BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27887_g1_i1 len=175 path=[153:0-174]

Length=175
                                                                      Score     E

emb|CAA55184.1|  heat shock protein 70 kDa                              121   2e-32   Zea mays [maize]
gb|AFV66576.1|  heat shock protein 70                                   120   3e-32   
gb|AEP40944.1|  heat shock protein 70 family protein                    120   3e-32   
emb|CCJ09763.1|  putative heat shock protein-70kDa                      121   3e-32   
gb|KDO67650.1|  hypothetical protein CISIN_1g0212722mg                  120   4e-32   
emb|CAA67588.1|  70 kD heatshockprotein                                 120   4e-32   Medicago sativa [alfalfa]
emb|CAA10980.1|  putative heat shock cognate protein                    117   4e-32   Hordeum vulgare [barley]
gb|ABR13285.1|  putative dnaK-type molecular chaperone hsc70.1          119   7e-32   Prunus dulcis [sweet almond]
gb|ACU17965.1|  unknown                                                 120   1e-31   Glycine max [soybeans]
ref|XP_002805956.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   1e-31   
ref|XP_001783063.1|  predicted protein                                  119   1e-31   
gb|AAK59628.2|  putative dnaK-type molecular chaperone hsc70.1 pr...    119   2e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CAA55183.1|  heat shock protein 70 kDa                              118   3e-31   Zea mays [maize]
gb|ABP01597.1|  heat shock protein 70                                   120   3e-31   Ageratina adenophora
gb|ACH61066.1|  heat shock protein 70 kDa                               118   4e-31   Pseudotsuga menziesii
gb|ACH61090.1|  heat shock protein 70 kDa                               118   4e-31   Pseudotsuga macrocarpa
gb|AAX07349.1|  heat shock protein 70                                   120   5e-31   Zea mays [maize]
gb|AAB65162.1|  heat shock cognate protein                              120   6e-31   Solanum commersonii
gb|AEX55235.1|  heat shock protein 70                                   120   6e-31   
gb|EEC71767.1|  hypothetical protein OsI_04375                          120   7e-31   Oryza sativa Indica Group [Indian rice]
gb|EMT15100.1|  Heat shock cognate 70 kDa protein 1                     124   8e-31   
gb|EAY81899.1|  hypothetical protein OsI_37065                          120   8e-31   Oryza sativa Indica Group [Indian rice]
gb|EEC76425.1|  hypothetical protein OsI_14101                          120   9e-31   Oryza sativa Indica Group [Indian rice]
gb|AAP42157.1|AF509339_1  heat shock protein 70                         120   9e-31   Saussurea medusa
tpg|DAA55190.1|  TPA: heat shock protein70-4                            121   9e-31   
emb|CDY04364.1|  BnaC04g18290D                                          118   1e-30   
gb|ABG22609.1|  Heat shock cognate 70 kDa protein, putative, expr...    121   1e-30   
ref|XP_004156719.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   1e-30   
ref|XP_004492129.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   1e-30   
gb|AEO13403.1|  heat shock 70                                           121   1e-30   
gb|AAL85887.1|AF479058_1  70 kDa heat shock protein                     119   2e-30   Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_009913284.1|  PREDICTED: probable mediator of RNA polymera...    120   2e-30   
ref|XP_006574857.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   2e-30   
gb|KHN48981.1|  Heat shock cognate 70 kDa protein                       120   2e-30   
gb|KDO36486.1|  hypothetical protein CISIN_1g020168mg                   118   2e-30   
emb|CDY16797.1|  BnaA09g05850D                                          117   2e-30   
dbj|BAA34919.1|  heat shock protein 70 cognate                          119   2e-30   Salix gilgiana
emb|CDY40360.1|  BnaA10g27080D                                          117   2e-30   
ref|XP_010253827.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   2e-30   
emb|CDY15422.1|  BnaC04g42010D                                          117   2e-30   
gb|EAY89450.1|  hypothetical protein OsI_10982                          119   3e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_010922357.1|  PREDICTED: heat shock cognate 70 kDa protein 2     121   3e-30   
gb|ABG22608.1|  Heat shock cognate 70 kDa protein, putative, expr...    120   3e-30   
ref|XP_008656365.1|  PREDICTED: probable mediator of RNA polymera...    121   3e-30   
ref|XP_002441219.1|  hypothetical protein SORBIDRAFT_09g022580          121   3e-30   Sorghum bicolor [broomcorn]
gb|KHN21966.1|  Heat shock cognate 70 kDa protein                       121   3e-30   
ref|XP_007016452.1|  Heat shock cognate protein 70-1                    121   3e-30   
ref|XP_004961848.1|  PREDICTED: probable mediator of RNA polymera...    121   3e-30   
ref|XP_003537997.1|  PREDICTED: heat shock cognate 70 kDa protein 2     121   3e-30   
gb|KDP35613.1|  hypothetical protein JCGZ_09051                         120   3e-30   
gb|KDP44975.1|  hypothetical protein JCGZ_01475                         120   3e-30   
gb|AFA51946.1|  heat shock protein 70                                   120   3e-30   
ref|XP_007139236.1|  hypothetical protein PHAVU_008G012600g             120   3e-30   
gb|AIZ68155.1|  heat shock protein 70                                   120   3e-30   
ref|XP_002527736.1|  heat shock protein, putative                       120   3e-30   Ricinus communis
gb|AAN86274.1|  non-cell-autonomous heat shock cognate protein 70       120   3e-30   Cucurbita maxima [Boston marrow]
ref|XP_004962705.1|  PREDICTED: probable mediator of RNA polymera...    120   3e-30   
ref|XP_008802761.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   3e-30   
ref|XP_007144450.1|  hypothetical protein PHAVU_007G157200g             120   3e-30   
emb|CDY52661.1|  BnaC01g38510D                                          120   3e-30   
ref|XP_010030977.1|  PREDICTED: heat shock cognate 70 kDa protein 2     120   3e-30   
tpg|DAA44672.1|  TPA: hsp70 protein                                     119   3e-30   
ref|XP_010253221.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   3e-30   
ref|XP_003539680.2|  PREDICTED: heat shock cognate 70 kDa protein 2     120   3e-30   
emb|CDY50531.1|  BnaA01g30490D                                          120   3e-30   
ref|XP_003552695.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   3e-30   
ref|XP_004505872.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   3e-30   
gb|AEK70336.1|  heat shock protein 70                                   120   3e-30   
gb|AAB97316.1|  cytosolic heat shock 70 protein                         120   3e-30   Spinacia oleracea
gb|AIU34470.1|  putative heat shock protein                             120   3e-30   
ref|XP_009597695.1|  PREDICTED: heat shock cognate 70 kDa protein 2     120   3e-30   
gb|EMS52605.1|  Heat shock cognate 70 kDa protein 1                     120   3e-30   
ref|XP_009407484.1|  PREDICTED: probable mediator of RNA polymera...    120   3e-30   
ref|XP_003578898.1|  PREDICTED: heat shock cognate 70 kDa protein 2     120   3e-30   
gb|AAR17080.1|  heat shock protein 70-3                                 120   3e-30   Nicotiana tabacum [American tobacco]
gb|AAP04522.1|  heat shock protein 70                                   120   3e-30   Nicotiana tabacum [American tobacco]
ref|NP_001044757.1|  Os01g0840100                                       120   3e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ19310.1|  hypothetical protein OsJ_34853                          120   3e-30   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ91305.1|  predicted protein                                      120   3e-30   
ref|XP_009120551.1|  PREDICTED: probable mediator of RNA polymera...    120   3e-30   
emb|CDX73815.1|  BnaA03g32320D                                          120   3e-30   
ref|XP_008447699.1|  PREDICTED: heat shock cognate 70 kDa protein 2     120   3e-30   
gb|AAM48131.1|AF509336_1  heat shock protein 70                         120   3e-30   Saussurea medusa
gb|AGL07711.1|  heat shock protein 70                                   120   3e-30   
ref|XP_004250958.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   3e-30   
ref|XP_010937646.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   3e-30   
ref|XP_009620324.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   3e-30   
ref|XP_009409520.1|  PREDICTED: heat shock cognate 70 kDa protein 2     120   3e-30   
ref|XP_002442353.1|  hypothetical protein SORBIDRAFT_08g018750          120   3e-30   Sorghum bicolor [broomcorn]
gb|EAY98319.1|  hypothetical protein OsI_20227                          119   3e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_011027580.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   3e-30   
gb|ACJ11742.1|  heat shock protein 70                                   120   3e-30   Gossypium hirsutum [American cotton]
gb|ABA95501.2|  Heat shock cognate 70 kDa protein, putative, expr...    120   3e-30   Oryza sativa Japonica Group [Japonica rice]
