAPLDVGSKTSGIDVNCEPITALAPEVQSPPEEQA  350

Query  1283  ---------GGNDVFWQQFLTE  1321
                      G NDVFW+QFLTE
Sbjct  351   VATGNNVRTGVNDVFWEQFLTE  372



>ref|XP_003542993.1| PREDICTED: heat stress transcription factor A-4a-like [Glycine 
max]
Length=392

 Score =   224 bits (570),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 149/365 (41%), Positives = 211/365 (58%), Gaps = 60/365 (16%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             M+  QG S+S  PFL K YE+VDD + +++VSWS   RSF+VWNPPEF+RDLLPKYFKHN
Sbjct  2     MEEAQGSSSSLPPFLTKIYEMVDDPSTNSIVSWSATNRSFIVWNPPEFSRDLLPKYFKHN  61

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG---V  709
             NFSSFIRQLNTYGFRKID EQWEFAND+F+RGQ HLLKNIHRRKP+HSHS Q   G    
Sbjct  62    NFSSFIRQLNTYGFRKIDPEQWEFANDDFVRGQPHLLKNIHRRKPVHSHSLQNIQGQGVS  121

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
              L+E ER+ F++EIE+LK E   L  EL+  EQE +    + Q  + RL+ ++++Q  ++
Sbjct  122   SLTESERQSFKDEIEKLKHEKEQLLRELEMHEQEWKMYEVQLQHSNDRLEKLEKKQENLV  181

Query  890   ALVAQLSLKP----DLLHHLEVHNKKRK------------------------------PS  967
             + V+Q+  KP    +LL   E  ++KR+                               S
Sbjct  182   SSVSQVLQKPGIALNLLLLTENMDRKRRLPRSGLFSDDASIEDHMETSQVLPRENADGAS  241

Query  968   VSNGHLELVNNLDSSITVCQKILNGISNG-EEAYGNFETLPQAPSGDSRFSSPSTQTDTP  1144
             + +   E ++ L+SS+T  + I + + +   +++ N +           F   ++  D+P
Sbjct  242   IFSSSTERLDLLESSMTFWENITHDVGDVFVQSHLNLD-----------FDESTSCADSP  290

Query  1145  EISSLHT------KHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQ  1306
              IS +        K  G + +++ A   AA D+D  K   E    TA +   G ND+FW+
Sbjct  291   AISCVQLEVEDQPKSHGINVSSEPA-VVAAPDLDASK---EQPVETAPL-TTGVNDIFWE  345

Query  1307  QFLTE  1321
             +FLTE
Sbjct  346   RFLTE  350



>gb|KHN47390.1| Heat stress transcription factor A-4a [Glycine soja]
Length=391

 Score =   224 bits (570),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 149/365 (41%), Positives = 211/365 (58%), Gaps = 60/365 (16%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             M+  QG S+S  PFL K YE+VDD + +++VSWS   RSF+VWNPPEF+RDLLPKYFKHN
Sbjct  1     MEEAQGSSSSLPPFLTKIYEMVDDPSTNSIVSWSATNRSFIVWNPPEFSRDLLPKYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG---V  709
             NFSSFIRQLNTYGFRKID EQWEFAND+F+RGQ HLLKNIHRRKP+HSHS Q   G    
Sbjct  61    NFSSFIRQLNTYGFRKIDPEQWEFANDDFVRGQPHLLKNIHRRKPVHSHSLQNIQGQGVS  120

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
              L+E ER+ F++EIE+LK E   L  EL+  EQE +    + Q  + RL+ ++++Q  ++
Sbjct  121   SLTESERQSFKDEIEKLKHEKEQLLRELEMHEQEWKMYEVQLQHSNDRLEKLEKKQENLV  180

Query  890   ALVAQLSLKP----DLLHHLEVHNKKRK------------------------------PS  967
             + V+Q+  KP    +LL   E  ++KR+                               S
Sbjct  181   SSVSQVLQKPGIALNLLLLTENMDRKRRLPRSGLFSDDASIEDHMETSQVLPRENADGAS  240

Query  968   VSNGHLELVNNLDSSITVCQKILNGISNG-EEAYGNFETLPQAPSGDSRFSSPSTQTDTP  1144
             + +   E ++ L+SS+T  + I + + +   +++ N +           F   ++  D+P
Sbjct  241   IFSSSTERLDLLESSMTFWENITHDVGDVFVQSHLNLD-----------FDESTSCADSP  289

Query  1145  EISSLHT------KHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQ  1306
              IS +        K  G + +++ A   AA D+D  K   E    TA +   G ND+FW+
Sbjct  290   AISCVQLEVEDQPKSHGINVSSEPA-VVAAPDLDASK---EQPVETAPL-TTGVNDIFWE  344

Query  1307  QFLTE  1321
             +FLTE
Sbjct  345   RFLTE  349



>gb|AHZ44767.1| heat shock factor A4c [Triticum aestivum]
Length=448

 Score =   225 bits (574),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = +2

Query  371  QGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSS  550
            QG S SPAPFL KTYE+V+D A S VVSW  GG SFVVWNPP+F+RDLLPKYFKHNNFSS
Sbjct  16   QGASLSPAPFLIKTYEMVEDPATSRVVSWGPGGASFVVWNPPDFSRDLLPKYFKHNNFSS  75

Query  551  FIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeper  730
            FIRQLNTYGFRKID E+WEFAND+FIRG  HLLKNIHRRKP+HSHS Q     PL+E ER
Sbjct  76   FIRQLNTYGFRKIDPERWEFANDDFIRGHMHLLKNIHRRKPVHSHSPQNQVNGPLAESER  135

Query  731  refeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
            RE+EEEI RLK ENS L  EL R+ Q+     +  QSL+ RL ++++RQ  V+A V
Sbjct  136  REYEEEISRLKHENSVLVAELQRQAQQQCGLSWLMQSLEERLLAMEQRQADVVASV  191



>emb|CDO96874.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   223 bits (567),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 144/348 (41%), Positives = 199/348 (57%), Gaps = 50/348 (14%)
 Frame = +2

Query  395   PFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTY  574
             PFL KTYE+VDD   +A+VSWS   RSF+VWNPPEF+RDLLP+YFKHNNFSSFIRQLNTY
Sbjct  12    PFLTKTYEMVDDPLTNAIVSWSCNNRSFIVWNPPEFSRDLLPQYFKHNNFSSFIRQLNTY  71

Query  575   GFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeie  754
             GFRKID EQWEFAND+F+RGQ HLLKNI+RRKP+HSHS Q      LSE ERR ++++IE
Sbjct  72    GFRKIDPEQWEFANDDFVRGQPHLLKNIYRRKPVHSHSGQGAVESQLSESERRRYKDDIE  131

Query  755   rLKQENSSLRVELDRREQENRECRFEFQSLDSR--LQSIDERQRQVLALVAQLSLKP---  919
             RLK +  +L  EL R +QE  E RFE Q L +   +Q ++++Q+ +++ ++++  +P   
Sbjct  132   RLKSDKEALLFELQRYKQE--EQRFELQVLGTTESVQLMEQKQKNMMSFLSKILQRPILA  189

Query  920   -DLLHHLEVHNKKRK----------PSVSNGHL--------------------ELVNNLD  1006
              +L+    +H +KR+           S++N  +                    +L+  LD
Sbjct  190   LELMPEPHIHERKRRIPGNSYLNEDISMANTQINSQILQKEQLDASSLLAFNKDLLEELD  249

Query  1007  SSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGADG  1186
             S+++  + IL  +    +A     + P      S   SP      P     + K    D 
Sbjct  250   STLSFWENILINVG---QACDRLTSSPALVESTSCAGSPVVSYTEP-----NPKMSEIDM  301

Query  1187  NAKAAWNCAAVDVDRLKDRLEGRSSTAAVPV---VGGNDVFWQQFLTE  1321
             +     N A ++     D L   + T  VP     G NDVFW+QFLTE
Sbjct  302   DCDQNTNTAVINDTANSDELVAMNPT-NVPTNGPTGVNDVFWEQFLTE  348



>ref|XP_009590974.1| PREDICTED: heat stress transcription factor A-4a-like [Nicotiana 
tomentosiformis]
 ref|XP_009590975.1| PREDICTED: heat stress transcription factor A-4a-like [Nicotiana 
tomentosiformis]
 ref|XP_009590976.1| PREDICTED: heat stress transcription factor A-4a-like [Nicotiana 
tomentosiformis]
Length=407

 Score =   223 bits (568),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 147/371 (40%), Positives = 206/371 (56%), Gaps = 68/371 (18%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD     + +  PF+AKTYE+VDD +   +VSWS   +SF+VWNPP+FAR+LLP+YFKHN
Sbjct  1     MDEAPCSANALPPFIAKTYEMVDDPSTDPIVSWSSNNKSFIVWNPPDFARELLPRYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGV--P  712
             NFSSFIRQLNTYGFRK+D EQWEFAN++FIRG+ HLLKNIHRRKP+HSHS Q    V   
Sbjct  61    NFSSFIRQLNTYGFRKVDPEQWEFANEDFIRGEPHLLKNIHRRKPVHSHSVQNLHSVSSA  120

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             L+E ER+ ++E+IE+LK EN SL +EL   +Q+ +    + Q    R+Q +  RQ+ +L+
Sbjct  121   LTESERQGYKEDIEKLKHENESLHLELQGHKQDYQGLEMQMQVFTERVQQVKHRQKNMLS  180

Query  893   LVAQLSLKP----DLLHHLEVHNKKRKPSVSN----------------------------  976
              +AQ   KP     L+  LE++ +KR+   +N                            
Sbjct  181   TLAQAINKPGLGLSLMPQLEMNERKRRLPGNNFLYNETGLEDNQASSSPQDSTRESMDAT  240

Query  977   GHL----ELVNNLDSSITVCQKILNGIS-NGEEAYGNFETLPQAPSGDSRFSSPSTQTDT  1141
              HL    EL++ L+SS+T  + IL+ +  NG     + +        D+  S      D+
Sbjct  241   SHLTLNKELLDQLESSLTFWENILHDVDQNGMRRSSSVDL-------DASISC----ADS  289

Query  1142  PEISSLHTKHPGADGNAKAAWNCAAVDVDRLKDRL---EGRSSTAAVPVVGG--------  1288
             P IS        +  N     N + +D++   +R+   E       V V+G         
Sbjct  290   PTISY-------SQLNVDIGSNISGIDMNSEPNRITVPEVALQEDQVVVIGTATNRQTGV  342

Query  1289  NDVFWQQFLTE  1321
             NDVFW+QFLTE
Sbjct  343   NDVFWEQFLTE  353



>ref|XP_004485934.1| PREDICTED: heat stress transcription factor A-4a-like [Cicer 
arietinum]
Length=382

 Score =   222 bits (565),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 145/366 (40%), Positives = 198/366 (54%), Gaps = 60/366 (16%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             M+     S S  PFL+KTYE+VDD +   +VSWS   RSF+VWN P+FA+DLLPKYFKHN
Sbjct  1     MEEGHSSSNSMPPFLSKTYEMVDDPSTDTIVSWSVTNRSFIVWNQPDFAKDLLPKYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG----  706
             NFSSFIRQLNTYGFRK+D EQWEFAND+F++GQ HL+KNIHRRKP+HSHS Q   G    
Sbjct  61    NFSSFIRQLNTYGFRKVDPEQWEFANDDFVKGQPHLMKNIHRRKPVHSHSLQNVHGQGAA  120

Query  707   -VPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQ  883
               PL+E ERR  + EI+ LK +   L +E  R+EQE      +   L  RL++++++Q+ 
Sbjct  121   APPLTESERRNLKGEIQILKHDKQQLLLEFQRQEQEQNINEIDLLCLKDRLENLEQKQQN  180

Query  884   VLALVAQLSLKPDL---LHHL--EVHNKKRKP----------------------------  964
             +L+ V+Q+  KP +   L+ L      K+R P                            
Sbjct  181   MLSSVSQVLQKPGVELSLYPLTENTERKRRYPRNSSFSDEASIEDPIEISQMLCGENADS  240

Query  965   -SVSNGHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDT  1141
              SV +  +E ++ LDSSI   + I+  +  GE ++ +   +         F       D+
Sbjct  241   TSVLSLSMERLDLLDSSIMYWENIM--LDLGEASFQSHSNI--------DFDDSINCADS  290

Query  1142  PEISSLHT------KHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFW  1303
             P+IS +        K P  D N + A       V       E + +  A    G NDVFW
Sbjct  291   PDISCVQLDFEVLPKSPMIDVNPEPAVAVVPYPVAS-----EEQPAATAPVTTGVNDVFW  345

Query  1304  QQFLTE  1321
             +QFLTE
Sbjct  346   EQFLTE  351



>ref|XP_003629847.1| Heat stress transcription factor A-4a [Medicago truncatula]
 gb|AET04323.1| heat shock transcription factor A4A [Medicago truncatula]
Length=401

 Score =   223 bits (567),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 145/349 (42%), Positives = 208/349 (60%), Gaps = 38/349 (11%)
 Frame = +2

Query  374   GGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSF  553
             G S+S  PFLAKTYE+VDDR++  +VSWS   +SFVVWNPPEFAR LLP++FKHNNFSSF
Sbjct  5     GSSSSLPPFLAKTYEMVDDRSSDPIVSWSASNKSFVVWNPPEFARVLLPRFFKHNNFSSF  64

Query  554   IRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQP-NSGVPLSeper  730
             IRQLNTYGFRK+D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS     +  PL+E ER
Sbjct  65    IRQLNTYGFRKVDPEQWEFANDDFLRGQPHLMKNIHRRKPVHSHSLHNLQAQAPLTESER  124

Query  731   refeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLS  910
             +   +EIE+LKQ+   L +E +R + +      +      +L+ ++ +Q+++L+ V++  
Sbjct  125   QSMVDEIEKLKQDREQLLMETNRYQHDWETYEIQMHCSKDQLEKLEHKQQKMLSSVSEAL  184

Query  911   LKP----DLLHHLEVHNKKRK-PSVS---NGHLELVNNLDSSITVCQK--------ILNG  1042
              KP    +LL   E   +KR+ P+ S   N    + + +++S+ + ++         LN 
Sbjct  185   QKPMIAVNLLPLAEAMERKRRLPARSGCFNNEASVEDAMETSVALPRENAEDNSTLTLNT  244

Query  1043  --ISNGEEAYGNFETLPQAPSG-------DSRFSSPSTQTDTPEISS------LHTKHPG  1177
               +   E +   +ETL     G       +      +   D+  ISS      +  K P 
Sbjct  245   ERLDQLEASVAFWETLAHEVGGNFVHTHSNMDLDESTCCADSLSISSQQLDGEVRPKSPE  304

Query  1178  ADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTEE  1324
              D N + A   AA++   LK++   R +TAA    G NDVFW+QFLTE+
Sbjct  305   IDMNVEPA--SAALEAVALKEQ-PARITTAA---TGVNDVFWEQFLTED  347



>dbj|BAJ93519.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   223 bits (568),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 148/381 (39%), Positives = 200/381 (52%), Gaps = 59/381 (15%)
 Frame = +2

Query  353   CEMDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFK  532
              EM+G   G ASPAPFL KTYE+V+D A S VVSW  GG SFVVWNPP+F+RDLLPKYFK
Sbjct  1     MEMEGGSQG-ASPAPFLIKTYEMVEDPATSRVVSWGPGGASFVVWNPPDFSRDLLPKYFK  59

Query  533   HNNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVP  712
             HNNFSSFIRQLNTYGFRKID E+WEFAND+FIRG  HLLKNIHRRKP+HSHS Q     P
Sbjct  60    HNNFSSFIRQLNTYGFRKIDPERWEFANDDFIRGHMHLLKNIHRRKPVHSHSLQNQVNGP  119

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             L+E ERRE+E+EI RLK ENS L  EL ++  +     +  QSL+ RL  +++RQ  V++
Sbjct  120   LAESERREYEDEISRLKHENSLLVAELQKQAHQQCGIGWLMQSLEDRLMVMEQRQTDVVS  179

Query  893   LVAQLSLKPDLLHH------LEVH-----NKKRK-----------------------PSV  970
              V  +  +    HH      LE+      +KKR+                       P +
Sbjct  180   SVRDILQRRRGAHHPGQQTMLELEPTDRFSKKRRVPKIDLFVEEQRVPYPRAIGDETPGM  239

Query  971   SNGHLELVNNLDSSITVCQKILNGI-------SNGEEAYGNFETLP--------------  1087
                + E    ++ ++   +K++          S  + A G+ +  P              
Sbjct  240   IQVNAEPFEKMEMALVSLEKLVQRAAAATPTPSTDDPALGDLQAAPMEAGVNLELSPPNI  299

Query  1088  ---QAPSGDSRFSSPSTQTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRS  1258
                 +P   +   SP     +P +     +       ++A  +  A   D  +D     +
Sbjct  300   RHVHSPPELAVAESPGYAVQSPMLLFPDIQQDKHKTMSEADLSSEASTTDTSQDETTAET  359

Query  1259  STAAVPVVGGNDVFWQQFLTE  1321
                  P V  ND+FW++FL +
Sbjct  360   GVPREPAVAANDLFWERFLVD  380



>gb|AHZ44768.1| heat shock factor A4e [Triticum aestivum]
Length=445

 Score =   223 bits (569),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = +2

Query  371  QGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSS  550
            QG S SPAPFL KTYE+V+D A S VVSW  GG SFVVWNPP+F+RDLLPKYFKHNNFSS
Sbjct  14   QGASLSPAPFLIKTYEMVEDPATSRVVSWGPGGASFVVWNPPDFSRDLLPKYFKHNNFSS  73

Query  551  FIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeper  730
            FIRQLNTYGFRKID E WEFAND+FIRG  HLLKNIHRRKP+HSHS Q     PL+E ER
Sbjct  74   FIRQLNTYGFRKIDPELWEFANDDFIRGHMHLLKNIHRRKPVHSHSPQNQVNGPLAESER  133

Query  731  refeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
            RE+EEEI RLK EN  L  EL R+ Q+     +  QSL+ RL ++++RQ  V+A V
Sbjct  134  REYEEEISRLKHENGLLVAELQRQAQQQCGLSWLMQSLEDRLTAMEQRQANVVASV  189



>ref|XP_002440121.1| hypothetical protein SORBIDRAFT_09g026440 [Sorghum bicolor]
 gb|EES18551.1| hypothetical protein SORBIDRAFT_09g026440 [Sorghum bicolor]
Length=476

 Score =   223 bits (568),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = +2

Query  380  SASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIR  559
            S+SP PFL KTYE+V+D A + VVSW  GG SFVVWNPP+F+RDLLPKYFKHNNFSSFIR
Sbjct  22   SSSPPPFLIKTYEMVEDPATNHVVSWGPGGASFVVWNPPDFSRDLLPKYFKHNNFSSFIR  81

Query  560  QLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperref  739
            QLNTYGFRKID E+WEFAND+FIRG THLLKNIHRRKP+HSHS Q     PL+E ERRE 
Sbjct  82   QLNTYGFRKIDPERWEFANDDFIRGHTHLLKNIHRRKPVHSHSLQTQVNGPLAESERREL  141

Query  740  eeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQL  907
            E+EI RLK E S L  +L R+ Q+     ++ QSL+SRL +++ERQR ++A +  +
Sbjct  142  EDEINRLKYEKSLLLADLQRQNQQRCGISWQMQSLESRLVAMEERQRHIVASLCDI  197



>ref|XP_007147994.1| hypothetical protein PHAVU_006G171700g [Phaseolus vulgaris]
 ref|XP_007147995.1| hypothetical protein PHAVU_006G171700g [Phaseolus vulgaris]
 gb|ESW19988.1| hypothetical protein PHAVU_006G171700g [Phaseolus vulgaris]
 gb|ESW19989.1| hypothetical protein PHAVU_006G171700g [Phaseolus vulgaris]
Length=386

 Score =   220 bits (561),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 144/366 (39%), Positives = 212/366 (58%), Gaps = 67/366 (18%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             M+  QG S+S  PFL+KTY++VDD + +++VSWS   +SFVVWNPPEF++DLLP++FKH+
Sbjct  2     MEEAQGNSSSLPPFLSKTYDMVDDPSTNSIVSWSVTNKSFVVWNPPEFSKDLLPRFFKHS  61

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS---AQPNSGV  709
             NFSSFIRQLNTYGFRKID E WEFAN+ F+RGQ HLLKNIHRRKP+HSHS    Q     
Sbjct  62    NFSSFIRQLNTYGFRKIDPELWEFANEGFVRGQPHLLKNIHRRKPVHSHSLQNIQVQGSS  121

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
             PL++ ER+ F++EI +LK E   +  EL+R EQE      + Q  + RL+ ++++Q  ++
Sbjct  122   PLTKSERQSFKDEIRKLKDEKDQILRELERHEQEWGMYEVQLQYSNDRLEQLEKKQENLV  181

Query  890   ALVAQLSLKP----DLLHHLEVHNKKRK------------------------------PS  967
             + V+++  KP    +LL   E  ++KR+                               S
Sbjct  182   SSVSEVLQKPGIALNLLPLTENGDRKRRLPRSGLFSDDDSIEDHMETSSVLPGVNAEGAS  241

Query  968   VSNGHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPE  1147
             +   ++E  + L+SSI   + I + +    +++ N +               ++  D+P 
Sbjct  242   IFAPNMERFDILESSIMFWENIAHDV----QSHVNMD-----------LDETTSCADSPA  286

Query  1148  ISSLHT------KHPGADGNAKAAWNCAAV-DVDRLKDRLEGRSSTAAVPVVGG-NDVFW  1303
             ISS+        K PG + N+++A   AAV D+D  K+     S    VPV  G ND+FW
Sbjct  287   ISSVQLEVEVQPKSPGINVNSESA--VAAVPDLDASKE-----SPVGTVPVATGVNDIFW  339

Query  1304  QQFLTE  1321
             ++FLTE
Sbjct  340   ERFLTE  345



>ref|XP_008656477.1| PREDICTED: heat stress transcription factor A-4d-like [Zea mays]
Length=449

 Score =   222 bits (565),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 142/187 (76%), Gaps = 2/187 (1%)
 Frame = +2

Query  359  MDGTQGGSAS--PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFK  532
            M G +G ++S  P PFL KTYE+V+D A + VVSW  GG SFVVWNPP+F+RDLLPKYFK
Sbjct  1    MAGMEGSNSSSQPPPFLIKTYEMVEDPATNHVVSWGPGGASFVVWNPPDFSRDLLPKYFK  60

Query  533  HNNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVP  712
            HNNFSSFIRQLNTYGFRKID E+WEFAND+F+RG THLLKNIHRRKP+HSHS Q     P
Sbjct  61   HNNFSSFIRQLNTYGFRKIDPERWEFANDDFVRGHTHLLKNIHRRKPVHSHSPQTQVNGP  120

Query  713  LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
            L+E ERRE E+EI RLK E S L  +L R+ Q+     ++ QSL+ RL  ++ERQR ++A
Sbjct  121  LAESERRELEDEISRLKYEKSLLLTDLQRQSQQRCGISWQMQSLERRLAQMEERQRNIVA  180

Query  893  LVAQLSL  913
             +  + L
Sbjct  181  SLRDILL  187



>emb|CBI30730.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   218 bits (556),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 144/334 (43%), Positives = 191/334 (57%), Gaps = 47/334 (14%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD + G S SP PFL KTYE+VDD    ++VSWS+  +SF+VWNP +F+RDLLP++FKHN
Sbjct  1     MDESPGSSNSPPPFLTKTYEMVDDPTTDSIVSWSQTNKSFIVWNPEDFSRDLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG----  706
             NFSSFIRQLNTYGFRKID+EQW FAN++FIRGQ HLL+NIHRRKP+HSHS Q   G    
Sbjct  61    NFSSFIRQLNTYGFRKIDSEQWAFANEDFIRGQPHLLRNIHRRKPVHSHSIQNQKGQGTS  120

Query  707   VPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQV  886
              PLSE +R  +  +IERLK +  +L +EL R +++ +    + Q L  RLQ +++RQ+ V
Sbjct  121   CPLSESDREGYRADIERLKHDKGALLLELQRHKEDRQGLELQMQHLKDRLQHMEQRQQTV  180

Query  887   LALVAQLSLKPDL----LHHLEVHNKKRKPSVSNGHLELV----NNLDSSITVCQKILNG  1042
             ++ +A++  KP L    L  +E HN+KR+   SN   +      N + +S TV  + L+ 
Sbjct  181   ISYLARMLQKPGLALSFLPSMETHNRKRRLLTSNCFYDESDVEENRIATSHTVNTEKLDA  240

Query  1043  ISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGADGNAKAAWNCAAVD  1222
              S           L      +S  SS     D    +S    HP         W      
Sbjct  241   TS----------VLELVEFLESSLSSWEDILDEFRPTSGTLIHP---------WKQVV--  279

Query  1223  VDRLKDRLEGRSSTAAVPV-VGGNDVFWQQFLTE  1321
                           AA PV  G NDVFW+QF TE
Sbjct  280   -------------GAASPVPTGVNDVFWEQFFTE  300



>ref|XP_010317423.1| PREDICTED: heat stress transcription factor A-4a [Solanum lycopersicum]
 ref|XP_010317424.1| PREDICTED: heat stress transcription factor A-4a [Solanum lycopersicum]
Length=401

 Score =   219 bits (559),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 154/414 (37%), Positives = 221/414 (53%), Gaps = 76/414 (18%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD       +  PF+AK YE+VDD +   +VSWS   +SF+V NPP+FARDLLP+YFKHN
Sbjct  1     MDEAPCSVNALPPFIAKIYEMVDDPSTDPIVSWSLNNKSFIVRNPPDFARDLLPRYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ---PNSGV  709
             NFSSFIRQLNTYGF+KID EQWEFAN++F+RGQ HLLKNI+RRKP+HSHS Q     S  
Sbjct  61    NFSSFIRQLNTYGFKKIDPEQWEFANEDFLRGQPHLLKNIYRRKPVHSHSVQNIHSLSSS  120

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
              L+E ER+ ++E+IE+LK EN SL + L R +Q+++    + Q L+ R+Q + +RQ+ VL
Sbjct  121   ALTESERQGYKEDIEKLKHENESLHLVLHRHKQDHQGLEMQMQVLNQRVQQVKDRQKNVL  180

Query  890   ALVAQLSLKP----DLLHHLEVHNKKRK-------------------------------P  964
             + +A+   KP     L+  LE++ +KR+                                
Sbjct  181   STLARTINKPGLALSLMPQLEMNERKRRLPGNSFLYNEIGLEDNQASSSENTTRENMDHT  240

Query  965   SVSNGHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTP  1144
             S+S  + E+++ L+SS+T  +  L  I        +   L ++ S            D+P
Sbjct  241   SLSTLNKEVLDQLESSLTFWEYTLRDIDQTRMRRSSSIDLDESISC----------ADSP  290

Query  1145  EIS------SLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQ  1306
              IS       + +K    D N++   N    DV   ++R+E  +++  VP  G NDVFW+
Sbjct  291   AISYPQLTVDVGSKVSDIDMNSEPNGNTTP-DVTPPENRVE--TASHNVP-TGVNDVFWE  346

Query  1307  QFLTEEVeserreigirngre------------------CMIVFAEQMGHFTPA  1414
             QFLTE   S   +    +                      +I   EQ+GH TPA
Sbjct  347   QFLTENPGSTDVKPEREDMESKISESKTVEDGKFWWNRKTVISLTEQLGHLTPA  400



>gb|AFW82556.1| hypothetical protein ZEAMMB73_407508 [Zea mays]
Length=446

 Score =   221 bits (562),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 141/185 (76%), Gaps = 1/185 (1%)
 Frame = +2

Query  359  MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
            M+G+   S+ P PFL KTYE+V+D A + VVSW  GG SFVVWNPP+F+RDLLPKYFKHN
Sbjct  1    MEGS-NSSSQPPPFLIKTYEMVEDPATNHVVSWGPGGASFVVWNPPDFSRDLLPKYFKHN  59

Query  539  NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
            NFSSFIRQLNTYGFRKID E+WEFAND+F+RG THLLKNIHRRKP+HSHS Q     PL+
Sbjct  60   NFSSFIRQLNTYGFRKIDPERWEFANDDFVRGHTHLLKNIHRRKPVHSHSPQTQVNGPLA  119

Query  719  eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
            E ERRE E+EI RLK E S L  +L R+ Q+     ++ QSL+ RL  ++ERQR ++A +
Sbjct  120  ESERRELEDEISRLKYEKSLLLTDLQRQSQQRCGISWQMQSLERRLAQMEERQRNIVASL  179

Query  899  AQLSL  913
              + L
Sbjct  180  RDILL  184



>gb|AFK44257.1| unknown [Medicago truncatula]
Length=401

 Score =   219 bits (558),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 144/349 (41%), Positives = 206/349 (59%), Gaps = 38/349 (11%)
 Frame = +2

Query  374   GGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSF  553
             G S+S  PFLAKTYE+VDDR++  +VSWS   +SFVVWNPPEFAR LLP++FKHNNFSSF
Sbjct  5     GSSSSLPPFLAKTYEMVDDRSSDPIVSWSASNKSFVVWNPPEFARVLLPRFFKHNNFSSF  64

Query  554   IRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQP-NSGVPLSeper  730
             I QLNTYGFRK+D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS     +  PL+E ER
Sbjct  65    ITQLNTYGFRKVDPEQWEFANDDFLRGQPHLMKNIHRRKPVHSHSLHNLQAQAPLTESER  124

Query  731   refeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLS  910
             +   +EIE+LKQ+   L +E +R + +      +      +L+ ++ +Q+++L  V++  
Sbjct  125   QSMVDEIEKLKQDREQLLMETNRYQHDWETYEIQMHCSKDQLEKLEHKQQKMLPSVSEAL  184

Query  911   LKP----DLLHHLEVHNKKRK-PSVS---NGHLELVNNLDSSITVCQK--------ILNG  1042
              KP    +LL   E   +KR+ P+ S   N    + + +++S+ + ++         LN 
Sbjct  185   QKPMIAVNLLPLAEAMERKRRLPARSGCFNNEASVEDAMETSVALPRENAEDNSTLTLNT  244

Query  1043  --ISNGEEAYGNFETLPQAPSG-------DSRFSSPSTQTDTPEISS------LHTKHPG  1177
               +   E +   +ETL     G       +      +   D+  ISS      +  K P 
Sbjct  245   ERLDQLEASVAFWETLAHEVGGNFVHTHSNMDLDESTCCADSLSISSQQLDGEVRPKSPE  304

Query  1178  ADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTEE  1324
              D N + A   AA++   LK++   R +TAA    G NDVFW+QFLTE+
Sbjct  305   IDMNVEPA--SAALEAVALKEQ-PARITTAA---TGVNDVFWEQFLTED  347



>ref|XP_006398255.1| hypothetical protein EUTSA_v10000950mg [Eutrema salsugineum]
 dbj|BAJ34615.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ39708.1| hypothetical protein EUTSA_v10000950mg [Eutrema salsugineum]
Length=345

 Score =   217 bits (553),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 137/332 (41%), Positives = 195/332 (59%), Gaps = 47/332 (14%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD   GGS+S  PFL KTYE+VDD ++ ++VSWS   +SF+V NP +F+RDLLP++FKH 
Sbjct  1     MDENSGGSSSLPPFLTKTYEMVDDSSSDSIVSWSDNNKSFIVKNPADFSRDLLPRFFKHK  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQP-NSGVPL  715
             NFSSFIRQLNTYGFRKID E+WEFAND+F+RGQ +L+KNIHRRKP+HSHS Q   +  PL
Sbjct  61    NFSSFIRQLNTYGFRKIDPEKWEFANDDFVRGQPYLMKNIHRRKPVHSHSLQNLQAQNPL  120

Query  716   SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
             +E ER+  +++IERL++EN  L  +L  +EQE +    +  +L  RLQ+++ RQ+ +++ 
Sbjct  121   TESERQSMKDQIERLRKENEVLLADLQNQEQERKVFELQVATLKERLQNMEHRQKSIVSY  180

Query  896   VAQLSLKPDLLHHLEVHNKKRK----------PSVSNGHLELVNNLDSSITVCQKILNGI  1045
             V+Q+  KP L  +LE H ++++          PS SN   E V  L+SS+T  + ++   
Sbjct  181   VSQVLEKPGLSLNLETHERRKRKSQETTSLLPPSRSNA--EQVEKLESSLTFLENLV---  235

Query  1046  SNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGADGNAKAAWNCAAVDV  1225
                                          T++ + S +H+     D N   +  C     
Sbjct  236   -----------------------------TESCDKSGVHSSSMDLDVNESTS--CGETRP  264

Query  1226  DRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                K  +     T A P  G NDVFW+Q LTE
Sbjct  265   KSTKIDMNSEPVTVAAPKTGVNDVFWEQCLTE  296



>gb|EMT25826.1| Heat stress transcription factor A-4d [Aegilops tauschii]
Length=517

 Score =   222 bits (565),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +2

Query  371  QGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSS  550
            QG S SPAPFL KTYE+V+D A + VVSW  GG SFVVWNPP+F+RDLLPKYFKHNNFSS
Sbjct  89   QGASLSPAPFLIKTYEMVEDPATNRVVSWGPGGASFVVWNPPDFSRDLLPKYFKHNNFSS  148

Query  551  FIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeper  730
            FIRQLNTYGFRKID E+WEFAND+FIRG  HLLKNIHRRKP+HSHS Q     PL+E ER
Sbjct  149  FIRQLNTYGFRKIDPERWEFANDDFIRGHMHLLKNIHRRKPVHSHSPQTQVNGPLAEAER  208

Query  731  refeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
            RE+EE+I RLK ENS L  EL R+ ++     +  QSL+ RL +++ RQ  V+A V
Sbjct  209  REYEEDISRLKHENSVLVAELQRQARQQCGLSWLMQSLEDRLMAMERRQADVVASV  264



>ref|XP_011010913.1| PREDICTED: heat stress transcription factor A-4c-like isoform 
X1 [Populus euphratica]
 ref|XP_011010914.1| PREDICTED: heat stress transcription factor A-4c-like isoform 
X2 [Populus euphratica]
Length=407

 Score =   219 bits (557),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 144/356 (40%), Positives = 209/356 (59%), Gaps = 39/356 (11%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD +QG   S  PFLAKTYE+VDD +  ++VSWS+  +SF VW+PPEFARDLLP++FKHN
Sbjct  1     MDESQGSPNSLPPFLAKTYEMVDDPSTDSIVSWSQSNKSFTVWDPPEFARDLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVP--  712
             NFSSFIRQLNTYGFRKID EQWEFAN++FIRGQ  L+KNIHRRKP+HSHS Q   G    
Sbjct  61    NFSSFIRQLNTYGFRKIDPEQWEFANEDFIRGQPFLMKNIHRRKPVHSHSLQNLQGQGSN  120

Query  713   -LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
              L++ ER+  +++IERLK++  +L +EL  +EQ+ +    + + L  +L+ ++ RQ+ ++
Sbjct  121   LLTDSERQSMKDDIERLKRDKQALILELQMQEQQQKGFEMQIEGLKEKLKQMERRQQTMV  180

Query  890   ALVAQLSLKP----DLLHHLEVHNKKRKPS-VSNGHLELVNNLDSSITVCQKILNGISNG  1054
             + V ++  +P    +L+  LE H++KR+ S +   H E  +N D+     Q +    ++G
Sbjct  181   SFVTRVLPQPGLALNLMPQLEGHDRKRRLSRIGCLHSEASSNEDNQTVTSQALSRENADG  240

Query  1055  EE-AYGNFETLPQAPSGDS--------------------RFSSPSTQTDTPEIS------  1153
                A  N E   Q  S  +                         ++  ++P IS      
Sbjct  241   NSFALLNMEQFEQLESSLTFWENMVNDVVQTHNHNTKTIEMDESTSGAESPVISCAQLIF  300

Query  1154  SLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                 K PG D N++ +    AV  + +  + +   +T AV   G NDVFW+QFLTE
Sbjct  301   DFRPKTPGIDMNSEPS---IAVVPEPVSPKEQPAGTTPAV-ATGVNDVFWEQFLTE  352



>ref|XP_006356094.1| PREDICTED: heat stress transcription factor A-4a-like isoform 
X1 [Solanum tuberosum]
Length=403

 Score =   218 bits (555),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 154/414 (37%), Positives = 219/414 (53%), Gaps = 76/414 (18%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD       +  PF+AK YE+VDD +   +VSWS   +SF+V NPP+FARDLLP+YFKHN
Sbjct  1     MDEAPCSVNALPPFIAKIYEMVDDPSTDPIVSWSSNNKSFIVLNPPDFARDLLPRYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPN---SGV  709
             NFSSFIRQLNTYGF+KID EQWEFAN++F+RGQ HLLKNI+RRKP+HSHS Q     S  
Sbjct  61    NFSSFIRQLNTYGFKKIDPEQWEFANEDFLRGQPHLLKNIYRRKPVHSHSVQNIHILSSS  120

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
              L+E ER+ ++E+IE+LK EN SL + L R +Q+++    + Q L+ R+Q + +RQ+ VL
Sbjct  121   ALTESERQGYKEDIEKLKHENESLHLVLHRHKQDHQGLEMQMQVLNQRVQQVKDRQKNVL  180

Query  890   ALVAQLSLKP----DLLHHLEVHNKKRK-------------------------------P  964
             + +A+   KP     L+  LE++ +KR+                                
Sbjct  181   STLARTINKPGLALSLMPQLEMNERKRRLPGNSFLYNETGLEDNQASSSENSTRENMDPT  240

Query  965   SVSNGHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTP  1144
             S+   + E+++ L+ S+T  +  L  I            + Q+ S D       +  D+P
Sbjct  241   SLLTLNKEVLDQLEPSLTFWEYTLRDIDQAR--------MRQSSSID--LDESISCADSP  290

Query  1145  EIS------SLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQ  1306
              IS       + +K    D N++   N    DV   ++R+E  S+   VP  G NDVFW+
Sbjct  291   AISYPQLTVDVGSKVSDIDMNSEPNGNTTP-DVTPPENRVETASNN--VP-TGVNDVFWE  346

Query  1307  QFLTEEVeserreigirngre------------------CMIVFAEQMGHFTPA  1414
             QFLTE   S   +    +                      +I   EQ+GH TPA
Sbjct  347   QFLTENPGSTDVKPEREDMESKISESKTVEDGKFWWNRKTVISLTEQLGHLTPA  400



>ref|XP_008792312.1| PREDICTED: heat stress transcription factor A-4b-like [Phoenix 
dactylifera]
Length=450

 Score =   219 bits (557),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 155/386 (40%), Positives = 208/386 (54%), Gaps = 78/386 (20%)
 Frame = +2

Query  389   PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
             PAPFL KTY++VDD + +++VSWS G  SF+VWNPPEFARDLLPKYFKHNNFSSF+RQLN
Sbjct  13    PAPFLTKTYDMVDDPSTNSIVSWSPGNTSFIVWNPPEFARDLLPKYFKHNNFSSFVRQLN  72

Query  569   TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSA--QPNSGVPLSeperrefe  742
             TYGFRKID +QWEFAN++F RGQ HLL+NIHRRKPIHSHS   Q +SG PL+E ER E E
Sbjct  73    TYGFRKIDPDQWEFANEDFARGQRHLLRNIHRRKPIHSHSLHHQGSSG-PLAETERHELE  131