gb|ACM42161.1|  heat shock protein 70.58                                120   4e-30   Ageratina adenophora
gb|EMT07406.1|  Heat shock cognate 70 kDa protein 1                     120   4e-30   
ref|XP_004142076.1|  PREDICTED: probable mediator of RNA polymera...    120   4e-30   
emb|CAB72130.1|  heat shock protein 70                                  120   4e-30   Cucumis sativus [cucumbers]
ref|NP_001051724.1|  Os03g0821100                                       120   4e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008660826.1|  PREDICTED: probable mediator of RNA polymera...    120   4e-30   
ref|XP_006649850.1|  PREDICTED: probable mediator of RNA polymera...    120   4e-30   
gb|EMS68426.1|  Heat shock cognate 70 kDa protein 4                     120   4e-30   
gb|KCW50223.1|  hypothetical protein EUGRSUZ_J00023                     120   4e-30   
emb|CDY00784.1|  BnaC03g37680D                                          120   4e-30   
ref|XP_002528432.1|  heat shock protein, putative                       120   4e-30   Ricinus communis
ref|XP_004307529.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
gb|ACR38891.1|  heat shock protein 70                                   120   4e-30   Apopellia endiviifolia (species B)
gb|KDP44987.1|  hypothetical protein JCGZ_01487                         120   4e-30   
gb|ACJ11745.1|  heat shock protein 70                                   120   4e-30   Gossypium hirsutum [American cotton]
ref|XP_002311161.1|  heat shock protein 70                              120   4e-30   Populus trichocarpa [western balsam poplar]
ref|XP_008674324.1|  PREDICTED: probable mediator of RNA polymera...    120   4e-30   
gb|ACJ11741.1|  heat shock protein 70                                   120   4e-30   Gossypium hirsutum [American cotton]
gb|ACD93209.1|  heat shock protein 70                                   120   4e-30   Camellia sinensis [black tea]
ref|XP_010465032.1|  PREDICTED: probable mediator of RNA polymera...    120   4e-30   
ref|XP_002884912.1|  hypothetical protein ARALYDRAFT_897465             120   4e-30   
gb|KHN27222.1|  Heat shock cognate 70 kDa protein 2                     120   4e-30   
ref|XP_010030975.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
gb|ADB85350.1|  putative heat shock cognate                             120   4e-30   Phyllostachys edulis [kikko-chiku]
gb|KDP44981.1|  hypothetical protein JCGZ_01481                         120   4e-30   
ref|XP_010486980.1|  PREDICTED: probable mediator of RNA polymera...    120   4e-30   
ref|XP_006407319.1|  hypothetical protein EUTSA_v10020257mg             120   4e-30   
gb|AFU34347.1|  70-kDa heat shock protein                               120   4e-30   
dbj|BAP90755.1|  heat shock protein 70                                  120   4e-30   
ref|XP_004492128.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
ref|XP_009622753.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
ref|XP_004249574.1|  PREDICTED: heat shock cognate 70 kDa protein 2     120   4e-30   
ref|XP_010253202.1|  PREDICTED: heat shock cognate 70 kDa protein 2     120   4e-30   
ref|XP_009777579.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
ref|XP_009786102.1|  PREDICTED: heat shock cognate 70 kDa protein 2     120   4e-30   
ref|XP_002316294.1|  heat shock protein 70                              120   4e-30   Populus trichocarpa [western balsam poplar]
dbj|BAK00257.1|  predicted protein                                      120   4e-30   
ref|XP_006297173.1|  hypothetical protein CARUB_v10013177mg             120   4e-30   
ref|XP_011027180.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
ref|XP_004287404.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
gb|AAB99745.1|  HSP70                                                   120   4e-30   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009785159.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
ref|XP_010231300.1|  PREDICTED: probable mediator of RNA polymera...    120   4e-30   
gb|AAN86276.1|  cell-autonomous heat shock cognate protein 70           120   4e-30   Cucurbita maxima [Boston marrow]
gb|ACJ11740.1|  heat shock protein 70                                   120   4e-30   Gossypium hirsutum [American cotton]
ref|XP_007009369.1|  Heat shock protein 70                              120   4e-30   
ref|XP_007027052.1|  Heat shock cognate protein 70-1 isoform 1          120   4e-30   
ref|XP_011027172.1|  PREDICTED: probable mediator of RNA polymera...    120   4e-30   
ref|XP_009357719.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
ref|XP_006833219.1|  hypothetical protein AMTR_s00072p00181720          120   4e-30   
gb|KCW50224.1|  hypothetical protein EUGRSUZ_J00023                     120   4e-30   
ref|XP_010499184.1|  PREDICTED: probable mediator of RNA polymera...    120   4e-30   
gb|ADZ46371.1|  HSP70                                                   120   4e-30   
emb|CAB72129.1|  heat shock protein 70                                  120   4e-30   Cucumis sativus [cucumbers]
ref|XP_004246402.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
ref|XP_003621886.1|  Heat shock protein                                 120   4e-30   
ref|XP_011094842.1|  PREDICTED: heat shock cognate 70 kDa protein 2     120   4e-30   
ref|XP_007144451.1|  hypothetical protein PHAVU_007G157200g             120   4e-30   
ref|NP_187864.1|  heat shock protein 70-4                               120   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002532297.1|  heat shock protein, putative                       120   4e-30   Ricinus communis
ref|XP_004142745.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
ref|XP_006341042.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
ref|XP_003621869.1|  Heat shock protein                                 120   4e-30   
gb|KEH30131.1|  heat shock cognate 70 kDa protein                       120   4e-30   
ref|XP_006644983.1|  PREDICTED: probable mediator of RNA polymera...    120   4e-30   
ref|XP_004307527.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
ref|XP_006350760.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
ref|XP_009357717.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
ref|XP_009135236.1|  PREDICTED: probable mediator of RNA polymera...    120   4e-30   
ref|XP_004302715.1|  PREDICTED: probable mediator of RNA polymera...    120   4e-30   
ref|XP_006436017.1|  hypothetical protein CICLE_v10033622mg             120   4e-30   
ref|XP_009592776.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
gb|AEO22185.1|  CytHSP70                                                119   4e-30   
gb|AHW48175.1|  heat shock protein 70                                   119   4e-30   
gb|ACJ85522.1|  unknown                                                 120   4e-30   Medicago truncatula
ref|XP_006664117.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
gb|AAV98051.1|  heat shock protein 70                                   120   4e-30   Medicago sativa [alfalfa]
ref|XP_010095022.1|  Heat shock 70 kDa protein 4                        120   4e-30   
emb|CAA05547.1|  heat shock protein 70                                  120   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006349514.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
ref|XP_008370710.1|  PREDICTED: heat shock cognate 70 kDa protein 2     120   4e-30   
gb|ADD71975.1|  heat shock protein 70                                   120   4e-30   
ref|XP_008371627.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
gb|ABP35942.1|  heat shock protein 70                                   120   4e-30   Cyclamen persicum
emb|CAA47948.2|  heat shock protein 70                                  120   4e-30   Oryza sativa [red rice]
ref|XP_009374678.1|  PREDICTED: probable mediator of RNA polymera...    120   4e-30   
ref|WP_039310754.1|  molecular chaperone DnaK                           120   4e-30   
ref|XP_008458906.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
ref|XP_010558794.1|  PREDICTED: probable mediator of RNA polymera...    120   4e-30   
ref|XP_007220208.1|  hypothetical protein PRUPE_ppa002641mg             120   4e-30   
ref|XP_002284008.1|  PREDICTED: heat shock cognate 70 kDa protein 2     120   4e-30   Vitis vinifera
ref|NP_001068540.1|  Os11g0703900                                       120   4e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663128.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
gb|AAS57913.1|  70 kDa heat shock cognate protein 2                     120   4e-30   Vigna radiata [mung bean]
gb|ABX76301.1|  heat shock protein 70                                   120   4e-30   Ageratina adenophora
ref|XP_002263599.1|  PREDICTED: heat shock cognate 70 kDa protein 2     120   4e-30   Vitis vinifera
ref|XP_011077460.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
ref|XP_009606077.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
gb|KCW50226.1|  hypothetical protein EUGRSUZ_J00025                     120   4e-30   
gb|KCW50227.1|  hypothetical protein EUGRSUZ_J00025                     120   4e-30   
ref|XP_004156718.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   4e-30   
ref|XP_011027667.1|  PREDICTED: probable mediator of RNA polymera...    119   4e-30   
gb|AAN86275.1|  non-cell-autonomous heat shock cognate protein 70       120   4e-30   Cucurbita maxima [Boston marrow]
ref|XP_008369876.1|  PREDICTED: probable mediator of RNA polymera...    120   5e-30   
ref|XP_009338761.1|  PREDICTED: probable mediator of RNA polymera...    120   5e-30   
gb|EEC75662.1|  hypothetical protein OsI_12445                          117   5e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_008233611.1|  PREDICTED: heat shock cognate 70 kDa protein 2     120   5e-30   
ref|XP_006398708.1|  hypothetical protein EUTSA_v10012922mg             119   5e-30   
ref|XP_009414319.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   6e-30   
gb|AII99890.1|  heat shock protein                                      120   6e-30   
ref|XP_010669896.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    121   7e-30   
emb|CAA31663.1|  hsp70 (AA 6 - 651)                                     120   7e-30   Petunia x hybrida [garden petunia]
gb|AIA22210.1|  heat shock protein 70                                   120   7e-30   
sp|P09189.1|HSP7C_PETHY  RecName: Full=Heat shock cognate 70 kDa ...    119   8e-30   Petunia x hybrida [garden petunia]
gb|EYU19900.1|  hypothetical protein MIMGU_mgv1a002641mg                119   8e-30   
ref|XP_001767839.1|  predicted protein                                  119   8e-30   
gb|EMS45385.1|  Heat shock cognate 70 kDa protein 1                     120   8e-30   
ref|XP_001783048.1|  predicted protein                                  119   8e-30   
gb|AAV97978.1|  heat shock protein hsp70                                119   9e-30   Saussurea medusa
gb|KEH30132.1|  heat shock cognate 70 kDa protein                       119   9e-30   
ref|XP_001751923.1|  predicted protein                                  119   9e-30   
ref|XP_010555208.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   9e-30   
ref|XP_004984739.1|  PREDICTED: probable mediator of RNA polymera...    119   9e-30   
ref|XP_001785822.1|  predicted protein                                  119   9e-30   
ref|NP_001167696.1|  heat shock cognate 70 kDa protein 2                119   9e-30   Zea mays [maize]
ref|XP_009414320.1|  PREDICTED: probable mediator of RNA polymera...    119   9e-30   
ref|XP_010553033.1|  PREDICTED: probable mediator of RNA polymera...    119   9e-30   
gb|ACT34017.1|  heat shock cognate 70 kDa protein                       119   9e-30   Cenchrus americanus [bulrush millet]
ref|NP_001148198.1|  heat shock cognate 70 kDa protein 2                119   9e-30   Zea mays [maize]
ref|XP_008458892.1|  PREDICTED: heat shock cognate 70 kDa protein       119   1e-29   
ref|XP_010520113.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   1e-29   
ref|XP_002468097.1|  hypothetical protein SORBIDRAFT_01g039530          119   1e-29   Sorghum bicolor [broomcorn]
ref|XP_011027182.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   1e-29   
ref|XP_006378714.1|  heat shock protein 70 cognate                      119   1e-29   
ref|XP_006429028.1|  hypothetical protein CICLE_v10011260mg             119   1e-29   
gb|EPS60056.1|  heat shock protein 70                                   119   1e-29   
ref|XP_004493999.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   1e-29   
ref|XP_004142750.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   1e-29   
ref|XP_011016414.1|  PREDICTED: heat shock cognate 70 kDa protein 2     119   1e-29   
ref|XP_002312090.1|  heat shock protein 70 cognate                      119   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_002312089.1|  heat shock protein 70 cognate                      119   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_006290203.1|  hypothetical protein CARUB_v10003889mg             119   1e-29   
ref|XP_011028442.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   1e-29   
gb|ABR18415.1|  unknown                                                 119   1e-29   Picea sitchensis
ref|XP_010495044.1|  PREDICTED: probable mediator of RNA polymera...    119   1e-29   
ref|XP_003554320.2|  PREDICTED: probable mediator of RNA polymera...    119   1e-29   
emb|CDP09040.1|  unnamed protein product                                119   1e-29   
gb|KHN02428.1|  Heat shock cognate 70 kDa protein                       119   1e-29   
gb|KHN13891.1|  Heat shock cognate 70 kDa protein 2                     119   1e-29   
ref|XP_006378715.1|  hypothetical protein POPTR_0010s21280g             119   1e-29   
ref|XP_010423825.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    119   1e-29   
ref|XP_003552691.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   1e-29   
ref|XP_010490742.1|  PREDICTED: probable mediator of RNA polymera...    119   1e-29   
ref|NP_195870.1|  heat shock cognate protein 70-1                       119   1e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CAA52684.1|  heat shock protein 70 cognate                          119   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb|EYU26579.1|  hypothetical protein MIMGU_mgv1a002667mg                119   1e-29   
ref|XP_006348998.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   1e-29   
ref|XP_010446275.1|  PREDICTED: probable mediator of RNA polymera...    119   1e-29   
emb|CDY40362.1|  BnaA10g27060D                                          117   1e-29   
ref|XP_001759874.1|  predicted protein                                  119   1e-29   
ref|NP_001049712.1|  Os03g0276500                                       119   1e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007139240.1|  hypothetical protein PHAVU_008G013000g             119   1e-29   
ref|XP_010452093.1|  PREDICTED: probable mediator of RNA polymera...    119   1e-29   
gb|KEH30133.1|  heat shock cognate 70 kDa protein                       119   1e-29   
ref|XP_004142749.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   1e-29   
gb|ABD32895.1|  Heat shock protein Hsp70                                119   1e-29   Medicago truncatula
ref|XP_004307259.1|  PREDICTED: probable mediator of RNA polymera...    119   1e-29   
ref|XP_006436010.1|  hypothetical protein CICLE_v10030928mg             119   1e-29   
ref|XP_004981251.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   1e-29   
ref|XP_009102555.1|  PREDICTED: probable mediator of RNA polymera...    119   1e-29   
ref|XP_010423853.1|  PREDICTED: probable mediator of RNA polymera...    119   1e-29   
ref|XP_009115390.1|  PREDICTED: probable mediator of RNA polymera...    119   1e-29   
gb|EYU33210.1|  hypothetical protein MIMGU_mgv1a002616mg                119   1e-29   
gb|EMT11425.1|  Heat shock cognate 70 kDa protein 1                     119   1e-29   
ref|XP_002968525.1|  hypothetical protein SELMODRAFT_440382             119   1e-29   
ref|XP_009778799.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   1e-29   
gb|AAS09825.1|  heat shock cognate protein 70                           119   1e-29   Eutrema halophilum
gb|KHG00348.1|  Heat shock 70 kDa 4 -like protein                       118   1e-29   
gb|EMT11692.1|  Heat shock cognate 70 kDa protein                       119   1e-29   
ref|XP_003521330.1|  PREDICTED: probable mediator of RNA polymera...    119   1e-29   
ref|XP_002987127.1|  hypothetical protein SELMODRAFT_446858             119   1e-29   
ref|XP_008812042.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   1e-29   
ref|XP_006398709.1|  hypothetical protein EUTSA_v10012922mg             119   1e-29   
dbj|BAD94888.1|  dnaK-type molecular chaperone hsc70.1 - like           117   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873056.1|  HSC70-1                                            119   1e-29   
ref|XP_008241192.1|  PREDICTED: probable mediator of RNA polymera...    119   1e-29   
ref|XP_002976219.1|  hypothetical protein SELMODRAFT_443120             119   1e-29   
ref|XP_010423858.1|  PREDICTED: probable mediator of RNA polymera...    119   1e-29   
ref|XP_007207158.1|  hypothetical protein PRUPE_ppa024477mg             119   1e-29   
emb|CDP00073.1|  unnamed protein product                                119   1e-29   
ref|XP_004492118.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   1e-29   
dbj|BAJ86014.1|  predicted protein                                      119   1e-29   
ref|XP_006407675.1|  hypothetical protein EUTSA_v10020258mg             118   1e-29   
emb|CAA54419.1|  heat shock cognate 70-1                                119   1e-29   
gb|KFK24738.1|  hypothetical protein AALP_AA8G018100                    119   1e-29   
ref|XP_006287234.1|  hypothetical protein CARUB_v10000420mg             119   2e-29   
ref|XP_003558228.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   2e-29   
ref|XP_009419750.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   2e-29   