Query  743   eeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLK--  916
             EEIERLK +   L  EL +  Q       + Q+L+ RL  ++ RQR +LA + Q+  +  
Sbjct  132   EEIERLKHDKLMLISELQKHTQLQHGMEQKMQTLEERLHDMEHRQRNLLAFLTQIVQRRG  191

Query  917   --PDLLHHLEVHNKKRK-PSVSNGH-----------------------------LELVNN  1000
                D +   E  +KKR+ P  S  +                             +E    
Sbjct  192   FLSDFVQQSEFLSKKRRLPKTSYFYEDANMEENCVISQSKSREESNMGSMHAVDIEPFEK  251

Query  1001  LDSSITVCQKILNGIS--NGEEAYGN--FETLP--------QAPSGDS----RFSSPSTQ  1132
             ++SS+   +    G+S  +GE+ Y +    +LP         A S D+    R  SP   
Sbjct  252   MESSLNSLENFFRGVSQASGEDVYYDCALHSLPSGAVLTEMNASSEDTEVNLRSPSPKLH  311

Query  1133  TDTPEISSLHTKHPGADGNAKAAWNC-----------------------AAVDVDRLKDR  1243
               +P +  +H+     +  + A                           AA +VD  ++R
Sbjct  312   PSSPCLGDMHSSPELTESTSYAESPALPLTEIQTDTRIKVSEIDVNSEPAAPEVDSSRER  371

Query  1244  LEGRSSTAAVPVVGGNDVFWQQFLTE  1321
               G ++ + VP  G NDVFW+QFLTE
Sbjct  372   AAG-AAASTVP-TGVNDVFWEQFLTE  395



>ref|XP_004143229.1| PREDICTED: heat stress transcription factor A-4b-like [Cucumis 
sativus]
 gb|KGN47015.1| hypothetical protein Csa_6G169310 [Cucumis sativus]
Length=300

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/248 (48%), Positives = 168/248 (68%), Gaps = 20/248 (8%)
 Frame = +2

Query  359   MDGTQGGS-ASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKH  535
             MDG++G S  +P PFL KTYE+VDD   +++VSW++ G SFVVWNPPEFA++LLP YFKH
Sbjct  1     MDGSEGSSTGAPPPFLTKTYEMVDDPMTNSIVSWNQSGFSFVVWNPPEFAQELLPIYFKH  60

Query  536   NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSH--SAQPNSGV  709
             NNFSSF+RQLNTYGFRKID EQWEFAN+ FIRG+THLLK+IHRRKPI+SH  S+Q N G 
Sbjct  61    NNFSSFVRQLNTYGFRKIDREQWEFANEGFIRGKTHLLKSIHRRKPIYSHSQSSQGNGGA  120

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
             PLSE ER E E++I+ L QE ++L+ +L + E E  +   + Q +  +L  +  +Q+Q++
Sbjct  121   PLSEQERHELEQKIKTLYQEKTNLQSQLQKHENEKEQIGHQIQRICEKLWRMGNQQKQLI  180

Query  890   ALV-AQL---------------SLKPDLLHHLEVHNKKRKPSVSNGHLELVNNLDSSITV  1021
              ++ A+L                   + L   E  N K+K  V+   LEL+  L+ S+ +
Sbjct  181   GILGAELEKNEHRKKRKIGKVNEFLVEELTEFEKDNLKKK-KVNVPPLELLGKLELSLGL  239

Query  1022  CQKILNGI  1045
             C+ +L+ +
Sbjct  240   CEDLLSNV  247



>ref|XP_004147389.1| PREDICTED: heat stress transcription factor A-4a-like [Cucumis 
sativus]
 gb|KGN65603.1| hypothetical protein Csa_1G467710 [Cucumis sativus]
Length=409

 Score =   218 bits (554),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 148/358 (41%), Positives = 200/358 (56%), Gaps = 41/358 (11%)
 Frame = +2

Query  359   MDGTQGGS-ASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKH  535
             MD  QGG   S  PFL KTY++VDD + +++VSWS   +SFVVWNP EF+  LLPK+FKH
Sbjct  1     MDEAQGGGLTSLPPFLVKTYDMVDDPSTNSIVSWSSSDKSFVVWNPLEFSSVLLPKFFKH  60

Query  536   NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG---  706
             +NFSSFIRQLNTYGFRK+D EQWEFAN++F+RG+ HL+KNIHRRKPIHSHS Q   G   
Sbjct  61    SNFSSFIRQLNTYGFRKVDPEQWEFANEDFVRGKPHLMKNIHRRKPIHSHSLQNLHGQGI  120

Query  707   VPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQV  886
              PL+E ER  F+++IERLK +   L +EL + EQE +    + Q+L  R Q + +  +  
Sbjct  121   SPLTEVERNSFKDDIERLKLDKEQLLLELQKYEQEYQGVGLQIQNLKDRFQRVQQEMQLF  180

Query  887   LALVAQLSLKP----DLLHHLEVHNKKRK-PSVS---------NGHLELVNNLDSSITVC  1024
             ++L+A+L  KP    DLL  LE   +KR+ P VS         + HL     +      C
Sbjct  181   ISLMARLLQKPGLHLDLLPQLETPERKRRLPRVSYNISEDSLEDNHLGTTQTIGRDDMGC  240

Query  1025  -----------QKILNGISNGEEAYGNF-ETL-PQAPSGDSRFSSPSTQTDTPEISS---  1156
                        + +   ++  E    ++ ET+ P   S +       +   +P IS    
Sbjct  241   SFDPILEKEQLELLETSLTFWEGIIHSYDETVSPLDSSSNLELVGSVSHASSPAISCRLV  300

Query  1157  ---LHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                   K PG D N +     A V  D +  + +     A +P  G NDVFWQQFLTE
Sbjct  301   REEFRCKSPGIDMNLEP---MATVAPDSVASKDQAAGVNAPLP-TGFNDVFWQQFLTE  354



>ref|XP_004162154.1| PREDICTED: LOW QUALITY PROTEIN: heat stress transcription factor 
A-4b-like [Cucumis sativus]
Length=300

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/248 (48%), Positives = 167/248 (67%), Gaps = 20/248 (8%)
 Frame = +2

Query  359   MDGTQGGS-ASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKH  535
             MDG++G S  +P PFL KTYE+VDD   +++VSW++ G SFVVWNPPEFA++LLP YFKH
Sbjct  1     MDGSEGSSTGAPPPFLTKTYEMVDDPMTNSIVSWNQSGFSFVVWNPPEFAQELLPIYFKH  60

Query  536   NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSH--SAQPNSGV  709
             NNFSSF+RQLNTYGFRKID EQWEFAN+ FIRG+THLLK+IHRRKPI+SH  S+Q N G 
Sbjct  61    NNFSSFVRQLNTYGFRKIDREQWEFANEGFIRGKTHLLKSIHRRKPIYSHSQSSQGNGGA  120

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
             PLSE ER E E+ I+ L QE ++L+ +L + E E  +   + Q +  +L  +  +Q+Q++
Sbjct  121   PLSEQERHELEQXIKTLYQEKTNLQSQLQKHENEKEQIGHQIQRICEKLWRMGNQQKQLI  180

Query  890   ALV-AQL---------------SLKPDLLHHLEVHNKKRKPSVSNGHLELVNNLDSSITV  1021
              ++ A+L                   + L   E  N K+K  V+   LEL+  L+ S+ +
Sbjct  181   GILGAELEKNEHRKKRKIGKVNEFLVEELTEFEKDNLKKK-KVNVPPLELLGKLELSLGL  239

Query  1022  CQKILNGI  1045
             C+ +L+ +
Sbjct  240   CEDLLSNV  247



>ref|XP_009406764.1| PREDICTED: heat stress transcription factor A-4b-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406765.1| PREDICTED: heat stress transcription factor A-4b-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406766.1| PREDICTED: heat stress transcription factor A-4b-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406767.1| PREDICTED: heat stress transcription factor A-4b-like [Musa acuminata 
subsp. malaccensis]
Length=441

 Score =   218 bits (554),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 152/205 (74%), Gaps = 6/205 (3%)
 Frame = +2

Query  359  MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
            M+G++G S SP PFL KTYE+VDD + +++VSWS    SFVVWNPPEFARDLLPKYFKHN
Sbjct  1    MEGSRGSSNSPPPFLTKTYEMVDDPSTNSIVSWSPSNTSFVVWNPPEFARDLLPKYFKHN  60

Query  539  NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
            NFSSF+RQLNTYGFRK D +QWEF ND+FIRGQ HLL+NI+RRKP+HSHS   N G   S
Sbjct  61   NFSSFVRQLNTYGFRKTDPDQWEFTNDDFIRGQRHLLQNIYRRKPVHSHSLH-NQGN-TS  118

Query  719  eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
            E ER+E EEEIERLKQ+  +L  E  ++ Q+      + QSL+ RLQ ++ RQR ++  +
Sbjct  119  EAERQELEEEIERLKQKKGTLLSEFQKQTQQRHGMEHQMQSLEDRLQVLENRQRSLMDFL  178

Query  899  AQLSLKPDLLHHL----EVHNKKRK  961
            AQ+  KP  L ++    ++ +KKR+
Sbjct  179  AQIIQKPGFLSNIVQFSDLRSKKRR  203



>ref|XP_009785427.1| PREDICTED: heat stress transcription factor A-4a-like [Nicotiana 
sylvestris]
Length=405

 Score =   216 bits (550),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 142/364 (39%), Positives = 204/364 (56%), Gaps = 55/364 (15%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD     + +  PF+AKTYE+VDD +   +VSWS   +SF+VWNPP+FAR+LLP+YFKHN
Sbjct  1     MDEAPCSANALPPFIAKTYEMVDDPSTDPIVSWSSTNKSFIVWNPPDFARELLPRYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGV--P  712
             NFSSFIRQLNTYGFRK+D EQWEFAN++FI+G+ HLL+NIHRRKP+HSHS Q    V   
Sbjct  61    NFSSFIRQLNTYGFRKVDPEQWEFANEDFIKGEPHLLRNIHRRKPVHSHSVQNLHSVSSA  120

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             L+E ER+ ++E+IE+LK EN SL +EL   +Q+ +    +      R+Q +  RQ+ +L+
Sbjct  121   LTESERQGYKEDIEKLKHENESLHLELQGHKQDYQGLEMQMLVFTERVQLVKHRQKNMLS  180

Query  893   LVAQLSLKP----DLLHHLEVHNKKRK-------------------------------PS  967
              +A+   KP     L+  LE++ +KR+                                S
Sbjct  181   TLARTINKPGLALSLIPQLEMNERKRRLPGNSFLYNETGLEDNQASSSQESTRENMDPTS  240

Query  968   VSNGHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPE  1147
                 + EL++ LDSS+T  + IL+ +        N+     +   D+  S      D+P 
Sbjct  241   DLTLNKELLDQLDSSLTFWENILHDVDR------NWMRRSSSVDLDASISC----ADSPA  290

Query  1148  IS------SLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQ  1309
             IS       + +K  G D N++     A  +V   +D++    +    P  G NDVFW+Q
Sbjct  291   ISYSQLNVDIGSKICGIDMNSEPK-GIAVPEVALQEDQVVVIGTATNRP-TGVNDVFWEQ  348

Query  1310  FLTE  1321
             FLTE
Sbjct  349   FLTE  352



>gb|EYU28124.1| hypothetical protein MIMGU_mgv1a020225mg [Erythranthe guttata]
Length=411

 Score =   216 bits (550),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 152/370 (41%), Positives = 212/370 (57%), Gaps = 63/370 (17%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD  Q  S S  PFLAKTYE+V+D ++ +VVSWS   +SF+VWNPPEF+RDLLP++FKHN
Sbjct  1     MDEAQCSSNSLPPFLAKTYEMVEDPSSDSVVSWSWNNKSFIVWNPPEFSRDLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPN--SGVP  712
             NFSSFIRQLNTYGFRK+D EQWEF+N++F+RGQ HLLKNIHRRKP+HSHSA PN  S  P
Sbjct  61    NFSSFIRQLNTYGFRKVDPEQWEFSNEDFVRGQPHLLKNIHRRKPVHSHSA-PNLASLPP  119

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             L+E ER+ ++E+IE+L+ +  SL VEL R + E +  + + + L  R+Q+++ R   +L+
Sbjct  120   LTEMERKSYKEDIEKLRNDKESLHVELQRHKDEQQCLKSQMRILSERVQNVENRHSNMLS  179

Query  893   LVAQLSLKP----DLLHHLEVHNKKRK---------------------------------  961
              +AQ   KP    DL+   EVH++KR+                                 
Sbjct  180   SLAQTLHKPASSLDLMPQGEVHDRKRRFPGNSYLCEETNMEDNNNNNNNNNNNNQRAASQ  239

Query  962   ---------PSVSNGHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRF  1114
                       S+ N + EL+  L+SS+   +KI+  + +G     +   L ++ S     
Sbjct  240   RSTIEKLDANSLLNFNKELLEQLESSLMFWEKIVFDVGDGLVQRNSSSELVESTSCGPSP  299

Query  1115  SSPSTQTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPV-VGGN  1291
             S   TQ D            G D N++      A  ++ L+ R E ++   A  V  G N
Sbjct  300   SISYTQLDL---------DVGIDMNSEPK---TAFGLE-LQPRTEEQAVEVATNVRTGVN  346

Query  1292  DVFWQQFLTE  1321
             DVFW+QFLTE
Sbjct  347   DVFWEQFLTE  356



>ref|XP_008443546.1| PREDICTED: heat stress transcription factor A-4c [Cucumis melo]
 ref|XP_008443555.1| PREDICTED: heat stress transcription factor A-4c [Cucumis melo]
 ref|XP_008443573.1| PREDICTED: heat stress transcription factor A-4c [Cucumis melo]
Length=409

 Score =   216 bits (549),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 143/358 (40%), Positives = 196/358 (55%), Gaps = 41/358 (11%)
 Frame = +2

Query  359   MDGTQGGS-ASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKH  535
             MD  QGG   S  PFL KTY++VDD + +++VSWS   +SFVVWNP EF+  LLPK+FKH
Sbjct  1     MDEAQGGGLTSLPPFLVKTYDMVDDPSTNSIVSWSSSDKSFVVWNPLEFSSVLLPKFFKH  60

Query  536   NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG---  706
             +NFSSFIRQLNTYGFRK+D EQWEFAN++F+RG+ HL+KNIHRRKPIHSHS Q   G   
Sbjct  61    SNFSSFIRQLNTYGFRKVDPEQWEFANEDFVRGKPHLMKNIHRRKPIHSHSLQNLHGQGI  120

Query  707   VPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQV  886
              PL+E ER  F++ IERLK +   L +EL + EQE +    + Q+L  R Q + +  +  
Sbjct  121   SPLTEVERNSFKDNIERLKLDKEQLLLELQKYEQEYQGVGLQMQNLKDRFQRVQQGMQLF  180

Query  887   LALVAQLSLKP----DLLHHLEVHNKKRKPSVSNGHLELVNNLDSSITVCQKI-------  1033
             + L+A+L  KP    DLL  LE   +KR+   ++ ++   +  D  +   Q I       
Sbjct  181   IGLMARLFQKPGLRLDLLPQLETPERKRRLPRASYNISEDSLEDDQLGTTQAIGREDLSC  240

Query  1034  --------------LNGISNGEEAYGNFE--TLPQAPSGDSRFSSPSTQTDTPEISS---  1156
                              ++  E    +++   +P   S +       +   +P IS    
Sbjct  241   SFDPILEKEQLELLETSLTFWEGIIHSYDQTVIPLDSSSNLELVGSVSHASSPAISCRLV  300

Query  1157  ---LHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                   K PG D N +     A V  D +  + +     A +P  G NDVFWQQFLTE
Sbjct  301   REEFRCKSPGIDMNLEP---MATVAPDSVASKDQAAGVNAPLP-TGFNDVFWQQFLTE  354



>ref|XP_004163351.1| PREDICTED: heat stress transcription factor A-4a-like [Cucumis 
sativus]
Length=406

 Score =   215 bits (548),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 140/364 (38%), Positives = 209/364 (57%), Gaps = 57/364 (16%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD +QG S +  PFL KTYE+V+D +   +VSW+ G RSF+VWNP EF+ +LLP++FKHN
Sbjct  1     MDESQGSSNTLPPFLTKTYEMVNDPSTDPIVSWTSGNRSFIVWNPLEFSCELLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG----  706
             NFSSFIRQLNTYGFRK+D E+WEFAN++F +G+  LL+NIHRRKP+HSHS Q   G    
Sbjct  61    NFSSFIRQLNTYGFRKVDPEKWEFANEDFEKGRPDLLRNIHRRKPVHSHSLQNVQGQGFP  120

Query  707   VPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQV  886
              PL + ER+ F+EEIER KQ N  L +E  R EQE+R+ + + + +  R +++ ++Q+ +
Sbjct  121   SPLLDLERKRFKEEIERRKQTNEKLLLESQRHEQEHRDFQLQMRLMKERFENMQQQQQIL  180

Query  887   LALVAQLSLKPDLLHHL----EVHNKKRK-------------------------------  961
             L+ VA++  KP+L  +       H++KR+                               
Sbjct  181   LSHVARVLQKPELTIYFVPEPNSHDRKRRLTTVTYYYNESSAEDDLEEHSHSMSKQQIDY  240

Query  962   PSVSNGHLELVNNLDSSITVCQKILNGISNG----EEAYGNFETLPQAPSGDSRFSSPST  1129
              S S+ ++E ++ LDSS+T  ++ ++ + +        +   +   Q+P      S+P  
Sbjct  241   SSTSDLNMEHLDQLDSSLTFWERTIHDVDHTIFLPNMKFNQTKRDIQSP------STPFV  294

Query  1130  QTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQ  1309
             Q D    S  H      D N++   + A+   D +  R E   +TA+    G NDVFW+Q
Sbjct  295   QLDRSHQSKSHV----IDMNSEPVGSIAS---DSIASRKEADETTASA-RNGANDVFWEQ  346

Query  1310  FLTE  1321
             FLTE
Sbjct  347   FLTE  350



>ref|XP_004134595.1| PREDICTED: heat stress transcription factor A-4a-like [Cucumis 
sativus]
 gb|KGN49332.1| hypothetical protein Csa_6G520300 [Cucumis sativus]
Length=406

 Score =   215 bits (547),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 140/364 (38%), Positives = 209/364 (57%), Gaps = 57/364 (16%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD +QG S +  PFL KTYE+V+D +   +VSW+ G RSF+VWNP EF+ +LLP++FKHN
Sbjct  1     MDESQGSSNTLPPFLTKTYEMVNDPSTDPIVSWTSGNRSFIVWNPLEFSCELLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG----  706
             NFSSFIRQLNTYGFRK+D E+WEFAN++F +G+  LL+NIHRRKP+HSHS Q   G    
Sbjct  61    NFSSFIRQLNTYGFRKVDPEKWEFANEDFEKGRPDLLRNIHRRKPVHSHSLQNVQGQGFP  120

Query  707   VPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQV  886
              PL + ER+ F+EEIER KQ N  L +E  R EQE+R+ + + + +  R +++ ++Q+ +
Sbjct  121   SPLLDLERKRFKEEIERRKQTNEKLLLESQRHEQEHRDFQLQMRLMKERFENMQQQQQIL  180

Query  887   LALVAQLSLKPDLLHHL----EVHNKKRK-------------------------------  961
             L+ VA++  KP+L  +       H++KR+                               
Sbjct  181   LSHVARVLQKPELTIYFVPEPNSHDRKRRLTTVTYYYNESSAEDDLEEHSHSMSKQQIDY  240

Query  962   PSVSNGHLELVNNLDSSITVCQKILNGISNG----EEAYGNFETLPQAPSGDSRFSSPST  1129
              S S+ ++E ++ LDSS+T  ++ ++ + +        +   +   Q+P      S+P  
Sbjct  241   SSTSDLNMEHLDQLDSSLTFWERTIHDVDHTIFLPNMKFNQTKRDIQSP------STPFV  294

Query  1130  QTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQ  1309
             Q D    S  H      D N++   + A+   D +  R E   +TA+    G NDVFW+Q
Sbjct  295   QLDRSHQSKSHV----IDMNSEPVGSIAS---DSIASRKEADETTASA-RNGANDVFWEQ  346

Query  1310  FLTE  1321
             FLTE
Sbjct  347   FLTE  350



>ref|XP_004161196.1| PREDICTED: heat stress transcription factor A-4a-like [Cucumis 
sativus]
Length=409

 Score =   215 bits (547),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 146/358 (41%), Positives = 200/358 (56%), Gaps = 41/358 (11%)
 Frame = +2

Query  359   MDGTQGGS-ASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKH  535
             MD  QGG   S  PFL KTY++VDD + +++VSWS   +SFVVWNP EF+  LLPK+FKH
Sbjct  1     MDEAQGGGLTSLPPFLVKTYDMVDDPSTNSIVSWSSSDKSFVVWNPLEFSSVLLPKFFKH  60

Query  536   NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG---  706
             +NFSSFIRQLNTYGFRK+D EQWEF+N++F+RG+ HL+KNIHRRKPIHSHS Q   G   
Sbjct  61    SNFSSFIRQLNTYGFRKVDPEQWEFSNEDFVRGKPHLMKNIHRRKPIHSHSLQNLHGQGI  120

Query  707   VPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQV  886
              PL+E ER  F+++IERLK +   L +EL + EQE +    + Q+L  + Q + +  +  
Sbjct  121   SPLTEVERNSFKDDIERLKLDKEQLLLELQKYEQEYQGVGLQMQNLKDQFQRVQQEMQLF  180

Query  887   LALVAQLSLKP----DLLHHLEVHNKKRK-PSVS---------NGHLELVNNLDSSITVC  1024
             ++L+A+L  KP    DLL  LE   +KR+ P VS         + HL     +      C
Sbjct  181   ISLMARLLQKPGLHLDLLPQLETPERKRRLPRVSYNISEDSLEDNHLGTTQTIGRDDMGC  240

Query  1025  -----------QKILNGISNGEEAYGNF-ETL-PQAPSGDSRFSSPSTQTDTPEISS---  1156
                        + +   ++  E    ++ ET+ P   S +       +   +P IS    
Sbjct  241   SFDPILEKEQLELLETSLTFWEGIIHSYDETVSPLDSSSNLELVGSVSHASSPAISCRLV  300

Query  1157  ---LHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                   K PG D N +     A V  D +  + +     A +P  G NDVFWQQFLTE
Sbjct  301   REEFRCKSPGIDMNLEP---MATVAPDSVASKEQAAGVNAPLP-TGFNDVFWQQFLTE  354



>ref|XP_004961415.1| PREDICTED: heat stress transcription factor A-4d-like [Setaria 
italica]
Length=449

 Score =   216 bits (549),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 134/173 (77%), Gaps = 0/173 (0%)
 Frame = +2

Query  389  PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
            P PFL KTYE+V+D A + VVSW  GG SFVVWNPP+F+RDLLPKYFKHNNFSSFIRQLN
Sbjct  15   PPPFLIKTYEMVEDPATNHVVSWGPGGASFVVWNPPDFSRDLLPKYFKHNNFSSFIRQLN  74

Query  569  TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeee  748
            TYGFRKID E+WEFAN++FIRG THLLKNIHRRKP+HSHS Q     PL+E ERRE E+E
Sbjct  75   TYGFRKIDPERWEFANEDFIRGHTHLLKNIHRRKPVHSHSLQTQVNGPLAESERRELEDE  134

Query  749  ierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQL  907
            I RLK E S L  +L R+ Q+     ++ QSL+ RL  +++RQR ++A +  +
Sbjct  135  INRLKYEKSLLLADLQRQNQQQYGINWQMQSLEDRLVQMEQRQRNIVASLCDI  187



>ref|XP_010924707.1| PREDICTED: heat stress transcription factor A-4b-like [Elaeis 
guineensis]
Length=445

 Score =   214 bits (546),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 152/386 (39%), Positives = 205/386 (53%), Gaps = 83/386 (22%)
 Frame = +2

Query  389   PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
             PAPFL KTY++VDD + +++VSWS    SF+VWNP EFARDLLPKYFKH+NFSSF+RQLN
Sbjct  13    PAPFLTKTYDMVDDPSTNSIVSWSASDTSFIVWNPLEFARDLLPKYFKHSNFSSFVRQLN  72

Query  569   TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSA--QPNSGVPLSeperrefe  742
             TYGFRK+D +QWEFAN+EF+RGQ+HLLKNIHRRKPIHSHS   Q NSG PL+E ER E E
Sbjct  73    TYGFRKVDPDQWEFANEEFVRGQSHLLKNIHRRKPIHSHSLHHQGNSG-PLAETERHELE  131

Query  743   eeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKP-  919
             EEIER+ ++   L  EL +  Q+      + Q+L++RL  ++  QR +LA + Q+  +P 
Sbjct  132   EEIERINRDKLMLISELQKHTQQQHGMEQQMQTLEARLHVMEHHQRSMLAALTQIIQRPG  191

Query  920   ---DLLHHLEVHNKKRKPSVSNGHLELVN------------------------------N  1000
                + +      +KKR+   +N   E  N                               
Sbjct  192   FHSNFVQQSGFLSKKRRLPKTNYFYEDANMEENRAISQSKSGEKSDVVSMHPMDIEPFEK  251

Query  1001  LDSSITVCQKILNGIS--NGEEAYGN--FETLP--------QAPSGDS----RFSSPSTQ  1132
             ++SS+   +    GIS  +GE+ Y +    +LP         A S D+    R  SP   
Sbjct  252   MESSLNSLENFFRGISQASGEDMYYDCALHSLPSGAVITEMNASSEDTDVNLRSPSPKLH  311

Query  1133  TDTPEISSLHTKHPGADGNAKAAWNC-----------------------AAVDVDRLKDR  1243
               +P +  +H+     +  + A                           AA +VD  +DR
Sbjct  312   PSSPHLGDIHSSPELTESTSYAESPALPLTEIQIDIRSKVSEIDVNSEPAAHEVDSSRDR  371

Query  1244  LEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                    A VP  G NDVFW+QFLTE
Sbjct  372   ------AATVP-TGVNDVFWEQFLTE  390



>ref|XP_009415179.1| PREDICTED: heat stress transcription factor A-4b-like [Musa acuminata 
subsp. malaccensis]
Length=417

 Score =   213 bits (543),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 147/379 (39%), Positives = 201/379 (53%), Gaps = 65/379 (17%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             M+     + SP  FL KTYE+VDD   +++VSWS    SFVVWN  EFARDLLP+YFKHN
Sbjct  1     MESPLASTNSPPAFLTKTYEMVDDPTTNSIVSWSLTNASFVVWNQLEFARDLLPRYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS--AQPNSGVP  712
             NFSSF+RQLNTYGFRKI+ +QWEFAN+ F RGQ HLL NIHRRKP+HSHS   Q NS  P
Sbjct  61    NFSSFVRQLNTYGFRKIEPDQWEFANEGFKRGQRHLLNNIHRRKPVHSHSLHGQLNSSAP  120

Query  713   LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
             LS+ E++E EEEIERLKQE   L  EL   ++++ + + + +SL+ RLQ++  R R ++A
Sbjct  121   LSDAEKQELEEEIERLKQEKVVLVNEL---QKQHTQVQHQMRSLEGRLQALGNRLRGLIA  177

Query  893   LVAQLSLKP----DLLHHLEVHNKKRK--------------------------PSVSNGH  982
              + ++  +P    +L+ H ++H+ +++                          PSV    
Sbjct  178   FLKRIVKEPRGLSNLVQHFDLHSTRKRRLPHFDCFDEDANIDDNQIAIFQPDIPSVQALD  237

Query  983   LELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRF----------------  1114
              E    L+SS+   +    G          ++++   PS D                   
Sbjct  238   TEPFEMLESSLNSLENFFRGFGQASGGGMFYDSIVSCPSSDLYLSEMNASSEDTDAKLQP  297

Query  1115  SSPS-----TQTDTPEISSLHTKHPGADGNAKAA-----WNCAAVDVDRLKDRLEGRSST  1264
             SSP      T  DT E +     HP  D  +K +         A  VD  +D   G   T
Sbjct  298   SSPCPGDIYTSLDTAERTGHVAIHP-TDSRSKVSEIDMNAEPTATRVDSSRDLTTG---T  353

Query  1265  AAVPVVGGNDVFWQQFLTE  1321
             A+  + G NDVFW+QF TE
Sbjct  354   ASTMLEGVNDVFWEQFFTE  372



>ref|XP_006644706.1| PREDICTED: heat stress transcription factor A-4b-like [Oryza 
brachyantha]
Length=440

 Score =   214 bits (544),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 147/390 (38%), Positives = 203/390 (52%), Gaps = 74/390 (19%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             M+G  GG + P PFL+KTYE+VDD +  AVV+W+  G SFVV N PEF RDLLPKYFKHN
Sbjct  2     MEGAGGGGSLP-PFLSKTYEMVDDPSTDAVVAWTSAGTSFVVANQPEFCRDLLPKYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
             NFSSF+RQLNTYGFRK+D EQWEFAN++FIRGQ H LKNIHRRKPI SHS+      PL+
Sbjct  61    NFSSFVRQLNTYGFRKVDPEQWEFANEDFIRGQRHRLKNIHRRKPIFSHSSHTQGVGPLT  120

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             E ERR++E+EIERLK +N++L  EL +   +        Q+L+ +L  ++++QR +++ V
Sbjct  121   ENERRDYEDEIERLKCDNAALSSELQQNTLKKLNMEKRMQTLEEKLFVVEDQQRNLISYV  180

Query  899   AQLSLKPDLLHHL----EVHNKKRKPSVSNGHLELVNNLDSSITVC--------------  1024
              ++   P  L       + H KKR+  +     E  N  ++ I  C              
Sbjct  181   REIVKAPGFLSSFVQQQDNHRKKRRLPIPISFHEDANTQENPIMPCDLTNSPAQAFYRES  240

Query  1025  ----QKILNGISN----GEEAYGN-----------------FETLPQAPSGDSRFSSPST  1129
                 +  LN + N      E +GN                    +      D R SSP T
Sbjct  241   FDKMESSLNSLENFLREASEEFGNDISYDDGAAAGPSSTVVLTEIHSPGESDPRVSSPPT  300

Query  1130  QTDTPEIS-SLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAV-----PVV---  1282
             +  T   +   H+ H  A+  +     CA   + ++  R++ R+  + +     P V   
Sbjct  301   KMRTSAGAVDSHSSHDVAESTS-----CAESPLPQMHSRVDTRAKVSEIDVNSEPAVTET  355

Query  1283  ----------------GGNDVFWQQFLTEE  1324
                             G ND FWQQFLTE+
Sbjct  356   GPSRDQPAEGPPAVTPGANDGFWQQFLTEQ  385



>ref|XP_006654692.1| PREDICTED: heat stress transcription factor A-4d-like [Oryza 
brachyantha]
Length=439

 Score =   213 bits (543),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 139/181 (77%), Gaps = 0/181 (0%)
 Frame = +2

Query  365  GTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNF  544
            G +  S+ P PFL KTYE+V+D   + VVSW  GG SFVVWNP +F+RDLLPKYFKHNNF
Sbjct  9    GGREKSSGPPPFLIKTYEMVEDATTNHVVSWGPGGASFVVWNPLDFSRDLLPKYFKHNNF  68

Query  545  SSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSep  724
            SSFIRQLNTYGFRKID E+WEFAN++FIRGQTHLLKNIHRRKP+HSHS Q     PL+E 
Sbjct  69   SSFIRQLNTYGFRKIDPERWEFANEDFIRGQTHLLKNIHRRKPVHSHSLQNQINGPLAES  128

Query  725  errefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQ  904
            ERRE EEEI RLK E S L  +L R+ Q+     ++ Q+L+ RL ++++RQ+ ++A + +
Sbjct  129  ERRELEEEINRLKYEKSLLVADLQRQSQQQYVINWQMQTLEGRLMAMEQRQKNMVASLCE  188

Query  905  L  907
            +
Sbjct  189  M  189



>ref|XP_008456389.1| PREDICTED: heat stress transcription factor A-4c-like [Cucumis 
melo]
Length=300

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/242 (49%), Positives = 165/242 (68%), Gaps = 21/242 (9%)
 Frame = +2

Query  380   SASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIR  559
             S +P PFL KTYE+VDD  ++++VSWS+ G SFVVWNPPEFA++LLP YFKHNNFSSF+R
Sbjct  9     SGAPPPFLTKTYEMVDDPMSNSIVSWSQSGFSFVVWNPPEFAQELLPIYFKHNNFSSFVR  68

Query  560   QLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSH--SAQPNSGVPLSeperr  733
             QLNTYGFRKID EQWEFAN+ FIRG+THLLK+IHRRKP++SH  S+Q N G PLSE ER+
Sbjct  69    QLNTYGFRKIDREQWEFANEGFIRGKTHLLKSIHRRKPMYSHSQSSQGNGGAPLSEQERQ  128

Query  734   efeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV-AQL-  907
             E E +I+ L QE ++L  +L + E E  +   + Q +  +L  +  +Q+Q++ ++ A+L 
Sbjct  129   ELEHKIKTLYQEKTNLESQLQKHENEKEQIGHQIQRICEKLWRMGHQQKQLIGILGAELE  188

Query  908   ------SLKPDLLHHLEVHN---------KKRKPSVSNGHLELVNNLDSSITVCQKILNG  1042
                     K   ++ L V           KK+K +VS   LEL+  L+ S+ +C+ +L  
Sbjct  189   KHEQRKKRKMGKVNELLVEEWTEFERDDLKKKKVNVSP--LELMGKLELSLELCEDLLCN  246

Query  1043  IS  1048
             ++
Sbjct  247   VA  248



>ref|XP_010481538.1| PREDICTED: heat stress transcription factor A-4c-like [Camelina 
sativa]
 ref|XP_010481539.1| PREDICTED: heat stress transcription factor A-4c-like [Camelina 
sativa]
Length=349

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 144/328 (44%), Positives = 196/328 (60%), Gaps = 36/328 (11%)
 Frame = +2

Query  362   DGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNN  541
             + + GGS+S  PFL KTYE+VDD ++ +VVSWS   +SF+V NP EF+RDLLP++FKH N
Sbjct  3     ESSHGGSSSLPPFLTKTYEMVDDDSSDSVVSWSENNKSFIVKNPAEFSRDLLPRFFKHKN  62

Query  542   FSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-AQPNSGVPLS  718
             FSSFIRQLNTYGFRK+D E+WEF+ND+F+RG+ +L+KNIHRRKP+HSHS     +  PL+
Sbjct  63    FSSFIRQLNTYGFRKVDPEKWEFSNDDFVRGRPYLMKNIHRRKPVHSHSLVNLQTQNPLT  122

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             E ERR  E++IERLK+E   L VEL  +EQE ++   +  +L  RLQ +++ Q+ ++A V
Sbjct  123   ESERRSMEDQIERLKREKEGLLVELQSQEQERKDFEMQVTTLKDRLQQMEQHQKSIVAYV  182

Query  899   AQLSLKPDLLHHLEVHN--KKRKPS----VSNGHLELVNNLDSSITVCQKILNGISNGEE  1060
             +Q+  KP L  +LE H   K+R P      S  H+E V NL+SS+T  + +++      E
Sbjct  183   SQVLGKPGLSLNLENHEIRKRRVPESSLPSSRSHVEQVENLESSLTFWENLVS------E  236

Query  1061  AYGNFETLPQAPSGDSRFSSPSTQTDTPEIS-SLHTKHPGADGNAKAAWNCAAVDVDRLK  1237
             +Y          SG    SS S   D  E S S+    P +            V V    
Sbjct  237   SY--------EKSGVQ--SSSSMDLDAAESSLSMGDTRPKSSKIDMNLEPPVTVTV----  282

Query  1238  DRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                       A P  G ND FW+Q LTE
Sbjct  283   --------AVAAPKAGVNDDFWEQCLTE  302



>ref|NP_199383.1| heat stress transcription factor A-4c [Arabidopsis thaliana]
 sp|Q9FK72.1|HFA4C_ARATH RecName: Full=Heat stress transcription factor A-4c; Short=AtHsfA4c; 
AltName: Full=AtHsf-20; AltName: Full=Protein ROOT HANDEDNESS 
1 [Arabidopsis thaliana]
 dbj|BAB09213.1| heat shock transcription factor [Arabidopsis thaliana]
 gb|AAQ54332.1| heat shock factor RHA1 [Arabidopsis thaliana]
 gb|AAT71921.1| At5g45710 [Arabidopsis thaliana]
 gb|AAU94406.1| At5g45710 [Arabidopsis thaliana]
 dbj|BAF00940.1| heat shock transcription factor [Arabidopsis thaliana]
 gb|AED95287.1| heat stress transcription factor A-4c [Arabidopsis thaliana]
Length=345

 Score =   210 bits (534),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 142/330 (43%), Positives = 196/330 (59%), Gaps = 41/330 (12%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD   GGS+S  PFL KTYE+VDD ++ +VV+WS   +SF+V NP EF+RDLLP++FKH 
Sbjct  1     MDENNGGSSSLPPFLTKTYEMVDDSSSDSVVAWSENNKSFIVKNPAEFSRDLLPRFFKHK  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-AQPNSGVPL  715
             NFSSFIRQLNTYGFRK+D E+WEF ND+F+RG+ +L+KNIHRRKP+HSHS     +  PL
Sbjct  61    NFSSFIRQLNTYGFRKVDPEKWEFLNDDFVRGRPYLMKNIHRRKPVHSHSLVNLQAQNPL  120

Query  716   SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
             +E ERR  E++IERLK E   L  EL  +EQE +E   +  +L  RLQ +++ Q+ ++A 
Sbjct  121   TESERRSMEDQIERLKNEKEGLLAELQNQEQERKEFELQVTTLKDRLQHMEQHQKSIVAY  180

Query  896   VAQLSLKPDLLHHLEVHNKKRK--------PSVSNGHLELVNNLDSSITVCQKILNGISN  1051
             V+Q+  KP L  +LE H ++++        PS S  H+E V  L+SS+T  +   N +S 
Sbjct  181   VSQVLGKPGLSLNLENHERRKRRFQENSLPPSSS--HIEQVEKLESSLTFWE---NLVSE  235

Query  1052  GEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDR  1231
               E  G   +     + +S  S   T+  + +I          D N++       V V  
Sbjct  236   SCEKSGLQSSSMDHDAAESSLSIGDTRPKSSKI----------DMNSE-----PPVTV--  278

Query  1232  LKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                       TA  P  G ND FW+Q LTE
Sbjct  279   ----------TAPAPKTGVNDDFWEQCLTE  298



>ref|XP_006280755.1| hypothetical protein CARUB_v10026722mg [Capsella rubella]
 gb|EOA13653.1| hypothetical protein CARUB_v10026722mg [Capsella rubella]
Length=343

 Score =   209 bits (531),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 143/329 (43%), Positives = 201/329 (61%), Gaps = 39/329 (12%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD   GGS+S  PFL KTYE+VDD ++ +VVSWS   +SF+V NP EF+RDLLP++FKH 
Sbjct  1     MDENNGGSSSLPPFLTKTYEMVDDSSSDSVVSWSDNNKSFIVKNPAEFSRDLLPRFFKHK  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-AQPNSGVPL  715
             NFSSFIRQLNTYGFRK+D E+WEF N++F+RG+ +L+KNIHRRKP+HSHS +   +  PL
Sbjct  61    NFSSFIRQLNTYGFRKVDPEKWEFLNEDFVRGRPYLMKNIHRRKPVHSHSLSNIQAQNPL  120

Query  716   SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
             +E ERR  E++IERLK+E   L VEL  +EQE ++   +  +L  RLQ +++ Q+ ++A 
Sbjct  121   TESERRSMEDQIERLKKEKEGLLVELQSQEQERKDFEMQVTTLKDRLQHMEQHQKSIVAY  180

Query  896   VAQLSLKPDLLHHLEVHN--KKRKPSV----SNGHLELVNNLDSSITVCQKILNGISNGE  1057
             V+Q+  KP L  +LE H   K+R P      S  H+E V NL+SS+T  +   N +S   
Sbjct  181   VSQVLEKPGLSLNLENHERRKRRLPETPLPASRSHVEQVENLESSLTFWE---NLVSESY  237

Query  1058  EAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDRLK  1237
             E  G                    Q+ + ++ +  +     D   K+    + +D++   
Sbjct  238   EKSG-------------------VQSSSMDLDAAESSLSMGDTRPKS----SKIDMN---  271

Query  1238  DRLEGRSS-TAAVPVVGGNDVFWQQFLTE  1321
               LE   + TAA P  G ND FW+Q LTE
Sbjct  272   --LEPPVTITAAAPKTGVNDDFWEQCLTE  298



>gb|EMS46878.1| Heat stress transcription factor A-4d [Triticum urartu]
Length=401

 Score =   210 bits (535),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +2

Query  371  QGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSS  550
            QG S SPAPFL KTYE+V+D A S VVSW  GG SFVVWNPP+F+RDLLPKYFKHNNFSS
Sbjct  16   QGASLSPAPFLIKTYEMVEDPATSRVVSWGPGGASFVVWNPPDFSRDLLPKYFKHNNFSS  75

Query  551  FIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeper  730
            FIRQLNTYGFRKID E+WEFAND+FIRG  HLLKNIHRRKP+HSHS Q     PL+E ER
Sbjct  76   FIRQLNTYGFRKIDPERWEFANDDFIRGHMHLLKNIHRRKPVHSHSPQNQVNGPLAESER  135

Query  731  refeeeierLKQENSSLRVELDRREQE  811
            RE+EEEI RLK ENS L  EL R+ Q+
Sbjct  136  REYEEEISRLKHENSVLVAELQRQAQQ  162



>ref|XP_008649894.1| PREDICTED: heat stress transcription factor A-4d-like isoform 
X2 [Zea mays]
 gb|AFW78761.1| hypothetical protein ZEAMMB73_588662 [Zea mays]
 gb|AIB04795.1| HSF transcription factor, partial [Zea mays]
Length=469

 Score =   211 bits (538),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 133/173 (77%), Gaps = 0/173 (0%)
 Frame = +2

Query  389  PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
            P PFL KTYE+V+D A   VVSW  GG SFVVWNPP+ +RDLLPKYFKH+NFSSFIRQLN
Sbjct  22   PTPFLVKTYEMVEDPATIHVVSWGPGGASFVVWNPPDLSRDLLPKYFKHSNFSSFIRQLN  81

Query  569  TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeee  748
            TYGFRKI+ E+WEFAND+FIRG  HLLK IHRRKP+HSHS +  +  PL+E +RRE E+E
Sbjct  82   TYGFRKINPERWEFANDDFIRGHKHLLKRIHRRKPVHSHSLRTQASGPLAESQRRELEDE  141

Query  749  ierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQL  907
            I RL+ E S L  +L R+ Q+ R   ++ QSL+SRL  ++ERQR V+A +  +
Sbjct  142  ISRLRYEKSLLLADLQRQNQQQRGISWQMQSLESRLAQMEERQRSVVASLCDI  194



>ref|XP_004969950.1| PREDICTED: heat stress transcription factor A-4b-like [Setaria 
italica]
Length=448

 Score =   210 bits (535),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 149/396 (38%), Positives = 207/396 (52%), Gaps = 76/396 (19%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             M+   G ++S  PFL+KTYE+VDD A  AVV+W+  G SFVV N  EF RDLLPKYFKHN
Sbjct  1     MEAGGGSASSLPPFLSKTYEMVDDPATDAVVAWTPPGTSFVVANQAEFCRDLLPKYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
             NFSSF+RQLNTYGFRK+D EQWEFAN++FIRGQ H LKNIHRRKPI SHS+ P    PL+
Sbjct  61    NFSSFVRQLNTYGFRKVDPEQWEFANEDFIRGQRHRLKNIHRRKPIFSHSSHPQGSGPLA  120

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             + ERRE+E+EIE+LK++N +L +EL++  Q+  +     Q L+ +L  +++RQ+ ++A V
Sbjct  121   DNERREYEDEIEKLKRDNDALTLELEKNAQKKIDMERRMQELEDKLIYLEDRQKNLIAYV  180

Query  899   AQLSLKP----DLLHHLEVHNKKRKPSV---------SNGH-------------LELVNN  1000
               +   P      +   + H KKR+  V         + G+             +E  + 
Sbjct  181   RDIVQAPGFRSSFVQQPDHHGKKRRLPVPISLHQDANAEGNQIVHGGLTNPPVCIESFDK  240

Query  1001  LDSSITVCQKILNGISNG-----------------EEAYGNFETLPQAPSGDSRF-SSPS  1126
             ++SS+   +      S                    E + + E+ P  PS  SR  +S +
Sbjct  241   MESSLNSLENFFREASEAFDISYDGVPGPSSAVVITELHSSGESDPHVPSPPSRMHTSSA  300

Query  1127  TQTDTPEISSLHTKHPGADG-----NAKAAWNCAA--------------VDVDRLKDRLE  1249
                D+P  S +HT   GA       +   + +CA                 V  +   LE
Sbjct  301   GAGDSP--SRMHTSSAGAGDSLSSHDVTESTSCAESPPLPQMMSFTDSRAKVSEIDVNLE  358

Query  1250  ------GRSSTAAV-----PVVGGNDVFWQQFLTEE  1324
                   G S   A      P  G ND FW+QFLTE+
Sbjct  359   PAITETGPSRDQAAEDSPHPAPGANDGFWEQFLTEQ  394



>ref|XP_010088011.1| Heat stress transcription factor A-4a [Morus notabilis]
 gb|EXB31127.1| Heat stress transcription factor A-4a [Morus notabilis]
Length=412

 Score =   209 bits (531),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 143/367 (39%), Positives = 198/367 (54%), Gaps = 56/367 (15%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD +QG   S  PFL+KTYE+VDD +  ++VSWS   +SF+VWNPPEFA  LLP++FKHN
Sbjct  1     MDESQGSCNSLPPFLSKTYEMVDDPSTDSIVSWSSSNKSFIVWNPPEFAGVLLPRFFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ--PNSGVP  712
             NFSSFIRQLNTYGFRK D EQWEF N++FIRGQ HLLKNIHRRKP+HSHS Q     G P
Sbjct  61    NFSSFIRQLNTYGFRKADPEQWEFTNEDFIRGQPHLLKNIHRRKPVHSHSLQNLQGQGTP  120

Query  713   -LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
              L+E ER+  ++EIERL+ +   L +E  R E E R    +  SL    Q+ + RQ+ ++
Sbjct  121   QLAESERKSLKDEIERLQHDIEWLELESKRYENEQRGLEIQKHSLKECFQNTERRQQSIV  180

Query  890   ALVAQL----SLKPDLLHHLEVHNKKRK-PSVS---------------------------  973
             +L+ Q      L  +++  +E H +KR+ P V                            
Sbjct  181   SLLNQALQKRELSMNIVPQVEAHIRKRRLPKVGYFYDGAGIKDNLIGGLESELGEKVDSD  240

Query  974   ---NGHLELVNNLDSSITVCQKILNGISNGE-EAYGNFETLPQAPSGDSRFSSPSTQTDT  1141
                N +L+ +  LD+S+T  + I++  S    +   N E      +G +         ++
Sbjct  241   SFLNLNLDQLEQLDASLTFWEDIVSDFSQSHFQISSNIELDESNSTGCA---------ES  291

Query  1142  PEIS------SLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPV-VGGNDVF  1300
             P IS       +  K P  D N+       A +    K++     +    P+  G NDVF
Sbjct  292   PAISYVQLNVDIRPKSPDIDVNSDPV-PTGASEPAASKEQSPKEQAIGPTPLPTGVNDVF  350

Query  1301  WQQFLTE  1321
             W+QFLTE
Sbjct  351   WEQFLTE  357



>emb|CDY09259.1| BnaC03g62890D [Brassica napus]
Length=362

 Score =   207 bits (526),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 149/377 (40%), Positives = 212/377 (56%), Gaps = 43/377 (11%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD +  G + P PFL KTYE+VDD ++ ++VSWS+  +SF+VWNPPEF+RDLLPK+FKHN
Sbjct  1     MDESNHGGSLP-PFLTKTYEMVDDSSSDSIVSWSQSNKSFIVWNPPEFSRDLLPKFFKHN  59

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
             NF+SFIRQLNTYGFRK D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS+      PL+
Sbjct  60    NFASFIRQLNTYGFRKADPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSSPSLQPHPLT  119

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             + ER+   ++IERL +E   L  EL ++E+E    + + + L  +LQ +++RQ+ +++ V
Sbjct  120   DSERQRMNDQIERLTKEKEVLLQELHKQEKEREMFQQQVKELKDQLQHMEKRQKTMVSFV  179

Query  899   AQLSLKPDLLHH-----LEVHNKKRK-----------PSVSNGHLELVNNLDSSITVCQK  1030
             +Q+  KP+L  +     LE + +KR+           PS     L+ V  L+SSI V + 
Sbjct  180   SQVLEKPELALNLSPCLLETNERKRRFPRIGLEGSTSPSSQARELQ-VEQLESSIAVWEN  238

Query  1031  ILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGADGNAKAAWNC  1210
             +++  S+        E+L Q            + T  PE   L       D       + 
Sbjct  239   LVSEDSS--------ESLGQEKRSMMTLDVDESST-CPESPPLPCIQLSIDTCPNCPTSP  289

Query  1211  AAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE-----EVeserreigirngreC-  1372
               +D++   D     +S    P  G NDVFWQQ LTE     E +  + E       EC 
Sbjct  290   RTIDMNSEPD-----TSKEPPPAAGVNDVFWQQLLTENPGSTEQKEVQAERKDDKAEECW  344

Query  1373  -----MIVFAEQMGHFT  1408
                  +    EQ+GH T
Sbjct  345   WDLRNVNTLTEQLGHLT  361



>gb|ACA58566.1| heat shock transcription factor [Cenchrus americanus]
Length=435

 Score =   209 bits (531),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 151/387 (39%), Positives = 207/387 (53%), Gaps = 71/387 (18%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             M+   GG++S  PFL+KTYE+VDD A  AVV+W+  G SFVV N  EF RDLLPKYFKHN
Sbjct  1     MEAGGGGASSLPPFLSKTYEMVDDPATDAVVAWTPPGTSFVVVNRAEFCRDLLPKYFKHN  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
             NFSSF+RQLNTYGFRK+D EQWEF ND+FIRGQ H LKNIHRRKPI SHS+ P+   PL+
Sbjct  61    NFSSFVRQLNTYGFRKVDPEQWEFLNDDFIRGQRHRLKNIHRRKPIFSHSSHPHGSGPLA  120

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             + ERRE+EEEIE+LK++N +L +EL++  Q+  +     Q L+ +L  +++RQ+ ++A V
Sbjct  121   DNERREYEEEIEKLKRDNDALTLELEKNAQKKIDMERRMQELEDKLICLEDRQKNLIAYV  180

Query  899   AQLSLKP----DLLHHLEVHNKKRKPSV---------SNGHLELVNNLDSSITVC-----  1024
               +   P      +   + H KKR+  +         + G+ ++V+   ++  VC     
Sbjct  181   RDIVQAPGFRSSFVQQPDHHGKKRRLPIPISLHQDENAEGN-QIVHGALTNPLVCIESFD  239

Query  1025  --QKILNGISN-GEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEI--------------S  1153
               +  LN + N   EA G F+      S D     PS+     E+              S
Sbjct  240   KMESSLNSLENFFREASGAFDI-----SYDGGVPGPSSAVVITELHSSGESDPRVPSPPS  294

Query  1154  SLHTKHPGADG-----NAKAAWNCAA--------------VDVDRLKDRLE------GRS  1258
              +HT   GA       +   + +CA                 V  +   LE      G S
Sbjct  295   RMHTSSAGAGDSLSSHDVTESTSCAESPPLPQMTTFDNSRAKVSEIDVNLEPAITETGPS  354

Query  1259  STAAV-----PVVGGNDVFWQQFLTEE  1324
                A      P  G ND FW+QFLTE+
Sbjct  355   RDQAPEDSPHPAPGTNDGFWEQFLTEQ  381



>ref|XP_003568041.1| PREDICTED: LOW QUALITY PROTEIN: heat stress transcription factor 
A-4d-like [Brachypodium distachyon]
Length=424

 Score =   208 bits (529),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 136/371 (37%), Positives = 196/371 (53%), Gaps = 70/371 (19%)
 Frame = +2

Query  398   FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
             FL KTYE+V+D A + VVSW  GG SFVVW+PPEF+RD+LPKYFKHNNFSSFIRQLNTYG
Sbjct  17    FLIKTYEMVEDPATNRVVSWGPGGASFVVWDPPEFSRDMLPKYFKHNNFSSFIRQLNTYG  76

Query  578   FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeier  757
             FRKID E+WEF N++F+RG  HLLKNIHRRKP+HSHS Q  +  PL+E ERR+ E+EI R
Sbjct  77    FRKIDPERWEFGNEDFVRGHMHLLKNIHRRKPVHSHSLQNQANGPLAEAERRDLEDEISR  136

Query  758   LKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQL------SLKP  919
             LK E S L  +L R+ Q+     +  QSL+ RL  +++RQ  V+A +  +      ++  
Sbjct  137   LKHEKSVLLADLQRQAQQQCGINWHMQSLEDRLVVMEQRQENVVAYLGDILQRRRGTVSG  196

Query  920   DLLHHLEVHNKKRK--------------------------------PSVSNGHLELVNNL  1003
              +L   +  +KKR+                                P VS  + E    +
Sbjct  197   SVLLETDHFSKKRRVPRIDFFAQEPAVEEQRVPYLPAMVAETPGVLPPVSGANAEPFEKM  256

Query  1004  DSSITVCQKILNGISN---GEEAY------------GNFETLPQAPSGD----SRFSSPS  1126
             + ++   +K+     N    E+ Y            GN +  P   S +    +  + P 
Sbjct  257   ELALVSLEKLFQRAGNYAPYEDVYNAAAAPSSALALGNLQAAPMEGSINLQPSAELAEPP  316

Query  1127  TQTDTPEISSLHTKH------PGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGG  1288
               + +P + S +          G D N++A+ +  + D    + R+    + +       
Sbjct  317   GYSQSPVLPSAYIHEDMGKTITGVDMNSEASTSGTSQDETTAETRVSHEPALS-------  369

Query  1289  NDVFWQQFLTE  1321
             ND+FW++FLTE
Sbjct  370   NDIFWERFLTE  380



>ref|XP_008649893.1| PREDICTED: heat stress transcription factor A-4d-like isoform 
X1 [Zea mays]
Length=544

 Score =   211 bits (537),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 133/173 (77%), Gaps = 0/173 (0%)
 Frame = +2

Query  389  PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
            P PFL KTYE+V+D A   VVSW  GG SFVVWNPP+ +RDLLPKYFKH+NFSSFIRQLN
Sbjct  97   PTPFLVKTYEMVEDPATIHVVSWGPGGASFVVWNPPDLSRDLLPKYFKHSNFSSFIRQLN  156

Query  569  TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeee  748
            TYGFRKI+ E+WEFAND+FIRG  HLLK IHRRKP+HSHS +  +  PL+E +RRE E+E
Sbjct  157  TYGFRKINPERWEFANDDFIRGHKHLLKRIHRRKPVHSHSLRTQASGPLAESQRRELEDE  216

Query  749  ierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQL  907
            I RL+ E S L  +L R+ Q+ R   ++ QSL+SRL  ++ERQR V+A +  +
Sbjct  217  ISRLRYEKSLLLADLQRQNQQQRGISWQMQSLESRLAQMEERQRSVVASLCDI  269



>ref|XP_008439712.1| PREDICTED: heat stress transcription factor A-4c-like [Cucumis 
melo]
Length=449

 Score =   209 bits (531),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 135/360 (38%), Positives = 207/360 (58%), Gaps = 50/360 (14%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD +Q  S +  PFL KTYE+V+D +   +VSW+ G +SF+VWNP EF+ +LLP++FKHN
Sbjct  45    MDESQCSSNTLPPFLTKTYEMVNDPSTDPIVSWTSGNKSFIVWNPLEFSCELLPRFFKHN  104

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSG----  706
             NFSSFIRQLNTYGFRK+D E+WEFAN++F +G+  LL+NIHRRKP+HSHS Q   G    
Sbjct  105   NFSSFIRQLNTYGFRKVDPEKWEFANEDFEKGRPDLLRNIHRRKPVHSHSLQNVQGQGFP  164

Query  707   VPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQV  886
              PL + ER+ F+EEIERL Q N  L +E  R EQE+R+ + + + +  R +++ ++Q+ +
Sbjct  165   TPLLDLERKRFKEEIERLNQTNEKLLLESQRHEQEHRDFQLQMRLMKERFENMQQQQQIL  224

Query  887   LALVAQLSLKPDLLHHL----EVHNKKRKPS-----------------------------  967
             L+ VA++  KP+L  +     + H++KR+ +                             
Sbjct  225   LSHVARVLQKPELTIYFVPESDSHDRKRRLTTVSYYYNESSAEDDLAEHSHSMSKQQIDY  284

Query  968   --VSNGHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDT  1141
                S+ ++E ++ LDSS++  ++ ++ +      +  F +  +         SP T    
Sbjct  285   SLTSDLNMEQLDQLDSSLSFWERTIHDVD-----HAIFLSNMKFNQTKRDIQSPPTPLQL  339

Query  1142  PEISSLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                 S H+K    D N++   + A+   D +  R E   +TA+    G NDVFW+QFLTE
Sbjct  340   ER--SHHSKSHVIDMNSEPVGSIAS---DSIASRKEADETTASA-RNGANDVFWEQFLTE  393



>ref|XP_002865228.1| AT-HSFA4C [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41487.1| AT-HSFA4C [Arabidopsis lyrata subsp. lyrata]
Length=345

 Score =   205 bits (522),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 143/330 (43%), Positives = 196/330 (59%), Gaps = 41/330 (12%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD   GGS+S  PFL KTYE+VDD ++ ++VSWS   +SF+V NP EF+RDLLPK+FKH 
Sbjct  1     MDENNGGSSSLPPFLTKTYEMVDDSSSDSIVSWSENNKSFIVKNPAEFSRDLLPKFFKHK  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQP-NSGVPL  715
             NFSSFIRQLNTYGFRK+D E+WEF ND+F+RG+ +L+KNIHRRKP+HSHS Q   +  PL
Sbjct  61    NFSSFIRQLNTYGFRKVDPEKWEFLNDDFVRGRPYLMKNIHRRKPVHSHSLQNLQAQNPL  120

Query  716   SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
             +E ERR  E++IERLK+E   L  EL  +EQE ++   +  +L  RLQ +++ Q+ ++A 
Sbjct  121   TESERRSMEDQIERLKREKEGLLAELQNQEQERKDFELQVMTLKDRLQHMEQHQKSIVAY  180

Query  896   VAQLSLKPDLLHHLEVHNKKRK--------PSVSNGHLELVNNLDSSITVCQKILNGISN  1051
             V+Q+  KP L  +LE H ++++        PS S  H E V  L+SS+T  +   N +S 
Sbjct  181   VSQVLEKPGLSLNLENHERRKRRFQENSLPPSSS--HAEQVEKLESSLTFWE---NLVSE  235

Query  1052  GEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDR  1231
               E  G   +     + +S  S   TQ  + +I          D N++       V V  
Sbjct  236   SCEKSGMQSSSMDLDAAESSLSIGDTQPKSSKI----------DMNSE-----PPVTV--  278

Query  1232  LKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                       T   P  G ND FW+Q LTE
Sbjct  279   ----------TTPAPKTGVNDDFWEQCLTE  298



>ref|XP_006854048.1| hypothetical protein AMTR_s00048p00075850 [Amborella trichopoda]
 gb|ERN15515.1| hypothetical protein AMTR_s00048p00075850 [Amborella trichopoda]
Length=507

 Score =   208 bits (530),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 144/210 (69%), Gaps = 12/210 (6%)
 Frame = +2

Query  359  MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
            MDG    + +P PFL+KTY++VDD A  ++VSWS G  SF+VWNPPEFARDLLPKYFKHN
Sbjct  1    MDGLHANANAPPPFLSKTYDMVDDPATDSIVSWSPGNNSFIVWNPPEFARDLLPKYFKHN  60

Query  539  NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSH---------SA  691
            NFSSF+RQLNTYGFRK+D ++WEFAN+ F+RGQ HLLKNI+RRKP HSH         SA
Sbjct  61   NFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGQRHLLKNIYRRKPSHSHTQPQQSQGQSA  120

Query  692  QPNSGVPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDE  871
              N+ V +    +   EEEIERLK++ + L  EL R  Q+ +    + Q++  RLQ +++
Sbjct  121  SVNACVEVG---KFGIEEEIERLKRDKNVLMQELVRLRQQQQSTDHQLQTMSQRLQGMEQ  177

Query  872  RQRQVLALVAQLSLKPDLLHHLEVHNKKRK  961
            RQ+Q+++ +A+    P  L  L   N+  +
Sbjct  178  RQQQMMSFLAKAMQSPGFLAQLMQQNENNR  207



>gb|EEC71476.1| hypothetical protein OsI_03736 [Oryza sativa Indica Group]
Length=440

 Score =   206 bits (524),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 142/377 (38%), Positives = 197/377 (52%), Gaps = 70/377 (19%)
 Frame = +2

Query  395   PFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTY  574
             PFL+KTYE+VDD +  AVV W+  G SFVV N PEF RDLLPKYFKHNNFSSF+RQLNTY
Sbjct  12    PFLSKTYEMVDDPSTDAVVGWTPAGTSFVVANQPEFCRDLLPKYFKHNNFSSFVRQLNTY  71

Query  575   GFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeie  754
             GFRK+D EQWEFAN++FI+GQ H LKNIHRRKPI SHS+      PL++ ER+++EEEIE
Sbjct  72    GFRKVDPEQWEFANEDFIKGQRHRLKNIHRRKPIFSHSSHSQGAGPLTDNERKDYEEEIE  131

Query  755   rLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHH  934
             RLK +N++L  EL     +        Q+L+ +L  +++RQR +++ V ++   P  L  
Sbjct  132   RLKSDNAALSSELQNNTLKKLNMEKRMQALEEKLFVVEDRQRSLISYVREIVKAPGFLSS  191

Query  935   L----EVHNKKRKPSVSNGHLELVNNLDSSITVC------------------QKILNGIS  1048
                  + H KKR+  +     E  N  ++ I  C                  +  LN + 
Sbjct  192   FVQQQDHHRKKRRLPIPISFHEDANTQENQIMPCDLTNSPAQTFYRESFDKMESSLNSLE  251

Query  1049  N----GEEAYGN---FETLPQAPS-------------GDSRFSSPSTQTDTPEISSLHTK  1168
             N      E +GN   ++     PS              D R SSP T+  T   SS    
Sbjct  252   NFLREASEEFGNDISYDDGVPGPSSTVVLTELHSPGESDPRVSSPPTRMRT---SSAGAG  308

Query  1169  HPGADGNAKAAWNCA-AVDVDRLKDRLEGRSSTAAV-----PVV----------------  1282
                +  +   + +CA +  + ++  R++ R+  + +     P V                
Sbjct  309   DSHSSRDVAESTSCAESPPIPQMHSRVDTRAKVSEIDVNSEPAVTETGPSRDQPAEEPPA  368

Query  1283  ---GGNDVFWQQFLTEE  1324
                G ND FWQQFLTE+
Sbjct  369   VTPGANDGFWQQFLTEQ  385



>ref|XP_010494690.1| PREDICTED: heat stress transcription factor A-4c-like [Camelina 
sativa]
 ref|XP_010494691.1| PREDICTED: heat stress transcription factor A-4c-like [Camelina 
sativa]
 ref|XP_010494692.1| PREDICTED: heat stress transcription factor A-4c-like [Camelina 
sativa]
 ref|XP_010494693.1| PREDICTED: heat stress transcription factor A-4c-like [Camelina 
sativa]
 ref|XP_010494694.1| PREDICTED: heat stress transcription factor A-4c-like [Camelina 
sativa]
Length=343

 Score =   203 bits (516),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 142/319 (45%), Positives = 198/319 (62%), Gaps = 41/319 (13%)
 Frame = +2

Query  395   PFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTY  574
             PFL KTYE+VDD ++ +VVSWS   +SF+V NP EF+RDLLP++FKH NFSSFIRQLNTY
Sbjct  14    PFLTKTYEMVDDDSSDSVVSWSENNKSFIVKNPAEFSRDLLPRFFKHKNFSSFIRQLNTY  73

Query  575   GFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-AQPNSGVPLSeperrefeeei  751
             GFRK+D E+WEF+N++F+RG+ +L+KNIHRRKP+HSHS     +  PL+E ERR  E++I
Sbjct  74    GFRKVDPEKWEFSNEDFVRGRPYLMKNIHRRKPVHSHSLVNLQTQNPLTEAERRSMEDQI  133

Query  752   erLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLH  931
             ERLK+E   L VEL  +EQE ++   +  +L  RLQ +++ Q+ ++A V+Q+  KP L  
Sbjct  134   ERLKREKEDLLVELQSQEQERKDFEMQVTTLKDRLQQMEQHQKSIVAYVSQVLGKPGLSL  193

Query  932   HLEVHNKKRK-------PSVSNGHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQ  1090
             +LE H ++++       PS S  H+E V NL+SS+T  + +++      E+Y        
Sbjct  194   NLENHERRKRRVPESSLPS-SRSHVEQVENLESSLTFWENLVS------ESY--------  238

Query  1091  APSGDSRFSSPSTQTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEG--RSST  1264
               SG    SS S   D  E SSL       D   K+    + +D++     LE     S 
Sbjct  239   EKSGVQ--SSSSMDLDAAE-SSLSI----GDTRPKS----SKIDMN-----LEPPVTVSV  282

Query  1265  AAVPVVGGNDVFWQQFLTE  1321
             A  P  G ND FW+Q LTE
Sbjct  283   AVAPKAGVNDDFWEQCLTE  301



>ref|XP_003569811.1| PREDICTED: heat stress transcription factor A-4b-like [Brachypodium 
distachyon]
Length=438

 Score =   205 bits (522),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 146/384 (38%), Positives = 203/384 (53%), Gaps = 70/384 (18%)
 Frame = +2

Query  374   GGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSF  553
             GG+AS  PFL KTYE+VD+ A  AVVSW+  G SFVV +  +F RDLLPKYFKHNNFSSF
Sbjct  5     GGAASLPPFLTKTYEMVDEPATDAVVSWTPSGTSFVVASQADFCRDLLPKYFKHNNFSSF  64

Query  554   IRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperr  733
             +RQLNTYGFRK+D EQWEFAN+EFIRGQ H LKNIHRRKPI SHS+      PL + ERR
Sbjct  65    VRQLNTYGFRKVDPEQWEFANEEFIRGQRHRLKNIHRRKPIFSHSSHTQGAGPLVDSERR  124

Query  734   efeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSL  913
             ++EEEIERLK +N++L  EL++  ++  +     Q+L+ +L +++++Q  ++  V  +  
Sbjct  125   DYEEEIERLKCDNAALTSELEKNAEKKIDMEKRMQALEDKLFAVEDQQTNLICYVRDIVK  184

Query  914   KPDLLHHL---EVHNKKR----KP------SVSNG----HLELVN---------NLDSSI  1015
             +P  L        H++K+    KP      + + G    H +L N         + D   
Sbjct  185   EPGFLSSFVQQSDHSRKKRRLPKPISFHEDTSTQGNQIMHRDLTNSPAHELSRESFDKME  244

Query  1016  TVCQKILNGISNGEEAYGN----------------------FETLPQAPS----------  1099
             +    + N +    EA+GN                       E+ P APS          
Sbjct  245   SSLNSLENFLREATEAFGNGISYDCDIPGPSAVVLTELHLSGESDPHAPSPPSMMHTSSA  304

Query  1100  --GDSR----FSSPSTQTDTPEISSLHTKHPGADGNAKAA---WNCAAVDVDRLKDRLEG  1252
               GDS      +  ++ T++P +   H++   AD  AK +    N      +    R + 
Sbjct  305   GVGDSHSSRGIAESTSCTESPPLPQTHSR---ADSRAKVSEIDVNLEPAVTETGPSRDQP  361

Query  1253  RSSTAAVPVVGGNDVFWQQFLTEE  1324
                  A    G ND FWQQFLTE+
Sbjct  362   GQDPPATAAAGANDGFWQQFLTEQ  385



>ref|XP_009415941.1| PREDICTED: heat stress transcription factor A-5 [Musa acuminata 
subsp. malaccensis]
Length=452

 Score =   205 bits (522),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 149/213 (70%), Gaps = 15/213 (7%)
 Frame = +2

Query  365  GTQGGSAS-PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNN  541
            G  GGSA  PAPFL KTYE+VDD + + VVSWS    SFVVWNPP+FA  LLP YFKHNN
Sbjct  6    GEHGGSAGGPAPFLLKTYEMVDDASTNDVVSWSPSMNSFVVWNPPDFAAHLLPTYFKHNN  65

Query  542  FSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSe  721
            FSSFIRQLNTYGFRKID+E+WEFAN++FI+GQ HLLKNI+RRKPIHSHS  P  G  L++
Sbjct  66   FSSFIRQLNTYGFRKIDSERWEFANEDFIKGQKHLLKNIYRRKPIHSHSRPPGGG--LAD  123

Query  722  perrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVA  901
             ER   EEEI+RLK+E +SL++ + + EQ +   + +   ++ R+  +++RQ +++A + 
Sbjct  124  SERIALEEEIDRLKREKASLQMAVQKFEQLHSGTKIQLGDVERRVADMEKRQLKMVAFLQ  183

Query  902  QLSLKPDLLHHL------------EVHNKKRKP  964
            ++   P L+ +L             +H K+R P
Sbjct  184  RVMQNPRLMENLVKMVSSSSIDFSVIHKKRRLP  216



>emb|CAM32756.1| heat shock factor A4d [Oryza sativa Indica Group]
Length=459

 Score =   205 bits (522),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 142/197 (72%), Gaps = 6/197 (3%)
 Frame = +2

Query  398  FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
            FL KTYE+V+D A + VVSW  GG SFVVWNP +F+RDLLPKYFKHNNFSSFIRQLNTYG
Sbjct  21   FLIKTYEMVEDAATNHVVSWGPGGASFVVWNPLDFSRDLLPKYFKHNNFSSFIRQLNTYG  80

Query  578  FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeier  757
            FRKID E+WEFAN++FIRG THLLKNIHRRKP+HSHS Q     PL+E ERRE EEEI R
Sbjct  81   FRKIDPERWEFANEDFIRGHTHLLKNIHRRKPVHSHSLQNQINGPLAESERRELEEEINR  140

Query  758  LKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQL------SLKP  919
            LK E S L  +L R+ Q+     ++ Q+++ RL ++++RQ+ ++A + ++      ++  
Sbjct  141  LKYEKSILVADLQRQNQQQYVINWQMQAMEGRLVAMEQRQKNIVASLCEMLQRRGGAVSS  200

Query  920  DLLHHLEVHNKKRKPSV  970
             LL       K+R P +
Sbjct  201  SLLESDHFSKKRRVPKM  217



>emb|CCO62016.1| HSFA4a protein [Helianthus annuus]
Length=387

 Score =   203 bits (516),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 132/343 (38%), Positives = 180/343 (52%), Gaps = 57/343 (17%)
 Frame = +2

Query  395   PFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTY  574
             PF+AKTYE+VDD + +++VSWS+  RSF+VWNPPEF+ +LLP++FKHNNFSSFIRQLNTY
Sbjct  22    PFIAKTYEMVDDPSTNSIVSWSQTNRSFIVWNPPEFSGELLPRFFKHNNFSSFIRQLNTY  81

Query  575   GFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ--PNSG-----VPLSeperr  733
             GFRKID E WEFAN++FIRGQ HLLKNIHRRKP+HSHS     N+G      PL+E E++
Sbjct  82    GFRKIDPELWEFANEDFIRGQPHLLKNIHRRKPVHSHSIHNLANNGSSSSSSPLTESEKQ  141

Query  734   efeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSL  913
             ++ E+I  L+ E  SL ++    +QE    +FE   L  RL+   + Q+ +L  + +   
Sbjct  142   QYIEKISTLQHEKESLSIQFHMHKQEQERIKFEAHGLTDRLKRAAKLQKDILCCLDEFLQ  201

Query  914   KPDLLHHLE---VHNKKRKPSVSNG-----------------------HLELVNNLDSSI  1015
             KP          + N+KR+ S  N                        + ELV  L+SS+
Sbjct  202   KPPQECEFTPRLMENRKRRLSSENVNEQVCPFDIPIRETITADALLALNTELVEQLESSV  261

Query  1016  TVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEIS-SLHTKHPGADGNA  1192
                + I   + +  E       L   P G     + S   D P I+    +K    D N+
Sbjct  262   MSWEGIFKEVDDEFEMQKWSMELDHGPVG----CADSPTIDYPLINVETGSKESEIDMNS  317

Query  1193  KAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
             K                     +         NDVFW+QFLTE
Sbjct  318   KPV-------------------NPVPTEETAVNDVFWEQFLTE  341



>gb|EAY98789.1| hypothetical protein OsI_20732 [Oryza sativa Indica Group]
Length=457

 Score =   205 bits (521),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 142/197 (72%), Gaps = 6/197 (3%)
 Frame = +2

Query  398  FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
            FL KTYE+V+D A + VVSW  GG SFVVWNP +F+RDLLPKYFKHNNFSSFIRQLNTYG
Sbjct  19   FLIKTYEMVEDAATNHVVSWGPGGASFVVWNPLDFSRDLLPKYFKHNNFSSFIRQLNTYG  78

Query  578  FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeier  757
            FRKID E+WEFAN++FIRG THLLKNIHRRKP+HSHS Q     PL+E ERRE EEEI R
Sbjct  79   FRKIDPERWEFANEDFIRGHTHLLKNIHRRKPVHSHSLQNQINGPLAESERRELEEEINR  138

Query  758  LKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQL------SLKP  919
            LK E S L  +L R+ Q+     ++ Q+++ RL ++++RQ+ ++A + ++      ++  
Sbjct  139  LKYEKSILVADLQRQNQQQYVINWQMQAMEGRLVAMEQRQKNIVASLCEMLQRRGGAVSS  198

Query  920  DLLHHLEVHNKKRKPSV  970
             LL       K+R P +
Sbjct  199  SLLESDHFSKKRRVPKM  215



>ref|NP_001056127.1| Os05g0530400 [Oryza sativa Japonica Group]
 sp|Q93VB5.1|HFA4D_ORYSJ RecName: Full=Heat stress transcription factor A-4d; AltName: 
Full=Heat stress transcription factor 10; Short=rHsf10; AltName: 
Full=Heat stress transcription factor 15; Short=OsHsf-15; 
AltName: Full=Protein SPOTTED LEAF 7 [Oryza sativa Japonica 
Group]
 dbj|BAB71737.1| heat stress transcription factor Spl7 [Oryza sativa Japonica 
Group]
 dbj|BAB71738.1| heat stress transcription factor Spl7 [Oryza sativa Japonica 
Group]
 gb|AAQ23064.1| heat shock factor RHSF10 [Oryza sativa Japonica Group]
 gb|AAS72351.1| heat shock transcription factor [Oryza sativa Japonica Group]
 dbj|BAF18041.1| Os05g0530400 [Oryza sativa Japonica Group]
 dbj|BAG94592.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64456.1| hypothetical protein OsJ_19305 [Oryza sativa Japonica Group]
Length=459

 Score =   205 bits (521),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 142/197 (72%), Gaps = 6/197 (3%)
 Frame = +2

Query  398  FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
            FL KTYE+V+D A + VVSW  GG SFVVWNP +F+RDLLPKYFKHNNFSSFIRQLNTYG
Sbjct  21   FLIKTYEMVEDAATNHVVSWGPGGASFVVWNPLDFSRDLLPKYFKHNNFSSFIRQLNTYG  80

Query  578  FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeier  757
            FRKID E+WEFAN++FIRG THLLKNIHRRKP+HSHS Q     PL+E ERRE EEEI R
Sbjct  81   FRKIDPERWEFANEDFIRGHTHLLKNIHRRKPVHSHSLQNQINGPLAESERRELEEEINR  140

Query  758  LKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQL------SLKP  919
            LK E S L  +L R+ Q+     ++ Q+++ RL ++++RQ+ ++A + ++      ++  
Sbjct  141  LKYEKSILVADLQRQNQQQYVINWQMQAMEGRLVAMEQRQKNIVASLCEMLQRRGGAVSS  200

Query  920  DLLHHLEVHNKKRKPSV  970
             LL       K+R P +
Sbjct  201  SLLESDHFSKKRRVPKM  217



>emb|CDY13041.1| BnaA09g17760D, partial [Brassica napus]
Length=307

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 132/330 (40%), Positives = 188/330 (57%), Gaps = 41/330 (12%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD   G S S  PFL KTYE+VDD ++ +++SWS   +SF+V +P EF++DLLP++FKH 
Sbjct  1     MDENNGVSTSLPPFLTKTYEMVDDSSSDSIISWSDHNKSFIVKSPAEFSKDLLPRFFKHK  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQP-NSGVPL  715
             NFSSFIRQLNTYGFRK+D E+WEFAN++F+RGQ +L+KNIHRRKP+HSHS Q   +  PL
Sbjct  61    NFSSFIRQLNTYGFRKVDPEKWEFANEDFVRGQPYLMKNIHRRKPVHSHSLQNLQAQSPL  120

Query  716   SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
             SE ER+  +++IERLK+E   L  +L  +E E +    +  +L  RLQ +++RQR ++  
Sbjct  121   SESERQSMKDQIERLKREKEVLLADLQNQELERKGFELQVTALKDRLQHMEQRQRSIVTF  180

Query  896   VAQLSLKPDLLHHLEVHNKKRKP--------SVSNGHLELVNNLDSSITVCQKILNGISN  1051
             V+Q+  KP L  +LE H ++++           S  H   V  L+SS+T  + ++     
Sbjct  181   VSQVLEKPGLSLNLETHERRKRKLQETETSLPPSRSHAAQVEKLESSLTFLENLV-----  235

Query  1052  GEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDR  1231
                            S D          D  E +S        D  AK+      +D++ 
Sbjct  236   -------------TESCDK-----GMDIDVNESTSCAESLSNGDNRAKS----TKIDMN-  272

Query  1232  LKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                  E  +   A P  G NDVFW+Q LTE
Sbjct  273   ----AEPVTIAVAAPKTGVNDVFWEQCLTE  298



>ref|XP_010449453.1| PREDICTED: heat stress transcription factor A-4a [Camelina sativa]
 ref|XP_010449454.1| PREDICTED: heat stress transcription factor A-4a [Camelina sativa]
 ref|XP_010449455.1| PREDICTED: heat stress transcription factor A-4a [Camelina sativa]
 ref|XP_010449456.1| PREDICTED: heat stress transcription factor A-4a [Camelina sativa]
Length=391