ref|XP_010484430.1|  PREDICTED: probable mediator of RNA polymera...    119   2e-29   
ref|NP_187555.1|  heat shock protein 70-3                               119   2e-29   
ref|XP_002283532.2|  PREDICTED: heat shock cognate 70 kDa protein 2     119   2e-29   
gb|AAA62445.1|  heat shock protein                                      119   2e-29   
ref|XP_008784530.1|  PREDICTED: heat shock cognate 70 kDa protein 2     119   2e-29   
ref|XP_010042813.1|  PREDICTED: probable mediator of RNA polymera...    117   2e-29   
gb|EMS65159.1|  Heat shock cognate 70 kDa protein                       119   2e-29   
ref|XP_006424799.1|  hypothetical protein CICLE_v10027981mg             119   2e-29   
ref|XP_007016460.1|  Heat shock cognate protein 70-1                    119   2e-29   
ref|XP_010463615.1|  PREDICTED: probable mediator of RNA polymera...    119   2e-29   
gb|AAS57914.1|  70 kDa heat shock cognate protein 3                     119   2e-29   
sp|P27322.1|HSP72_SOLLC  RecName: Full=Heat shock cognate 70 kDa ...    119   2e-29   
ref|NP_001055754.1|  Os05g0460000                                       119   2e-29   
ref|XP_007009362.1|  Heat shock cognate protein 70-1                    119   2e-29   
ref|XP_006488297.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   2e-29   
ref|XP_008223380.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   2e-29   
ref|XP_008802766.1|  PREDICTED: probable mediator of RNA polymera...    118   2e-29   
ref|XP_003625487.1|  Heat shock protein                                 119   2e-29   
ref|XP_002284063.1|  PREDICTED: heat shock cognate 70 kDa protein 2     118   2e-29   
ref|XP_009353695.1|  PREDICTED: heat shock cognate 70 kDa protein...    118   2e-29   
ref|XP_007207204.1|  hypothetical protein PRUPE_ppa002646mg             118   2e-29   
emb|CDP09035.1|  unnamed protein product                                118   2e-29   
ref|XP_010456365.1|  PREDICTED: probable mediator of RNA polymera...    119   2e-29   
ref|XP_006392363.1|  hypothetical protein EUTSA_v10023343mg             118   2e-29   
gb|AAA82974.1|  HSP70b                                                  112   3e-29   
gb|EMS50129.1|  Heat shock cognate 70 kDa protein 1                     119   3e-29   
gb|ADU04389.1|  heat shock protein 70                                   112   3e-29   
gb|ADN03965.1|  heat shock cognate 70 kDa protein                       117   3e-29   
ref|XP_002884737.1|  heat shock cognate 70 kDa protein 3                118   3e-29   
ref|XP_009122774.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    117   3e-29   
ref|XP_010558317.1|  PREDICTED: probable mediator of RNA polymera...    118   3e-29   
ref|XP_010464591.1|  PREDICTED: heat shock 70 kDa protein 3             118   3e-29   
ref|XP_006297174.1|  hypothetical protein CARUB_v10013178mg             118   3e-29   
ref|XP_006407676.1|  hypothetical protein EUTSA_v10020258mg             118   3e-29   
ref|XP_006486093.1|  PREDICTED: probable mediator of RNA polymera...    119   3e-29   
dbj|BAJ34054.1|  unnamed protein product                                118   3e-29   
ref|XP_004493886.1|  PREDICTED: probable mediator of RNA polymera...    118   3e-29   
gb|KFK38330.1|  hypothetical protein AALP_AA3G100200                    118   3e-29   
ref|XP_006365705.1|  PREDICTED: heat shock cognate 70 kDa protein...    118   3e-29   
ref|XP_007132076.1|  hypothetical protein PHAVU_011G065000g             118   3e-29   
gb|EYU19903.1|  hypothetical protein MIMGU_mgv1a002628mg                118   3e-29   
gb|AAB42159.1|  Hsc70                                                   118   3e-29   
ref|NP_001266213.1|  heat shock protein 70 isoform 3                    118   3e-29   
gb|AAS57912.1|  70 kDa heat shock cognate protein 1                     118   4e-29   
ref|XP_010452091.1|  PREDICTED: probable mediator of RNA polymera...    115   4e-29   
ref|XP_010319122.1|  PREDICTED: heat shock protein 70 isoform 3 i...    118   4e-29   
ref|XP_009122772.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    117   4e-29   
ref|XP_009784009.1|  PREDICTED: heat shock cognate 70 kDa protein       118   4e-29   
emb|CAA83548.1|  PsHSC71.0                                              117   4e-29   
ref|XP_010486515.1|  PREDICTED: heat shock 70 kDa protein 3-like        117   4e-29   
ref|XP_009604213.1|  PREDICTED: heat shock cognate 70 kDa protein       117   4e-29   
ref|XP_004250959.1|  PREDICTED: heat shock cognate 70 kDa protein       117   4e-29   
ref|XP_006349004.1|  PREDICTED: heat shock cognate 70 kDa protein...    117   4e-29   
emb|CCA29121.1|  heat shock protein 70 isoform 2                        117   4e-29   
ref|XP_006349005.1|  PREDICTED: heat shock cognate 70 kDa protein...    117   4e-29   
ref|XP_003563611.1|  PREDICTED: heat shock cognate 70 kDa protein...    117   4e-29   
ref|XP_008776656.1|  PREDICTED: heat shock cognate 70 kDa protein...    117   4e-29   
gb|KFK32679.1|  hypothetical protein AALP_AA6G274700                    117   4e-29   
ref|XP_010918390.1|  PREDICTED: heat shock cognate 70 kDa protein...    117   5e-29   
ref|XP_007162654.1|  hypothetical protein PHAVU_001G169000g             117   5e-29   
gb|ACB70177.1|  70 kDa heat shock protein                               117   5e-29   
ref|NP_195869.1|  heat shock protein 70                                 117   5e-29   
ref|XP_011091460.1|  PREDICTED: heat shock cognate 70 kDa protein...    117   5e-29   
ref|XP_010106444.1|  Heat shock cognate 70 kDa protein                  117   5e-29   
ref|XP_010534306.1|  PREDICTED: probable mediator of RNA polymera...    117   5e-29   
ref|XP_002873055.1|  predicted protein                                  117   5e-29   
gb|AGZ15406.1|  heat shock cognate 70 kDa protein                       117   6e-29   
gb|AGR45355.1|  HSP70                                                   117   6e-29   
gb|EMS51616.1|  Heat shock cognate 70 kDa protein 1                     117   6e-29   
ref|XP_010095013.1|  Heat shock 70 kDa protein 4                        117   7e-29   
gb|EPS64948.1|  hypothetical protein M569_09829                         117   7e-29   
ref|XP_008674843.1|  PREDICTED: heat shock 70 kDa protein-like          117   8e-29   
ref|XP_002502667.1|  heat shock 70 kDa protein                          117   8e-29   
ref|XP_010685795.1|  PREDICTED: heat shock cognate 70 kDa protein 2     117   9e-29   
ref|XP_004970526.1|  PREDICTED: probable mediator of RNA polymera...    117   9e-29   
ref|XP_002456611.1|  hypothetical protein SORBIDRAFT_03g039360          116   1e-28   
ref|NP_001183165.1|  uncharacterized protein LOC100501536               116   1e-28   
gb|AIU40169.1|  heat shock protein 70                                   116   1e-28   
ref|XP_010473075.1|  PREDICTED: heat shock 70 kDa protein 3-like        116   1e-28   
ref|XP_009388623.1|  PREDICTED: heat shock cognate 70 kDa protein...    116   1e-28   
gb|KDP44979.1|  hypothetical protein JCGZ_01479                         116   2e-28   
ref|XP_003564580.1|  PREDICTED: heat shock cognate 70 kDa protein       115   2e-28   
dbj|BAK02194.1|  predicted protein                                      115   2e-28   
gb|EMS65063.1|  Heat shock cognate 70 kDa protein                       115   2e-28   
ref|XP_009380663.1|  PREDICTED: heat shock cognate 70 kDa protein...    115   2e-28   
ref|XP_008776699.1|  PREDICTED: probable mediator of RNA polymera...    115   2e-28   
ref|XP_003558220.1|  PREDICTED: heat shock cognate 70 kDa protein...    115   2e-28   
ref|XP_010911697.1|  PREDICTED: probable mediator of RNA polymera...    111   2e-28   
gb|AAB88009.1|  heat shock cognate protein HSC70                        115   3e-28   
ref|XP_003083987.1|  putative hsp70 (ISS)                               115   3e-28   
ref|XP_008784528.1|  PREDICTED: heat shock cognate 70 kDa protein...    115   3e-28   
ref|XP_003064239.1|  heat shock protein 70kDa                           115   3e-28   
emb|CEG00633.1|  Heat shock protein 70 family                           115   4e-28   
sp|P29357.3|HSP7E_SPIOL  RecName: Full=Chloroplast envelope membr...    115   4e-28   
gb|EPS68565.1|  hypothetical protein M569_06198                         115   4e-28   
sp|P16121.2|HSP70_LUPPO  RecName: Full=Heat shock 70 kDa protein        111   4e-28   
ref|XP_008812036.1|  PREDICTED: probable mediator of RNA polymera...    115   4e-28   
ref|XP_005643450.1|  heat shock protein 70                              114   5e-28   
dbj|BAI81971.1|  heat shock protein 70                                  107   5e-28   
ref|XP_010937656.1|  PREDICTED: probable mediator of RNA polymera...    114   6e-28   
gb|KFK37144.1|  hypothetical protein AALP_AA4G218800                    114   7e-28   
gb|KFK33437.1|  hypothetical protein AALP_AA5G013700                    114   7e-28   
gb|EMT06830.1|  Heat shock cognate 70 kDa protein                       114   8e-28   
gb|ACD45076.1|  heat-shock protein 70                                   114   8e-28   
gb|KHN17505.1|  Heat shock 70 kDa protein                               112   9e-28   