 Score =   203 bits (516),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 143/357 (40%), Positives = 204/357 (57%), Gaps = 55/357 (15%)
 Frame = +2

Query  374   GGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSF  553
             G S+S  PFL KTYE+VDD ++ ++VSWS+  +SF+VWNPPEF+RDLLP++FKHNNFSSF
Sbjct  8     GSSSSLPPFLTKTYEMVDDSSSDSIVSWSQSNKSFIVWNPPEFSRDLLPRFFKHNNFSSF  67

Query  554   IRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-----AQPNSGVPLS  718
             IRQLNTYGFRK D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS     AQ N    L+
Sbjct  68    IRQLNTYGFRKADPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSLPNLQAQQNL---LT  124

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             + ER   + +IERL +E   L  EL ++++E      + + L  RLQ +++RQ+ +++ V
Sbjct  125   DSERVRMKNQIERLTKEKEGLLEELQKQDEEREGFEMQVKELKERLQHMEKRQKTMVSFV  184

Query  899   AQLSLKPDLLHHL-----EVHNKKRK-PSV---------------------------SNG  979
             +Q+  KP L  +L     E + +KR+ P +                           S+ 
Sbjct  185   SQVLEKPGLALNLSPCVPEPNERKRRFPRIGFLPDESMMEENQTYVVVREEGSTSPSSHT  244

Query  980   HLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSL  1159
                 V  L SSI + +   N +S+  E+     ++      DS     ST  ++P +S +
Sbjct  245   TEHQVEQLGSSIAIWE---NLVSDSCESMLQTRSMMTLDVDDS-----STCPESPPLSCI  296

Query  1160  HTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVP---VVGGNDVFWQQFLTE  1321
                    D   K+  +   +DV+   D  + ++ T A P   V G NDVFWQQF +E
Sbjct  297   QL---SIDKRPKSPPSPRIIDVNSEPDVTKEQNKTVAAPPPSVAGANDVFWQQFFSE  350



>ref|NP_001044247.1| Os01g0749300 [Oryza sativa Japonica Group]
 sp|Q94J16.1|HFA4B_ORYSJ RecName: Full=Heat stress transcription factor A-4b; AltName: 
Full=Heat stress transcription factor 4; Short=OsHsf-04; AltName: 
Full=Heat stress transcription factor 9; Short=rHsf9 
[Oryza sativa Japonica Group]
 dbj|BAB56047.1| putative heat shock factor [Oryza sativa Japonica Group]
 gb|AAQ23063.1| heat shock factor RHSF9 [Oryza sativa Japonica Group]
 dbj|BAF06161.1| Os01g0749300 [Oryza sativa Japonica Group]
 dbj|BAG98932.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55381.1| hypothetical protein OsJ_03456 [Oryza sativa Japonica Group]
Length=440

 Score =   204 bits (519),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 141/377 (37%), Positives = 197/377 (52%), Gaps = 70/377 (19%)
 Frame = +2

Query  395   PFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTY  574
             PFL+KTYE+VDD +  AVV W+  G SFVV N PEF RDLLPKYFKHNNFSSF+RQLNTY
Sbjct  12    PFLSKTYEMVDDPSTDAVVGWTPAGTSFVVANQPEFCRDLLPKYFKHNNFSSFVRQLNTY  71

Query  575   GFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeie  754
             GFRK+D EQWEFAN++FI+GQ H LKNIHRRKPI SHS+      PL++ ER+++EEEIE
Sbjct  72    GFRKVDPEQWEFANEDFIKGQRHRLKNIHRRKPIFSHSSHSQGAGPLTDNERKDYEEEIE  131

Query  755   rLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLL--  928
             RLK +N++L  EL     +        Q+L+ +L  ++++QR +++ V ++   P  L  
Sbjct  132   RLKSDNAALSSELQNNTLKKLNMEKRMQALEEKLFVVEDQQRSLISYVREIVKAPGFLSS  191

Query  929   --HHLEVHNKKRKPSVSNGHLELVNNLDSSITVC------------------QKILNGIS  1048
                  + H KKR+  +     E  N  ++ I  C                  +  LN + 
Sbjct  192   FVQQQDHHRKKRRLPIPISFHEDANTQENQIMPCDLTNSPAQTFYRESFDKMESSLNSLE  251

Query  1049  N----GEEAYGN---FETLPQAPS-------------GDSRFSSPSTQTDTPEISSLHTK  1168
             N      E +GN   ++     PS              D R SSP T+  T   SS    
Sbjct  252   NFLREASEEFGNDISYDDGVPGPSSTVVLTELHSPGESDPRVSSPPTRMRT---SSAGAG  308

Query  1169  HPGADGNAKAAWNCA-AVDVDRLKDRLEGRSSTAAV-----PVV----------------  1282
                +  +   + +CA +  + ++  R++ R+  + +     P V                
Sbjct  309   DSHSSRDVAESTSCAESPPIPQMHSRVDTRAKVSEIDVNSEPAVTETGPSRDQPAEEPPA  368

Query  1283  ---GGNDVFWQQFLTEE  1324
                G ND FWQQFLTE+
Sbjct  369   VTPGANDGFWQQFLTEQ  385



>ref|XP_002456359.1| hypothetical protein SORBIDRAFT_03g034630 [Sorghum bicolor]
 gb|EES01479.1| hypothetical protein SORBIDRAFT_03g034630 [Sorghum bicolor]
Length=434

 Score =   204 bits (518),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 145/205 (71%), Gaps = 5/205 (2%)
 Frame = +2

Query  359  MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
            M+   GG++S  PFL+KTYE+VDD A  AVV+W+  G SFVV N  EF RDLLPKYFKHN
Sbjct  1    MEAGGGGASSLPPFLSKTYEMVDDPATDAVVAWTPPGTSFVVANQAEFCRDLLPKYFKHN  60

Query  539  NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
            NFSSF+RQLNTYGFRKID EQWEFAN++FIRGQ H LKNIHRRKPI SHS+   SG PL+
Sbjct  61   NFSSFVRQLNTYGFRKIDPEQWEFANEDFIRGQQHRLKNIHRRKPIFSHSSHTGSG-PLA  119

Query  719  eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
            + ERR++EEEIERLK +N++L  EL+   Q+        Q L+ +L  +++RQ+ ++A V
Sbjct  120  DTERRDYEEEIERLKSDNAALTSELENNAQKKLVTEKRMQDLEDKLIFLEDRQKNLMAYV  179

Query  899  AQLSLKPDLLHHL----EVHNKKRK  961
              +   P  L       + H KKR+
Sbjct  180  RDIVQAPGFLASFVQQPDHHGKKRR  204



>ref|XP_009108396.1| PREDICTED: heat stress transcription factor A-4a-like isoform 
X2 [Brassica rapa]
Length=368

 Score =   201 bits (512),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 141/341 (41%), Positives = 202/341 (59%), Gaps = 34/341 (10%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWS-RGGRSFVVWNPPEFARDLLPKYFKH  535
             MD +  G + P PFL KTYE+VDD ++ ++VSWS +  +SF+VWNPPEF+RDLLPK+FKH
Sbjct  1     MDESNHGGSLP-PFLTKTYEMVDDSSSDSIVSWSPQSNKSFIVWNPPEFSRDLLPKFFKH  59

Query  536   NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPL  715
             NNF+SFIRQLNTYGFRK D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS+      PL
Sbjct  60    NNFASFIRQLNTYGFRKADPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSSPSLQPHPL  119

Query  716   SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
             ++ ER+   ++IERL +E   L  EL ++E+E    + + + L  +LQ +++RQ+ + + 
Sbjct  120   TDSERQRMNDQIERLTKEKEVLLEELHKQEKEREMFQQQVKELKDQLQHMEKRQKTMASF  179

Query  896   VAQLSLKPDLLHHL-----EVHNKKRK-----------PSVSNGHLELVNNLDSSITVCQ  1027
             V+Q+  KP+L  +L     E + +KR+           PS     L+ V  L+SSI V +
Sbjct  180   VSQVLEKPELAFNLSPCLQETNERKRRFPRIGLEGSTSPSSQARELQ-VEQLESSIAVWE  238

Query  1028  KILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGADGNAKAAWN  1207
              +++  S+        E+L Q            + T  PE   L       D    +   
Sbjct  239   NLVSEDSS--------ESLGQETRSMMTLDVDESST-CPESPPLPCIQLSIDTCPTSP--  287

Query  1208  CAAVDVDRLKDRLEGRSSTAAVP---VVGGNDVFWQQFLTE  1321
                +D++   D  + +++ A  P     GGNDVFWQQ LTE
Sbjct  288   -RTIDMNSEPDASKEQNTVAPSPPLSAAGGNDVFWQQLLTE  327



>gb|ACN93796.2| HsfA4a [Triticum aestivum]
 gb|AFI98881.1| heat shock responsive transcription factor [Triticum aestivum]
Length=432

 Score =   203 bits (516),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 153/388 (39%), Positives = 212/388 (55%), Gaps = 74/388 (19%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             M+G+ GGS+S  PFL KTYE+VD+ A  AVV+W+  G SFVV +  +F RDLLPKYFKHN
Sbjct  1     MEGS-GGSSSLPPFLTKTYEMVDEPATDAVVAWTPSGTSFVVLSQADFCRDLLPKYFKHN  59

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
             NFSSF+RQLNTYGFRK+D EQWEFAN+EFIR Q H LKNIHRRKPI SHS+      PL+
Sbjct  60    NFSSFVRQLNTYGFRKVDPEQWEFANEEFIRDQRHRLKNIHRRKPIFSHSSHTQGAGPLA  119

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             + ERR++EEEIERLK +N+SL+++L+R++    +   + + L+ +L +I+ +Q+ +++ V
Sbjct  120   DSERRDYEEEIERLKCDNASLKLQLERKKT---DMESKMKVLEDKLFAIEGQQKNLISYV  176

Query  899   AQLSLKPDLLHHL----EVHNKKR---KP------SVSNG----HLELVNN-----LDSS  1012
              ++   P  +  L    + H KKR   KP      + + G    H ++VN+       +S
Sbjct  177   REIVNAPGFISSLIEQSDHHGKKRRLPKPISFHEDASTQGNQIMHCDMVNSPTHELFRAS  236

Query  1013  ITVCQKILNGISN----GEEAYGN-----------------------FETLPQAPS----  1099
                 +  LN + N      EA+GN                        E+ P A S    
Sbjct  237   FDKMESSLNSLENFFKEASEAFGNDVSYDGDVPGHSSAVVLTELHSSGESEPHAQSPPSM  296

Query  1100  --------GDSRFSSPSTQTDT-PEISSLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEG  1252
                     GDS  S    ++ + PE S L   H  AD  +K     + +DV+      E 
Sbjct  297   MHTCSAGVGDSHSSRDIAESASCPESSPLPEAHSRADSRSK----VSEIDVNLEPAVTET  352

Query  1253  RSSTAAVPV----VGGNDVFWQQFLTEE  1324
               S    P        ND FWQQFLTE+
Sbjct  353   GPSRDQQPTQDPPADANDGFWQQFLTEQ  380



>ref|XP_009392447.1| PREDICTED: heat stress transcription factor A-4b-like [Musa acuminata 
subsp. malaccensis]
Length=453

 Score =   203 bits (517),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 158/236 (67%), Gaps = 6/236 (3%)
 Frame = +2

Query  398   FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
             FL KTYE+VDD A +++VSWS    SFVVWN  EFARDLLPKYFKH+NFSSF+RQLNTYG
Sbjct  16    FLTKTYEMVDDPATNSIVSWSPTNLSFVVWNQLEFARDLLPKYFKHSNFSSFVRQLNTYG  75

Query  578   FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSA--QPNSGVPLSeperrefeeei  751
             FRKID +QWEFAN++FIRG+ HLLKNIHRRKP++SHS   Q +S  PLSE ++++ EEEI
Sbjct  76    FRKIDPDQWEFANEDFIRGEKHLLKNIHRRKPVYSHSPHNQGSSSGPLSEAQKQDLEEEI  135

Query  752   erLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLH  931
             ERLKQE + L  EL +   +      + QSL+ RLQ + +R R ++A + Q+  +P  L 
Sbjct  136   ERLKQEKAMLVNELQKNVHKQHGMEHQMQSLEERLQVLGDRHRNLMAFLTQIVQEPWFLS  195

Query  932   HL----EVHNKKRKPSVSNGHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLP  1087
             +L    ++ +KKR+    N   E     D+ I   Q+ L G  +G  +   F+  P
Sbjct  196   NLVQDSDLLSKKRRLPKINYFNEDTAMEDNQIVTFQQPLAGEKSGYASIQIFDMEP  251



>ref|XP_008657226.1| PREDICTED: heat stress transcription factor A-4b-like [Zea mays]
 gb|AFW85100.1| hypothetical protein ZEAMMB73_544541 [Zea mays]
 gb|AIB05549.1| HSF transcription factor, partial [Zea mays]
Length=433

 Score =   203 bits (516),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 151/380 (40%), Positives = 197/380 (52%), Gaps = 68/380 (18%)
 Frame = +2

Query  377   GSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFI  556
             G++S  PFL+KTYE+VDD A  AVV+W+  G SFVV N  EF RDLLPKYFKHNNFSSF+
Sbjct  3     GASSLPPFLSKTYEMVDDPATDAVVAWTPLGTSFVVANQAEFCRDLLPKYFKHNNFSSFV  62

Query  557   RQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperre  736
             RQLNTYGF+KID EQWEFAND+FIRGQ H LKNIHRRKPI SHS+      PL + ERR+
Sbjct  63    RQLNTYGFKKIDPEQWEFANDDFIRGQQHRLKNIHRRKPIFSHSSHTQGSGPLPDTERRD  122

Query  737   feeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLK  916
             +EEEIERLK +N++L  EL++  Q+        Q L+ +L  +++RQ+ ++A V  +   
Sbjct  123   YEEEIERLKCDNAALTSELEKNAQKKLVTEKRMQELEDKLIFLEDRQKNLMAYVRDIVQA  182

Query  917   P----DLLHHLEVHNKKRKPSV-------SNG------HLELVNN----------LDSSI  1015
             P      +   + H KKR+  V       SN       H   + N           +SS+
Sbjct  183   PGSFSSFVQQPDHHGKKRRLPVPISLYQDSNAEGNQVVHGGFITNPPACRESFDKTESSL  242

Query  1016  TVCQKILN------GISNGE------------EAYGNFETLPQAPSGDSRFSSPST----  1129
                +  L        IS G+            E + + E+ P  PS  SR  + S     
Sbjct  243   NSLENFLREASEAFNISYGDGLPGPSSAVVITELHSSGESDPHVPSPVSRMHTSSAGAGD  302

Query  1130  ---------QTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDR---LKDRLEGRSSTAAV  1273
                       T   E   L    P  D   K     + +DV+R   + +    R   A  
Sbjct  303   SLSSRDLTESTSCAESPRLAQIQPCTDSRTK----VSEIDVNREPAVTETGPTRDQPAEE  358

Query  1274  P---VVGGNDVFWQQFLTEE  1324
             P     G ND FWQQFLTE+
Sbjct  359   PPHVAAGVNDGFWQQFLTEQ  378



>ref|XP_010434484.1| PREDICTED: heat stress transcription factor A-4a-like [Camelina 
sativa]
 ref|XP_010434485.1| PREDICTED: heat stress transcription factor A-4a-like [Camelina 
sativa]
 ref|XP_010434486.1| PREDICTED: heat stress transcription factor A-4a-like [Camelina 
sativa]
 ref|XP_010434487.1| PREDICTED: heat stress transcription factor A-4a-like [Camelina 
sativa]
 ref|XP_010434488.1| PREDICTED: heat stress transcription factor A-4a-like [Camelina 
sativa]
Length=391

 Score =   202 bits (513),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 141/357 (39%), Positives = 206/357 (58%), Gaps = 55/357 (15%)
 Frame = +2

Query  374   GGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSF  553
             G S+S  PFL KTYE+VDD ++ ++VSWS+  +SF+VWNPP+F+RDLLP++FKHNNFSSF
Sbjct  8     GSSSSLPPFLTKTYEMVDDSSSDSIVSWSQSNKSFIVWNPPDFSRDLLPRFFKHNNFSSF  67

Query  554   IRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-----AQPNSGVPLS  718
             IRQLNTYGFRK D EQWEFAND+F+RGQ+HL+KNIHRRKP+HSHS     AQ N    L+
Sbjct  68    IRQLNTYGFRKADPEQWEFANDDFVRGQSHLMKNIHRRKPVHSHSLPNLQAQQNL---LT  124

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             + ER   + +IERL +E   L  EL ++++E      + + L  RLQ +++RQ+ +++ V
Sbjct  125   DSERVRMKNQIERLTKEKEGLLEELQKQDEEREGFEMQVKELKERLQRMEKRQKTMVSFV  184

Query  899   AQLSLKPDLLHHL-----EVHNKKRK-PSV---------------------------SNG  979
             +Q+  KP L  +L     E + +KR+ P +                           S+ 
Sbjct  185   SQVLEKPGLALNLSPCVPEPNERKRRFPRIGFLPDEPMMEENQTCVVVREEGSTSPSSHT  244

Query  980   HLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSL  1159
                 V  L SSI + +   N +S+  E+     ++      DS     ST  ++P +S +
Sbjct  245   TEHQVEQLGSSIAIWE---NLVSDSCESMLQTRSMMTLDVDDS-----STCPESPPLSCI  296

Query  1160  HTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVP---VVGGNDVFWQQFLTE  1321
                    D   K+  +   +D++   D  + +++T A P   V G NDVFWQQF +E
Sbjct  297   QL---SIDKRPKSPSSPRIIDMNSEPDVTKEQNNTVAAPPPSVAGANDVFWQQFFSE  350



>dbj|BAK02319.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=432

 Score =   202 bits (515),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 154/388 (40%), Positives = 207/388 (53%), Gaps = 74/388 (19%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             M+G+ GGS+S  PFL KTYE+VD+ A  AVV+W+  G SFVV++  +F RDLLPKYFKHN
Sbjct  1     MEGS-GGSSSLPPFLIKTYEMVDEPATDAVVAWTPSGTSFVVFSQADFCRDLLPKYFKHN  59

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
             NFSSF+RQLNTYGFRK+D EQWEFAN+EFIR Q H LKNIHRRKPI SHS+      PL+
Sbjct  60    NFSSFVRQLNTYGFRKVDPEQWEFANEEFIRDQRHRLKNIHRRKPIFSHSSHTQGAGPLA  119

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             + ERR++EEEIERLK EN+SL ++L+R++    +   + ++L+ +L +I+++QR +++ V
Sbjct  120   DSERRDYEEEIERLKCENASLNLQLERKKT---DMDSKMKALEDKLLAIEDQQRNLISYV  176

Query  899   AQLSLKPDLLHHL----EVHNKKRK----PSVSNG---------HLELVNN-----LDSS  1012
              ++   P  L       + H KKR+     S   G         H +L N+        S
Sbjct  177   TEIVKAPGFLSSFIEQSDHHGKKRRLPKSISFHEGASTQGNQIMHCDLANSPAHKLYRES  236

Query  1013  ITVCQKILNGISN----GEEAYGN-----------------------FETLPQAPS----  1099
                 +  LN + N      EA GN                        E+ P A S    
Sbjct  237   FDKMESSLNSLENFFKEATEALGNDISYDGDVPRHSSAVVLTELHSSGESDPHAQSPPSM  296

Query  1100  --------GDSRFSSPSTQTDT-PEISSLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEG  1252
                     GDS  S    ++ + PE   L   H  AD  AK     + +DV+      E 
Sbjct  297   MHTCSAGVGDSHSSRDIAESASCPESPPLPEAHSRADSRAK----VSDIDVNLEPAVTET  352

Query  1253  RSSTAAVPV----VGGNDVFWQQFLTEE  1324
               S    P        ND FWQQFLTE+
Sbjct  353   GPSRDQQPTQDPPADANDGFWQQFLTEQ  380



>ref|XP_009114395.1| PREDICTED: heat stress transcription factor A-4c [Brassica rapa]
 ref|XP_009114396.1| PREDICTED: heat stress transcription factor A-4c [Brassica rapa]
Length=340

 Score =   199 bits (507),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 132/330 (40%), Positives = 188/330 (57%), Gaps = 41/330 (12%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD   G S S  PFL KTYE+VDD ++ +++SWS   +SF+V +P EF++DLLP++FKH 
Sbjct  1     MDENNGVSTSLPPFLTKTYEMVDDSSSDSIISWSDHNKSFIVKSPAEFSKDLLPRFFKHK  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQP-NSGVPL  715
             NFSSFIRQLNTYGFRK+D E+WEFAN++F+RGQ +L+KNIHRRKP+HSHS Q   +  PL
Sbjct  61    NFSSFIRQLNTYGFRKVDPEKWEFANEDFVRGQPYLMKNIHRRKPVHSHSLQNLQAQSPL  120

Query  716   SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
             SE ER+  +++IERLK+E   L  +L  +E E +    +  +L  RLQ +++RQR ++  
Sbjct  121   SESERQSMKDQIERLKREKEVLLADLQNQELERKGFELQVTALKDRLQHMEQRQRSIVTF  180

Query  896   VAQLSLKPDLLHHLEVHNKKRKP--------SVSNGHLELVNNLDSSITVCQKILNGISN  1051
             V+Q+  KP L  +LE H ++++           S  H   V  L+SS+T  + ++     
Sbjct  181   VSQVLEKPGLSLNLETHERRKRKLQETETSLPPSRSHAAQVEKLESSLTFLENLV-----  235

Query  1052  GEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDR  1231
                            S D          D  E +S        D  AK+      +D++ 
Sbjct  236   -------------TESCDK-----GMDIDVNESTSCAESLSNGDNRAKS----TKIDMN-  272

Query  1232  LKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                  E  +   A P  G NDVFW+Q LTE
Sbjct  273   ----AEPVTIAVAAPKTGVNDVFWEQCLTE  298



>emb|CDX76506.1| BnaA08g08940D [Brassica napus]
Length=366

 Score =   200 bits (508),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 140/339 (41%), Positives = 201/339 (59%), Gaps = 32/339 (9%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWS-RGGRSFVVWNPPEFARDLLPKYFKH  535
             MD +  G + P PFL KTYE+VDD ++ ++VSWS +  +SF+VWNPPEF+RDLLPK+FKH
Sbjct  1     MDESNHGGSLP-PFLTKTYEMVDDSSSDSIVSWSPQSNKSFIVWNPPEFSRDLLPKFFKH  59

Query  536   NNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPL  715
             NNF+SFIRQLNTYGFRK D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS+      PL
Sbjct  60    NNFASFIRQLNTYGFRKADPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSSPSLQPHPL  119

Query  716   SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
             ++ ER+   ++I+RL +E   L  EL ++E+E    + + + L  +LQ +++RQ+ + + 
Sbjct  120   TDSERQRMNDQIQRLTKEKEVLLEELHKQEKEREMFQQQVKELKDQLQHMEKRQKTMASF  179

Query  896   VAQLSLKPDLLHHL-----EVHNKKRK-----------PSVSNGHLELVNNLDSSITVCQ  1027
             V+Q+  KP+L  +L     E + +KR+           PS     L+ V  L+SSI V +
Sbjct  180   VSQVLEKPELALNLSPCLQETNERKRRFPRIGLEGSTSPSSQARELQ-VEQLESSIAVWE  238

Query  1028  KILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGADGNAKAAWN  1207
              +++  S+        E+L Q            + T  PE   L       D    +   
Sbjct  239   NLVSEDSS--------ESLGQETRSMMTLDVDESST-CPESPPLPCIQLSIDTCPTSP--  287

Query  1208  CAAVDVDRLKDRLEGRSSTAAVPV-VGGNDVFWQQFLTE  1321
                +D++   D  + ++  A  P   GGNDVFWQQ LTE
Sbjct  288   -RTIDMNSEPDASKEQTIVAPPPPGAGGNDVFWQQLLTE  325



>ref|XP_003531216.1| PREDICTED: heat stress transcription factor A-5-like isoform 
X1 [Glycine max]
 gb|KHN12346.1| Heat stress transcription factor A-5 [Glycine soja]
Length=477

 Score =   201 bits (511),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 138/213 (65%), Gaps = 12/213 (6%)
 Frame = +2

Query  359  MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
            MDG    +  PAPFL KTYE+VDD + + +VSWS    SFVVWNPPEFAR LLP YFKHN
Sbjct  1    MDGAPQSAGGPAPFLLKTYEMVDDASTNDIVSWSSTNNSFVVWNPPEFARLLLPTYFKHN  60

Query  539  NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
            NFSSFIRQLNTYGFRKI  E+WEFANDEF++ Q HLLKNIHRRKPIHSHS  P S   L 
Sbjct  61   NFSSFIRQLNTYGFRKIHPERWEFANDEFLKDQKHLLKNIHRRKPIHSHSHPPGS---LV  117

Query  719  eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
            +PER  FEEEI++L +E +SL   +   +Q     + + +    RL  +D+RQ+Q+L   
Sbjct  118  DPERAAFEEEIDKLSREKNSLESNIRNFKQHQSTAKPKLEDFLQRLDGVDKRQKQLLNFF  177

Query  899  AQLSLKPDLLHH---------LEVHNKKRKPSV  970
             +    P  + H         L  + K+R P V
Sbjct  178  EKALQNPTFVEHLSRKIESMDLSAYKKRRLPQV  210



>dbj|BAB71739.1| spl7 protein [Oryza sativa]
 dbj|BAB71740.1| spl7 protein [Oryza sativa]
Length=459

 Score =   200 bits (509),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 141/197 (72%), Gaps = 6/197 (3%)
 Frame = +2

Query  398  FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
            FL KTYE+V+D A + VVS   GG SFVVWNP +F+RDLLPKYFKHNNFSSFIRQLNTYG
Sbjct  21   FLIKTYEMVEDAATNHVVSCGPGGASFVVWNPLDFSRDLLPKYFKHNNFSSFIRQLNTYG  80

Query  578  FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeier  757
            FRKID E+WEFAN++FIRG THLLKNIHRRKP+HSHS Q     PL+E ERRE EEEI R
Sbjct  81   FRKIDPERWEFANEDFIRGHTHLLKNIHRRKPVHSHSLQNQINGPLAESERRELEEEINR  140

Query  758  LKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQL------SLKP  919
            LK E S L  +L R+ Q+     ++ Q+++ RL ++++RQ+ ++A + ++      ++  
Sbjct  141  LKYEKSILVADLQRQNQQQYVINWQMQAMEGRLVAMEQRQKNIVASLCEMLQRRGGAVSS  200

Query  920  DLLHHLEVHNKKRKPSV  970
             LL       K+R P +
Sbjct  201  SLLESDHFSKKRRVPKM  217



>emb|CDY23108.1| BnaC09g18620D [Brassica napus]
Length=340

 Score =   197 bits (500),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 132/330 (40%), Positives = 189/330 (57%), Gaps = 41/330 (12%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD   G S S  PFL KTYE+VDD ++ +++SWS   +SF+V +P EF++DLLP++FKH 
Sbjct  1     MDENNGVSTSLPPFLTKTYEMVDDSSSDSIISWSDHNKSFIVKSPAEFSKDLLPRFFKHK  60

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQP-NSGVPL  715
             NFSSFIRQLNTYGFRK+D E+WEFAN++F+RGQ +L+KNIHRRKP+HSHS Q   +  PL
Sbjct  61    NFSSFIRQLNTYGFRKVDPEKWEFANEDFVRGQPYLMKNIHRRKPVHSHSLQNLQAQSPL  120

Query  716   SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
             SE ER+  +++IERLK++   L  +L  +E E +    +  +L  RLQ +++RQR ++  
Sbjct  121   SESERQSMKDQIERLKRDKEVLLTDLQNQELERKGFELQVTALKDRLQHMEQRQRSIVTF  180

Query  896   VAQLSLKPDLLHHLEVH-NKKRK-----PSVSNG--HLELVNNLDSSITVCQKILNGISN  1051
             V+Q+  KP    +LE H  +KRK      S+  G  H + V  L+SS+T  + ++     
Sbjct  181   VSQVLEKPGFSLNLETHETRKRKLQETETSLPPGRSHADQVEKLESSLTFLENLV-----  235

Query  1052  GEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDR  1231
                               +         D  E +S        D  AK+      +D++ 
Sbjct  236   ------------------TESCDKGMDIDVNESTSCAESLSNGDNRAKS----TKIDMN-  272

Query  1232  LKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                  E  +   A P  G NDVFW+Q LTE
Sbjct  273   ----AEPVTVAVAAPKTGVNDVFWEQCLTE  298



>ref|XP_009108394.1| PREDICTED: heat stress transcription factor A-4a-like isoform 
X1 [Brassica rapa]
 ref|XP_009108395.1| PREDICTED: heat stress transcription factor A-4a-like isoform 
X1 [Brassica rapa]
Length=370

 Score =   197 bits (500),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 141/343 (41%), Positives = 202/343 (59%), Gaps = 36/343 (10%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWS-RGGRSFVVWNPPEFARDLLPKYFKH  535
             MD +  G + P PFL KTYE+VDD ++ ++VSWS +  +SF+VWNPPEF+RDLLPK+FKH
Sbjct  1     MDESNHGGSLP-PFLTKTYEMVDDSSSDSIVSWSPQSNKSFIVWNPPEFSRDLLPKFFKH  59

Query  536   NNFSSFIRQLNTY--GFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGV  709
             NNF+SFIRQLNTY  GFRK D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS+      
Sbjct  60    NNFASFIRQLNTYVTGFRKADPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSSPSLQPH  119

Query  710   PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
             PL++ ER+   ++IERL +E   L  EL ++E+E    + + + L  +LQ +++RQ+ + 
Sbjct  120   PLTDSERQRMNDQIERLTKEKEVLLEELHKQEKEREMFQQQVKELKDQLQHMEKRQKTMA  179

Query  890   ALVAQLSLKPDLLHHL-----EVHNKKRK-----------PSVSNGHLELVNNLDSSITV  1021
             + V+Q+  KP+L  +L     E + +KR+           PS     L+ V  L+SSI V
Sbjct  180   SFVSQVLEKPELAFNLSPCLQETNERKRRFPRIGLEGSTSPSSQARELQ-VEQLESSIAV  238

Query  1022  CQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGADGNAKAA  1201
              + +++  S+        E+L Q            + T  PE   L       D    + 
Sbjct  239   WENLVSEDSS--------ESLGQETRSMMTLDVDESST-CPESPPLPCIQLSIDTCPTSP  289

Query  1202  WNCAAVDVDRLKDRLEGRSSTAAVP---VVGGNDVFWQQFLTE  1321
                  +D++   D  + +++ A  P     GGNDVFWQQ LTE
Sbjct  290   ---RTIDMNSEPDASKEQNTVAPSPPLSAAGGNDVFWQQLLTE  329



>gb|AAF37579.1|AF235958_1 heat shock transcription factor [Medicago sativa]
 gb|AAM14595.1|AF494082_1 heat shock transcription factor [Medicago sativa]
Length=402

 Score =   197 bits (502),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 138/354 (39%), Positives = 192/354 (54%), Gaps = 47/354 (13%)
 Frame = +2

Query  374   GGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSF  553
             G S+S  PFLAKTYE+VDDR++  +VSWS   +SFVVWNPPEFAR LL +  KHNNFSSF
Sbjct  5     GSSSSLPPFLAKTYEMVDDRSSDPIVSWSASNKSFVVWNPPEFARVLLSEILKHNNFSSF  64

Query  554   IRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQP-NSGVPLSeper  730
             IRQLNTYGFRK+D EQWEFAND+FIRGQ HL+KNIHRRKP+HSHS     +   L+E ER
Sbjct  65    IRQLNTYGFRKVDPEQWEFANDDFIRGQPHLMKNIHRRKPVHSHSLHNLQAQASLTESER  124

Query  731   refeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLS  910
             +   +EIE+LKQ+   L VE  R + +      +      +L+ ++ +Q+++L+ V++  
Sbjct  125   QSMIDEIEKLKQDREQLLVETKRYQHDWERHEIQMHCSKDQLEKLEHKQQKMLSSVSEAL  184

Query  911   LKP----DLLHHLEVHNKKRK-PSVS---NGHLELVNNLDSSITVCQKILN---------  1039
              KP    +LL   E   +KR+ P+ S   N    + + +++S+ + ++            
Sbjct  185   QKPMIAVNLLPLAEAMERKRRLPARSVCFNNEASVEDAMETSVALPRENSEDNFYFDVKH  244

Query  1040  -------------GISNGEEAYGNF------ETLPQAPSGDSRFSSPSTQTDTPEISSLH  1162
                          G +   E   NF        L ++     R S    Q D      + 
Sbjct  245   REIGSTSRHPWHFGKTLAHEVGDNFVHTHSNMDLDESTCCADRLSISCQQLD----GEVR  300

Query  1163  TKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTEE  1324
              K P  D N + A         + +     R +TAA    G NDVFW+QFLTE+
Sbjct  301   PKSPEIDMNVEPAAAALEAVAVKEQ---PARITTAA---TGVNDVFWEQFLTED  348



>ref|XP_009346396.1| PREDICTED: heat stress transcription factor A-1d-like [Pyrus 
x bretschneideri]
Length=516

 Score =   200 bits (508),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 114/239 (48%), Positives = 147/239 (62%), Gaps = 18/239 (8%)
 Frame = +2

Query  380   SASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIR  559
             S +P PFL+KTY++VDD A   VVSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+R
Sbjct  37    SNAPPPFLSKTYDMVDDPATDPVVSWSPTNNSFVVWNPPEFARDLLPKYFKHNNFSSFVR  96

Query  560   QLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ-------PNSGVPLS  718
             QLNTYGFRKID ++WEFAN+ F+RGQ HLLK+I+RRKP H HS Q        NS     
Sbjct  97    QLNTYGFRKIDPDRWEFANEGFLRGQKHLLKSINRRKPTHGHSHQQQQPSHGQNSMGACV  156

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             E  +   EEE+ERLK++ + L  EL R  Q+ +    + Q++  RLQ +++RQ+Q+++ +
Sbjct  157   EVGKFGLEEEVERLKRDKNVLMQELIRLRQQQQSTDNQLQTMVQRLQGMEQRQQQMMSFL  216

Query  899   AQLSLKPDLLHHL-----------EVHNKKRKPSVSNGHLELVNNLDSSITVCQKILNG  1042
             A+    PD                EV+ K+R         E  N  D  I   Q  +NG
Sbjct  217   AKAMHSPDFFTQFVQKNESNRRITEVNKKRRLKQEGIAERERSNAPDGQIVKYQPPMNG  275



>ref|XP_009340197.1| PREDICTED: heat stress transcription factor A-1d-like [Pyrus 
x bretschneideri]
Length=516

 Score =   200 bits (508),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 114/239 (48%), Positives = 147/239 (62%), Gaps = 18/239 (8%)
 Frame = +2

Query  380   SASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIR  559
             S +P PFL+KTY++VDD A   VVSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+R
Sbjct  37    SNAPPPFLSKTYDMVDDPATDPVVSWSPTNNSFVVWNPPEFARDLLPKYFKHNNFSSFVR  96

Query  560   QLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ-------PNSGVPLS  718
             QLNTYGFRKID ++WEFAN+ F+RGQ HLLK+I+RRKP H HS Q        NS     
Sbjct  97    QLNTYGFRKIDPDRWEFANEGFLRGQKHLLKSINRRKPTHGHSHQQQQPSHGQNSMGACV  156

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             E  +   EEE+ERLK++ + L  EL R  Q+ +    + Q++  RLQ +++RQ+Q+++ +
Sbjct  157   EVGKFGLEEEVERLKRDKNVLMQELIRLRQQQQSTDNQLQTMVQRLQGMEQRQQQMMSFL  216

Query  899   AQLSLKPDLLHHL-----------EVHNKKRKPSVSNGHLELVNNLDSSITVCQKILNG  1042
             A+    PD                EV+ K+R         E  N  D  I   Q  +NG
Sbjct  217   AKAMHSPDFFTQFVQKNESNRRITEVNKKRRLKQEGIAERERSNAPDGQIVKYQPPMNG  275



>ref|XP_006283847.1| hypothetical protein CARUB_v10004953mg [Capsella rubella]
 gb|EOA16745.1| hypothetical protein CARUB_v10004953mg [Capsella rubella]
Length=405

 Score =   197 bits (500),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 144/366 (39%), Positives = 208/366 (57%), Gaps = 60/366 (16%)
 Frame = +2

Query  362   DGTQGGSASP-APFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             D   GGS+S   PFL KTYE+VDD ++ ++VSWS+  +SF+VWNPPEF+RDLLP++FKHN
Sbjct  3     DNNHGGSSSSLPPFLTKTYEMVDDSSSDSIVSWSQSNKSFIVWNPPEFSRDLLPRFFKHN  62

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-----AQPNS  703
             NFSSFIRQLNTYGFRK D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS     AQ N 
Sbjct  63    NFSSFIRQLNTYGFRKADPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSLPNLQAQQN-  121

Query  704   GVPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQ  883
               PL++ ER   + +IERL +E   L  EL ++++E      + + L  RLQ +++RQ+ 
Sbjct  122   --PLTDAERLRMKNQIERLTKEKEGLLEELQKQDEEREGFEMQVKELKERLQHMEKRQKT  179

Query  884   VLALVAQLSLKPDLLHHL-----EVHNKKRK-PSV-------------------------  970
             +++ V+Q+  KP L  +L     E + +KR+ P++                         
Sbjct  180   MVSFVSQVLEKPGLALNLSPCVPEPNERKRRFPTIGFLPDEPMLEENQTCVVVREEGSTS  239

Query  971   --SNGHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTP  1144
               S+     V  L SSI + +   N +S+  E+     ++      DS     ST  ++P
Sbjct  240   PSSHSTEHQVEQLGSSIAIWE---NLVSDSCESMLQSRSMTTLDMDDS-----STCPESP  291

Query  1145  EISSLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSST-------AAVPVVGGNDVFW  1303
              +S +       +   K+  +   +D++   D  + ++ST          PV G NDVFW
Sbjct  292   PLSCIQL---SIETRPKSPLSPRIIDMNSEPDVSKEQNSTVAAAPPPPPPPVAGANDVFW  348

Query  1304  QQFLTE  1321
             QQF +E
Sbjct  349   QQFFSE  354



>emb|CAA58117.1| heat shock factor [Zea mays]
Length=308

 Score =   194 bits (492),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 141/202 (70%), Gaps = 4/202 (2%)
 Frame = +2

Query  377  GSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFI  556
            G++S  PFL+KTYE+VDD A  AVV+W+  G SFVV N  EF RDLLPKYFKHNNFSSF+
Sbjct  3    GASSLPPFLSKTYEMVDDPATDAVVAWTPLGTSFVVANQAEFWRDLLPKYFKHNNFSSFV  62

Query  557  RQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperre  736
            RQLNTYGF+KID EQWEFAND+FIRGQ H LKNIHRRKPI SHS+      PL + ERR+
Sbjct  63   RQLNTYGFKKIDPEQWEFANDDFIRGQQHRLKNIHRRKPIFSHSSHTQGSGPLPDTERRD  122

Query  737  feeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLK  916
            +EEEIERLK +N++L  EL++  Q+        Q L+ +L  +++RQ+ ++A V  +   
Sbjct  123  YEEEIERLKCDNAALTSELEKNAQKKLVTEKRMQDLEDKLIFLEDRQKNLMAYVRDIVQA  182