gb|EMS51135.1|  Heat shock cognate 70 kDa protein                       113   1e-27   
emb|CCA29120.1|  heat shock protein 70 isoform 1                        114   1e-27   
ref|XP_007512662.1|  Heat Shock Protein 70, cytosolic                   114   1e-27   
ref|NP_001234491.1|  heat shock cognate 70 kDa protein 1                113   1e-27   
emb|CCO27999.1|  Heat shock protein HSS1                                108   1e-27   
ref|XP_010274956.1|  PREDICTED: heat shock 70 kDa protein-like          107   2e-27   
gb|EMT17408.1|  Heat shock cognate 70 kDa protein                       113   2e-27   
emb|CAA27330.1|  heat shock protein 70                                  112   2e-27   
ref|XP_010905019.1|  PREDICTED: heat shock 70 kDa protein               113   2e-27   
ref|XP_008794364.1|  PREDICTED: heat shock 70 kDa protein-like          113   2e-27   
ref|XP_001421920.1|  Heat Shock Protein 70, cytosolic                   113   2e-27   
gb|EAY89457.1|  hypothetical protein OsI_10990                          111   2e-27   
ref|NP_001049719.2|  Os03g0277300                                       110   2e-27   
gb|ENY63418.1|  heat shock protein 70, hsp70A2, putative                108   2e-27   
gb|ABK25453.1|  unknown                                                 112   2e-27   
ref|XP_007203774.1|  hypothetical protein PRUPE_ppa002595mg             112   2e-27   
emb|CCM02072.1|  predicted protein                                      108   3e-27   
ref|XP_003549537.1|  PREDICTED: heat shock 70 kDa protein-like is...    112   3e-27   
ref|XP_008384260.1|  PREDICTED: heat shock 70 kDa protein isoform X1    112   3e-27   
gb|AFX73252.1|  70-kDa heat shock protein                               105   3e-27   
ref|XP_003610287.1|  Heat-shock protein                                 112   3e-27   
ref|XP_009366205.1|  PREDICTED: heat shock 70 kDa protein               112   3e-27   
gb|AFX73253.1|  70-kDa heat shock protein                               105   3e-27   
ref|XP_003519161.1|  PREDICTED: heat shock 70 kDa protein-like          112   3e-27   
prf||1205208A  heat shock protein hsp70                                 112   3e-27
sp|P11143.2|HSP70_MAIZE  RecName: Full=Heat shock 70 kDa protein        112   3e-27   
gb|KHN14134.1|  Heat shock 70 kDa protein                               112   3e-27   
emb|CDY35063.1|  BnaA06g10730D                                          111   3e-27   
emb|CDY33359.1|  BnaC05g12240D                                          111   3e-27   
gb|AJA39975.1|  heat shock protein 70                                   105   4e-27   
ref|XP_010094064.1|  Heat shock cognate 70 kDa protein                  112   4e-27   
ref|XP_007154870.1|  hypothetical protein PHAVU_003G154800g             112   4e-27   
gb|AAA82975.1|  PsHSP71.2                                               112   4e-27   
gb|ABN47221.1|  HSP70                                                   104   4e-27   
gb|ACN54681.1|  heat shock protein 70                                   105   4e-27   
gb|AHH81811.1|  heat shock protein 70                                   105   4e-27   
gb|EMS11429.1|  DnaK family protein                                     110   4e-27   
ref|XP_010931247.1|  PREDICTED: heat shock cognate 70 kDa protein...    112   4e-27   
sp|P26413.1|HSP70_SOYBN  RecName: Full=Heat shock 70 kDa protein        112   4e-27   
ref|XP_004507753.1|  PREDICTED: heat shock 70 kDa protein-like          112   4e-27   
emb|CAM34327.1|  putative heat-shock protein                            104   4e-27   
gb|KDP41951.1|  hypothetical protein JCGZ_26969                         112   5e-27   
gb|ADD59916.1|  heat shock protein 70                                   105   5e-27   
ref|XP_010094065.1|  Heat shock 70 kDa protein                          112   5e-27   
pdb|4WV5|A  Chain A, Heat Shock Protein 70 Substrate Binding Domain     105   5e-27   
ref|XP_002395192.1|  hypothetical protein MPER_04798                    108   5e-27   
ref|XP_008342821.1|  PREDICTED: heat shock 70 kDa protein-like          112   5e-27   
ref|XP_008342822.1|  PREDICTED: heat shock 70 kDa protein-like          112   6e-27   
ref|NP_176036.1|  heat shock protein ERD2                               111   6e-27   
gb|ABC48924.1|  HSp70                                                   105   6e-27   
ref|XP_009354217.1|  PREDICTED: heat shock 70 kDa protein-like          112   6e-27   
ref|XP_008342826.1|  PREDICTED: heat shock 70 kDa protein-like          112   6e-27   
ref|NP_001140835.1|  uncharacterized protein LOC100272911               111   6e-27   
gb|ACZ53945.1|  heat shock protein 70                                   103   6e-27   
ref|XP_008707551.1|  PREDICTED: heat shock 70 kDa protein               105   6e-27   
gb|ACB77912.1|  heat shock protein 70                                   105   6e-27   
ref|XP_001767221.1|  predicted protein                                  111   6e-27   
gb|ACB77918.1|  heat shock protein 70                                   105   6e-27   
ref|XP_009354216.1|  PREDICTED: heat shock 70 kDa protein-like          111   7e-27   
gb|AHJ80021.1|  truncated heat shock protein 70                         104   7e-27   
ref|XP_001781229.1|  predicted protein                                  111   7e-27   
ref|XP_005850065.1|  heat shock protein 70                              111   7e-27   
ref|XP_002512742.1|  heat shock protein, putative                       111   7e-27   
emb|CAH23228.1|  putative heat shock protein 70.1                       106   7e-27   
ref|XP_001735227.1|  heat shock cognate 70 kDa protein                  108   7e-27   
gb|KHJ78956.1|  DnaK family protein                                     107   8e-27   
gb|ABS80938.1|  inducible heat shock protein 70                         105   8e-27   
ref|XP_004287145.1|  PREDICTED: heat shock 70 kDa protein-like          111   8e-27   
emb|CDX83960.1|  BnaC08g16850D                                          111   9e-27   
ref|XP_002465468.1|  hypothetical protein SORBIDRAFT_01g039390          111   9e-27   
ref|XP_002277050.1|  PREDICTED: heat shock 70 kDa protein               111   9e-27   
ref|XP_010497610.1|  PREDICTED: heat shock 70 kDa protein 5-like        111   9e-27   
ref|XP_009149047.1|  PREDICTED: heat shock 70 kDa protein 5             111   1e-26   
ref|NP_173055.1|  heat shock protein 70B                                111   1e-26   
gb|AHJ80023.1|  heat shock protein 70                                   105   1e-26   
emb|CDX96825.1|  BnaA08g23680D                                          111   1e-26   
ref|XP_008658250.1|  PREDICTED: uncharacterized protein LOC100272...    111   1e-26   
ref|XP_010476705.1|  PREDICTED: heat shock 70 kDa protein 5             111   1e-26   
ref|XP_004984743.1|  PREDICTED: heat shock cognate 70 kDa protein...    111   1e-26   
ref|XP_009110463.1|  PREDICTED: heat shock 70 kDa protein 5-like        111   1e-26   
gb|AHJ80029.1|  heat shock protein 70                                   105   1e-26   
gb|AIS71882.1|  heat shock protein 70                                   105   1e-26   
gb|AHJ80022.1|  heat shock protein 70                                   105   1e-26   
ref|XP_002947129.1|  heat-shock inducible Hsp70                         111   1e-26   
ref|XP_010459142.1|  PREDICTED: heat shock 70 kDa protein 5-like        111   1e-26   
ref|XP_006306285.1|  hypothetical protein CARUB_v10012149mg             110   1e-26   
ref|XP_002446329.1|  hypothetical protein SORBIDRAFT_06g014400          110   1e-26   
gb|ACJ54890.1|  heat shock protein 70                                   110   1e-26   
gb|ABF95267.1|  Heat shock cognate 70 kDa protein, putative, expr...    110   1e-26   
ref|XP_010929169.1|  PREDICTED: heat shock 70 kDa protein-like          110   1e-26   
ref|XP_006649853.1|  PREDICTED: heat shock cognate 70 kDa protein...    110   1e-26   
gb|AHJ80043.1|  heat shock protein 70                                   105   1e-26   
gb|AHJ80025.1|  heat shock protein 70                                   105   1e-26   
gb|AHJ80016.1|  heat shock protein 70                                   105   1e-26   
gb|ADW27171.1|  HSP70                                                   104   1e-26   
sp|P11503.2|HSP70_ONCVO  RecName: Full=Heat shock 70 kDa protein;...    108   1e-26   
gb|AHJ80011.1|  heat shock protein 70                                   105   1e-26   
gb|AET43984.1|  Hsp70                                                   104   1e-26   
emb|CDJ02411.1|  Heat shock 70 kDa protein                              107   1e-26   
ref|XP_010273661.1|  PREDICTED: heat shock 70 kDa protein-like          110   1e-26   
gb|AHJ80019.1|  heat shock protein 70                                   105   2e-26   
gb|ABC40755.1|  heat shock cognate 70 kDa protein                       103   2e-26   
dbj|BAE48223.1|  heat shock protein 70                                  110   2e-26   
gb|ACB77908.1|  heat shock protein 70                                   103   2e-26   