Query  917  P----DLLHHLEVHNKKRKPSV  970
            P      +   + H KKR+  V
Sbjct  183  PGSFSSFVQQPDHHGKKRRLPV  204



>ref|XP_009132283.1| PREDICTED: heat stress transcription factor A-4a-like [Brassica 
rapa]
 ref|XP_009132288.1| PREDICTED: heat stress transcription factor A-4a-like [Brassica 
rapa]
Length=388

 Score =   196 bits (498),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 138/346 (40%), Positives = 194/346 (56%), Gaps = 40/346 (12%)
 Frame = +2

Query  374   GGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSF  553
             G S+S  PFL KTYE+VDD ++ ++VSWS+  RSF+VWNPPEF+RDLLP++FKHNNFSSF
Sbjct  8     GSSSSLPPFLTKTYEMVDDSSSDSIVSWSQSNRSFIVWNPPEFSRDLLPRFFKHNNFSSF  67

Query  554   IRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-----AQPNSGVPLS  718
             IRQLNTYGFRK D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS     AQ N+   L+
Sbjct  68    IRQLNTYGFRKADPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSLPNLQAQQNA---LT  124

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             + ER+    +IERL +E   L  +L R+EQE      + + L  +LQ +++RQ+ + + V
Sbjct  125   DSERQRMSSQIERLTKEKEGLLQKLHRQEQERDVFEQQVKKLKDQLQHMEKRQKTMDSYV  184

Query  899   AQLSLKPDLLHHL-----EVHNKKRK-------------------PSVSNGHLELVNNLD  1006
             +Q+   P+L  +L     E + +KR+                    S S+     V  L+
Sbjct  185   SQVMETPELALNLSPCLPETNERKRRLPRMLEDNQACVVVREEGSTSASDETEHQVEELE  244

Query  1007  SSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGADG  1186
             SSI V + +++   +  E            +G          +  PE   L   H   D 
Sbjct  245   SSIAVWENLVSVSDDSCEGMAQ-------STGSMMILDVDDSSTCPESPPLSCIHLSIDT  297

Query  1187  NAKAAWNCAAVDVDRLKDRLEG-RSSTAAVPVVGGNDVFWQQFLTE  1321
               K+  +   +D++    + +   +     P  G NDVFWQQ LTE
Sbjct  298   CPKSPPSHKIIDINSDVSKEQNIVAPAPPPPATGVNDVFWQQLLTE  343



>emb|CBH32510.1| heat shock factor, putative, expressed [Triticum aestivum]
 emb|CDM84186.1| unnamed protein product [Triticum aestivum]
Length=441

 Score =   197 bits (501),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 152/397 (38%), Positives = 212/397 (53%), Gaps = 83/397 (21%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             M+G+ GGSAS  PFL KTYE+VD+ A  AVV+W+  G SFVV +  +F RDLLPKYFKHN
Sbjct  1     MEGS-GGSASLPPFLTKTYEMVDEPATDAVVAWTPSGTSFVVLSQADFCRDLLPKYFKHN  59

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
             NFSSF+RQLNTYGFRK+D EQWEFAN+EFIR Q H LKNIHRRKPI SHS+      PL+
Sbjct  60    NFSSFVRQLNTYGFRKVDPEQWEFANEEFIRDQRHRLKNIHRRKPIFSHSSHTQGAGPLA  119

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             + ERR+++EEIERLK +N+SL+++L+R++    +   + ++L+ +L +I+++Q+ +++ V
Sbjct  120   DSERRDYDEEIERLKCDNASLKLQLERKKT---DMESKMKALEDKLFAIEDQQKNLISYV  176

Query  899   AQLSLKP----DLLHHLEVHNKKR---KP------SVSNG----HLELVNN-----LDSS  1012
              ++   P      +   +   KKR   KP      + + G    H +LVN+       +S
Sbjct  177   REIVNAPGFFSSFVEQSDHQGKKRRLPKPISFHEDTSTQGNQIMHCDLVNSPTHELFRAS  236

Query  1013  ITVCQKILNGISN----GEEAYGN-----------------------FETLP--------  1087
                 +  LN + N      EA+GN                        E+ P        
Sbjct  237   FDKMESSLNSLENFFKEASEAFGNDVSYDGDVPGHSSAVVLTELHSSAESEPLHSSAESE  296

Query  1088  ---QAPS----------GDSRFSSPSTQTDT-PEISSLHTKHPGADGNAKAAWNCAAVDV  1225
                Q+P           GDS  S    ++ + PE   L   H  AD  AK     + +DV
Sbjct  297   PHEQSPPSMMHTCSAGVGDSHSSRDIAESASCPESPPLPEAHSRADSRAK----VSEIDV  352

Query  1226  DRLKDRLEGRSSTAAVPV----VGGNDVFWQQFLTEE  1324
             +      E   S    P        ND FWQQFLTE+
Sbjct  353   NLEPAVTETGPSRDQQPTQDPPADANDGFWQQFLTEQ  389



>gb|EPS63036.1| hypothetical protein M569_11750, partial [Genlisea aurea]
Length=260

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 143/205 (70%), Gaps = 4/205 (2%)
 Frame = +2

Query  359  MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
            MD     S S  PF+AKTYE+VDD +  ++VSWS    SFVVW+ P F+RDLLPK+FKH+
Sbjct  1    MDEAPSSSNSLPPFIAKTYEMVDDPSTDSIVSWSLSNTSFVVWDTPRFSRDLLPKFFKHS  60

Query  539  NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-AQPNSGVP-  712
            NFSSFIRQLNTYGFRK+D EQWEFAND+FIRGQ  LLKNIHRRKP+HSHS A P+S    
Sbjct  61   NFSSFIRQLNTYGFRKVDPEQWEFANDDFIRGQPLLLKNIHRRKPVHSHSTANPSSSSHL  120

Query  713  LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
            L+E ER+ +E+EI+RL  +  SL  EL  +++E  E      +L  R+Q+++     +L+
Sbjct  121  LTENERKRYEDEIQRLAHDKDSLHAELQTKKREQEELTVTMGTLMDRVQNVENNHANMLS  180

Query  893  LVAQLSLKP--DLLHHLEVHNKKRK  961
             +AQ   +P  D +   +V+ +KR+
Sbjct  181  CLAQTLRRPAVDFVSLSDVNYRKRR  205



>ref|XP_004298212.1| PREDICTED: heat stress transcription factor A-5-like [Fragaria 
vesca subsp. vesca]
Length=477

 Score =   197 bits (501),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 144/226 (64%), Gaps = 15/226 (7%)
 Frame = +2

Query  359  MDGT---QGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYF  529
            MDGT    GG   PAPFL KTY++VDD A   +VSWS   +SFVVWNPPEFAR LLP YF
Sbjct  1    MDGTAGGGGGGGGPAPFLLKTYDMVDDSATDEIVSWSSNKKSFVVWNPPEFARLLLPTYF  60

Query  530  KHNNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGV  709
            KHNNFSSFIRQLNTYGFRKID E+WEFAN+EFI+ Q HLLKNIHRRKPIHSHS    S V
Sbjct  61   KHNNFSSFIRQLNTYGFRKIDPERWEFANEEFIQDQKHLLKNIHRRKPIHSHSNPQGSMV  120

Query  710  PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
               + ER   ++EIE+L  E ++L   + R +Q+    + + + L  R+  +++RQ+ + 
Sbjct  121  ---DQERAALDDEIEKLSNEKAALEANISRFQQQRSAEKLQLEDLTQRVNGMEQRQKNLH  177

Query  890  ALVAQLSLKPDLLHHL---------EVHNKKRKPSVSNGHLELVNN  1000
              + +    P  + HL           +NKKR+  V+     +V N
Sbjct  178  TFLDKAVQNPFFVEHLARKIESMDFSAYNKKRRLPVAELSQPVVEN  223



>ref|XP_006349912.1| PREDICTED: heat stress transcription factor A-5-like [Solanum 
tuberosum]
Length=478

 Score =   197 bits (501),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 127/180 (71%), Gaps = 3/180 (2%)
 Frame = +2

Query  398  FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
            FL KTYE+VDD     +VSW+  G SFVVWNPPEFAR LLP YFKHNNFSSFIRQLNTYG
Sbjct  19   FLLKTYEMVDDSQTDDIVSWTPTGHSFVVWNPPEFARILLPTYFKHNNFSSFIRQLNTYG  78

Query  578  FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeier  757
            FRKID E+WEFAN+EF++ Q HLLKNIHRRKPIHSHS  P S V   +PER  FEEEI++
Sbjct  79   FRKIDPERWEFANEEFLKDQKHLLKNIHRRKPIHSHSHPPGSTV---DPERAAFEEEIDK  135

Query  758  LKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHHL  937
            L +E S L   + R  Q+    + + + L  R+ SI++RQ  +LA V +    PD +  L
Sbjct  136  LTREKSGLEANVSRFRQQQSAAKLQLEELTGRVGSIEQRQESLLAFVEKAIQNPDFVERL  195



>ref|XP_009612973.1| PREDICTED: heat stress transcription factor A-5 [Nicotiana tomentosiformis]
Length=477

 Score =   196 bits (499),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 128/180 (71%), Gaps = 3/180 (2%)
 Frame = +2

Query  398  FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
            FL KTYE+VDD     +VSW+  G SFVVWNPPEFAR LLP YFKHNNFSSFIRQLNTYG
Sbjct  19   FLLKTYEMVDDSQTDDIVSWTPTGHSFVVWNPPEFARILLPTYFKHNNFSSFIRQLNTYG  78

Query  578  FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeier  757
            FRKID E+WEFAN+EF++ Q HLLKNIHRRKPIHSHS  P S V   +PER  FEEEI++
Sbjct  79   FRKIDPERWEFANEEFMKDQKHLLKNIHRRKPIHSHSHPPGSTV---DPERAAFEEEIDK  135

Query  758  LKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHHL  937
            L +E S L   + R  Q++   + + + +  R+ SI++RQ  +L  V +  L PD +  L
Sbjct  136  LSREKSGLEANVLRFRQQHSTAKLQLEEMTVRVGSIEQRQESLLTFVEKAVLNPDFVERL  195



>ref|NP_001051938.1| Os03g0854500 [Oryza sativa Japonica Group]
 sp|Q84T61.1|HSFA1_ORYSJ RecName: Full=Heat stress transcription factor A-1; AltName: 
Full=Heat stress transcription factor 13; Short=OsHsf-13; AltName: 
Full=Heat stress transcription factor 3; Short=rHsf3 
[Oryza sativa Japonica Group]
 gb|AAO66547.1| putative heat shock transcription factor [Oryza sativa Japonica 
Group]
 gb|AAQ23057.1| heat shock factor RHSF3 [Oryza sativa Japonica Group]
 gb|ABF99963.1| Heat shock factor protein HSF8, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13852.1| Os03g0854500 [Oryza sativa Japonica Group]
 gb|ACJ54887.1| heat shock factor [Oryza sativa Japonica Group]
 dbj|BAG94601.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97582.1| unnamed protein product [Oryza sativa Japonica Group]
Length=506

 Score =   197 bits (501),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 111/242 (46%), Positives = 151/242 (62%), Gaps = 18/242 (7%)
 Frame = +2

Query  368   TQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFS  547
             + G + +P PFL KTYE+VDD A  AVVSW  G  SFVVWN PEFARDLLPKYFKH+NFS
Sbjct  28    SNGVATAPPPFLMKTYEMVDDPATDAVVSWGPGNNSFVVWNTPEFARDLLPKYFKHSNFS  87

Query  548   SFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-----AQPNSGVP  712
             SF+RQLNTYGFRK+D ++WEFAN+ F+RGQ HLLK I+RRKP H ++       P + VP
Sbjct  88    SFVRQLNTYGFRKVDPDRWEFANEGFLRGQKHLLKTINRRKPTHGNNQVQQPQLPAAPVP  147

Query  713   LSeperr-efeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVL  889
                   +   EEEIE LK++ + L  EL R  Q+ +    + Q+L  RLQ +++RQ+Q++
Sbjct  148   ACVEVGKFGMEEEIEMLKRDKNVLMQELVRLRQQQQTTDHQLQTLGKRLQGMEQRQQQMM  207

Query  890   ALVAQLSLKPDLL-----------HHLEVHNKKRKPSVSNGHLELVN-NLDSSITVCQKI  1033
             + +A+    P  L             +   NKKR+    +G L+  + +LD  I   Q +
Sbjct  208   SFLAKAMHSPGFLAQFVQQNENSRRRIVASNKKRRLPKQDGSLDSESASLDGQIVKYQPM  267

Query  1034  LN  1039
             +N
Sbjct  268   IN  269



>ref|XP_009373551.1| PREDICTED: heat stress transcription factor A-5 [Pyrus x bretschneideri]
 ref|XP_009373553.1| PREDICTED: heat stress transcription factor A-5 [Pyrus x bretschneideri]
Length=483

 Score =   196 bits (499),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 145/227 (64%), Gaps = 23/227 (10%)
 Frame = +2

Query  389   PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
             PAPFL KTY +VDD A   +VSWS   +SFVVWNPPEFAR LLP YFKHNNFSSFIRQLN
Sbjct  13    PAPFLLKTYNMVDDSATDEIVSWSSNKKSFVVWNPPEFARVLLPTYFKHNNFSSFIRQLN  72

Query  569   TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeee  748
             TYGFRK D E+WEFAN++FI+ Q HLLKNIHRRKPIHSHS    S V   +PER   ++E
Sbjct  73    TYGFRKSDPERWEFANEDFIQDQKHLLKNIHRRKPIHSHSNPQGSMV---DPERAALDDE  129

Query  749   ierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLL  928
             IE+L  + ++L   +   +Q+    + + ++L  R+  +++RQ+ +L  + +    P+ +
Sbjct  130   IEKLSNDKAALEASISTFKQQRSAAKLQLENLAQRVSGMEQRQKNLLTFLDEAVHNPNFI  189

Query  929   HHL---------EVHNKKRK--------PSVSNGHLELVNNLDSSIT  1018
              HL           +NKKR+        P V NG    V+N  SSI+
Sbjct  190   EHLSRKFESMDFSAYNKKRRLPDIENLQPVVENG---FVDNQSSSIS  233



>gb|EPS72622.1| hypothetical protein M569_02138, partial [Genlisea aurea]
Length=331

 Score =   192 bits (488),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 124/321 (39%), Positives = 176/321 (55%), Gaps = 25/321 (8%)
 Frame = +2

Query  389   PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
             PAPFL KTYE+VDD     +VSWS   +SFVVWNPPEFAR LLP YFKH+NFSSFIRQLN
Sbjct  14    PAPFLVKTYEMVDDSTTDDIVSWSGSRKSFVVWNPPEFARLLLPSYFKHSNFSSFIRQLN  73

Query  569   TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeee  748
             TYGF+KID E+WEFAN++F++GQ HLLK+IHRRKPIHSHSA  +   P    ER  F EE
Sbjct  74    TYGFKKIDPERWEFANEDFVQGQKHLLKHIHRRKPIHSHSAVSSVVDP----ERVAFHEE  129

Query  749   ierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA----------LV  898
             I++L ++ + L+  L R ++     R + ++L+ R+  ++++Q  +L+           V
Sbjct  130   IDKLSKQKTVLQGNLARYKESQSTARLQLETLNQRISFMEQKQEHLLSFLEKAVQNPGFV  189

Query  899   AQLSLKPDLLHHLEVHNKKRKPSVSNGHLELVNNLDSSITVCQKILNGISNGEEAYGNFE  1078
              QL+ K + +  L  + K+R P   +   +          +C  +   +S+      N E
Sbjct  190   EQLTQKLESMEFLVYNKKRRIPQADDPPQQ---------DLCNTLTLELSDSGSDINNNE  240

Query  1079  TLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRS  1258
                 APS      +  +                   N   A   ++V+  +  + +E  S
Sbjct  241   DGRAAPSDSGASFNLHSVESQESDEEEEDDRVSCLLNLTLA--SSSVEPTKTHNPMESSS  298

Query  1259  STAAVPVVGGNDVFWQQFLTE  1321
                  P +  NDVFW+QFLTE
Sbjct  299   PPPPPPPLRVNDVFWEQFLTE  319



>ref|XP_003524927.1| PREDICTED: heat stress transcription factor A-5-like isoform 
X1 [Glycine max]
 ref|XP_006580147.1| PREDICTED: heat stress transcription factor A-5-like isoform 
X2 [Glycine max]
Length=479

 Score =   196 bits (498),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 139/215 (65%), Gaps = 14/215 (7%)
 Frame = +2

Query  359  MDGT--QGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFK  532
            MDG     G+  PAPFL KTY++VDD + + +VSWS    SFVVWNPPEFAR LLP YFK
Sbjct  1    MDGAPQSAGAGGPAPFLLKTYDMVDDASTNDIVSWSSTNNSFVVWNPPEFARLLLPTYFK  60

Query  533  HNNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVP  712
            HNNFSSFIRQLNTYGFRKI  E+WEFANDEF++ Q HLLKNI+RRKPIHSHS  P S   
Sbjct  61   HNNFSSFIRQLNTYGFRKIHPERWEFANDEFLKDQKHLLKNIYRRKPIHSHSHPPGS---  117

Query  713  LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
            L +PER  FEEEI++L +E +SL   +   +Q     + + +    RL  I++RQ+Q+L 
Sbjct  118  LVDPERAAFEEEIDKLSREKTSLESNIYNFKQHQSTAKPKLEDFLQRLDGIEQRQKQLLN  177

Query  893  LVAQLSLKPDLLHH---------LEVHNKKRKPSV  970
               +    P  + H         L  + K+R P V
Sbjct  178  FFEKALQNPTFVEHLSRKIESMDLSAYKKRRLPQV  212



>ref|XP_010943416.1| PREDICTED: heat stress transcription factor A-1-like [Elaeis 
guineensis]
Length=507

 Score =   197 bits (500),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 110/235 (47%), Positives = 144/235 (61%), Gaps = 29/235 (12%)
 Frame = +2

Query  359  MDGTQGGSASPA------------PFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEF  502
            MD   GG  SPA            PFL+KTY++VDD A  A+VSW  G  SFVVWN PEF
Sbjct  1    MDAVAGGEGSPAGANAGLGGNAPPPFLSKTYDMVDDPATDAIVSWGPGNNSFVVWNTPEF  60

Query  503  ARDLLPKYFKHNNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHS  682
            ARDLLPKYFKHNNFSSF+RQLNTYGFRK+D ++WEFAN+ F+RGQ HLLK I+RRKP  +
Sbjct  61   ARDLLPKYFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGQKHLLKTINRRKPAQT  120

Query  683  H------SAQPNSGVPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSL  844
            H       AQ  +     E  +   EEEIERLK++ + L  EL R  Q+ +    +F +L
Sbjct  121  HRQSQQSQAQDTNVAACVEVGKFGLEEEIERLKRDKNVLMQELVRLRQQQQATDNQFHTL  180

Query  845  DSRLQSIDERQRQVLALVAQLSLKPDLLHHL-----------EVHNKKRKPSVSN  976
              RLQ +++RQ+Q+++ +A+    P+ L               V+ K+R P+  N
Sbjct  181  GQRLQGMEQRQQQMMSFLAKAMQSPEFLAQFVQQNDNNRRIAGVNKKRRSPAQDN  235



>ref|XP_002867969.1| AT-HSFA4A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44228.1| AT-HSFA4A [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   194 bits (493),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 144/346 (42%), Positives = 201/346 (58%), Gaps = 34/346 (10%)
 Frame = +2

Query  374   GGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSF  553
             G S+S  PFL KTYE+VDD ++ ++VSWS+  +SF+VWNPPEF+RDLLP++FKHNNFSSF
Sbjct  8     GTSSSLPPFLTKTYEMVDDSSSDSIVSWSQSNKSFIVWNPPEFSRDLLPRFFKHNNFSSF  67

Query  554   IRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-----AQPNSGVPLS  718
             IRQLNTYGFRK D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS     AQ N   PL+
Sbjct  68    IRQLNTYGFRKADPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSLPNLQAQQN---PLT  124

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             + ER     +IERL +E   L  EL ++++E      + + L  RLQ +++RQ+ +++ V
Sbjct  125   DSERLRMNNQIERLTKEKEGLLEELQKQDEEREVFERQVKELKERLQHMEKRQKTMVSFV  184

Query  899   AQLSLKPDLLHHL-----EVHNKKRK-PSV----------SNGHLELVNNLDSSITVCQK  1030
             +Q+  KP L  +L     E + +KR+ P +           N    +V    S+      
Sbjct  185   SQVLEKPGLALNLSPCVPETNERKRRFPRIGFFPDEPMLEDNQTCVVVREEGSTSPSSHT  244

Query  1031  ILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQT-DTPEISSLHTKHP------GADGN  1189
               + +   E + G +E L  + S +S   S S  T D  E S+     P        D  
Sbjct  245   TEHQVEQLESSIGIWENL-VSDSCESMLQSRSMMTLDVDESSTCPQSPPLSCIQLSIDTR  303

Query  1190  AKAAWNCAAVDVDRLKD--RLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
              K+  +   +D++   D  + +   + A  PV G NDVFWQQF TE
Sbjct  304   PKSPPSQRIIDMNSEPDFSKEQNTVAAAPPPVAGANDVFWQQFFTE  349



>gb|AEB26589.1| heat shock factor A4b [Hordeum vulgare subsp. vulgare]
Length=180

 Score =   187 bits (474),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 134/173 (77%), Gaps = 12/173 (7%)
 Frame = +2

Query  359  MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
            M+G+ GGS+S  PFL KTYE+VD+ A  AVV+W+  G SFVV++  +F RDLLPKYFKHN
Sbjct  1    MEGS-GGSSSLPPFLIKTYEMVDEPATDAVVAWTPSGTSFVVFSQADFCRDLLPKYFKHN  59

Query  539  NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
            NFSSF+RQLNTYGFRK+D EQWEFAN+EFIR Q H LKNIHRRKPI SHS+      PL+
Sbjct  60   NFSSFVRQLNTYGFRKVDPEQWEFANEEFIRDQRHRLKNIHRRKPIFSHSSHTQGAGPLA  119

Query  719  eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQ  877
            + ERR++EEEIERLK EN+SL ++L+R++ +          +DS+++++ ERQ
Sbjct  120  DSERRDYEEEIERLKCENASLNLQLERKKTD----------MDSKMKAL-ERQ  161



>ref|XP_010276853.1| PREDICTED: heat shock factor protein HSF8 [Nelumbo nucifera]
 ref|XP_010276854.1| PREDICTED: heat shock factor protein HSF8 [Nelumbo nucifera]
 ref|XP_010276855.1| PREDICTED: heat shock factor protein HSF8 [Nelumbo nucifera]
 ref|XP_010276856.1| PREDICTED: heat shock factor protein HSF8 [Nelumbo nucifera]
 ref|XP_010276857.1| PREDICTED: heat shock factor protein HSF8 [Nelumbo nucifera]
 ref|XP_010276858.1| PREDICTED: heat shock factor protein HSF8 [Nelumbo nucifera]
Length=496

 Score =   196 bits (497),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 134/188 (71%), Gaps = 4/188 (2%)
 Frame = +2

Query  386  SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQL  565
            +P PFL+KTY++VDD + +++VSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+RQL
Sbjct  21   APPPFLSKTYDMVDDPSTNSIVSWSPSNNSFVVWNPPEFARDLLPKYFKHNNFSSFVRQL  80

Query  566  NTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQP----NSGVPLSeperr  733
            NTYGFRK+D ++WEFAN+ F+RGQ HLLK+I+RRKP H H  QP     S     E  + 
Sbjct  81   NTYGFRKVDPDRWEFANEGFLRGQKHLLKSINRRKPAHVHHQQPQGQSTSVGACVEVGKF  140

Query  734  efeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSL  913
              EEE+ERLK++ + L  EL R  Q+ +    + Q++  RLQ +++RQ+Q+++ +A+   
Sbjct  141  GLEEEVERLKRDKNVLMQELVRLRQQQQATDHQLQTMGQRLQGMEQRQQQMMSFLAKAMQ  200

Query  914  KPDLLHHL  937
             P  L  L
Sbjct  201  SPGFLAQL  208



>ref|XP_008340741.1| PREDICTED: heat stress transcription factor A-1d [Malus domestica]
Length=516

 Score =   196 bits (498),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/238 (47%), Positives = 146/238 (61%), Gaps = 18/238 (8%)
 Frame = +2

Query  380   SASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIR  559
             S +P PFL+KTY++VDD A   VVSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+R
Sbjct  37    SNAPPPFLSKTYDMVDDPATDPVVSWSPTNNSFVVWNPPEFARDLLPKYFKHNNFSSFVR  96

Query  560   QLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ-------PNSGVPLS  718
             QLNTYGFRKID ++WEFAN+ F+RG+ HLLK+I+RRKP H HS Q        NS     
Sbjct  97    QLNTYGFRKIDPDRWEFANEGFLRGKKHLLKSINRRKPTHGHSHQQQQPSHGQNSMGACV  156

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             E  +   EEE+ERLK++ + L  EL R  Q+ +    + Q++  RLQ +++RQ+Q+++ +
Sbjct  157   EVGKFGLEEEVERLKRDKNVLMQELIRLRQQQQSTDNQLQTMVQRLQGMEQRQQQMMSFL  216

Query  899   AQLSLKPDLLHHL-----------EVHNKKRKPSVSNGHLELVNNLDSSITVCQKILN  1039
             A+    PD                EV+ K+R         E  N  D  I   Q  +N
Sbjct  217   AKAMHSPDFFTQFVQKNESNRRITEVNKKRRLKREGVAERECSNAPDGQIVKYQPPMN  274



>ref|XP_004300222.1| PREDICTED: heat shock factor protein HSF8-like [Fragaria vesca 
subsp. vesca]
Length=508

 Score =   196 bits (498),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 133/194 (69%), Gaps = 8/194 (4%)
 Frame = +2

Query  380  SASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIR  559
            S +P PFL+KTY++VDD A   +VSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+R
Sbjct  33   SNAPPPFLSKTYDMVDDPATDPIVSWSPTNNSFVVWNPPEFARDLLPKYFKHNNFSSFVR  92

Query  560  QLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ--------PNSGVPL  715
            QLNTYGFRK+D ++WEFAN+ F+RGQ HLLK+I+RRKP H HS Q         NS    
Sbjct  93   QLNTYGFRKVDPDRWEFANEGFLRGQKHLLKSINRRKPAHGHSLQQPQQPSHGQNSVAAC  152

Query  716  SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
             E  +   EEE+E LK++ + L  EL R  Q+ +    + Q++  RLQ +++RQ+Q+++ 
Sbjct  153  VEVGKFGLEEEVEMLKRDKNVLMQELIRLRQQQQSTDNQLQTMVQRLQGMEQRQQQMMSF  212

Query  896  VAQLSLKPDLLHHL  937
            +A+    P  L+  
Sbjct  213  LAKAVQSPGFLNQF  226



>ref|XP_009783144.1| PREDICTED: heat stress transcription factor A-5 [Nicotiana sylvestris]
Length=478

 Score =   195 bits (496),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 126/180 (70%), Gaps = 3/180 (2%)
 Frame = +2

Query  398  FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
            FL KTYE+VDD     +VSW+  G SFVVWNPPEFAR LLP YFKHNNFSSFIRQLNTYG
Sbjct  20   FLLKTYEMVDDSQTDDIVSWTPTGHSFVVWNPPEFARILLPTYFKHNNFSSFIRQLNTYG  79

Query  578  FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeier  757
            FRKID E+WEFAN+EF++ Q HLLKNIHRRKPIHSHS  P S V   +PER  FEEEI++
Sbjct  80   FRKIDPERWEFANEEFVKDQKHLLKNIHRRKPIHSHSHPPGSTV---DPERAAFEEEIDK  136

Query  758  LKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHHL  937
            L +E S L   + R  Q+    + + + +  R+  I++RQ  +L  V +  L PD +  L
Sbjct  137  LSREKSGLEANVLRFRQQQSAAKLQLEEMTERVGGIEQRQESLLTFVEKAVLNPDFVERL  196



>emb|CDX78902.1| BnaA01g09690D [Brassica napus]
Length=517

 Score =   196 bits (498),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 138/346 (40%), Positives = 194/346 (56%), Gaps = 40/346 (12%)
 Frame = +2

Query  374   GGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSF  553
             G S+S  PFL KTYE+VDD ++ ++VSWS+  RSF+VWNPPEF+RDLLP++FKHNNFSSF
Sbjct  8     GSSSSLPPFLTKTYEMVDDSSSDSIVSWSQSNRSFIVWNPPEFSRDLLPRFFKHNNFSSF  67

Query  554   IRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-----AQPNSGVPLS  718
             IRQLNTYGFRK D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS     AQ N+   L+
Sbjct  68    IRQLNTYGFRKADPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSLPNLQAQQNA---LT  124

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             + ER+    +IERL +E   L  +L R+EQE      + + L  +LQ +++RQ+ + + V
Sbjct  125   DSERQRMSSQIERLTKEKEGLLQKLHRQEQERDVFEQQVKKLKDQLQHMEKRQKTMDSYV  184

Query  899   AQLSLKPDLLHHL-----EVHNKKRK-------------------PSVSNGHLELVNNLD  1006
             +Q+   P+L  +L     E + +KR+                    S S+     V  L+
Sbjct  185   SQVMETPELALNLSPCLPETNERKRRLPRMLEDNQACVVVREEGSTSASDETEHQVEELE  244

Query  1007  SSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGADG  1186
             SSI V + +++   +  E            +G          +  PE   L   H   D 
Sbjct  245   SSIAVWENLVSVSDDSCEGMAQ-------STGSMMILDVDDSSTCPESPPLSCIHLSIDT  297

Query  1187  NAKAAWNCAAVDVDRLKDRLEG-RSSTAAVPVVGGNDVFWQQFLTE  1321
               K+  +   +D++    + +   +     P  G NDVFWQQ LTE
Sbjct  298   CPKSPPSHKIIDINSDVSKEQNIVAPAPPPPATGVNDVFWQQLLTE  343



>ref|XP_008813276.1| PREDICTED: heat stress transcription factor A-5-like [Phoenix 
dactylifera]
Length=469

 Score =   194 bits (493),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 121/278 (44%), Positives = 161/278 (58%), Gaps = 21/278 (8%)
 Frame = +2

Query  389   PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
             PAPFL KTY++VDD +   +VSW     SFVVWNPP+F+  LLP YFKHNNFSSFIRQLN
Sbjct  10    PAPFLLKTYDMVDDSSTDDIVSWGPAKTSFVVWNPPDFSARLLPAYFKHNNFSSFIRQLN  69

Query  569   TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeee  748
             TYGFRKID E+WEFAN++FI+GQ HLLKNIHRRKPIHSHS  P S   L + ER   EEE
Sbjct  70    TYGFRKIDPERWEFANEDFIKGQKHLLKNIHRRKPIHSHSHPPGS---LVDSERAALEEE  126

Query  749   ierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLL  928
             IERL +E ++L+ +L R +Q+    + +   L+ RL  +++RQ +++A + +   KP  +
Sbjct  127   IERLTRERAALQADLYRFKQQQTGTKIQLDDLERRLVEMEQRQLKMIAFLQRAVQKPRFV  186

Query  929   HHL--------------EVHNKKRKPSVSNGHLELVNNL--DSSITVCQKILNGISNGEE  1060
              +L               +H K+R P          N+L  D S T    I +G      
Sbjct  187   ENLAKMVTSSSLSVDFKAIHKKRRLPGTGYCQEAPENSLYDDHSSTSKPDIGHGFHTDFC  246

Query  1061  AYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHP  1174
                  E  P    G+    + S+Q+   +  S H K P
Sbjct  247   HKLKLELCPAISDGN--LVTVSSQSSHEDNGSPHMKQP  282



>ref|XP_008238205.1| PREDICTED: heat shock factor protein HSF8 [Prunus mume]
Length=514

 Score =   195 bits (495),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 141/212 (67%), Gaps = 19/212 (9%)
 Frame = +2

Query  380  SASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIR  559
            S +P PFL+KTY++VDD A   VVSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+R
Sbjct  33   SNAPPPFLSKTYDMVDDPATDQVVSWSPTNNSFVVWNPPEFARDLLPKYFKHNNFSSFVR  92

Query  560  QLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS---AQP----NSGVPLS  718
            QLNTYGFRK+D ++WEFAN+ F+RGQ HLLK+I+RRKP H HS    QP    NS     
Sbjct  93   QLNTYGFRKVDPDRWEFANEGFLRGQKHLLKSINRRKPAHGHSHQQPQPSQGQNSVAACV  152

Query  719  eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
            E  +   EEE+ERLK++ + L  EL +  Q+ +    + Q++  RLQ +++RQ+Q+++ +
Sbjct  153  EVGKFGLEEEVERLKRDKNVLMQELIKLRQQQQSTDNQLQAMVQRLQGMEQRQQQMMSFL  212

Query  899  AQLSLKPDLLHH------------LEVHNKKR  958
            A+    P  L              +EV+ K+R
Sbjct  213  AKAVQSPSFLTQFVQQQNESNRRIIEVNKKRR  244



>gb|EPS68530.1| hypothetical protein M569_06240, partial [Genlisea aurea]
Length=160

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 116/153 (76%), Gaps = 6/153 (4%)
 Frame = +2

Query  359  MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
            MDG+ G S SPAPFL+KTYE+VDD     +VSWS+ G SFVVWNPPE AR LLPKYFKHN
Sbjct  1    MDGSNGSSNSPAPFLSKTYEMVDDPLTCRIVSWSQSGLSFVVWNPPELARVLLPKYFKHN  60

Query  539  NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
            NFSSFIRQLNTYGFRK+  EQWEFAN+ F RG   LLKNI RRKP+HSHS         +
Sbjct  61   NFSSFIRQLNTYGFRKVVPEQWEFANEGFFRGGRSLLKNIRRRKPVHSHSG------AFT  114

Query  719  eperrefeeeierLKQENSSLRVELDRREQENR  817
            + ER  FE+EIERLK+E +SL+ E+++   ENR
Sbjct  115  DSERDVFEKEIERLKREKNSLQSEVEKYRHENR  147



>ref|XP_004504369.1| PREDICTED: heat stress transcription factor A-5-like [Cicer arietinum]
Length=482

 Score =   194 bits (493),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 133/207 (64%), Gaps = 12/207 (6%)
 Frame = +2

Query  368  TQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFS  547
            +   +  PAPFL KTY++VDD     +VSWS    SFVVW+PPEFAR LLP YFKHNNFS
Sbjct  8    STAATGGPAPFLLKTYDMVDDSGTDEIVSWSSTNNSFVVWDPPEFARVLLPTYFKHNNFS  67

Query  548  SFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSepe  727
            SFIRQLNTYGFRKI  E+WEF NDEFI+ Q HLLKNIHRRKPIHSHS  P S   +++PE
Sbjct  68   SFIRQLNTYGFRKIHPERWEFGNDEFIKDQKHLLKNIHRRKPIHSHSHPPGS---VADPE  124

Query  728  rrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQL  907
            R  FEEEIE+L +E +SL   L   +Q     + + +    RL  +++RQ  +L+   Q 
Sbjct  125  RAAFEEEIEKLSREKNSLESNLFNYKQNQSTAKLQLEDFQQRLDGMEKRQTNLLSFFEQA  184

Query  908  SLKPDLLHHLE---------VHNKKRK  961
               P  + HL           +NKKR+
Sbjct  185  LQNPSFVEHLSRKIESMDLAAYNKKRR  211



>ref|XP_007146362.1| hypothetical protein PHAVU_006G034200g [Phaseolus vulgaris]
 gb|ESW18356.1| hypothetical protein PHAVU_006G034200g [Phaseolus vulgaris]
Length=487

 Score =   194 bits (492),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 133/204 (65%), Gaps = 13/204 (6%)
 Frame = +2

Query  395  PFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTY  574
            PFL KTY++VDD + S +VSWS    SFVVWNPPEFAR LLP YFKHNNFSSFIRQLNTY
Sbjct  20   PFLLKTYDMVDDSSTSDIVSWSSSNTSFVVWNPPEFARLLLPTYFKHNNFSSFIRQLNTY  79

Query  575  GFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeie  754
            GFRKI  E+WEFAN+EF++GQ HLLKNIHRRKPIHSHS  P + V   +PER  FEEEIE
Sbjct  80   GFRKIHPERWEFANEEFVKGQKHLLKNIHRRKPIHSHSHPPGTIV---DPERAAFEEEIE  136

Query  755  rLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHH  934
            +L  E SSL   +    Q     + + +    RL   ++RQ+Q+L    +    P  + H
Sbjct  137  KLSNEKSSLESNIHNFRQHQSTAKLQLEDFLQRLDGTEKRQKQLLNFFEKALQNPSFVEH  196

Query  935  ---------LEVHNKKRK-PSVSN  976
                     L  +NKKR+ P V N
Sbjct  197  LSRKIESMDLSAYNKKRRLPQVDN  220



>ref|XP_011003631.1| PREDICTED: heat stress transcription factor A-5-like [Populus 
euphratica]
Length=489

 Score =   194 bits (492),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 132/183 (72%), Gaps = 3/183 (2%)
 Frame = +2

Query  389  PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
            PAPFL KTY++VDD +   +VSWS    SFVVWNPPEFAR LLP +FKHNNFSSFIRQLN
Sbjct  19   PAPFLVKTYDMVDDSSTDEIVSWSSNKNSFVVWNPPEFARLLLPTFFKHNNFSSFIRQLN  78

Query  569  TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeee  748
            TYGFRKID E+WEFAN++F++ Q HLLKNIHRRKPIHSHS QP     L +PER  +EEE
Sbjct  79   TYGFRKIDPERWEFANEDFVKDQKHLLKNIHRRKPIHSHS-QPQGS--LVDPERAAYEEE  135

Query  749  ierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLL  928
            IE+L ++ + L+  + R EQ+    + + + L  ++ ++ +RQ ++L+ + +    P  +
Sbjct  136  IEKLARDKAKLKASILRFEQQRSSAKLQVEDLTQKIDTMQQRQEKLLSFLEKAVQNPTFV  195

Query  929  HHL  937
             HL
Sbjct  196  EHL  198



>gb|KDO77936.1| hypothetical protein CISIN_1g015635mg [Citrus sinensis]
Length=362

 Score =   190 bits (483),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 136/368 (37%), Positives = 187/368 (51%), Gaps = 76/368 (21%)
 Frame = +2

Query  497   EFARDLLPKYFKHNNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPI  676
             +FARDLLPKYFKHNNFSSFIRQLNTYGFRK+D EQWEFAN++F+RGQ   LKNIHRRKP+
Sbjct  6     DFARDLLPKYFKHNNFSSFIRQLNTYGFRKVDPEQWEFANEDFVRGQPERLKNIHRRKPV  65

Query  677   HSHSAQP--NSGVPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDS  850
             HSHS Q     G PL+E ER+  +++IERLK+E   L +EL R EQE +    + Q L  
Sbjct  66    HSHSNQNLHGQGTPLTESERQGLKDDIERLKKEKEILLLELQRHEQERQGFESQMQLLRE  125

Query  851   RLQSIDERQRQVLALVAQLSLKPDLLH----HLEVHNKKRK-------------------  961
             R Q +++RQ+++++ V +   KP L      HLE H++KR+                   
Sbjct  126   RFQLMEQRQQKMVSFVGRALQKPGLESNFGAHLENHDRKRRLPRIDYFYDEANIEDNPMG  185

Query  962   ----------PSVSNGHLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSR  1111
                         +S+ ++E    L+SS+T  + I+  +  G+  +         P+    
Sbjct  186   TSQIVAGADSADISSSNMEKFEQLESSMTFWENIVQDV--GQSCF--------QPNSSLE  235

Query  1112  FSSPSTQTDTPEISSLH------TKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAV  1273
                 ++  D+P IS +        K PG D N++ A   A   V       E  ++T   
Sbjct  236   LDESTSCADSPAISCIQLNVDARPKSPGIDMNSEPAVTAATEPV----PSKEPETATTIP  291

Query  1274  PVVGGNDVFWQQFLTEEVeserreigirngreC---------------------MIVFAE  1390
                G NDVFW+QFLTE   S   +      +EC                     +   AE
Sbjct  292   LQAGVNDVFWEQFLTENPGSSDAQEVQSERKECDGKKNENKPADHGKFWWNMRNVNSLAE  351

Query  1391  QMGHFTPA  1414
             QMGH TPA
Sbjct  352   QMGHLTPA  359



>ref|XP_002265319.2| PREDICTED: heat stress transcription factor A-5 [Vitis vinifera]
Length=488

 Score =   194 bits (492),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 123/275 (45%), Positives = 167/275 (61%), Gaps = 29/275 (11%)
 Frame = +2

Query  395   PFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTY  574
             PFL KTYE+VDD +   +VSWS    SFVVWNPPEFAR LLP YFKHNNFSSFIRQLNTY
Sbjct  20    PFLLKTYEMVDDSSTDEIVSWSSTKSSFVVWNPPEFARVLLPMYFKHNNFSSFIRQLNTY  79

Query  575   GFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeie  754
             GFRK D E+WEFAN++F++ Q HLLKNIHRRKPIHSHS  P    P ++ ER  F+EEIE
Sbjct  80    GFRKSDPERWEFANEDFVKDQKHLLKNIHRRKPIHSHS-HPQG--PPADSERAAFDEEIE  136

Query  755   rLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHH  934
             RL +E + L++++  + +E +  + + + L  R+  +++RQ ++L  + +    P  + H
Sbjct  137   RLSREKTELQLKV-YKVKEQQSAKLQLEDLTQRVSGMEQRQEKLLTFLEKAVQNPTFVKH  195

Query  935   L---------EVHNKKRK-PSVSNGHLE------LVNNLDSSITVCQKILNGISNGEEAY  1066
             L           +NKKR+ P V   HL+      L++N  SS T C  I +      + +
Sbjct  196   LAQKIESMDFSAYNKKRRLPQV--DHLQPVAENSLLDNYSSSRTECGSIFH------KDF  247

Query  1067  GNFETLPQAPSG-DSRFSSPSTQTDTPEISSLHTK  1168
              N   L  +P+  D    S STQ+   +  S H K
Sbjct  248   SNKLKLELSPAASDINLLSQSTQSSNEDAGSPHMK  282



>ref|XP_010913096.1| PREDICTED: heat stress transcription factor A-5-like [Elaeis 
guineensis]
 ref|XP_010913097.1| PREDICTED: heat stress transcription factor A-5-like [Elaeis 
guineensis]
 ref|XP_010913099.1| PREDICTED: heat stress transcription factor A-5-like [Elaeis 
guineensis]
 ref|XP_010913100.1| PREDICTED: heat stress transcription factor A-5-like [Elaeis 
guineensis]
Length=478

 Score =   193 bits (490),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 117/276 (42%), Positives = 161/276 (58%), Gaps = 20/276 (7%)
 Frame = +2

Query  389   PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
             PAPFL KTY++VDD +   +VSWS    SF+VWN P+FA  LLP YFKHNNFSSFIRQLN
Sbjct  22    PAPFLLKTYDMVDDSSTDDIVSWSPAKNSFIVWNHPDFAARLLPTYFKHNNFSSFIRQLN  81

Query  569   TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeee  748
             TYGFRKID E+WEFAN++F++GQ HLLKNIHRRKPIHSHS  P S   L+  ER   EEE
Sbjct  82    TYGFRKIDPERWEFANEDFVKGQKHLLKNIHRRKPIHSHSHPPGS---LAYSERAALEEE  138

Query  749   ierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLL  928
             IERL +E ++L+ +L R  Q+    + +   L+ RL  +++RQ +++A + +    P  +
Sbjct  139   IERLAREKAALQADLWRFRQQQPGTKIQLDDLERRLAEMEQRQHKMIAFLQRALQNPRFV  198

Query  929   HHLE------------VHNKKRKPSVSNGHLELVNNL--DSSITVCQKILNGISNGEEAY  1066
              +L             +H K+R P + +      N+   D S T    + +G       +
Sbjct  199   ENLRKMAVSSSVDFSAIHKKRRLPEMESCQEAPENSFYDDHSSTSKSDVGHGFHMD---F  255

Query  1067  GNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHP  1174
              +   L   P+      + STQ+   +  S H K P
Sbjct  256   CDKLKLELCPAISDNLVAASTQSSNEDNGSPHMKQP  291



>gb|EYU32713.1| hypothetical protein MIMGU_mgv1a006911mg [Erythranthe guttata]
Length=426

 Score =   192 bits (487),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 149/225 (66%), Gaps = 16/225 (7%)
 Frame = +2

Query  398   FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
             FL KTYE+VDD A  A+VSWS   +SFVVWNPPEFAR LLP YFKHNNFSSFIRQLNTYG
Sbjct  18    FLLKTYEMVDDTATDAIVSWSASRKSFVVWNPPEFARVLLPSYFKHNNFSSFIRQLNTYG  77

Query  578   FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeier  757
             FRKID E+WEFAN++F + Q HLLKNIHRRKPIHSHS QP   V   + ER  FEEEI++
Sbjct  78    FRKIDPEKWEFANEDFTKDQKHLLKNIHRRKPIHSHS-QPQGSV---DSERASFEEEIDK  133

Query  758   LKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHHL  937
             L ++ S L  +L   +++    + + ++L  R+ S+++RQ ++L+ + +    PD +  L
Sbjct  134   LSRDKSVLEGKLSGYKEQQSAAKSQLETLTPRIVSMEQRQEKLLSFLEKAVQNPDFVDRL  193

Query  938   ---------EVHNKKRKPSVSNGHLELVNNL---DSSITVCQKIL  1036
                       V+NKKR+   S+    + +NL   D   ++C + L
Sbjct  194   TQKLESMDFSVYNKKRRLPQSDHVQSIQDNLLLDDQLGSICDQDL  238



>gb|KHG05169.1| Heat shock factor HSF8 [Gossypium arboreum]
Length=515

 Score =   194 bits (492),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 109/249 (44%), Positives = 152/249 (61%), Gaps = 27/249 (11%)
 Frame = +2

Query  386   SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQL  565
             +P PFL+KTY++VDD A  A+VSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+RQL
Sbjct  41    TPPPFLSKTYDMVDDPATDAIVSWSPSNNSFVVWNPPEFARDLLPKYFKHNNFSSFVRQL  100

Query  566   NTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS--------AQPNSGVPLSe  721
             NTYGFRK+D ++WEFAN+ F+RGQ HLL+NI RRKP H H          Q +S     E
Sbjct  101   NTYGFRKVDPDRWEFANEGFLRGQKHLLRNISRRKPAHGHGHQQTQQSHGQSSSVGACVE  160

Query  722   perrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVA  901
               +   EEE+ERLK++ + L  EL R  Q+ +    + Q++  RLQ +++RQ+Q+++ +A
Sbjct  161   VGKFGLEEEVERLKRDKNVLMQELVRLRQQQQATDNQLQAMVQRLQGMEQRQQQMMSFLA  220

Query  902   QLSLKPDLLHH-----------LEVHNKKRK--------PSVSNGHLELVNNLDSSITVC  1024
             +    P  L             +   NKKR+         + S+G +     L+ +  + 
Sbjct  221   KAMQSPGFLAQFVQQQNESNRRISEANKKRRLKQDGNDTSAASDGQIIKYQPLNEAKEML  280

Query  1025  QKILNGISN  1051
              +I+ G S+
Sbjct  281   MQIMKGDSS  289



>gb|KDP39324.1| hypothetical protein JCGZ_01081 [Jatropha curcas]
Length=495

 Score =   193 bits (491),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 122/280 (44%), Positives = 168/280 (60%), Gaps = 24/280 (9%)
 Frame = +2

Query  389   PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
             PAPFL KTY++VDD +   +VSWS    SFVVWNPPEFAR LLP YFKHNNFSSFIRQLN
Sbjct  23    PAPFLLKTYDMVDDSSTDEIVSWSSSKNSFVVWNPPEFARVLLPTYFKHNNFSSFIRQLN  82

Query  569   TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeee  748
             TYGFRKID E+WEFAN++F++ Q HLLKNIHRRKPIHSHS    S   L +PER  F+ E
Sbjct  83    TYGFRKIDPEKWEFANEDFVKDQKHLLKNIHRRKPIHSHSHPHGS---LVDPERAAFDVE  139

Query  749   ierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLL  928
             I+RL +E ++L   +   + +    + + + L  R+ S+++RQ ++LAL+ +    P  +
Sbjct  140   IDRLAREKATLEESVVGSKHQRSAEKLQLEDLTQRVNSMEQRQEKLLALLEKAVQNPTFI  199

Query  929   HHL---------EVHNKKRK-PSV----SNGHLELVNNLDSSITVCQKILNGISNGEEAY  1066
              HL           ++KKR+ P V    SN     V+N  +S +    +++      + +
Sbjct  200   EHLARKIDSMDFSAYSKKRRLPQVDHSKSNAENSFVDNQSNSRSEFGNVIH------QDF  253

Query  1067  GNFETLPQAPS-GDSRFSSPSTQTDTPEISSLHTKHPGAD  1183
              N   L  +P+  D    S STQ+   ++ S   K  G D
Sbjct  254   SNKLRLELSPAVSDINLVSNSTQSSNEDMGSPQRKASGGD  293



>ref|XP_010245198.1| PREDICTED: heat stress transcription factor A-1 [Nelumbo nucifera]
Length=510

 Score =   194 bits (492),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 132/189 (70%), Gaps = 5/189 (3%)
 Frame = +2

Query  386  SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQL  565
            +P PFL+KTY++VDD + +++VSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+RQL
Sbjct  21   APPPFLSKTYDMVDDPSTNSIVSWSPSNNSFVVWNPPEFARDLLPKYFKHNNFSSFVRQL  80

Query  566  NTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperref--  739
            NTYGFRK+D ++WEFAN+ F+RGQ HLLK I+RRKP H H  Q   G   S     E   
Sbjct  81   NTYGFRKVDPDRWEFANEGFLRGQKHLLKTINRRKPSHIHHQQQPQGQNSSVAACVEVGK  140

Query  740  ---eeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLS  910
               EEE+ERLK++ + L  EL R  Q+ +    + Q++  RLQ +++RQ+Q+++ +A+  
Sbjct  141  FGLEEEVERLKRDKNVLMQELVRLRQQQQATDHQLQTMGQRLQGMEQRQQQMMSFLAKAV  200

Query  911  LKPDLLHHL  937
              P  L  L
Sbjct  201  QSPGFLAQL  209



>ref|XP_010908496.1| PREDICTED: heat stress transcription factor A-1 [Elaeis guineensis]
Length=511

 Score =   193 bits (491),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 135/197 (69%), Gaps = 6/197 (3%)
 Frame = +2

Query  377  GSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFI  556
            G  +P PFL+KTYE+VDD A  A+VSW     SFVVWN PEFARDLLPKYFKHNNFSSF+
Sbjct  26   GGNAPPPFLSKTYEMVDDPATDAIVSWGPANNSFVVWNTPEFARDLLPKYFKHNNFSSFV  85

Query  557  RQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS----AQP-NSGVPLSe  721
            RQLNTYGFRK+D ++WEFAN+ F+RG+  LLK I+RRKP H+HS    +QP NS V    
Sbjct  86   RQLNTYGFRKVDPDRWEFANEGFLRGRKDLLKTINRRKPSHAHSQTQQSQPQNSSVAACV  145

Query  722  perr-efeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
               +   EEEIERLK++ + L  EL R  Q+ +    + Q+L  RLQ +++RQ+Q+++ +
Sbjct  146  EVGKFGLEEEIERLKRDKNVLMQELVRLRQQQQATDHQLQTLGKRLQGMEQRQQQMMSFL  205

Query  899  AQLSLKPDLLHHLEVHN  949
            A+    P  L  L   N
Sbjct  206  AKAMQSPGFLAQLVEQN  222



>ref|NP_193623.1| heat stress transcription factor A-4a [Arabidopsis thaliana]
 sp|O49403.1|HFA4A_ARATH RecName: Full=Heat stress transcription factor A-4a; Short=AtHsfA4a; 
AltName: Full=AtHsf-15; AltName: Full=Heat shock factor 
protein 21; Short=HSF 21; AltName: Full=Heat shock transcription 
factor 21; Short=HSTF 21 [Arabidopsis thaliana]
 emb|CAA16745.1| heat shock transcription factor-like protein [Arabidopsis thaliana]
 emb|CAB78890.1| heat shock transcription factor-like protein [Arabidopsis thaliana]
 gb|AAM78104.1| AT4g18880/F13C5_50 [Arabidopsis thaliana]
 gb|AAN46803.1| At4g18880/F13C5_50 [Arabidopsis thaliana]
 gb|AEE84101.1| heat stress transcription factor A-4a [Arabidopsis thaliana]
Length=401

 Score =   191 bits (484),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 144/374 (39%), Positives = 198/374 (53%), Gaps = 77/374 (21%)
 Frame = +2

Query  359   MDGTQGG--SASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFK  532
             MD    G  S+S  PFL KTYE+VDD ++ ++VSWS+  +SF+VWNPPEF+RDLLP++FK
Sbjct  1     MDENNHGVSSSSLPPFLTKTYEMVDDSSSDSIVSWSQSNKSFIVWNPPEFSRDLLPRFFK  60

Query  533   HNNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGV-  709
             HNNFSSFIRQLNTYGFRK D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS  PN    
Sbjct  61    HNNFSSFIRQLNTYGFRKADPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSL-PNLQAQ  119

Query  710   --PLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQ  883
               PL++ ER     +IERL +E   L  EL ++++E      + + L  RLQ +++RQ+ 
Sbjct  120   LNPLTDSERVRMNNQIERLTKEKEGLLEELHKQDEEREVFEMQVKELKERLQHMEKRQKT  179

Query  884   VLALVAQLSLKPDLLHHL-----EVHNKKRK-PSV-------------------------  970
             +++ V+Q+  KP L  +L     E + +KR+ P +                         
Sbjct  180   MVSFVSQVLEKPGLALNLSPCVPETNERKRRFPRIEFFPDEPMLEENKTCVVVREEGSTS  239

Query  971   --SNGHLELVNNLDSSITV--------CQKILNGISNGEEAYGNFETLPQAP-------S  1099
               S+     V  L+SSI +        C+ +L   S          T P++P       S
Sbjct  240   PSSHTREHQVEQLESSIAIWENLVSDSCESMLQSRSMMTLDVDESSTFPESPPLSCIQLS  299

Query  1100  GDSRFSSPSTQTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPV  1279
              DSR  SP     +P I  ++ +  G+      A                   +    PV
Sbjct  300   VDSRLKSPP----SPRIIDMNCEPDGSKEQNTVA-------------------APPPPPV  336

Query  1280  VGGNDVFWQQFLTE  1321
              G ND FWQQF +E
Sbjct  337   AGANDGFWQQFFSE  350



>ref|XP_008380467.1| PREDICTED: heat stress transcription factor A-5-like [Malus domestica]
 ref|XP_008380468.1| PREDICTED: heat stress transcription factor A-5-like [Malus domestica]
Length=483

 Score =   192 bits (489),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 139/217 (64%), Gaps = 20/217 (9%)
 Frame = +2

Query  389  PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
            PAPFL KTY +VDD A   +VSWS   +SFVVWNPPEF+R LLP YFKHNNFSSFIRQLN
Sbjct  13   PAPFLLKTYNMVDDSATDEIVSWSSNKKSFVVWNPPEFSRVLLPTYFKHNNFSSFIRQLN  72

Query  569  TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeee  748
            TYGFRK D E+WEFAN++FI+ Q HLLKNIHRRKPIHSHS    S V   +PER   ++E
Sbjct  73   TYGFRKSDPERWEFANEDFIQDQKHLLKNIHRRKPIHSHSNPQGSMV---DPERAALDDE  129

Query  749  ierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLL  928
            IE+L  +  +L   +   +Q+    + + ++L  R+  +++RQ+ +L  + +    P+ +
Sbjct  130  IEKLSHDKDTLEASISTFKQQQSAAKLQLENLAQRVSGMEQRQKNLLTFLDEAVHNPNFI  189

Query  929  HHL---------EVHNKKRK--------PSVSNGHLE  988
             HL           +NKKR+        P V NG ++
Sbjct  190  EHLSRKIESMDFSAYNKKRRLPDIENLQPVVENGFVD  226



>ref|XP_008802552.1| PREDICTED: heat stress transcription factor A-1-like [Phoenix 
dactylifera]
Length=471

 Score =   192 bits (487),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 132/193 (68%), Gaps = 6/193 (3%)
 Frame = +2

Query  389  PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
            P PFL+KTY++VDD +  A+VSW  G  SFVVWN PEFARDLLPKYFKH+NFSSF+RQLN
Sbjct  23   PPPFLSKTYDMVDDLSTDAIVSWGPGNNSFVVWNTPEFARDLLPKYFKHSNFSSFVRQLN  82

Query  569  TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSH------SAQPNSGVPLSeper  730
            TYGFRK+D ++WEFAN+ F+RGQ HLLK I+RRKP+ +H       AQ  +     E  +
Sbjct  83   TYGFRKVDPDRWEFANEGFLRGQKHLLKTINRRKPVQTHRQAQQSQAQDTNVAACVEVGK  142

Query  731  refeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLS  910
               EEEIE LK++ + L  EL R  Q+ +    +F +L  RLQ +++RQ+Q+++ +A+  
Sbjct  143  FGLEEEIEMLKRDKNVLMQELVRLRQQQQATDNQFHTLGQRLQGMEQRQQQMMSFLAKAM  202

Query  911  LKPDLLHHLEVHN  949
              P+ L  L   N
Sbjct  203  QSPEFLAQLVQQN  215



>gb|KDP30379.1| hypothetical protein JCGZ_17108 [Jatropha curcas]
Length=515

 Score =   193 bits (490),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 132/192 (69%), Gaps = 8/192 (4%)
 Frame = +2

Query  386  SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQL  565
            +P PFL+KTY++VDD A  A+VSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+RQL
Sbjct  41   APPPFLSKTYDMVDDPATDAIVSWSPTNNSFVVWNPPEFARDLLPKYFKHNNFSSFVRQL  100

Query  566  NTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS--------AQPNSGVPLSe  721
            NTYGFRK+D ++WEFAN+ F+RGQ HLL++I RRKP H HS         Q +S     E
Sbjct  101  NTYGFRKVDPDRWEFANEGFLRGQKHLLRSISRRKPAHGHSHQQTQQPHGQSSSVGACVE  160

Query  722  perrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVA  901
              +   EEE+ERLK++ + L  EL R  Q+ +    + Q++  RLQ +++RQ+Q+++ +A
Sbjct  161  VGKFGLEEEVERLKRDKNVLMQELVRLRQQQQTTDSQLQTMVQRLQGMEQRQQQMMSFLA  220

Query  902  QLSLKPDLLHHL  937
            +    P  L   
Sbjct  221  KAMQSPGFLAQF  232



>gb|AEO91550.1| heat shock transcription factor [Populus simonii]
Length=482

 Score =   192 bits (487),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 132/191 (69%), Gaps = 8/191 (4%)
 Frame = +2

Query  380  SASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIR  559
            S +P PFL+KTY++VDD A  AVVSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+R
Sbjct  5    SNAPPPFLSKTYDMVDDPATDAVVSWSSTNNSFVVWNPPEFARDLLPKYFKHNNFSSFVR  64

Query  560  QLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ-------PNSGVPLS  718
            QLNTYGFRK+D ++WEFAN+ F+RGQ HLL+ I RRKP H H+ Q        NS V   
Sbjct  65   QLNTYGFRKVDPDRWEFANEGFLRGQKHLLRIISRRKPAHGHANQQPQQPHGQNSSVAAC  124

Query  719  eperr-efeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
                +   +EE+ERLK++ + L  EL R  Q+ +    + Q++  RLQ +++RQ+Q+++ 
Sbjct  125  VEVGKFGLKEEVERLKRDKNVLMQELVRLRQQQQSTDSQLQTMVQRLQGMEQRQQQMMSF  184

Query  896  VAQLSLKPDLL  928
            +A+    P  L
Sbjct  185  LAKAMNSPGFL  195



>ref|XP_006368372.1| heat shock transcription factor family protein [Populus trichocarpa]
 gb|ERP64941.1| heat shock transcription factor family protein [Populus trichocarpa]
Length=510

 Score =   192 bits (489),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 131/194 (68%), Gaps = 8/194 (4%)
 Frame = +2

Query  380  SASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIR  559
            S SP PFL+KTY++VDD    AVVSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+R
Sbjct  31   SNSPPPFLSKTYDMVDDPETDAVVSWSSTNNSFVVWNPPEFARDLLPKYFKHNNFSSFVR  90

Query  560  QLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ-------PNSGVPLS  718
            QLNTYGFRK+D ++WEFAN+ F+RGQ HLL+ I RRKP H H+ Q        NS V   
Sbjct  91   QLNTYGFRKVDPDRWEFANEGFLRGQKHLLRTISRRKPAHGHTNQQPQQARGQNSTVGAC  150

Query  719  eperr-efeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
                +   EEE+ERLK++ + L  EL R  Q+ +    + Q++  RLQ +++RQ+Q+++ 
Sbjct  151  VEVGKFGLEEEVERLKRDKNVLMQELVRLRQQQQSTDSQLQTMVQRLQGMEQRQQQMMSF  210

Query  896  VAQLSLKPDLLHHL  937
            +A+    P  L   
Sbjct  211  LAKAMQSPGFLAQF  224



>ref|XP_009350928.1| PREDICTED: heat stress transcription factor A-5-like [Pyrus x 
bretschneideri]
 ref|XP_009350929.1| PREDICTED: heat stress transcription factor A-5-like [Pyrus x 
bretschneideri]
Length=483

 Score =   192 bits (487),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 137/209 (66%), Gaps = 15/209 (7%)
 Frame = +2

Query  398  FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
            FL KTY++VDD A   +VSWS   +SF+VWNPPEFAR LLP YFKHNNFSSFIRQLNTYG
Sbjct  16   FLLKTYDMVDDSATDEIVSWSSNKKSFIVWNPPEFARVLLPTYFKHNNFSSFIRQLNTYG  75

Query  578  FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeier  757
            FRKID E+WEFAN++FI+ Q HLLKNIHRRKPIHSHS    S V   + ER   ++EIE+
Sbjct  76   FRKIDPERWEFANEDFIQDQKHLLKNIHRRKPIHSHSNPQGSMV---DSERAALDDEIEK  132

Query  758  LKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHHL  937
            L  + ++L   + R +Q+  E + + + L  R+  +++RQ+ ++  + +    P+ + HL
Sbjct  133  LSHDKAALEANISRFKQQRSEAKLQLEDLTQRVSGMEQRQKNLVTFLDRAVHNPNFVEHL  192

Query  938  E----------VHNKKRKPSVSNGHLELV  994
                        H K+R P +   HL+ V
Sbjct  193  TRKIESMDFLAYHKKRRLPDID--HLQPV  219



>gb|AAC31792.1| heat shock transcription factor 21 [Arabidopsis thaliana]
Length=401

 Score =   190 bits (482),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 141/366 (39%), Positives = 195/366 (53%), Gaps = 75/366 (20%)
 Frame = +2

Query  377   GSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFI  556
              S+S  PFL KTYE+VDD ++ ++VSWS+  +SF+VWNPPEF+RDLLP++FKHNNFSSFI
Sbjct  9     SSSSLPPFLTKTYEMVDDSSSDSIVSWSQSNKSFIVWNPPEFSRDLLPRFFKHNNFSSFI  68

Query  557   RQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGV---PLSepe  727
             RQLNTYGFRK D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS  PN      PL++ E
Sbjct  69    RQLNTYGFRKADPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSL-PNLQAQLNPLTDSE  127

Query  728   rrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQL  907
             R     +IERL +E   L  EL ++++E      + + L  RLQ +++RQ+ +++ V+Q+
Sbjct  128   RVRMNNQIERLTKEKEGLLEELHKQDEEREVFEMQVKELKERLQHMEKRQKTMVSFVSQV  187

Query  908   SLKPDLLHHL-----EVHNKKRK-PSV---------------------------SNGHLE  988
               KP L  +L     E + +KR+ P +                           S+    
Sbjct  188   LEKPGLALNLSPCVPETNERKRRFPRIEFFPDEPMLEENKTCVVVREEGSTSPSSHTREH  247

Query  989   LVNNLDSSITV--------CQKILNGISNGEEAYGNFETLPQAP-------SGDSRFSSP  1123
              V  L+SSI +        C+ +L   S          T P++P       S DSR  SP
Sbjct  248   QVEQLESSIAIWENLVSDSCESMLQSRSMMTLDVDESSTFPESPPLSCIQLSVDSRLKSP  307

Query  1124  STQTDTPEISSLHTKHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFW  1303
                  +P I  ++ +  G+      A                   +    PV G ND FW
Sbjct  308   P----SPRIIDMNCEPDGSKEQNTVA-------------------APPPPPVAGANDGFW  344

Query  1304  QQFLTE  1321
             QQF +E
Sbjct  345   QQFFSE  350



>ref|XP_007040659.1| Heat shock transcription factor A1D isoform 1 [Theobroma cacao]
 ref|XP_007040660.1| Heat shock transcription factor A1D isoform 1 [Theobroma cacao]
 gb|EOY25160.1| Heat shock transcription factor A1D isoform 1 [Theobroma cacao]
 gb|EOY25161.1| Heat shock transcription factor A1D isoform 1 [Theobroma cacao]
Length=528

 Score =   192 bits (489),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 131/192 (68%), Gaps = 8/192 (4%)
 Frame = +2

Query  386  SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQL  565
            +P PFL+KTY++VDD A  A+VSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+RQL
Sbjct  41   APPPFLSKTYDMVDDPATDAIVSWSPTNNSFVVWNPPEFARDLLPKYFKHNNFSSFVRQL  100

Query  566  NTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS--------AQPNSGVPLSe  721
            NTYGFRK+D ++WEFAN+ F+RGQ HLL+NI RRKP H H          Q +S     E
Sbjct  101  NTYGFRKVDPDRWEFANEGFLRGQKHLLRNISRRKPAHGHGHQQTQQSHGQSSSVGACVE  160

Query  722  perrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVA  901
              +   EEE+ERLK++ + L  EL R  Q+ +    + Q++  RLQ +++RQ+Q+++ +A
Sbjct  161  VGKFGLEEEVERLKRDKNVLMQELVRLRQQQQATDNQLQTVVQRLQGMEQRQQQMMSFLA  220

Query  902  QLSLKPDLLHHL  937
            +    P  L   
Sbjct  221  KAVQSPGFLAQF  232



>ref|XP_006414044.1| hypothetical protein EUTSA_v10025409mg [Eutrema salsugineum]
 dbj|BAJ33602.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55497.1| hypothetical protein EUTSA_v10025409mg [Eutrema salsugineum]
Length=393

 Score =   189 bits (481),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 136/344 (40%), Positives = 194/344 (56%), Gaps = 31/344 (9%)
 Frame = +2

Query  374   GGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSF  553
             G S+S  PFL KTYE+VDD ++ ++VSWS+  +SF+VWNPPEF+R LLP++FKHNNFSSF
Sbjct  8     GSSSSLPPFLTKTYEMVDDSSSDSIVSWSQSNKSFIVWNPPEFSRGLLPRFFKHNNFSSF  67

Query  554   IRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-----AQPNSGVPLS  718
             IRQLNTYGFRK D EQWEFAN++F+RG+ HL+KNIHRRKP+HSHS     AQ N   PL+
Sbjct  68    IRQLNTYGFRKADPEQWEFANEDFVRGEPHLMKNIHRRKPVHSHSLPNLQAQQN---PLT  124

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             + ER+    +IERL +E   L  EL ++E+E      + + L  +LQ +++RQ+ +++ V
Sbjct  125   DSERQRMNNQIERLTKEKEGLLEELHKQEEEREVFEQQVKKLKDQLQHMEKRQKTMVSFV  184

Query  899   AQLSLKPDLLHHL-----EVHNKKRK-------PSVSNGHLELVNNLDSSITVCQKIL-N  1039
             +Q+  KP L  +L     E + +KR+       P +      +V   + S +       +
Sbjct  185   SQVLEKPGLALNLSPSLPETNERKRRFPRLGFEPMLEENQTCVVAREEGSTSPSSHTTEH  244

Query  1040  GISNGEEAYGNFETLPQAPSGDSRFSSPSTQT-------DTPEISSLHTKHPGADGNAKA  1198
              +   E +   +E L          S+ S  T         PE   L       D   K 
Sbjct  245   QVEQLESSIAIWENLVSESCESMAQSTRSMMTLDVDESSTCPESPPLSCIQLSIDTRPKC  304

Query  1199  AWNCAAVDVDRLKDRLEGRSST---AAVPVVGGNDVFWQQFLTE  1321
               +   +D++   D  + +S+       P  G NDVFWQQFLTE
Sbjct  305   PPSPRIIDMNSEPDVSKEQSTVAPAPPPPAAGVNDVFWQQFLTE  348



>ref|XP_006485538.1| PREDICTED: heat shock factor protein HSF8-like isoform X1 [Citrus 
sinensis]
 ref|XP_006485540.1| PREDICTED: heat shock factor protein HSF8-like isoform X1 [Citrus 
sinensis]
 ref|XP_006485542.1| PREDICTED: heat shock factor protein HSF8-like isoform X1 [Citrus 
sinensis]
Length=516

 Score =   192 bits (488),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 134/195 (69%), Gaps = 8/195 (4%)
 Frame = +2

Query  368  TQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFS  547
             Q  + +P PFL+KTY++VDD A  ++VSWS    SFVVWNPPEFARDLLPKYFKHNNFS
Sbjct  30   VQNATNAPPPFLSKTYDMVDDLATDSIVSWSPTSNSFVVWNPPEFARDLLPKYFKHNNFS  89

Query  548  SFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSH--------SAQPNS  703
            SF+RQLNTYGFRK+D ++WEFAN+ F+RGQ HLL++I RRKP H H        +AQ +S
Sbjct  90   SFVRQLNTYGFRKVDPDRWEFANEGFLRGQKHLLRSISRRKPAHGHGHQQSHQQNAQSSS  149

Query  704  GVPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQ  883
                 E  +   EEE+ERLK++ + L  EL R  Q+ +    + Q++  RLQ +++R +Q
Sbjct  150  VGACVEVGKFGLEEEVERLKRDKNVLMQELVRLRQQQQATDSQLQTMVQRLQGMEQRHQQ  209

Query  884  VLALVAQLSLKPDLL  928
            ++A +A+    P  L
Sbjct  210  MMAFLAKAVQSPGFL  224



>gb|KFK28556.1| hypothetical protein AALP_AA7G011600 [Arabis alpina]
Length=390

 Score =   189 bits (480),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 143/346 (41%), Positives = 194/346 (56%), Gaps = 55/346 (16%)
 Frame = +2

Query  395   PFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTY  574
             PFL KTYE+VDD ++ ++VSWS+  +SF+VWNPPEF+RDLLP++FKHNNFSSFIRQLNTY
Sbjct  16    PFLTKTYEMVDDSSSDSIVSWSQSNKSFIVWNPPEFSRDLLPRFFKHNNFSSFIRQLNTY  75

Query  575   GFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-----AQPNSGVPLSeperref  739
             GFRK D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS     AQ N   PL++ ER+  
Sbjct  76    GFRKADPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSLPNLQAQQN---PLTDSERQRM  132

Query  740   eeeierLKQENSSLRVELD-RREQENRECRFEFQ--SLDSRLQSIDERQRQVLALVAQLS  910
               +IERL  E   L   LD  ++QE  + RFE Q   L  RL  +++RQ+ +++ V+Q+ 
Sbjct  133   NNQIERLTNEKEGL---LDELQKQEEEKERFEIQVKELKDRLHYMEKRQKTMVSFVSQVL  189

Query  911   LKPDLLHHL-----EVHNKKRK------------------------PSVSNGHLELVNNL  1003
              KP L  +L     E + +KR+                        P   +     V  L
Sbjct  190   EKPGLALNLSPCVTETNERKRRFQRIGFEENHQTCVVVVREEGSISPPSQHTTEHQVEML  249

Query  1004  DSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGAD  1183
              SSI + + +++          +  TL      D   S P    ++P +S LH      D
Sbjct  250   GSSIAIWENLVSDSCESMVQSRSMMTL----DVDESSSCP----ESPPLSCLHL---SID  298

Query  1184  GNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                K+  +   +D++   D +     T   P  G NDVFWQQFLTE
Sbjct  299   TCPKSPPSPRIIDMNSEPD-VSKDQDTVPPPAAGVNDVFWQQFLTE  343



>ref|XP_011018512.1| PREDICTED: heat stress transcription factor A-1d isoform X1 [Populus 
euphratica]
Length=510

 Score =   192 bits (488),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 131/194 (68%), Gaps = 8/194 (4%)
 Frame = +2

Query  380  SASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIR  559
            S SP PFL+KTY++VDD    AVVSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+R
Sbjct  31   SNSPPPFLSKTYDMVDDPETDAVVSWSSTNNSFVVWNPPEFARDLLPKYFKHNNFSSFVR  90

Query  560  QLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ-------PNSGVPLS  718
            QLNTYGFRK+D ++WEFAN+ F+RGQ HLL+ I RRKP H H+ Q        NS V   
Sbjct  91   QLNTYGFRKVDPDRWEFANEGFLRGQKHLLRTISRRKPAHGHANQQPQQTRGQNSTVGAC  150

Query  719  eperr-efeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
                +   EEE+ERLK++ + L  EL R  Q+ +    + Q++  RLQ +++RQ+Q+++ 
Sbjct  151  VEVGKFGLEEEVERLKRDKNVLMQELVRLRQQQQSTDSQLQAMVQRLQGMEQRQQQMMSF  210

Query  896  VAQLSLKPDLLHHL  937
            +A+    P  L   
Sbjct  211  LAKAMQSPGFLAQF  224



>ref|XP_002527650.1| Heat shock factor protein HSF8, putative [Ricinus communis]
 gb|EEF34721.1| Heat shock factor protein HSF8, putative [Ricinus communis]
Length=510

 Score =   192 bits (488),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 131/195 (67%), Gaps = 8/195 (4%)
 Frame = +2

Query  377  GSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFI  556
             S +P PFL+KTY++VDD A  AVVSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+
Sbjct  35   ASNAPPPFLSKTYDMVDDPATDAVVSWSPTNNSFVVWNPPEFARDLLPKYFKHNNFSSFV  94

Query  557  RQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS--------AQPNSGVP  712
            RQLNTYGFRK+D ++WEFAN+ F+RGQ HLLK+I RRKP H H          Q +S   
Sbjct  95   RQLNTYGFRKVDPDRWEFANEGFLRGQKHLLKSISRRKPAHGHGHQQAQQPHGQSSSVGA  154

Query  713  LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLA  892
              E  +   EEE+ERLK++ + L  EL R  Q+ +    + Q++  RLQ +++RQ+Q+++
Sbjct  155  CVEVGKFGLEEEVERLKRDKNVLMQELVRLRQQQQTTDSQLQTMVQRLQGMEQRQQQMMS  214

Query  893  LVAQLSLKPDLLHHL  937
             +A+    P      
Sbjct  215  FLAKAMQSPGFFAQF  229



>ref|NP_001236740.1| heat shock factor protein hsf8-related [Glycine max]
 gb|AAS15800.1| heat shock factor protein hsf8-related [Glycine max]
Length=510

 Score =   192 bits (487),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 112/263 (43%), Positives = 149/263 (57%), Gaps = 36/263 (14%)
 Frame = +2

Query  359   MDG----TQGGSASPAP-------------FLAKTYELVDDRANSAVVSWSRGGRSFVVW  487
             MDG    + GG ASPAP             FL+KTYE+V+D +  ++VSWS    SFVVW
Sbjct  1     MDGRASSSVGGEASPAPAPVPITNANAPPPFLSKTYEMVEDPSTDSIVSWSPTNNSFVVW  60

Query  488   NPPEFARDLLPKYFKHNNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRR  667
             NPPEFARDLLPK+FKHNNFSSF+RQLNTYGFRK+D ++WEFAN+ F+RGQ HLLK I RR
Sbjct  61    NPPEFARDLLPKHFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGQKHLLKTITRR  120

Query  668   KPIHSHSAQPNSGVPLSeperref-------eeeierLKQENSSLRVELDRREQENRECR  826
             KP H H+ Q       S              EEE+E LK++ + L  EL R  Q+ +   
Sbjct  121   KPAHGHNQQAQQAHGQSSSVGACVEVGKFGLEEEVEILKRDKNVLMQELVRLRQQQQATD  180

Query  827   FEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHHL------------EVHNKKRKPSV  970
              + QS+  RLQ +++RQ+Q+++ +A+    P  L               E + K+R    
Sbjct  181   NQLQSMVQRLQGMEQRQQQMMSFLAKAVQSPGFLAQFVQQQNESSRRITEANKKRRLKQE  240

Query  971   SNGHLELVNNLDSSITVCQKILN  1039
               G +E     D  I   Q ++N
Sbjct  241   GIGEMEHTAASDGQIVKYQPLIN  263



>ref|XP_002303429.2| heat shock transcription factor family protein [Populus trichocarpa]
 gb|EEE78408.2| heat shock transcription factor family protein [Populus trichocarpa]
Length=507

 Score =   192 bits (487),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 132/191 (69%), Gaps = 8/191 (4%)
 Frame = +2

Query  380  SASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIR  559
            S +P PFL+KTY++VDD A  AVVSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+R
Sbjct  31   SNAPPPFLSKTYDMVDDPATDAVVSWSSTNNSFVVWNPPEFARDLLPKYFKHNNFSSFVR  90

Query  560  QLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ-------PNSGVPLS  718
            QLNTYGFRK+D ++WEFAN+ F+RGQ HLL+ I RRKP H H+ Q        NS V   
Sbjct  91   QLNTYGFRKVDPDRWEFANEGFLRGQKHLLRIISRRKPAHGHANQQPQQPHGQNSSVAAC  150

Query  719  eperr-efeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
                +   EEE+ERLK++ + L  EL R  Q+ +    + Q++  RLQ +++RQ+Q+++ 
Sbjct  151  VEVGKFGLEEEVERLKRDKNVLMQELVRLRQQQQSTDSQLQTMVQRLQGMEQRQQQMMSF  210

Query  896  VAQLSLKPDLL  928
            +A+    P  L
Sbjct  211  LAKAMNSPGFL  221



>ref|XP_006492535.1| PREDICTED: heat stress transcription factor A-5-like [Citrus 
sinensis]
Length=493

 Score =   191 bits (486),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 133/201 (66%), Gaps = 11/201 (5%)
 Frame = +2