>emb|CAA55184.1| heat shock protein 70 kDa [Zea mays]
Length=219

 Score =   121 bits (303),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  37   LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  94



>gb|AFV66576.1| heat shock protein 70, partial [Ziziphus jujuba]
Length=186

 Score =   120 bits (301),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  115  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  172



>gb|AEP40944.1| heat shock protein 70 family protein [Posidonia oceanica]
Length=200

 Score =   120 bits (301),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  20   LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  77



>emb|CCJ09763.1| putative heat shock protein-70kDa, partial [Hirudo medicinalis]
Length=229

 Score =   121 bits (303),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  49   LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  106



>gb|KDO67650.1| hypothetical protein CISIN_1g0212722mg, partial [Citrus sinensis]
Length=206

 Score =   120 bits (301),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  20   LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  77



>emb|CAA67588.1| 70 kD heatshockprotein [Medicago sativa]
Length=214

 Score =   120 bits (302),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  32   LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  89



>emb|CAA10980.1| putative heat shock cognate protein [Hordeum vulgare subsp. vulgare]
Length=109

 Score =   117 bits (294),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEE EKM
Sbjct  43   LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEESEKM  100



>gb|ABR13285.1| putative dnaK-type molecular chaperone hsc70.1 [Prunus dulcis]
Length=179

 Score =   119 bits (298),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKM
Sbjct  30   LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKM  87



>gb|ACU17965.1| unknown [Glycine max]
Length=233

 Score =   120 bits (300),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  52   LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  109



>ref|XP_002805956.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Macaca mulatta]
Length=224

 Score =   119 bits (299),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  39   LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  96



>ref|XP_001783063.1| predicted protein [Physcomitrella patens]
 gb|EDQ52132.1| predicted protein [Physcomitrella patens]
Length=220

 Score =   119 bits (299),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  37   LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  94



>gb|AAK59628.2| putative dnaK-type molecular chaperone hsc70.1 protein [Arabidopsis 
thaliana]
Length=215

 Score =   119 bits (297),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  31   LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  88



>emb|CAA55183.1| heat shock protein 70 kDa [Zea mays]
Length=219

 Score =   118 bits (296),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPR VPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  37   LSGIPPAPRSVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  94



>gb|ABP01597.1| heat shock protein 70 [Ageratina adenophora]
Length=301

 Score =   120 bits (300),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  119  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  176



>gb|ACH61066.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61067.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61068.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61069.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61070.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61071.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61072.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61073.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61074.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61075.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61076.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61077.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61078.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61079.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61080.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61081.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61082.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61083.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61084.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61085.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61086.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61087.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61088.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
 gb|ACH61089.1| heat shock protein 70 kDa [Pseudotsuga menziesii]
Length=224

 Score =   118 bits (296),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  59   LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  116



>gb|ACH61090.1| heat shock protein 70 kDa [Pseudotsuga macrocarpa]
Length=224

 Score =   118 bits (296),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  59   LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  116



>gb|AAX07349.1| heat shock protein 70 [Zea mays]
Length=373

 Score =   120 bits (302),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  191  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  248



>gb|AAB65162.1| heat shock cognate protein [Solanum commersonii]
Length=339

 Score =   120 bits (300),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  157  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  214



>gb|AEX55235.1| heat shock protein 70 [Allium sativum]
Length=367

 Score =   120 bits (301),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  186  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  243



>gb|EEC71767.1| hypothetical protein OsI_04375 [Oryza sativa Indica Group]
Length=423

 Score =   120 bits (302),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  241  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  298



>gb|EMT15100.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=1430

 Score =   124 bits (311),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|EAY81899.1| hypothetical protein OsI_37065 [Oryza sativa Indica Group]
Length=434

 Score =   120 bits (302),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  252  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  309



>gb|EEC76425.1| hypothetical protein OsI_14101 [Oryza sativa Indica Group]
Length=434

 Score =   120 bits (301),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  253  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  310



>gb|AAP42157.1|AF509339_1 heat shock protein 70 [Saussurea medusa]
Length=427

 Score =   120 bits (301),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  247  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  304



>tpg|DAA55190.1| TPA: heat shock protein70-4 [Zea mays]
Length=521

 Score =   121 bits (303),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  339  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  396



>emb|CDY04364.1| BnaC04g18290D [Brassica napus]
Length=271

 Score =   118 bits (295),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  110  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  167



>gb|ABG22609.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=544

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  362  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  419



>ref|XP_004156719.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
Length=547

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  362  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  419



>ref|XP_004492129.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=542

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  362  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  419



>gb|AEO13403.1| heat shock 70 [Glycine max]
Length=560

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  378  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  435



>gb|AAL85887.1|AF479058_1 70 kDa heat shock protein [Sandersonia aurantiaca]
Length=336

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKM
Sbjct  155  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKM  212



>ref|XP_009913284.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c, partial [Haliaeetus albicilla]
Length=520

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  418  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  475



>ref|XP_006574857.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Glycine 
max]
Length=586

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  404  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  461



>gb|KHN48981.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=585

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  404  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  461



>gb|KDO36486.1| hypothetical protein CISIN_1g020168mg [Citrus sinensis]
Length=330

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  148  LSGIPPAPRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  205



>emb|CDY16797.1| BnaA09g05850D [Brassica napus]
Length=264

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK++IEKM
Sbjct  107  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDDIEKM  164



>dbj|BAA34919.1| heat shock protein 70 cognate [Salix gilgiana]
Length=408

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKM
Sbjct  227  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKM  284



>emb|CDY40360.1| BnaA10g27080D [Brassica napus]
Length=260

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK++IEKM
Sbjct  104  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDDIEKM  161



>ref|XP_010253827.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=619

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  438  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  495



>emb|CDY15422.1| BnaC04g42010D [Brassica napus]
 emb|CDY10446.1| BnaCnng03470D [Brassica napus]
Length=260

 Score =   117 bits (292),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK++IEKM
Sbjct  104  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDDIEKM  161



>gb|EAY89450.1| hypothetical protein OsI_10982 [Oryza sativa Indica Group]
Length=438

 Score =   119 bits (298),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKM
Sbjct  255  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKM  312



>ref|XP_010922357.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Elaeis guineensis]
Length=648

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|ABG22608.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=602

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  420  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  477



>ref|XP_008656365.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 gb|AFW82225.1| hypothetical protein ZEAMMB73_366749 [Zea mays]
Length=649

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  466  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  523



>ref|XP_002441219.1| hypothetical protein SORBIDRAFT_09g022580 [Sorghum bicolor]
 gb|EES19649.1| hypothetical protein SORBIDRAFT_09g022580 [Sorghum bicolor]
Length=649

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  466  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  523



>gb|KHN21966.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=646

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  464  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  521



>ref|XP_007016452.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34071.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=677

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_004961848.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=649

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  466  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  523



>ref|XP_003537997.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
Length=649

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|KDP35613.1| hypothetical protein JCGZ_09051 [Jatropha curcas]
Length=648

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|KDP44975.1| hypothetical protein JCGZ_01475 [Jatropha curcas]
Length=617

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  436  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  493



>gb|AFA51946.1| heat shock protein 70 [Paeonia suffruticosa]
Length=650

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_007139236.1| hypothetical protein PHAVU_008G012600g [Phaseolus vulgaris]
 gb|ESW11230.1| hypothetical protein PHAVU_008G012600g [Phaseolus vulgaris]
Length=647

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|AIZ68155.1| heat shock protein 70 [Galtonia saundersiae]
Length=648

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_002527736.1| heat shock protein, putative [Ricinus communis]
 gb|EEF34649.1| heat shock protein, putative [Ricinus communis]
Length=647

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|AAN86274.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=647

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_004962705.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=649

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_008802761.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_007144450.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
 gb|ESW16444.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
Length=614

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>emb|CDY52661.1| BnaC01g38510D [Brassica napus]
Length=647

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_010030977.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Eucalyptus grandis]
Length=649

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>tpg|DAA44672.1| TPA: hsp70 protein [Zea mays]
Length=544

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFD+DANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  362  LSGIPPAPRGVPQITVCFDMDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  419



>ref|XP_010253221.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=648

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_003539680.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
 gb|KHN32117.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=649

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>emb|CDY50531.1| BnaA01g30490D [Brassica napus]
Length=650

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_003552695.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Glycine 
max]
 gb|KHN13895.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=647

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_004505872.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|AEK70336.1| heat shock protein 70 [Paeonia lactiflora]
Length=650

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|AAB97316.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88132.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88133.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=651

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|AIU34470.1| putative heat shock protein, partial [Taraxacum brevicorniculatum]
Length=646

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_009597695.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana tomentosiformis]
Length=648

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|EMS52605.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=647

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_009407484.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
 ref|XP_009407485.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=649

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  468  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  525



>ref|XP_003578898.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Brachypodium 
distachyon]
Length=648

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|AAR17080.1| heat shock protein 70-3 [Nicotiana tabacum]
Length=648

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|AAP04522.1| heat shock protein 70 [Nicotiana tabacum]
Length=648

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|NP_001044757.1| Os01g0840100 [Oryza sativa Japonica Group]
 dbj|BAB67894.1| putative HSP70 [Oryza sativa Japonica Group]
 dbj|BAB93214.1| putative HSP70 [Oryza sativa Japonica Group]
 dbj|BAF06671.1| Os01g0840100 [Oryza sativa Japonica Group]
 gb|EAZ14100.1| hypothetical protein OsJ_04024 [Oryza sativa Japonica Group]
 dbj|BAH01518.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86881.1| 70kDa heat shock protein [Oryza sativa Japonica Group]
 gb|ADR66969.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=648

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  466  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  523



>gb|EAZ19310.1| hypothetical protein OsJ_34853 [Oryza sativa Japonica Group]
Length=632

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  450  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  507



>dbj|BAJ91305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=647

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_009120551.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=650

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>emb|CDX73815.1| BnaA03g32320D [Brassica napus]
Length=652

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_008447699.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Cucumis melo]
Length=647

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|AAM48131.1|AF509336_1 heat shock protein 70 [Saussurea medusa]
Length=647

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|AGL07711.1| heat shock protein 70 [Ziziphus jujuba]
Length=654

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_004250958.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_010937646.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_009620324.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_009409520.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_002442353.1| hypothetical protein SORBIDRAFT_08g018750 [Sorghum bicolor]
 gb|EES16191.1| hypothetical protein SORBIDRAFT_08g018750 [Sorghum bicolor]
 gb|AHV91025.1| Hsp70 [Saccharum hybrid cultivar]
Length=649

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|EAY98319.1| hypothetical protein OsI_20227 [Oryza sativa Indica Group]
Length=410

 Score =   119 bits (297),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  230  LSGIPPAPRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  287



>ref|XP_011027580.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|ACJ11742.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|ABA95501.2| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=615

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|ACM42161.1| heat shock protein 70.58 [Ageratina adenophora]
Length=645

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|EMT07406.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=647

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_004142076.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 ref|XP_004161675.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 gb|KGN54238.1| Heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>emb|CAB72130.1| heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|NP_001051724.1| Os03g0821100 [Oryza sativa Japonica Group]
 gb|AAO65876.1| heat shock protein cognate 70 [Oryza sativa Japonica Group]
 gb|ABF99592.1| Heat shock cognate 70 kDa protein 2, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13638.1| Os03g0821100 [Oryza sativa Japonica Group]
 gb|EAZ29089.1| hypothetical protein OsJ_13143 [Oryza sativa Japonica Group]
 dbj|BAG91581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=649

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  468  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  525



>ref|XP_008660826.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 tpg|DAA47114.1| TPA: heat shock protein 70 [Zea mays]
Length=649

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_006649850.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Oryza brachyantha]
Length=655

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  472  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  529



>gb|EMS68426.1| Heat shock cognate 70 kDa protein 4 [Triticum urartu]
Length=648

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  466  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  523



>gb|KCW50223.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=615

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>emb|CDY00784.1| BnaC03g37680D [Brassica napus]
Length=650

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_002528432.1| heat shock protein, putative [Ricinus communis]
 gb|EEF33915.1| heat shock protein, putative [Ricinus communis]
Length=649

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_004307529.1| PREDICTED: heat shock cognate 70 kDa protein-like [Fragaria vesca 
subsp. vesca]
Length=649

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|ACR38891.1| heat shock protein 70 [Pellia endiviifolia (species B)]
 gb|ACR38900.1| heat shock protein 70 [Pellia endiviifolia (species B)]
Length=651

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|KDP44987.1| hypothetical protein JCGZ_01487 [Jatropha curcas]
Length=648

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|ACJ11745.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_002311161.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE88528.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_008674324.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 gb|ACL53191.1| unknown [Zea mays]
 tpg|DAA55191.1| TPA: heat shock protein70-4 isoform 1 [Zea mays]
 tpg|DAA55192.1| TPA: heat shock protein70-4 isoform 2 [Zea mays]
 tpg|DAA55193.1| TPA: heat shock protein70-4 isoform 3 [Zea mays]
Length=649

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|ACJ11741.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|ACD93209.1| heat shock protein 70 [Camellia sinensis]
Length=677

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_010465032.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_002884912.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61171.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|KHN27222.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_010030975.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Eucalyptus 
grandis]
 gb|KCW50222.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=649

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|ADB85350.1| putative heat shock cognate [Phyllostachys edulis]
Length=674

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  48   LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  105



>gb|KDP44981.1| hypothetical protein JCGZ_01481 [Jatropha curcas]
Length=648

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_010486980.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_006407319.1| hypothetical protein EUTSA_v10020257mg [Eutrema salsugineum]
 gb|ESQ48772.1| hypothetical protein EUTSA_v10020257mg [Eutrema salsugineum]
Length=650

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|AFU34347.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34348.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34349.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34350.1| 70-kDa heat shock protein [Ipomoea batatas]
Length=652

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>dbj|BAP90755.1| heat shock protein 70 [Chrysanthemum x morifolium]
Length=647

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_004492128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=647

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_009622753.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=649

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_004249574.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
Length=644

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_010253202.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nelumbo nucifera]
Length=648

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_009777579.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=648

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_009786102.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana sylvestris]
Length=648

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_002316294.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEF02465.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>dbj|BAK00257.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=648

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  466  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  523



>ref|XP_006297173.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
 gb|EOA30071.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
Length=650

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_011027180.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=649

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_004287404.1| PREDICTED: heat shock cognate 70 kDa protein-like [Fragaria vesca 
subsp. vesca]
Length=649

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|AAB99745.1| HSP70 [Triticum aestivum]
 gb|EMT04103.1| Heat shock cognate 70 kDa protein [Aegilops tauschii]
Length=648

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  466  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  523



>ref|XP_009785159.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
 dbj|BAM24707.1| Heat shock protein 70 [Nicotiana tabacum]
Length=649

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_010231300.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brachypodium distachyon]
Length=649

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  466  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  523



>gb|AAN86276.1| cell-autonomous heat shock cognate protein 70 [Cucurbita maxima]
Length=650

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|ACJ11740.1| heat shock protein 70 [Gossypium hirsutum]
Length=647

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_007009369.1| Heat shock protein 70 [Theobroma cacao]
 gb|EOY18179.1| Heat shock protein 70 [Theobroma cacao]
Length=649

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_007027052.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
 gb|EOY07554.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
Length=646

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_011027172.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X1 [Populus euphratica]
 ref|XP_011027173.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X2 [Populus euphratica]
Length=648

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_009357719.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X2 [Pyrus 
x bretschneideri]
Length=649

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  466  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  523



>ref|XP_006833219.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
 gb|ERM98497.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
Length=657

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|KCW50224.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=632

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_010499184.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|ADZ46371.1| HSP70 [Malus hupehensis]
Length=650

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>emb|CAB72129.1| heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_004246402.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_003621886.1| Heat shock protein [Medicago truncatula]
 gb|AES78104.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_011094842.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Sesamum indicum]
Length=646

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_007144451.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
 gb|ESW16445.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
Length=648

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|NP_187864.1| heat shock protein 70-4 [Arabidopsis thaliana]
 sp|Q9LHA8.1|MD37C_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37c; AltName: Full=Heat shock 70 kDa protein 4; 
AltName: Full=Heat shock cognate 70 kDa protein 4; AltName: 
Full=Heat shock cognate protein 70-4; Short=AtHsc70-4; AltName: 
Full=Heat shock protein 70-4; Short=AtHsp70-4 [Arabidopsis 
thaliana]
 gb|AAG51030.1|AC069474_29 heat shock protein 70; 34105-36307 [Arabidopsis thaliana]
 dbj|BAB02269.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AAL06844.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL06851.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL24367.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AEE75218.1| heat shock protein 70-4 [Arabidopsis thaliana]
Length=650

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_002532297.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30081.1| heat shock protein, putative [Ricinus communis]
Length=652

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_004142745.1| PREDICTED: heat shock cognate 70 kDa protein-like [Cucumis sativus]
 gb|KGN51286.1| Heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_006341042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_003621869.1| Heat shock protein [Medicago truncatula]
 gb|AES78087.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=648

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|KEH30131.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_006644983.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Oryza brachyantha]
Length=649

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  466  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  523



>ref|XP_004307527.1| PREDICTED: heat shock cognate 70 kDa protein-like [Fragaria vesca 
subsp. vesca]
Length=651

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_006350760.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Solanum 
tuberosum]
Length=648

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_009357717.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=650

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_009135236.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=652

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_004302715.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Fragaria vesca subsp. vesca]
Length=647

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_006436017.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
 ref|XP_006486087.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
 gb|ESR49257.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
Length=653

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_009592776.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|AEO22185.1| CytHSP70 [Triticum aestivum]
Length=540

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKM
Sbjct  356  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKM  413



>gb|AHW48175.1| heat shock protein 70, partial [Triticum aestivum]
Length=539

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKM
Sbjct  355  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKM  412



>gb|ACJ85522.1| unknown [Medicago truncatula]
 gb|AFK38758.1| unknown [Medicago truncatula]
Length=649

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_006664117.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|AAV98051.1| heat shock protein 70 [Medicago sativa]
Length=649

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_010095022.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58128.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=651

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>emb|CAA05547.1| heat shock protein 70 [Arabidopsis thaliana]
Length=650

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_006349514.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=647

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_008370710.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Malus domestica]
Length=649

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|ADD71975.1| heat shock protein 70 [Rhododendron lapponicum]
Length=651

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_008371627.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Malus domestica]
 gb|AAF34134.1| high molecular weight heat shock protein [Malus domestica]
Length=650

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|ABP35942.1| heat shock protein 70 [Cyclamen persicum]
Length=650

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>emb|CAA47948.2| heat shock protein 70 [Oryza sativa Indica Group]
Length=648

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  466  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  523



>ref|XP_009374678.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=647

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|WP_039310754.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
 gb|AHL69785.1| heat shock protein [Camellia sinensis]
 gb|KHL91223.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
Length=650