Query  398  FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
            FL KTY++VDD +   +VSWS    SFVVWNPPEFAR LLP YFKHNNFSSFIRQLNTYG
Sbjct  20   FLIKTYDMVDDSSTDEIVSWSDNKNSFVVWNPPEFARLLLPTYFKHNNFSSFIRQLNTYG  79

Query  578  FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeier  757
            FRKID E+WEF+ND+F++ + HLLKNIHRRKPIHSHS     G  +  PER  FEE++ER
Sbjct  80   FRKIDPEKWEFSNDDFVKDKRHLLKNIHRRKPIHSHSHPQTQGSSVD-PERATFEEQMER  138

Query  758  LKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHHL  937
            L  E S+L   + R +Q+    + + + L  R+ S+D+RQ  +L  + +    P  + HL
Sbjct  139  LSHEKSALEANIVRLKQQRSTAKLQLEDLAQRIDSMDQRQENLLTFLQKAVQNPTFVDHL  198

Query  938  ---------EVHNKK-RKPSV  970
                       +NKK RKP V
Sbjct  199  ARKIESMDISAYNKKRRKPQV  219



>ref|XP_002452118.1| hypothetical protein SORBIDRAFT_04g020050 [Sorghum bicolor]
 gb|EES05094.1| hypothetical protein SORBIDRAFT_04g020050 [Sorghum bicolor]
Length=485

 Score =   191 bits (485),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 133/184 (72%), Gaps = 4/184 (2%)
 Frame = +2

Query  389  PAPFLAKTYELVDDRANSAVVSWSRGGR-SFVVWNPPEFARDLLPKYFKHNNFSSFIRQL  565
            PAPFL KTYE+VDD ++ AVVSWS     SFVVWNPPEFA  +LP YFKHNNFSSFIRQL
Sbjct  24   PAPFLLKTYEMVDDPSSDAVVSWSDASDGSFVVWNPPEFAARMLPTYFKHNNFSSFIRQL  83

Query  566  NTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefee  745
            NTYGFRKID E+WEFAN+ F++GQ HLLKNIHRRKPIHSHS QP +   L + ER  FE+
Sbjct  84   NTYGFRKIDPERWEFANEYFVKGQKHLLKNIHRRKPIHSHSHQPGA---LPDNERALFED  140

Query  746  eierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDL  925
            EI+RL +E ++L+ +L +  Q+      + + L+ R+  +++RQ ++L+ + Q    P  
Sbjct  141  EIDRLSREKAALQADLWKFNQQQSGAVSQIEDLERRVLDMEQRQTKMLSFLQQAQKNPQF  200

Query  926  LHHL  937
            +  L
Sbjct  201  VSKL  204



>ref|XP_008803687.1| PREDICTED: heat stress transcription factor A-5-like [Phoenix 
dactylifera]
Length=484

 Score =   191 bits (484),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 137/206 (67%), Gaps = 15/206 (7%)
 Frame = +2

Query  389  PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
            PAPFL KTY++VDD A   +VSWS    SF+VWNPP+FA  LLP YFKHNNFSSFIRQLN
Sbjct  25   PAPFLLKTYDMVDDSATDDIVSWSPTQASFIVWNPPDFAAHLLPAYFKHNNFSSFIRQLN  84

Query  569  TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeee  748
            TYGFRKID E+WEFAN+EF++GQ HLLKNIHRRKPIHSHS  P S    +  ER   EEE
Sbjct  85   TYGFRKIDPERWEFANEEFVKGQKHLLKNIHRRKPIHSHSHPPGS---FAYSERAALEEE  141

Query  749  ierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLL  928
            IER+ +E ++L+ +L R  Q+    + +   L+ RL  +++RQ +++A + +    P  +
Sbjct  142  IERITREKAALQADLWRFRQQQSGTKIQLDDLERRLAEMEQRQLKMIAFLQRALENPRFV  201

Query  929  HHL------------EVHNKKRKPSV  970
             +L             +H K+R P +
Sbjct  202  ENLLKMAVASSVDFSAIHKKRRLPGM  227



>gb|AII99901.1| heat shock transcription factor [Gossypium hirsutum]
Length=515

 Score =   191 bits (485),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 152/249 (61%), Gaps = 27/249 (11%)
 Frame = +2

Query  386   SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQL  565
             +P PFL+K+Y++VDD A  A+VSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+RQL
Sbjct  41    TPPPFLSKSYDMVDDPATDAIVSWSPSNNSFVVWNPPEFARDLLPKYFKHNNFSSFVRQL  100

Query  566   NTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS--------AQPNSGVPLSe  721
             NTYGFRK+D ++WEFAN+ F+RGQ HLL+NI RRKP H H          Q +S     E
Sbjct  101   NTYGFRKVDPDRWEFANEGFLRGQKHLLRNISRRKPAHGHGHQQTQQSHGQSSSVDACVE  160

Query  722   perrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVA  901
               +   EEE+ERLK++ + L  EL R  Q+ +    + Q +  RLQ +++RQ+Q+++ +A
Sbjct  161   VGKFGLEEEVERLKRDKNVLMQELVRLRQQQQATDNQLQVMVQRLQGMEQRQQQMMSFLA  220

Query  902   QLSLKPDLL-----------HHLEVHNKKRK--------PSVSNGHLELVNNLDSSITVC  1024
             +    P  L             +   NKKR+         + S+G +     L+ +  + 
Sbjct  221   KAMQSPGFLAQFVQQQNESNRRISEANKKRRLKQDGNDTSAASDGQIIKYQPLNEAKEML  280

Query  1025  QKILNGISN  1051
             ++I+ G S+
Sbjct  281   RRIMKGDSS  289



>ref|XP_009361739.1| PREDICTED: heat stress transcription factor A-1-like [Pyrus x 
bretschneideri]
Length=507

 Score =   191 bits (484),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 145/234 (62%), Gaps = 19/234 (8%)
 Frame = +2

Query  386   SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQL  565
             +P PFL KTY++VDD +  AVVSWS G  SFVVWN PEF+RDLLPKYFKHNNFSSF+RQL
Sbjct  20    TPPPFLNKTYDMVDDHSTDAVVSWSNGNNSFVVWNVPEFSRDLLPKYFKHNNFSSFVRQL  79

Query  566   NTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-AQPNSGV------PLSep  724
             NTYGFRK+D ++WEFAN+ F+RGQ HLLK + RRKP H  S  QP   V      P  E 
Sbjct  80    NTYGFRKVDPDRWEFANEGFLRGQKHLLKTVSRRKPAHVQSHQQPPPQVQSSQVGPCVEV  139

Query  725   errefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQ  904
                  EEE+ERLK++ ++L  EL R  Q+ +    +  ++  R+Q +++RQ+Q+++ +A+
Sbjct  140   VNPGLEEEVERLKRDKNTLMQELVRLRQQQQATDNQLHNVGQRMQGMEQRQQQMMSFLAK  199

Query  905   LSLKPDLLHHLEVH-----------NKKRKPSVSNGHLELVNNLDSSITVCQKI  1033
                 P  L  L  H           NKKR+       + LV NL S +   Q +
Sbjct  200   AMHSPGFLSQLVQHQNENNRRITGSNKKRRLPRQEDEI-LVGNLGSKVLDGQMV  252



>ref|XP_008438315.1| PREDICTED: heat stress transcription factor A-5 [Cucumis melo]
Length=467

 Score =   190 bits (482),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 133/180 (74%), Gaps = 3/180 (2%)
 Frame = +2

Query  398  FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
            FL KTY++VDD +   +VSW+   +SFVVWNPPEFAR LLP +FKH+NFSSFIRQLNTYG
Sbjct  18   FLLKTYDMVDDSSTDEIVSWTSSKKSFVVWNPPEFARLLLPTFFKHSNFSSFIRQLNTYG  77

Query  578  FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeier  757
            FRKID+E+WEFAN++FI+ Q HLLKNIHRRKPIHSHS    S +   +PER  FE+EIER
Sbjct  78   FRKIDSEKWEFANEDFIKDQKHLLKNIHRRKPIHSHSNPQGSHI---DPERAAFEDEIER  134

Query  758  LKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHHL  937
            L +E ++L V + R +Q+    + + Q L  +++S+++RQ+ +LA + +    P  + HL
Sbjct  135  LSREKNTLEVNISRFKQQKSTAKLQLQDLTVKVESMEKRQKNLLAFLEKAVQNPSFVEHL  194



>ref|XP_009354811.1| PREDICTED: heat stress transcription factor A-1-like [Pyrus x 
bretschneideri]
 ref|XP_009354812.1| PREDICTED: heat stress transcription factor A-1-like [Pyrus x 
bretschneideri]
 ref|XP_009354813.1| PREDICTED: heat stress transcription factor A-1-like [Pyrus x 
bretschneideri]
Length=507

 Score =   191 bits (484),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 145/234 (62%), Gaps = 19/234 (8%)
 Frame = +2

Query  386   SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQL  565
             +P PFL KTY++VDD +  AVVSWS G  SFVVWN PEF+RDLLPKYFKHNNFSSF+RQL
Sbjct  20    TPPPFLNKTYDMVDDHSTDAVVSWSNGNNSFVVWNVPEFSRDLLPKYFKHNNFSSFVRQL  79

Query  566   NTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-AQPNSGV------PLSep  724
             NTYGFRK+D ++WEFAN+ F+RGQ HLLK + RRKP H  S  QP   V      P  E 
Sbjct  80    NTYGFRKVDPDRWEFANEGFLRGQKHLLKTVSRRKPAHVQSHQQPPPQVQSSQVGPCVEV  139

Query  725   errefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQ  904
                  EEE+ERLK++ ++L  EL R  Q+ +    +  ++  R+Q +++RQ+Q+++ +A+
Sbjct  140   VNPGLEEEVERLKRDKNTLMQELVRLRQQQQATDNQLHNVGQRMQGMEQRQQQMMSFLAK  199

Query  905   LSLKPDLLHHLEVH-----------NKKRKPSVSNGHLELVNNLDSSITVCQKI  1033
                 P  L  L  H           NKKR+       + LV NL S +   Q +
Sbjct  200   AMHSPGFLSQLVQHQNENNRRITGSNKKRRLPRQEDEI-LVGNLGSKVLDGQMV  252



>gb|KHG03434.1| Heat shock factor HSF8 [Gossypium arboreum]
Length=511

 Score =   191 bits (484),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 132/196 (67%), Gaps = 9/196 (5%)
 Frame = +2

Query  389  PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
            P PFL+KTY++VDD A  A+VSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+RQLN
Sbjct  42   PPPFLSKTYDMVDDPATDAIVSWSPTNNSFVVWNPPEFARDLLPKYFKHNNFSSFVRQLN  101

Query  569  TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS--------AQPNSGVPLSep  724
            TYGFRK+D ++WEFAN+ F+RGQ HLL+NI RRKP H H          Q +S     E 
Sbjct  102  TYGFRKVDPDRWEFANEGFLRGQKHLLRNISRRKPAHGHGHQQTQQPHGQSSSMGACVEV  161

Query  725  errefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQ  904
             +   EEE+ERLK++ + L  EL R  Q+ +    + Q++  RLQ +++RQ+Q+++ +A+
Sbjct  162  GKFGLEEEVERLKRDKNVLMQELVRLRQQQQTTDNQLQNMVQRLQGMEQRQQQMMSFLAK  221

Query  905  LSLKPDLLHHLEVHNK  952
                P       VH +
Sbjct  222  AVQSPSFFAQF-VHQQ  236



>emb|CAN71266.1| hypothetical protein VITISV_017888 [Vitis vinifera]
Length=495

 Score =   190 bits (483),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 136/191 (71%), Gaps = 8/191 (4%)
 Frame = +2

Query  380  SASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIR  559
            S +P PFL+KTY++VDD A +++VSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+R
Sbjct  28   SNAPPPFLSKTYDMVDDPATNSIVSWSPTNNSFVVWNPPEFARDLLPKYFKHNNFSSFVR  87

Query  560  QLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS--------AQPNSGVPL  715
            QLNTYGFRK+D ++WEFAN+ F+RGQ HLL++I+RRKP H H+        +Q +S    
Sbjct  88   QLNTYGFRKVDPDRWEFANEGFLRGQKHLLRSINRRKPAHGHNLQQPQQSHSQGSSVGAC  147

Query  716  SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
             E  +   EEE+ERLK++ + L  EL R  Q+ +    + Q++  RLQ +++RQ+Q+++ 
Sbjct  148  VEVGKFGLEEEVERLKRDKNVLMQELVRLRQQQQTTDNQLQTMVQRLQGMEQRQQQMMSF  207

Query  896  VAQLSLKPDLL  928
            +A+    P  L
Sbjct  208  LAKAVQSPGFL  218



>ref|XP_008390927.1| PREDICTED: heat stress transcription factor A-1-like isoform 
X1 [Malus domestica]
 ref|XP_008390928.1| PREDICTED: heat stress transcription factor A-1-like isoform 
X1 [Malus domestica]
Length=507

 Score =   190 bits (483),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/234 (46%), Positives = 143/234 (61%), Gaps = 19/234 (8%)
 Frame = +2

Query  386   SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQL  565
             +P PFL KTY++VDD +  AVVSWS G  SFVVWN PEF+RDLLPKYFKHNNFSSF+RQL
Sbjct  20    APPPFLNKTYDMVDDHSTDAVVSWSNGNNSFVVWNVPEFSRDLLPKYFKHNNFSSFVRQL  79

Query  566   NTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperr----  733
             NTYGFRKID ++WEFAN+ F+RGQ HLLK + RRKP H  S QP      S         
Sbjct  80    NTYGFRKIDPDRWEFANEGFLRGQKHLLKTVSRRKPAHVQSHQPPPPQVQSSQVGACVEV  139

Query  734   ---efeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQ  904
                  EEE+ERLK++ ++L  EL R  Q+ +    +  ++  R+Q +++RQ+Q+++ +A+
Sbjct  140   VNHGLEEEVERLKRDKNTLMQELVRLRQQQQATDNQLHNVGQRMQGMEQRQQQMMSFLAK  199

Query  905   LSLKPDLLHHLEVH-----------NKKRKPSVSNGHLELVNNLDSSITVCQKI  1033
                 P  L  L  H           NKKR+       + LV NL S +   Q +
Sbjct  200   AMHSPGFLSQLVQHQNENNRRITGSNKKRRLPRQXDEI-LVGNLGSKVLDGQMV  252



>ref|XP_010908034.1| PREDICTED: heat stress transcription factor A-5-like [Elaeis 
guineensis]
Length=467

 Score =   189 bits (481),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 119/272 (44%), Positives = 161/272 (59%), Gaps = 20/272 (7%)
 Frame = +2

Query  398   FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
             FL KTY++VDD +   +VSWS    SFVVWNPP+FA  LLP YFKHNNFSSFIRQLNTYG
Sbjct  12    FLLKTYDMVDDSSTDDIVSWSPTKTSFVVWNPPDFAAHLLPTYFKHNNFSSFIRQLNTYG  71

Query  578   FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeier  757
             FRKID E+WEFAN++FI+GQ HLLKNIHRRKPIHSHS  P  G+ L++ E+   EEEIER
Sbjct  72    FRKIDPERWEFANEDFIKGQKHLLKNIHRRKPIHSHSHPP--GL-LADSEKAALEEEIER  128

Query  758   LKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHHL  937
             L +E ++L+ +L R +Q+    + + + L+ RL  +++RQ +++A + +    P  + +L
Sbjct  129   LSRERAALQADLCRFKQQQSGTKIQLEDLERRLVEMEQRQLKMIAFLQRAIHNPRFVDNL  188

Query  938   -------------EVHNKKRKPSVSNGHLELVNNL--DSSITVCQKILNGISNGEEAYGN  1072
                           +H K+R P          N+L  D S T    + +G          
Sbjct  189   VKMASSSLSVDFTAIHKKRRLPGTEYCQEASENSLYDDHSSTSKPDMGHGFHTDFCHELK  248

Query  1073  FETLPQAPSGDSRFSSPSTQTDTPEISSLHTK  1168
              E  P     DS   + STQ+   +  SLH K
Sbjct  249   LELCPAI--SDSNLVTVSTQSSHEDNGSLHMK  278



>gb|EAY85930.1| hypothetical protein OsI_07290 [Oryza sativa Indica Group]
Length=475

 Score =   189 bits (481),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 125/281 (44%), Positives = 171/281 (61%), Gaps = 21/281 (7%)
 Frame = +2

Query  389   PAPFLAKTYELVDDRANSAVVSWSRGG-RSFVVWNPPEFARDLLPKYFKHNNFSSFIRQL  565
             PAPFL KTYE+VDD +  AVVSWS     SFVVWN PEFA  LLP YFKH+NFSSFIRQL
Sbjct  19    PAPFLLKTYEMVDDPSTDAVVSWSDASDASFVVWNHPEFAARLLPAYFKHSNFSSFIRQL  78

Query  566   NTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefee  745
             NTYGFRKID E+WEFAN+ FI+GQ HLLKNIHRRKPIHSHS  P +   L + ER  FE+
Sbjct  79    NTYGFRKIDPERWEFANEYFIKGQKHLLKNIHRRKPIHSHSHPPGA---LPDNERAIFED  135

Query  746   eierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDL  925
             EIERL +E S+L+ +L + +Q+      + + L+ R+  +++RQ +++A + Q S  P  
Sbjct  136   EIERLSREKSNLQADLWKSKQQQSGTMNQIEDLERRVLGMEQRQTKMIAFLQQASKNPQF  195

Query  926   LHHL-----------EVHNKKRK-PSV--SNGHLELVNNLDSSITVCQKILNGISNGEEA  1063
             ++ L           +  NKKR+ P +  S  + E  +  D   +  ++    + N  + 
Sbjct  196   VNKLVKMAEASSIFTDAFNKKRRLPGLDYSIENTETTSFYDDHSSTSKQETGNLLN--QH  253

Query  1064  YGNFETLPQAPS-GDSRFSSPSTQTDTPEISSLHTKHPGAD  1183
             + +   L   P+  +S   + STQ+   +  S H KHP  D
Sbjct  254   FSDKLRLGLCPAMTESNIITLSTQSSNEDNGSPHGKHPECD  294



>ref|XP_011084620.1| PREDICTED: heat stress transcription factor A-1-like [Sesamum 
indicum]
Length=474

 Score =   189 bits (481),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 144/219 (66%), Gaps = 23/219 (11%)
 Frame = +2

Query  365  GTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNF  544
            GT   + SP PFL+KTY++VDD A  AVVSWSR   SFVVWN PEFARDLLPKYFKHNNF
Sbjct  11   GTASSATSPPPFLSKTYDMVDDPATDAVVSWSRSNNSFVVWNVPEFARDLLPKYFKHNNF  70

Query  545  SSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHS---------HSAQP  697
            SSF+RQLNTYGFRK+D ++WEFAN+ F+RGQ HLLK+I+RRK   +         HS+  
Sbjct  71   SSFVRQLNTYGFRKVDPDRWEFANEGFLRGQKHLLKSINRRKASQAQGQQQPAQIHSSSV  130

Query  698  NSGVPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQ  877
             S + +    +   EEE+ERLK++ + L  EL R  Q+ +    + Q++  R+  +++RQ
Sbjct  131  GSCIEVG---KFGIEEEVERLKRDKNVLMQELVRLRQQQQSTDHQLQTVGQRVHVMEQRQ  187

Query  878  RQVLALVAQLSLKPD----LLH-------HLEVHNKKRK  961
            +Q+++ +A+    PD    L+H       H+   NKKR+
Sbjct  188  QQMMSFLAKAVQSPDFVAQLVHQQNEGNRHISGSNKKRR  226



>ref|XP_003631489.1| PREDICTED: heat shock factor protein HSF8 [Vitis vinifera]
Length=496

 Score =   190 bits (482),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 136/191 (71%), Gaps = 8/191 (4%)
 Frame = +2

Query  380  SASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIR  559
            S +P PFL+KTY++VDD A +++VSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+R
Sbjct  29   SNAPPPFLSKTYDMVDDPATNSIVSWSPTNNSFVVWNPPEFARDLLPKYFKHNNFSSFVR  88

Query  560  QLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS--------AQPNSGVPL  715
            QLNTYGFRK+D ++WEFAN+ F+RGQ HLL++I+RRKP H H+        +Q +S    
Sbjct  89   QLNTYGFRKVDPDRWEFANEGFLRGQKHLLRSINRRKPAHGHNLQQPQQSHSQGSSVGAC  148

Query  716  SeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLAL  895
             E  +   EEE+ERLK++ + L  EL R  Q+ +    + Q++  RLQ +++RQ+Q+++ 
Sbjct  149  VEVGKFGLEEEVERLKRDKNVLMQELVRLRQQQQTTDNQLQTMVQRLQGMEQRQQQMMSF  208

Query  896  VAQLSLKPDLL  928
            +A+    P  L
Sbjct  209  LAKAVQSPGFL  219



>ref|XP_008338589.1| PREDICTED: heat stress transcription factor A-5-like [Malus domestica]
Length=483

 Score =   189 bits (481),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 136/209 (65%), Gaps = 15/209 (7%)
 Frame = +2

Query  398  FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
            FL KTY++VDD A   +VSWS   +SF+VWNPPEFAR LLP YFKHNNFSSFIRQLNTYG
Sbjct  16   FLLKTYDMVDDSATDEIVSWSSNKKSFIVWNPPEFARVLLPTYFKHNNFSSFIRQLNTYG  75

Query  578  FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeier  757
            FRKID E+WEFAN++FI+ Q HLLKNIHRRKPIHSHS    S V   + ER   ++EIE+
Sbjct  76   FRKIDPERWEFANEDFIQDQKHLLKNIHRRKPIHSHSNPQGSMV---DSERAALDDEIEK  132

Query  758  LKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHHL  937
            L  + ++L   + R +Q+    + + + L  R+  +++RQ+ ++  + +    P+ + HL
Sbjct  133  LSHDKAALEANISRFKQQRSAAKLQLEDLTQRVNGMEQRQKNLVTFLDRAVHNPNFVEHL  192

Query  938  E----------VHNKKRKPSVSNGHLELV  994
                        H K+R P +   HL+ V
Sbjct  193  TRKIESMDFSAYHKKRRLPDID--HLQPV  219



>ref|XP_004134371.1| PREDICTED: heat stress transcription factor A-5-like [Cucumis 
sativus]
Length=467

 Score =   189 bits (480),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 132/180 (73%), Gaps = 3/180 (2%)
 Frame = +2

Query  398  FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
            FL KTY++VDD +   +VSW+   +SFVVWNPPEFAR LLP +FKH+NFSSFIRQLNTYG
Sbjct  18   FLIKTYDMVDDSSTDEIVSWTSSKKSFVVWNPPEFARLLLPTFFKHSNFSSFIRQLNTYG  77

Query  578  FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeier  757
            FRKID+E+WEFAN++FI+ Q HLLKNIHRRKPIHSHS    S +   +PER  FE+EIER
Sbjct  78   FRKIDSEKWEFANEDFIKDQKHLLKNIHRRKPIHSHSNPQGSHI---DPERAAFEDEIER  134

Query  758  LKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHHL  937
            L +E ++L   + R +Q+    + + Q L  +++S+++RQ+ +LA + +    P  + HL
Sbjct  135  LAREKTTLETNISRFKQQKSTAKLQLQDLTVKVESMEKRQKNLLAFLEKAVQNPSFVEHL  194



>ref|XP_008222805.1| PREDICTED: heat stress transcription factor A-5 [Prunus mume]
Length=483

 Score =   189 bits (481),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 138/209 (66%), Gaps = 15/209 (7%)
 Frame = +2

Query  398  FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
            FL KTY++VDD A   +VSWS   +SF+VWNPPEFAR LLP YFKHNNFSSFIRQLNTYG
Sbjct  16   FLLKTYDMVDDSATDEIVSWSTNKKSFIVWNPPEFARLLLPTYFKHNNFSSFIRQLNTYG  75

Query  578  FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeier  757
            FRKID E+WEFAN++FI+ Q HLLKNIHRRKPIHSHS    S V   +PER   ++EIE+
Sbjct  76   FRKIDPERWEFANEDFIQDQKHLLKNIHRRKPIHSHSNPQGSMV---DPERAALDDEIEK  132

Query  758  LKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHHL  937
            L  + ++L   + R +Q+  + + + + L  R+ S+++RQ+ +L  + +    P  + HL
Sbjct  133  LSHDKATLEANISRFKQQRSDAKLQLEDLTQRVNSMEQRQKDLLKFLDKNVQNPTFVEHL  192

Query  938  E----------VHNKKRKPSVSNGHLELV  994
                        + K+R P V   HL+ V
Sbjct  193  TRKIEAMDFSACNKKRRLPDVD--HLQPV  219



>ref|XP_008800101.1| PREDICTED: heat stress transcription factor A-1-like [Phoenix 
dactylifera]
Length=484

 Score =   189 bits (481),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 139/215 (65%), Gaps = 16/215 (7%)
 Frame = +2

Query  389  PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
            P PFL+KTYE+VDD A  A+VSW     SFVVWN PEFARDLLPKYFKHNNFSSF+RQLN
Sbjct  2    PPPFLSKTYEMVDDPATDAIVSWGLANNSFVVWNTPEFARDLLPKYFKHNNFSSFVRQLN  61

Query  569  TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS----AQP-NSGVPLSeperr  733
            TYGFRK+D ++WEFAN+ F+RG+  LL+ I+RRKP H+HS    +QP N+ V       +
Sbjct  62   TYGFRKVDPDRWEFANEGFLRGRKDLLRTINRRKPSHAHSQTQQSQPQNASVAACVEVGK  121

Query  734  -efeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLS  910
               +EEIERLK++   L  EL R  Q+ +    + Q+L  RLQ +++RQ+Q+++ +A+  
Sbjct  122  FGLDEEIERLKRDKDVLMQELVRLRQQQQTTDHQLQTLGKRLQGMEQRQQQMMSFLAKAM  181

Query  911  LKPDLL----------HHLEVHNKKRKPSVSNGHL  985
              P  L           H+   NKKR+     G L
Sbjct  182  QSPGFLAQLVQQNDNSRHIAGGNKKRRLPKQEGSL  216



>ref|XP_007209949.1| hypothetical protein PRUPE_ppa004782mg [Prunus persica]
 gb|EMJ11148.1| hypothetical protein PRUPE_ppa004782mg [Prunus persica]
Length=491

 Score =   189 bits (481),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 139/212 (66%), Gaps = 19/212 (9%)
 Frame = +2

Query  380  SASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIR  559
            S +P PFL+KTY++VDD A   VVSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+R
Sbjct  23   SNAPPPFLSKTYDMVDDPATDQVVSWSPTNNSFVVWNPPEFARDLLPKYFKHNNFSSFVR  82

Query  560  QLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS---AQP----NSGVPLS  718
            QLNTYGFRK+D ++WEFAN+ F+RGQ HLLK+I+RRKP H H     QP    NS     
Sbjct  83   QLNTYGFRKVDPDRWEFANEGFLRGQKHLLKSINRRKPAHGHGHQQPQPSQGQNSVAACV  142

Query  719  eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
            E  +   EEE+ERLK++ + L  EL +  Q+ +    + Q++  RL  +++RQ+Q+++ +
Sbjct  143  EVGKFGLEEEVERLKRDKNVLMQELIKLRQQQQSTDNQLQAMVQRLLGMEQRQQQMMSFL  202

Query  899  AQLSLKPDLLHH------------LEVHNKKR  958
            A+    P  L              +EV+ K+R
Sbjct  203  AKAVQSPSFLTQFVQQQNESNRRIIEVNKKRR  234



>gb|EMT02670.1| Heat stress transcription factor A-2e [Aegilops tauschii]
Length=320

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 132/201 (66%), Gaps = 3/201 (1%)
 Frame = +2

Query  359  MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
            MDG   G A P PFLAKTY++VDD A  AVVSW+    SFVVW+P  FA  LLP YFKH+
Sbjct  1    MDGL--GDAGPTPFLAKTYDMVDDPATDAVVSWTATSNSFVVWDPHLFATLLLPSYFKHS  58

Query  539  NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
            NFSSF+RQLNTYGFRK+D ++WEFAN+ F+RGQ HLL+NI RRKP H    Q + G  L 
Sbjct  59   NFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGQRHLLRNIKRRKPTHGSQNQQSLGSYLE  118

Query  719  eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
                   + EI+ LK++   L  E+ +  QE +  R + Q+++ RLQ  +++Q+Q+++ +
Sbjct  119  -VGNFGHDVEIDHLKRDKQLLMAEVVKLRQEQQNTRSDLQAMEKRLQGTEQKQQQMMSFL  177

Query  899  AQLSLKPDLLHHLEVHNKKRK  961
            A++   P  +  L   ++ RK
Sbjct  178  ARVMQNPMFIRQLISQSEMRK  198



>ref|XP_004166114.1| PREDICTED: heat stress transcription factor A-5-like [Cucumis 
sativus]
Length=472

 Score =   189 bits (480),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 132/180 (73%), Gaps = 3/180 (2%)
 Frame = +2

Query  398  FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
            FL KTY++VDD +   +VSW+   +SFVVWNPPEFAR LLP +FKH+NFSSFIRQLNTYG
Sbjct  18   FLIKTYDMVDDSSTDEIVSWTSSKKSFVVWNPPEFARLLLPTFFKHSNFSSFIRQLNTYG  77

Query  578  FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeier  757
            FRKID+E+WEFAN++FI+ Q HLLKNIHRRKPIHSHS    S +   +PER  FE+EIER
Sbjct  78   FRKIDSEKWEFANEDFIKDQKHLLKNIHRRKPIHSHSNPQGSHI---DPERAAFEDEIER  134

Query  758  LKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHHL  937
            L +E ++L   + R +Q+    + + Q L  +++S+++RQ+ +LA + +    P  + HL
Sbjct  135  LSREKTTLETNISRFKQQKSTAKLQLQDLTVKVESMEKRQKNLLAFLEKAVQNPSFVEHL  194



>ref|NP_001046889.1| Os02g0496100 [Oryza sativa Japonica Group]
 sp|Q6K6S5.1|HSFA5_ORYSJ RecName: Full=Heat stress transcription factor A-5; AltName: 
Full=Heat stress transcription factor 6; Short=OsHsf-06 [Oryza 
sativa Japonica Group]
 dbj|BAD23142.1| putative heat stress transcription factor Spl7 [Oryza sativa 
Japonica Group]
 dbj|BAF08803.1| Os02g0496100 [Oryza sativa Japonica Group]
 dbj|BAG89603.1| unnamed protein product [Oryza sativa Japonica Group]
Length=475

 Score =   189 bits (480),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 125/281 (44%), Positives = 171/281 (61%), Gaps = 21/281 (7%)
 Frame = +2

Query  389   PAPFLAKTYELVDDRANSAVVSWSRGG-RSFVVWNPPEFARDLLPKYFKHNNFSSFIRQL  565
             PAPFL KTYE+VDD +  AVVSWS     SFVVWN PEFA  LLP YFKH+NFSSFIRQL
Sbjct  19    PAPFLLKTYEMVDDPSTDAVVSWSDASDASFVVWNHPEFAARLLPAYFKHSNFSSFIRQL  78

Query  566   NTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefee  745
             NTYGFRKID E+WEFAN+ FI+GQ HLLKNIHRRKPIHSHS  P +   L + ER  FE+
Sbjct  79    NTYGFRKIDPERWEFANEYFIKGQKHLLKNIHRRKPIHSHSHPPGA---LPDNERAIFED  135

Query  746   eierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDL  925
             EIERL +E S+L+ +L + +Q+      + + L+ R+  +++RQ +++A + Q S  P  
Sbjct  136   EIERLSREKSNLQADLWKSKQQQSGTMNQIEDLERRVLGMEQRQTKMIAFLQQASKNPQF  195

Query  926   LHHL-----------EVHNKKRK-PSV--SNGHLELVNNLDSSITVCQKILNGISNGEEA  1063
             ++ L           +  NKKR+ P +  S  + E  +  D   +  ++    + N  + 
Sbjct  196   VNKLVKMAEASSIFTDAFNKKRRLPGLDYSIENTETTSFYDDHSSTSKQETGNLLN--QH  253

Query  1064  YGNFETLPQAPS-GDSRFSSPSTQTDTPEISSLHTKHPGAD  1183
             + +   L   P+  +S   + STQ+   +  S H KHP  D
Sbjct  254   FSDKLRLGLCPAMTESNIITLSTQSSNEDNRSPHGKHPECD  294



>ref|XP_007163811.1| hypothetical protein PHAVU_001G266300g [Phaseolus vulgaris]
 gb|ESW35805.1| hypothetical protein PHAVU_001G266300g [Phaseolus vulgaris]
Length=441

 Score =   188 bits (477),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 145/221 (66%), Gaps = 17/221 (8%)
 Frame = +2

Query  359  MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
            M+GT  GS  PAPFL KTYE+VD+ +   +VSWS    +F+VWNP EF+R LLP +FKHN
Sbjct  4    MEGT--GSTDPAPFLLKTYEMVDESSTDEIVSWSSTNNTFIVWNPAEFSRLLLPTFFKHN  61

Query  539  NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
            NFSSFIRQLNTYGFRK+  E+WEFAN++F++ Q HLL NIHRRKPIHSHS       P+ 
Sbjct  62   NFSSFIRQLNTYGFRKVHPERWEFANEDFLKDQKHLLNNIHRRKPIHSHSLTQ----PVV  117

Query  719  eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
            + ER  FEE+I++L Q+N++++  + R +  +       Q L  RL +++ERQ+ +L + 
Sbjct  118  DSERSAFEEQIQKLSQDNTTIQSNILRFKHLHSAANTHLQDLRLRLDAMEERQQNLLTVF  177

Query  899  AQLSLKPDLLHH---------LEVHNKKRK--PSVSNGHLE  988
             +    P L+ H         L  +NKKR+  P + + HL+
Sbjct  178  QKALHNPALVQHITRKIESMDLLAYNKKRRLPPQLHDLHLQ  218



>ref|XP_010439797.1| PREDICTED: heat stress transcription factor A-4a-like [Camelina 
sativa]
 ref|XP_010439798.1| PREDICTED: heat stress transcription factor A-4a-like [Camelina 
sativa]
 ref|XP_010439799.1| PREDICTED: heat stress transcription factor A-4a-like [Camelina 
sativa]
 ref|XP_010439801.1| PREDICTED: heat stress transcription factor A-4a-like [Camelina 
sativa]
 ref|XP_010439802.1| PREDICTED: heat stress transcription factor A-4a-like [Camelina 
sativa]
 ref|XP_010439803.1| PREDICTED: heat stress transcription factor A-4a-like [Camelina 
sativa]
Length=394

 Score =   187 bits (474),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 138/357 (39%), Positives = 202/357 (57%), Gaps = 52/357 (15%)
 Frame = +2

Query  374   GGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSF  553
             G S+S  PFL KTYE+VDD ++ ++VSWS+  +SF+VWNPPEF+RDLLP++FKHNNFSSF
Sbjct  8     GSSSSLPPFLTKTYEMVDDSSSDSIVSWSQSNKSFIVWNPPEFSRDLLPRFFKHNNFSSF  67

Query  554   IRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS-----AQPNSGVPLS  718
             IRQLNTYGFRK D EQWEFAND+F+RGQ HL+KNI RRKP+HSHS     AQ N    L+
Sbjct  68    IRQLNTYGFRKADPEQWEFANDDFVRGQPHLMKNIRRRKPVHSHSLPNLQAQQNL---LT  124

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
             + ER   + +IERL +E   L  EL ++++E      + + L  RLQ +++RQ+ +++ V
Sbjct  125   DSERVRMKNQIERLTKEKEGLLEELQKQDEEREGFEMQVKELKERLQHMEKRQKTMVSFV  184

Query  899   AQLSLKPDLLHHL-----EVHNKKRK-PSV---------------------------SNG  979
             +Q+  KP L  +L     E + +KR+ P +                           S+ 
Sbjct  185   SQVLEKPGLALNLSPCVPEPNERKRRFPRIGFLPDEPMMEENQTCVVVREEGSTSPSSHT  244

Query  980   HLELVNNLDSSITVCQKILNGISNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSL  1159
               + V  L SSI + +   N +S+  E+     ++      DS     ST  ++P +S +
Sbjct  245   TEQQVEQLGSSIAIWE---NLVSDSCESMLQTRSMMTLDVDDS-----STCPESPPLSCI  296

Query  1160  HT---KHPGADGNAKAAWNCAAVDVDRLKDRLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
                  K P +  + +     +  DV + ++     ++     V G NDVFWQQF +E
Sbjct  297   QLSIDKRPKSPPSPRIIDMNSEPDVTKEQNNTVAAAAAPPPSVAGANDVFWQQFFSE  353



>ref|XP_004952518.1| PREDICTED: heat stress transcription factor A-5-like [Setaria 
italica]
Length=482

 Score =   189 bits (479),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 149/232 (64%), Gaps = 18/232 (8%)
 Frame = +2

Query  389   PAPFLAKTYELVDDRANSAVVSWSRGGR-SFVVWNPPEFARDLLPKYFKHNNFSSFIRQL  565
             PAPFL KTYE+VDD ++ AVVSWS     SFVVWNPPEFA  +LP YFKH+NFSSFIRQL
Sbjct  24    PAPFLLKTYEMVDDPSSDAVVSWSDASDGSFVVWNPPEFAARMLPTYFKHSNFSSFIRQL  83

Query  566   NTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefee  745
             NTYGF KID E+WEFAN+ F++GQ  LLKNIHRRKPIHSHS QP +   L + ER  FE+
Sbjct  84    NTYGFHKIDPERWEFANEYFVKGQKQLLKNIHRRKPIHSHSHQPGA---LPDNERALFED  140

Query  746   eierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDL  925
             EI+RL +E ++L+ +L +  Q+      + + L+ R+  +++RQ ++L+ + Q S  P  
Sbjct  141   EIDRLSREKTTLQTDLWKFNQQQSGAMSQIEDLERRVLDMEQRQVKMLSFLQQASKNPQF  200

Query  926   LHHL------------EVHNKKRKPSV--SNGHLELVNNLDSSITVCQKILN  1039
             +  L              H K+R P +  SN   E  +  D S T  Q++ N
Sbjct  201   VSKLAKMAEASPIFADAFHKKRRLPGLEYSNEAAETTSYDDHSSTSRQEMGN  252



>ref|NP_001147891.1| heat shock factor protein HSF30 [Zea mays]
 gb|ACF86882.1| unknown [Zea mays]
 gb|ACG29041.1| heat shock factor protein HSF30 [Zea mays]
 gb|ACR38763.1| unknown [Zea mays]
 gb|AFT82675.1| HSF11 transcription factor, partial [Zea mays subsp. mays]
 tpg|DAA51899.1| TPA: heat shock factor protein HSF30 [Zea mays]
Length=359

 Score =   186 bits (471),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 110/250 (44%), Positives = 153/250 (61%), Gaps = 19/250 (8%)
 Frame = +2

Query  359   MDGTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHN  538
             MD    GS+   PFL KTY++VDD   +AVVSWS    SFVVW+P  F   LLP+YFKHN
Sbjct  29    MDVLHDGSS--PPFLTKTYDMVDDPTTNAVVSWSAANNSFVVWDPHIFGTVLLPRYFKHN  86

Query  539   NFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLS  718
             NFSSF+RQLNTYGFRK+D ++WEFAN+EF+RGQ HLLKNI RRKP HS   Q + G  L 
Sbjct  87    NFSSFVRQLNTYGFRKVDPDRWEFANEEFLRGQRHLLKNIRRRKPPHSSPNQQSLGSYLE  146

Query  719   eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
                   +EEEI++LK++   L  E+ +  QE++  R + Q+++ +LQ  +++Q+Q++A +
Sbjct  147   -VGHFGYEEEIDQLKRDKQLLMAEVVKLRQEHQNTRSDLQAMEEKLQDTEQKQQQMMAFM  205

Query  899   AQLSLKPDLLHHLEVHNKKRKPSVSNGHLELVNNLDSSITVCQKILNGISNGEEA--YGN  1072
             A++   PD +  L    + RK             L+ +I+  +K    I  G EA   G 
Sbjct  206   ARVMQNPDFMRQLISQREMRK------------ELEDAIS--KKRRRRIDQGHEAGSMGT  251

Query  1073  FETLPQAPSG  1102
               +L Q P G
Sbjct  252   GSSLEQGPQG  261



>dbj|BAJ86783.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88718.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   188 bits (477),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 125/282 (44%), Positives = 173/282 (61%), Gaps = 24/282 (9%)
 Frame = +2

Query  395   PFLAKTYELVDDRANSAVVSWSRGG-RSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNT  571
             PFL KTYE+VDD A  AVVSWS     SFVVWN PEFA  LLP YFKH+NFSSFIRQLNT
Sbjct  19    PFLLKTYEMVDDPATDAVVSWSDASDASFVVWNSPEFAARLLPAYFKHSNFSSFIRQLNT  78

Query  572   YGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeei  751
             YGFRKID E+WEF N+ F++GQ HLLKNI+RRKPIHSHS QP +    S+ ER  FE+EI
Sbjct  79    YGFRKIDPERWEFGNEYFVKGQKHLLKNIYRRKPIHSHSHQPAAQ---SDNERSFFEDEI  135

Query  752   erLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLH  931
             +RL +E ++L+ EL + +Q+     F+ ++L+ R   +++RQ +++A + Q S  P  + 
Sbjct  136   DRLAREKANLQAELWKFKQQEPGTMFQIEALERRAVDMEQRQGKMIAFLQQASKNPHFVS  195

Query  932   HL-----------EVHNKKRKPSVSNGHLELVNNL----DSSITVCQKILNGISNGEEAY  1066
              L           +  +KKR+ S  +  +E         D S T  Q++ N ++   + +
Sbjct  196   KLVKMAEASSMFADALHKKRRLSGLDYAVEATETASFCDDHSATSRQEMGNLLN---QHF  252

Query  1067  GNFETLPQAPS-GDSRFSSPSTQTDTPEISSLHTKH-PGADG  1186
              +   L   P+  +S   + STQ+   +  SLH +H PG DG
Sbjct  253   SDKLKLGLCPAETESNLITLSTQSSHEDNCSLHGRHPPGHDG  294



>ref|XP_008373593.1| PREDICTED: heat shock factor protein HSF8-like [Malus domestica]
Length=519

 Score =   189 bits (480),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 134/201 (67%), Gaps = 7/201 (3%)
 Frame = +2

Query  380  SASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIR  559
            S +P PFL KTY++VDD A   VVSW+    SFVVWNPPEFARDLLPKYFKHNNFSSF+R
Sbjct  37   SNAPPPFLCKTYDMVDDPATDPVVSWTPTNNSFVVWNPPEFARDLLPKYFKHNNFSSFVR  96

Query  560  QLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQ-------PNSGVPLS  718
            QLNTYGFRK+D ++WEFA++ F+RGQ  LLK+I+RRKP H HS Q        NS     
Sbjct  97   QLNTYGFRKVDPDRWEFAHEGFLRGQKDLLKSINRRKPAHGHSHQQPQPSHGQNSMGACV  156

Query  719  eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
            E  +   +EE+ERLK++ S L  EL R  Q+ +    + Q++  RLQ +++RQ+Q+++ +
Sbjct  157  EVGKFGLKEEVERLKRDKSVLMQELIRLRQQQQSTDNQLQTMVQRLQGMEQRQQQMMSFL  216

Query  899  AQLSLKPDLLHHLEVHNKKRK  961
            A+    P L       N+  +
Sbjct  217  AKAMHSPGLFTQFVQQNESSR  237



>gb|AFQ02689.1| heat stress transcription factor A-5-like protein, partial [Oncidium 
hybrid cultivar]
Length=445

 Score =   187 bits (476),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 138/200 (69%), Gaps = 12/200 (6%)
 Frame = +2

Query  398  FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
            FL KTY++VDD +   +VSWS    SFVVWNPPEF+  LLP YFKH+NFSSFIRQLNTYG
Sbjct  1    FLVKTYDMVDDSSTDEIVSWSSANTSFVVWNPPEFSSRLLPTYFKHSNFSSFIRQLNTYG  60

Query  578  FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeier  757
            FRKID E+WEFANDEF++GQ H LKNI+RRKPIHSH+  P   V  ++ ER   EEEIER
Sbjct  61   FRKIDPERWEFANDEFVKGQKHKLKNIYRRKPIHSHTNPP---VVAADAERSTLEEEIER  117

Query  758  LKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHHL  937
            L++E ++L+ +L R +Q+    +F+ + ++ RL  +++RQ ++++ + +    P  + +L
Sbjct  118  LQREKAALQADLWRFKQQQSGTKFQLEDIERRLMDMEQRQVKMVSFLQRAVQNPKFVENL  177

Query  938  ---------EVHNKKRKPSV  970
                      +H K+R P V
Sbjct  178  VMMAGSSASALHKKRRHPGV  197



>emb|CDX99415.1| BnaC01g11370D [Brassica napus]
Length=384

 Score =   186 bits (471),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 140/191 (73%), Gaps = 4/191 (2%)
 Frame = +2

Query  374  GGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSF  553
            G S+S  PFL KTYE+VDD ++ ++VSWSR  RSF+VWNPPEF+RDLLP++FKHNNFSSF
Sbjct  8    GSSSSLPPFLTKTYEMVDDSSSDSIVSWSRSNRSFIVWNPPEFSRDLLPRFFKHNNFSSF  67

Query  554  IRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPN---SGVPLSep  724
            IRQLNTYGFRK D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS  PN      PL++ 
Sbjct  68   IRQLNTYGFRKADPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSL-PNLQSQQNPLTDS  126

Query  725  errefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQ  904
            ER     +IERL +E   L  +L ++EQE        ++L  +LQ +++RQ+ + + V+Q
Sbjct  127  ERLRMSSQIERLTKEKEGLLQKLHKQEQERDVFEQHVKTLKDQLQHMEKRQKTMDSYVSQ  186

Query  905  LSLKPDLLHHL  937
            +   P+L  +L
Sbjct  187  VMETPELALNL  197



>ref|XP_009136968.1| PREDICTED: heat stress transcription factor A-4a-like [Brassica 
rapa]
Length=390

 Score =   186 bits (472),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 138/345 (40%), Positives = 196/345 (57%), Gaps = 47/345 (14%)
 Frame = +2

Query  395   PFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTY  574
             PFL KTYE+VDD ++ ++VSWS+  +SF+VWNPPEF+RDLLPK+FKHNNFSSFIRQLNTY
Sbjct  16    PFLTKTYEMVDDSSSDSIVSWSQSNKSFIVWNPPEFSRDLLPKFFKHNNFSSFIRQLNTY  75

Query  575   GFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeie  754
             GFRK D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS       PL++ ER+   ++IE
Sbjct  76    GFRKADPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSLPNLQPHPLTDSERQRMNDKIE  135

Query  755   rLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHH  934
             RL +E   L  EL + E+E      + + L  +L  +++RQR +++ V+Q+  KP+L  +
Sbjct  136   RLTKEKQVLLEELHKHEEERELFEQQVKKLKDQLHHMEKRQRTMVSSVSQVLEKPELALN  195

Query  935   L-----EVHNKKRK-PSVSNGHLEL---------------------------VNNLDSSI  1015
             L     E +++KR+ P V      L                           V  L+SSI
Sbjct  196   LSPCLPEANDRKRRFPRVVGLETMLEENHQTCGAVREEGSTSTSSHDATEHQVERLESSI  255

Query  1016  TVCQKILNGI--SNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGADGN  1189
              + + +++    S  ++   N  TL             ST  ++P +S +       D  
Sbjct  256   AIWENLVSDSCESMEQQETRNMMTL--------DVDESSTCPESPPLSCIQL---SIDIR  304

Query  1190  AKAAWNCAAVDVDRLKD-RLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
              K+  +   +D++   D   E  + +   P VG NDVFWQQ LTE
Sbjct  305   LKSPPSPRTIDMNSEPDVSKEQNTVSPTPPAVGANDVFWQQLLTE  349



>ref|XP_002298675.2| Heat Stress Transcription Factor family protein [Populus trichocarpa]
 gb|EEE83480.2| Heat Stress Transcription Factor family protein [Populus trichocarpa]
Length=490

 Score =   188 bits (478),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 131/183 (72%), Gaps = 3/183 (2%)
 Frame = +2

Query  389  PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
            PAPFL KTY++VDD +   +VSWS    SFVVWNPPEFAR LLP +FKHNNFSSFIRQLN
Sbjct  20   PAPFLVKTYDMVDDSSTDEIVSWSSNKNSFVVWNPPEFARLLLPTFFKHNNFSSFIRQLN  79

Query  569  TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeee  748
            TYGFRKID E+WEFAN++F++ Q HLLKNI+RRKPIHSHS QP     L +PER  +EEE
Sbjct  80   TYGFRKIDPERWEFANEDFVKDQKHLLKNIYRRKPIHSHS-QPQGS--LVDPERAAYEEE  136

Query  749  ierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLL  928
            IE+L ++ + L+  +   EQ+    + + + L  ++ ++ +RQ ++L+ + +    P  +
Sbjct  137  IEKLARDKAKLKASILGFEQQRSSAKLQVEDLTQKIDTMQQRQEKLLSFLEKAVQNPTFV  196

Query  929  HHL  937
             HL
Sbjct  197  EHL  199



>ref|XP_010246534.1| PREDICTED: heat stress transcription factor A-5 [Nelumbo nucifera]
Length=490

 Score =   188 bits (478),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 140/215 (65%), Gaps = 15/215 (7%)
 Frame = +2

Query  389  PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
            PAPFL KTY++VDD +   +VSWS    SFVVWNPPEFAR LLP YFKHNNFSSFIRQLN
Sbjct  16   PAPFLLKTYDMVDDSSTDEIVSWSSKKNSFVVWNPPEFARLLLPTYFKHNNFSSFIRQLN  75

Query  569  TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSA-QPNSGVPLSeperrefee  745
            TYGFRKID E+WEFAND+F + Q HLLKNIHRRKPIHSHS  Q +SG    + ER   EE
Sbjct  76   TYGFRKIDPERWEFANDDFAKDQKHLLKNIHRRKPIHSHSQPQGSSG----DSERAALEE  131

Query  746  eierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDL  925
            EI RL QE  +L   L   +Q+    + + + L+ R+  + +RQ +++  +A+    P  
Sbjct  132  EIGRLSQEKDALHNTLCTFKQQQSVTKVQLEDLERRVHEMGQRQLRMMNFLAKAVQNPTF  191

Query  926  LHHL----------EVHNKKRKPSVSNGHLELVNN  1000
            + +L          E   KKR+  +++   E++++
Sbjct  192  VENLIQMVGSCMDIEAITKKRRIPIADYSHEILDD  226



>gb|EMT08035.1| Heat stress transcription factor A-5 [Aegilops tauschii]
Length=458

 Score =   187 bits (476),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 131/182 (72%), Gaps = 4/182 (2%)
 Frame = +2

Query  395  PFLAKTYELVDDRANSAVVSWSRGG-RSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNT  571
            PFL KTYE+VDD A  AVVSWS     SFVVWN PEFA  LLP YFKH+NFSSFIRQLNT
Sbjct  19   PFLLKTYEMVDDPATDAVVSWSDASDTSFVVWNSPEFAARLLPAYFKHSNFSSFIRQLNT  78

Query  572  YGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeei  751
            YGFRKID E+WEF N+ F++GQ HLLKNI+RRKPIHSHS QP +   L + ER  FE+EI
Sbjct  79   YGFRKIDPERWEFGNEYFVKGQKHLLKNIYRRKPIHSHSHQPGA---LPDNERSFFEDEI  135

Query  752  erLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLH  931
            +RL +E ++L+ EL + +Q+     F+ ++L+ R   +++RQ +++A + Q S  P  + 
Sbjct  136  DRLAREKANLQAELWKSKQQESGTMFQIEALERRAVDMEQRQGKMIAFLQQASKNPHFVG  195

Query  932  HL  937
             L
Sbjct  196  KL  197



>ref|XP_009406338.1| PREDICTED: heat stress transcription factor A-5-like [Musa acuminata 
subsp. malaccensis]
Length=477

 Score =   187 bits (476),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 134/204 (66%), Gaps = 14/204 (7%)
 Frame = +2

Query  389  PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
            PA FL KTY++VDD +   +VSWS    SFVVWNPP+FA  LLP YFKHNNFSSFIRQLN
Sbjct  9    PARFLLKTYDMVDDASTDDIVSWSSTNASFVVWNPPDFAARLLPTYFKHNNFSSFIRQLN  68

Query  569  TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeee  748
            TYGFRKID+E+WEFAN++F++GQ  LL NI RRKPIHSHS  P  G  L++ ER   EEE
Sbjct  69   TYGFRKIDSERWEFANEDFVKGQKRLLANIRRRKPIHSHSHPPGGG--LADSERAVLEEE  126

Query  749  ierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLL  928
            I+RL +E + L+  L + EQ+      + + L  RL  +++RQ +++A V +    P L+
Sbjct  127  IDRLNKEKAGLKDSLLKFEQQQSGTEIQIEDLKRRLADMEQRQLKMVAFVQRALQNPQLM  186

Query  929  HHL------------EVHNKKRKP  964
             +L             +H K+R P
Sbjct  187  ENLVKMAAASSVDFSYIHKKRRLP  210



>ref|XP_010909933.1| PREDICTED: heat stress transcription factor A-1-like [Elaeis 
guineensis]
Length=514

 Score =   188 bits (478),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 136/211 (64%), Gaps = 16/211 (8%)
 Frame = +2

Query  377  GSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFI  556
            G  +P PFL+KTY++VDD A  A+VSW  G  SFVVWN PEFARDLLPKYFKHNNFSSF+
Sbjct  26   GGNAPPPFLSKTYDMVDDPATDAIVSWGAGNNSFVVWNTPEFARDLLPKYFKHNNFSSFV  85

Query  557  RQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKP------IHSHSAQPNSGVPLS  718
            RQLNTYGFRK++ ++WEFAN+ F+RGQ HLLK I+RRKP       H    Q  +     
Sbjct  86   RQLNTYGFRKVNPDRWEFANEGFLRGQKHLLKTINRRKPGQTPSQAHQPQVQSTNLAACV  145

Query  719  eperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALV  898
            E  +   EEEIERLK++ + L  EL R  Q+ +    + Q+L  RL+ +++RQ+Q+++ +
Sbjct  146  EVGKFGLEEEIERLKRDKNVLMQELVRLRQQQQGTDRQLQTLGQRLKGMEQRQQQMMSFL  205

Query  899  AQLSLKPDLLH----------HLEVHNKKRK  961
            A+    P  L           H+   NKKR+
Sbjct  206  AKAMQSPGFLAQLVQQNDSNWHIAGMNKKRR  236



>dbj|BAJ86136.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=510

 Score =   188 bits (478),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 135/213 (63%), Gaps = 18/213 (8%)
 Frame = +2

Query  377  GSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFI  556
            G+ +P PFL KTY++VDD A  AVVSW     SF+VWN PEFARDLLPKYFKHNNFSSF+
Sbjct  21   GAGAPPPFLMKTYDMVDDPATDAVVSWGPASNSFIVWNTPEFARDLLPKYFKHNNFSSFV  80

Query  557  RQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS----------------  688
            RQLNTYGFRK+D ++WEFAN+ F+RGQ HLLK I+RRKP+H+++                
Sbjct  81   RQLNTYGFRKVDPDKWEFANEGFLRGQKHLLKTINRRKPLHANNQVQVQQQQHQQQHQQQ  140

Query  689  -AQPNSGVP-LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQS  862
                N+ +P   E  +   EEEIE LK++ + L  EL R  Q+ +    + Q+L  RL  
Sbjct  141  PQLQNAPIPSCVEVGKFGMEEEIEMLKRDKNVLMQELVRLRQQQQTTDHQLQTLGKRLHG  200

Query  863  IDERQRQVLALVAQLSLKPDLLHHLEVHNKKRK  961
            +++RQ+Q+++ +A+    P  L      N+  K
Sbjct  201  MEQRQQQMMSFLAKAMQSPGFLAQFVQQNENSK  233



>ref|XP_002466300.1| hypothetical protein SORBIDRAFT_01g005250 [Sorghum bicolor]
 gb|EER93298.1| hypothetical protein SORBIDRAFT_01g005250 [Sorghum bicolor]
Length=339

 Score =   184 bits (467),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 130/193 (67%), Gaps = 1/193 (1%)
 Frame = +2

Query  383  ASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQ  562
              P PFL KTY++VDD    AVVSWS    SF+VW+P  F   LLP+YFKHNNFSSF+RQ
Sbjct  35   GGPPPFLTKTYDMVDDPTTDAVVSWSATSNSFIVWDPHIFGTVLLPRYFKHNNFSSFVRQ  94

Query  563  LNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefe  742
            LNTYGFRK+D ++WEFAN+EF+RGQ HLLKNI RRKP HS   Q + G  L       +E
Sbjct  95   LNTYGFRKVDPDRWEFANEEFLRGQRHLLKNIRRRKPPHSSPNQQSLGSYLE-VGHFGYE  153

Query  743  eeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPD  922
            EEI++LK++   L  E+ +  QE +  + + Q+++ +LQ  +++Q+Q++A +A++   PD
Sbjct  154  EEIDQLKRDKQLLMTEVVKLRQEQQNTKSDLQAMEEKLQDTEQKQQQMMAFMARVMQNPD  213

Query  923  LLHHLEVHNKKRK  961
             +  L    + RK
Sbjct  214  FMRQLISQREMRK  226



>ref|XP_010530018.1| PREDICTED: heat stress transcription factor A-1a [Tarenaya hassleriana]
Length=514

 Score =   188 bits (478),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 127/200 (64%), Gaps = 9/200 (5%)
 Frame = +2

Query  365  GTQGGSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNF  544
              Q  +A P PFL+KTY++V+D    AVVSWS    SF+VWNPPEFARDLLPKYFKHNNF
Sbjct  34   AAQSANALPPPFLSKTYDMVEDPKTDAVVSWSPTNNSFIVWNPPEFARDLLPKYFKHNNF  93

Query  545  SSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSep  724
            SSF+RQLNTYGFRK+D ++WEFAN+ F+RGQ HLLK I RRKP+H H    +        
Sbjct  94   SSFVRQLNTYGFRKVDPDRWEFANEGFLRGQKHLLKTITRRKPVHGHGPPQSQQPQGQSS  153

Query  725  erref---------eeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQ  877
                          EEE+E+LK++ + L  EL +  Q+ +      Q++   LQ +++RQ
Sbjct  154  TSVSACVEVGKFGLEEEVEQLKRDKNVLMQELVKLRQQQQTTDNHLQTMVKHLQVMEQRQ  213

Query  878  RQVLALVAQLSLKPDLLHHL  937
            +Q+++ +A+    P  L H 
Sbjct  214  QQIMSFLAKAMQNPTFLSHF  233



>gb|EYU45384.1| hypothetical protein MIMGU_mgv1a027027mg [Erythranthe guttata]
Length=461

 Score =   187 bits (475),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 132/197 (67%), Gaps = 9/197 (5%)
 Frame = +2

Query  386  SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQL  565
            SP PFL+KTY++VDD A  AVVSWS+G  SFVVWN PEF+RDLLPKYFKHNNFSSF+RQL
Sbjct  20   SPPPFLSKTYDMVDDPATDAVVSWSKGNNSFVVWNVPEFSRDLLPKYFKHNNFSSFVRQL  79

Query  566  NTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS--------AQPNSGVPLSe  721
            NTYGFRK+D + WEFAN+ F+RG  HLLKNI+RRKP H+           Q +S     E
Sbjct  80   NTYGFRKVDPDHWEFANEGFLRGHKHLLKNINRRKPSHAQIQQQQQPAKTQNSSVGSCIE  139

Query  722  perrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVA  901
                  + E+E LK++ ++L  EL R  Q+ +    + Q++  R+  +++RQ+Q+++ +A
Sbjct  140  VGSSGIDGEVESLKRDKNNLMQELVRLRQQQQSTDNQLQTVGQRVHVMEQRQQQMMSFLA  199

Query  902  QLSLKPDLLHHLEVHNK  952
            +    P  +  L VH +
Sbjct  200  KAMQSPGFMSQL-VHQQ  215



>gb|AIG20080.1| HSF13 [Gossypium hirsutum]
Length=495

 Score =   187 bits (476),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 132/201 (66%), Gaps = 13/201 (6%)
 Frame = +2

Query  389  PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
            PAPFL KTY++VDD +   +VSWS   +SFVVWNPP+FAR LLP YFKHNNFSSFIRQLN
Sbjct  22   PAPFLIKTYDMVDDSSTDDIVSWSSNKKSFVVWNPPDFARLLLPTYFKHNNFSSFIRQLN  81

Query  569  TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeee  748
            TYGFRKID E+WEFAN++F++ Q HLLKNIHRRKPIHSHS   N    L + ER  +EEE
Sbjct  82   TYGFRKIDPERWEFANEDFVKDQRHLLKNIHRRKPIHSHS---NPQGSLIDHERAGYEEE  138

Query  749  ierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLL  928
            IE+L +E ++L  ++ R EQE    + + + L  +   ++ RQ  +   + +    P   
Sbjct  139  IEKLSREKAALEADVLRSEQERSSLKHQVEELTQQADQMERRQETLFNFLEKALQDPAFA  198

Query  929  HHL----------EVHNKKRK  961
             HL            +NKKR+
Sbjct  199  EHLFRRIESMDDVAAYNKKRR  219



>ref|XP_011079918.1| PREDICTED: heat stress transcription factor A-7a [Sesamum indicum]
Length=360

 Score =   184 bits (468),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 129/192 (67%), Gaps = 0/192 (0%)
 Frame = +2

Query  386  SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQL  565
             P PFL KTYE+VDD +   +VSW+RGG SFVVW+P  F+  +L +YFKHNNFSSF+RQL
Sbjct  47   GPPPFLTKTYEMVDDFSTDRIVSWNRGGHSFVVWDPHAFSTTVLSRYFKHNNFSSFVRQL  106

Query  566  NTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefee  745
            NTYGFRKID ++WEFAND F+RGQ HLL+NI RRK     S  P++  P  E  R   + 
Sbjct  107  NTYGFRKIDPDKWEFANDSFLRGQKHLLRNIKRRKATTQPSPPPHAIGPCVELGRFGLDA  166

Query  746  eierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDL  925
            EI+ L+++   L +EL +  Q+ +  R   Q ++ +LQ  + +Q+Q+++ +A+    P+ 
Sbjct  167  EIDSLRRDKRVLTMELIKLRQQQQNTRDYLQQMELKLQGTERKQQQMMSFLARAMQNPEF  226

Query  926  LHHLEVHNKKRK  961
            +H L  H +KRK
Sbjct  227  IHQLVQHKEKRK  238



>gb|ADX69244.1| heat shock transcription factor A4a [Brassica napus]
Length=389

 Score =   185 bits (470),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 137/344 (40%), Positives = 195/344 (57%), Gaps = 46/344 (13%)
 Frame = +2

Query  395   PFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTY  574
             PFL KTYE+VDD ++ ++VSWS+  +SF+VWNPPEF+RDLLPK+FKHNNFSSFIRQLNTY
Sbjct  16    PFLTKTYEMVDDSSSDSIVSWSQSNKSFIVWNPPEFSRDLLPKFFKHNNFSSFIRQLNTY  75

Query  575   GFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeie  754
             GFRK D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS       PL++ ER+   ++IE
Sbjct  76    GFRKADPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSLPNLQPHPLTDSERQRMNDKIE  135

Query  755   rLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHH  934
             RL +E   L  EL + E+E      + + L  +L  +++RQR +++ V+Q+  KP+L  +
Sbjct  136   RLTKEKQVLLEELHKHEEERELFEQQVKKLKDQLHHMEKRQRTMVSSVSQVLEKPELALN  195

Query  935   L-----EVHNKKRK-PSVS--------------------------NGHLELVNNLDSSIT  1018
             L     E + +KR+ P V                           +     V  L+SSI 
Sbjct  196   LSPCLPEANERKRRFPRVGLETMLEENHQTCGAVREEGSTSTSSHDATEHQVERLESSIA  255

Query  1019  VCQKILNGI--SNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGADGNA  1192
             + + +++    S  ++   N  TL             ST  ++P +S +       D   
Sbjct  256   IWENLVSDSCESMEQQETRNMMTL--------DVDESSTCPESPPLSCIQL---SIDIRL  304

Query  1193  KAAWNCAAVDVDRLKD-RLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
             K+  +   +D++   D   E  + +   P VG NDVFWQQ LTE
Sbjct  305   KSPPSPRTIDMNSEPDVSKEQNTVSPTPPAVGANDVFWQQLLTE  348



>gb|AEB26582.1| heat shock factor A1a [Hordeum vulgare subsp. vulgare]
Length=467

 Score =   187 bits (474),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 107/251 (43%), Positives = 146/251 (58%), Gaps = 30/251 (12%)
 Frame = +2

Query  377   GSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFI  556
             G+ +P PFL KTY++VDD A  AVVSW     SF+VWN PEFARDLLPKYFKHNNFSSF+
Sbjct  21    GARAPPPFLMKTYDMVDDPATDAVVSWGPASNSFIVWNTPEFARDLLPKYFKHNNFSSFV  80

Query  557   RQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS----------------  688
             RQLNTYGFRK+D ++WEFAN+ F+RGQ HLLK I+RRKP+H+++                
Sbjct  81    RQLNTYGFRKVDPDKWEFANEGFLRGQKHLLKTINRRKPLHANNQVQVQQQQHQQQHQQQ  140

Query  689   -AQPNSGVP-LSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQS  862
                 N+ +P   E  +   EEEIE LK++ + L  EL R  Q+ +    + Q+L  RL  
Sbjct  141   PQLQNAPIPSCVEVGKFGMEEEIEMLKRDKNVLMQELVRLRQQQQTTDHQLQTLGKRLHG  200

Query  863   IDERQRQVLALVAQLSLKPDLLHHLEVHN------------KKRKPSVSNGHLELVNNLD  1006
             +++RQ+Q+++ +A+    P  L      N            K+R P   +G       LD
Sbjct  201   MEQRQQQMMSFLAKAMQSPGFLAQFVQQNENSKRRIVAANKKRRLPKQDDGLNPESALLD  260

Query  1007  SSITVCQKILN  1039
               I   Q ++N
Sbjct  261   GQIIKYQPMIN  271



>ref|XP_010673379.1| PREDICTED: heat stress transcription factor A-5 [Beta vulgaris 
subsp. vulgaris]
Length=475

 Score =   187 bits (475),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 139/217 (64%), Gaps = 15/217 (7%)
 Frame = +2

Query  377  GSASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFI  556
            G   PAPFL KTY+++DD +   +VSWS    SF+VWNPPEFAR LLP YFKHNNFSSFI
Sbjct  11   GGGGPAPFLLKTYDMIDDSSTDEIVSWSHSHDSFIVWNPPEFARLLLPTYFKHNNFSSFI  70

Query  557  RQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperre  736
            RQLNTYGFRKID E+WEFAN+EFI+ + HLLKNIHRRKPIHSHS  P       +PER  
Sbjct  71   RQLNTYGFRKIDPERWEFANEEFIKDKKHLLKNIHRRKPIHSHSQPP------PDPERAT  124

Query  737  feeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLK  916
            FEEEIE+L +E + L  ++   +  +   + + + +  R+  +++RQ ++L  + +    
Sbjct  125  FEEEIEKLSREKNELDAKVSGFKMHHCAAKSQIEDITQRICGMEQRQEKLLTHLQKAVQN  184

Query  917  PDLLHH---------LEVHNKKRKPSVSNGHLELVNN  1000
            P  + H         L  +NKKR+   S+  L  V N
Sbjct  185  PAFVEHLAQKIEAMDLTAYNKKRRLPRSDLFLPAVEN  221



>ref|XP_010540760.1| PREDICTED: heat stress transcription factor A-1d isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540761.1| PREDICTED: heat stress transcription factor A-1d isoform X1 [Tarenaya 
hassleriana]
Length=490

 Score =   187 bits (476),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 129/184 (70%), Gaps = 3/184 (2%)
 Frame = +2

Query  386  SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQL  565
            +P PFL+KTY++V+D A  ++VSWS    SFVVWNPPEFARDLLPKYFKHNNFSSF+RQL
Sbjct  45   APPPFLSKTYDMVNDPATDSIVSWSPTNNSFVVWNPPEFARDLLPKYFKHNNFSSFVRQL  104

Query  566  NTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHS---AQPNSGVPLSeperre  736
            NTYGFRK+D ++WEFAN+ F+RGQ HLLK I RRKP H H     Q +S     E  +  
Sbjct  105  NTYGFRKVDPDRWEFANEGFLRGQRHLLKTITRRKPAHGHQHSHGQNSSVGACVEVGKFG  164

Query  737  feeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLK  916
             EEE+ERLK++ + L  EL R  Q+ +    + Q +  RLQ +++RQ+Q+++ +A+    
Sbjct  165  LEEEVERLKRDKNVLMQELVRLRQQQQSTDNQLQKMVQRLQGMEQRQQQIMSFLAKAVQN  224

Query  917  PDLL  928
            P  L
Sbjct  225  PHFL  228



>emb|CDY69818.1| BnaAnng31620D [Brassica napus]
Length=390

 Score =   185 bits (469),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 138/345 (40%), Positives = 195/345 (57%), Gaps = 47/345 (14%)
 Frame = +2

Query  395   PFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTY  574
             PFL KTYE+VDD ++ ++VSWS+  +SF+VWNPPEF+RDLLPK+FKHNNFSSFIRQLNTY
Sbjct  16    PFLTKTYEMVDDSSSDSIVSWSQSNKSFIVWNPPEFSRDLLPKFFKHNNFSSFIRQLNTY  75

Query  575   GFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeie  754
             GFRK D EQWEFAND+F+RGQ HL+KNIHRRKP+HSHS       PL++ ER+   ++IE
Sbjct  76    GFRKADPEQWEFANDDFVRGQPHLMKNIHRRKPVHSHSLPNLQPHPLTDSERQRMNDKIE  135

Query  755   rLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHH  934
             RL +E   L  EL + E+E      + + L  +L  +++RQR +++ V+Q+  KP+L  +
Sbjct  136   RLTKEKQVLLEELHKHEEERELFEQQVKKLKDQLHHMEKRQRTMVSSVSQVLEKPELALN  195

Query  935   L-----EVHNKKRK-PSVSNGHLEL---------------------------VNNLDSSI  1015
             L     E + +KR+ P V      L                           V  L+SSI
Sbjct  196   LSPCLPEANERKRRFPRVVGLETMLEENHQTCGAVREEGSTSTSSHDATEHQVERLESSI  255

Query  1016  TVCQKILNGI--SNGEEAYGNFETLPQAPSGDSRFSSPSTQTDTPEISSLHTKHPGADGN  1189
              + + +++    S  ++   N  TL             ST  ++P +S +       D  
Sbjct  256   AIWENLVSDSCESMEQQETRNMMTL--------DVDESSTCPESPPLSCIQL---SIDIR  304

Query  1190  AKAAWNCAAVDVDRLKD-RLEGRSSTAAVPVVGGNDVFWQQFLTE  1321
              K+  +   +D++   D   E  + +   P VG NDVFWQQ LTE
Sbjct  305   LKSPPSPRTIDMNSEPDVSKELNTVSPTPPAVGANDVFWQQLLTE  349



>gb|EPS70260.1| hypothetical protein M569_04499, partial [Genlisea aurea]
Length=265

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 133/202 (66%), Gaps = 14/202 (7%)
 Frame = +2

Query  365  GTQGGSA---------SPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLL  517
            G  GGSA          P PFL KTY++VDD +   VVSWS    SFVVW+  EFARDLL
Sbjct  1    GGGGGSALPHPMPSANGPPPFLVKTYDMVDDPSTDRVVSWSPTNNSFVVWDSAEFARDLL  60

Query  518  PKYFKHNNFSSFIRQLNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSA--  691
            PKYFKHNNFSSF+RQLNTYGFRK+D ++WEFAN+ F+RGQ HLLK+I RRKP H H    
Sbjct  61   PKYFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGQKHLLKSITRRKPTHGHPMHQ  120

Query  692  QPN---SGVPLSeperrefeeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQS  862
            QP+   S V   E  +   EEE+ERLK++ + L  EL R  Q+ +    + Q++  RLQ 
Sbjct  121  QPSNTQSSVACVEVGKFGLEEEVERLKRDKNVLMQELVRVRQQQQATDGQLQTMIQRLQV  180

Query  863  IDERQRQVLALVAQLSLKPDLL  928
            +++RQ+Q+++ +A+    P  L
Sbjct  181  MEQRQQQMMSFLAKAVNSPGFL  202



>ref|NP_001141978.1| uncharacterized protein LOC100274128 [Zea mays]
 gb|ACF87414.1| unknown [Zea mays]
 gb|ACG46272.1| heat shock transcription factor like protein [Zea mays]
 gb|AFW71476.1| heat shock transcription factor like protein [Zea mays]
 gb|AIB05179.1| HSF transcription factor, partial [Zea mays]
Length=484

 Score =   187 bits (474),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 138/207 (67%), Gaps = 16/207 (8%)
 Frame = +2

Query  389  PAPFLAKTYELVDDRANSAVVSWSRGGR-SFVVWNPPEFARDLLPKYFKHNNFSSFIRQL  565
            PAPFL KTYE+VDD ++ AVVSWS     SFVVWN PEFA  +LP YFKHNNFSSFIRQL
Sbjct  22   PAPFLLKTYEMVDDPSSDAVVSWSDASDGSFVVWNQPEFAARMLPTYFKHNNFSSFIRQL  81

Query  566  NTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefee  745
            NTYGFRKID E+WEFAN+ F++GQ HLLKNIHRRKPIHSHS QP +   L + ER  FE+
Sbjct  82   NTYGFRKIDPERWEFANEYFVKGQKHLLKNIHRRKPIHSHSHQPGA---LPDNERALFED  138

Query  746  eierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDL  925
            EI+RL +E ++L+ +L +  Q+      + + L+ R+  +++RQ ++L+ + Q    P  
Sbjct  139  EIDRLSREKAALQADLWKFNQQQSGAVNQLEDLERRVLDMEQRQTKMLSFLQQARKNPQF  198

Query  926  LHHL------------EVHNKKRKPSV  970
            +  L              H K+R P +
Sbjct  199  VRKLVKMAEESPIFADAFHKKRRLPGL  225



>ref|XP_002522803.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF39654.1| DNA binding protein, putative [Ricinus communis]
Length=491

 Score =   187 bits (475),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 128/180 (71%), Gaps = 3/180 (2%)
 Frame = +2

Query  398  FLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLNTYG  577
            FL KTY++VDD A   +VSWS    SFVVWNPPEFAR LLP YFKHNNFSSFIRQLNTYG
Sbjct  21   FLLKTYDMVDDTATDDIVSWSSAKNSFVVWNPPEFARLLLPTYFKHNNFSSFIRQLNTYG  80

Query  578  FRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefeeeier  757
            FRKID E+WEFAN++F++ Q HLLKNIHRRKPIHSHS  P S V   +PER  F+EEI+R
Sbjct  81   FRKIDPEKWEFANEDFVKDQKHLLKNIHRRKPIHSHSNPPGSAV---DPERAAFDEEIDR  137

Query  758  LKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPDLLHHL  937
            L  E ++L   + R +++    + + + L  ++ S+ +RQ ++LA + +    P  + +L
Sbjct  138  LTHEKATLEANIVRYKKQQSAEKLQLEDLMQKVDSMGQRQEKLLAFLEKAVQNPTFVENL  197



>ref|XP_009396840.1| PREDICTED: heat stress transcription factor A-1-like [Musa acuminata 
subsp. malaccensis]
Length=518

 Score =   187 bits (476),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 133/199 (67%), Gaps = 8/199 (4%)
 Frame = +2

Query  389  PAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQLN  568
            P PFL+KTY++VDD A  A+VSW     SFVVWNPPEFARDLLPKYFKHNNFSSF+RQLN
Sbjct  36   PPPFLSKTYDMVDDPATDAIVSWGPENNSFVVWNPPEFARDLLPKYFKHNNFSSFVRQLN  95

Query  569  TYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKP--IHSHSAQ---PNSGVPLSeperr  733
            TYGFRK+D ++WEFAN+ F+RGQ HLLK I+RRKP  +H HS Q   P+    ++     
Sbjct  96   TYGFRKVDPDRWEFANEGFLRGQKHLLKTINRRKPSHVHGHSQQEQTPSQSASVTACVEV  155

Query  734  ef---eeeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQ  904
                 EEE+ERLK++ + L  EL R  Q+ +    + Q+L   L+ +++RQ+Q+++ +A+
Sbjct  156  GKFGLEEEVERLKRDKNVLMQELIRLRQQQQASDHQLQTLMKSLKGMEQRQQQMMSFLAK  215

Query  905  LSLKPDLLHHLEVHNKKRK  961
                P     L   N + +
Sbjct  216  AMRSPGFFTQLVEQNDRSR  234



>ref|XP_004955620.1| PREDICTED: heat stress transcription factor A-2b-like [Setaria 
italica]
Length=365

 Score =   184 bits (466),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 131/193 (68%), Gaps = 0/193 (0%)
 Frame = +2

Query  383  ASPAPFLAKTYELVDDRANSAVVSWSRGGRSFVVWNPPEFARDLLPKYFKHNNFSSFIRQ  562
            A P PFL KTY++VDD A   +VSWS    SFVVW+P  FA  LLP++FKHNNFSSF+RQ
Sbjct  42   AGPPPFLTKTYDMVDDPATDPIVSWSGTNNSFVVWDPHAFATVLLPRHFKHNNFSSFVRQ  101

Query  563  LNTYGFRKIDAEQWEFANDEFIRGQTHLLKNIHRRKPIHSHSAQPNSGVPLSeperrefe  742
            LNTYGFRK+D ++WEFAN+ F+RGQ HLLKNI RRKP   +++   S  P  E     ++
Sbjct  102  LNTYGFRKVDPDRWEFANEGFLRGQRHLLKNIRRRKPPAQNASNQQSLGPYLEVGHFGYD  161

Query  743  eeierLKQENSSLRVELDRREQENRECRFEFQSLDSRLQSIDERQRQVLALVAQLSLKPD  922
             EI++LK++   L  E+ +  QE +  +   ++++ RLQ  +++Q+Q++A +A++   P+
Sbjct  162  AEIDQLKRDKQLLMAEVLKLRQEQQNTKANLKAMEDRLQGTEQKQQQMMAFLARVMRNPE  221

Query  923  LLHHLEVHNKKRK  961
             L HL   N+ RK
Sbjct  222  FLKHLVSQNEMRK  234



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5062430735620