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_008458906.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cucumis 
melo]
Length=652

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_010558794.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=649

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_007220208.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
 gb|EMJ21407.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
Length=649

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_002284008.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
 emb|CAN81694.1| hypothetical protein VITISV_017873 [Vitis vinifera]
Length=648

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|NP_001068540.1| Os11g0703900 [Oryza sativa Japonica Group]
 gb|AAX95352.1| dnaK-type molecular chaperone hsp70 - rice (fragment) [Oryza 
sativa Japonica Group]
 gb|ABA95500.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28903.1| Os11g0703900 [Oryza sativa Japonica Group]
Length=649

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_006663128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|AAS57913.1| 70 kDa heat shock cognate protein 2 [Vigna radiata]
Length=648

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|ABX76301.1| heat shock protein 70 [Ageratina adenophora]
Length=649

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_002263599.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=649

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_011077460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=646

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_009606077.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|KCW50226.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=742

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  560  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  617



>gb|KCW50227.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=735

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  560  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  617



>ref|XP_004156718.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
Length=659

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  474  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  531



>ref|XP_011027667.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Populus euphratica]
Length=515

 Score =   119 bits (298),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKM
Sbjct  334  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKM  391



>gb|AAN86275.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=652

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_008369876.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Malus domestica]
Length=648

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_009338761.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=656

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  475  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  532



>gb|EEC75662.1| hypothetical protein OsI_12445 [Oryza sativa Indica Group]
Length=297

 Score =   117 bits (292),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/56 (100%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE  169
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE
Sbjct  230  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE  285



>ref|XP_008233611.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Prunus mume]
Length=649

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_006398708.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
 gb|ESQ40161.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
Length=515

 Score =   119 bits (297),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  398  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  455



>ref|XP_009414319.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE+M
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERM  524



>gb|AII99890.1| heat shock protein [Cicer arietinum]
Length=847

 Score =   120 bits (302),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  667  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  724



>ref|XP_010669896.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104887018 
[Beta vulgaris subsp. vulgaris]
Length=1526

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2     LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
             LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  1342  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  1399


 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  467  LSGIPPAPRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  524



>emb|CAA31663.1| hsp70 (AA 6 - 651) [Petunia x hybrida]
Length=646

 Score =   120 bits (300),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE+M
Sbjct  462  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERM  519



>gb|AIA22210.1| heat shock protein 70 [Chrysanthemum indicum]
Length=647

 Score =   120 bits (300),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAED+TTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDRTTGQKNKITITNDKGRLSKEEIEKM  524



>sp|P09189.1|HSP7C_PETHY RecName: Full=Heat shock cognate 70 kDa protein [Petunia x hybrida]
 emb|CAA30018.1| heat shock protein 70 [Petunia x hybrida]
Length=651

 Score =   119 bits (299),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE+M
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERM  524



>gb|EYU19900.1| hypothetical protein MIMGU_mgv1a002641mg [Erythranthe guttata]
Length=651

 Score =   119 bits (299),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFD+DANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDLDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_001767839.1| predicted protein [Physcomitrella patens]
 gb|EDQ67353.1| predicted protein [Physcomitrella patens]
Length=649

 Score =   119 bits (299),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  524



>gb|EMS45385.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=762

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  582  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  639



>ref|XP_001783048.1| predicted protein [Physcomitrella patens]
 gb|EDQ52117.1| predicted protein [Physcomitrella patens]
Length=650

 Score =   119 bits (299),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  524



>gb|AAV97978.1| heat shock protein hsp70 [Saussurea medusa]
Length=647

 Score =   119 bits (299),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVC+DIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCYDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>gb|KEH30132.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=578

 Score =   119 bits (297),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKM
Sbjct  396  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKM  453



>ref|XP_001751923.1| predicted protein [Physcomitrella patens]
 gb|EDQ83358.1| predicted protein [Physcomitrella patens]
Length=648

 Score =   119 bits (299),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  524



>ref|XP_010555208.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=652

 Score =   119 bits (299),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE+M
Sbjct  468  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERM  525



>ref|XP_004984739.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=649

 Score =   119 bits (299),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFD+DANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDMDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_001785822.1| predicted protein [Physcomitrella patens]
 gb|EDQ49366.1| predicted protein [Physcomitrella patens]
Length=648

 Score =   119 bits (299),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  524



>ref|NP_001167696.1| heat shock cognate 70 kDa protein 2 [Zea mays]
 gb|ACG43177.1| heat shock cognate 70 kDa protein 2 [Zea mays]
Length=649

 Score =   119 bits (299),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFD+DANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDMDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_009414320.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=648

 Score =   119 bits (299),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKM  524



>ref|XP_010553033.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=652

 Score =   119 bits (299),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE+M
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERM  524



>gb|ACT34017.1| heat shock cognate 70 kDa protein [Cenchrus americanus]
 gb|ACY00390.1| heat shock cognate 70 kDa protein [Cenchrus americanus]
Length=649

 Score =   119 bits (299),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFD+DANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDMDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|NP_001148198.1| heat shock cognate 70 kDa protein 2 [Zea mays]
 gb|ACG30152.1| heat shock cognate 70 kDa protein 2 [Zea mays]
 tpg|DAA44671.1| TPA: hsp70 protein [Zea mays]
Length=649

 Score =   119 bits (299),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFD+DANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDMDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_008458892.1| PREDICTED: heat shock cognate 70 kDa protein [Cucumis melo]
Length=648

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEK+
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKL  524



>ref|XP_010520113.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=650

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            L+GIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LTGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_002468097.1| hypothetical protein SORBIDRAFT_01g039530 [Sorghum bicolor]
 gb|EER95095.1| hypothetical protein SORBIDRAFT_01g039530 [Sorghum bicolor]
Length=649

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFD+DANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDMDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_011027182.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKM  524



>ref|XP_006378714.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|ERP56511.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKM  524



>ref|XP_006429028.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 ref|XP_006480766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Citrus sinensis]
 gb|ESR42268.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 gb|KDO41235.1| hypothetical protein CISIN_1g006381mg [Citrus sinensis]
Length=647

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  524



>gb|EPS60056.1| heat shock protein 70 [Genlisea aurea]
Length=653

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            L+GIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM
Sbjct  467  LTGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  524



>ref|XP_004493999.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=661

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKM  524



>ref|XP_004142750.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
 ref|XP_004156713.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
Length=613

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEK+
Sbjct  432  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKL  489



>ref|XP_011016414.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Populus euphratica]
Length=648

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKM  524



>ref|XP_002312090.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89457.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKM  524



>ref|XP_002312089.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89456.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKM  524



>ref|XP_006290203.1| hypothetical protein CARUB_v10003889mg [Capsella rubella]
 gb|EOA23101.1| hypothetical protein CARUB_v10003889mg [Capsella rubella]
Length=650

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  468  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  525



>ref|XP_011028442.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKM  524



>gb|ABR18415.1| unknown [Picea sitchensis]
 gb|ACN39931.1| unknown [Picea sitchensis]
 gb|ACN39963.1| unknown [Picea sitchensis]
Length=652

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  466  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  523



>ref|XP_010495044.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=611

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  427  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  484



>ref|XP_003554320.2| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
Length=721

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKM
Sbjct  534  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKM  591



>emb|CDP09040.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  524



>gb|KHN02428.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=654

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKM  524



>gb|KHN13891.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  524



>ref|XP_006378715.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
 gb|ERP56512.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
Length=649

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKM  524



>ref|XP_010423825.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37c [Camelina sativa]
Length=658

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  468  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  525



>ref|XP_003552691.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform 1 [Glycine 
max]
Length=649

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  524



>ref|XP_010490742.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=654

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  468  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  525



>ref|NP_195870.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
 sp|P22953.3|MD37E_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37e; AltName: Full=Heat shock 70 kDa protein 1; 
AltName: Full=Heat shock cognate 70 kDa protein 1; AltName: 
Full=Heat shock cognate protein 70-1; Short=AtHsc70-1; AltName: 
Full=Heat shock protein 70-1; Short=AtHsp70-1; AltName: 
Full=Protein EARLY-RESPONSIVE TO DEHYDRATION 2 [Arabidopsis 
thaliana]
 emb|CAB85987.1| dnaK-type molecular chaperone hsc70.1 [Arabidopsis thaliana]
 gb|AAL09715.1| AT5g02500/T22P11_90 [Arabidopsis thaliana]
 gb|AAM53305.1| DnaK-type molecular chaperone hsc70.1 [Arabidopsis thaliana]
 gb|AAO22583.1| putative dnaK-type molecular chaperone hsc70.1 protein [Arabidopsis 
thaliana]
 gb|AED90480.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
Length=651

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  524



>emb|CAA52684.1| heat shock protein 70 cognate [Arabidopsis thaliana]
Length=651

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  524



>gb|EYU26579.1| hypothetical protein MIMGU_mgv1a002667mg [Erythranthe guttata]
Length=648

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  524



>ref|XP_006348998.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKM  175
            LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKM
Sbjct  467  LSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKM  524



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511558873218