BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27846_g1_i1 len=919 path=[897:0-918]

Length=919
                                                                      Score     E

gb|AAB07724.1|  Pn47p                                                   290   2e-91   Ipomoea nil [qian niu]
gb|KCW74072.1|  hypothetical protein EUGRSUZ_E02710                     204   1e-58   
ref|XP_010057070.1|  PREDICTED: phospholipase A1-IIgamma-like           205   2e-58   
ref|XP_002305750.2|  lipase class 3 family protein                      202   1e-57   Populus trichocarpa [western balsam poplar]
ref|XP_004233849.2|  PREDICTED: phospholipase A1-IIgamma-like           199   8e-57   
ref|XP_009765842.1|  PREDICTED: phospholipase A1-II 1-like              199   2e-56   
ref|XP_004232957.2|  PREDICTED: phospholipase A1-II 1-like              197   1e-55   
ref|XP_004293927.1|  PREDICTED: phospholipase A1-IIgamma-like           197   2e-55   
emb|CDO96758.1|  unnamed protein product                                194   6e-55   
ref|XP_011027707.1|  PREDICTED: phospholipase A1-IIgamma-like           194   8e-55   
ref|XP_006362440.1|  PREDICTED: phospholipase A1-II 1-like              194   1e-54   
ref|XP_009601720.1|  PREDICTED: phospholipase A1-II 1-like              194   1e-54   
ref|XP_010054330.1|  PREDICTED: phospholipase A1-IIgamma-like           193   3e-54   
ref|XP_006364325.1|  PREDICTED: phospholipase A1-IIgamma-like           193   3e-54   
ref|XP_011074749.1|  PREDICTED: phospholipase A1-IIgamma                193   4e-54   
ref|XP_004232943.1|  PREDICTED: phospholipase A1-II 1                   192   4e-54   
ref|XP_010054329.1|  PREDICTED: phospholipase A1-IIgamma-like           192   5e-54   
ref|XP_003608142.1|  Lipase                                             190   1e-53   
ref|XP_009628626.1|  PREDICTED: phospholipase A1-IIgamma-like           191   2e-53   
ref|XP_007025426.1|  Alpha/beta-Hydrolases superfamily protein          191   3e-53   
gb|AFK47098.1|  unknown                                                 190   3e-53   
ref|XP_009393076.1|  PREDICTED: phospholipase A1-II 1                   189   6e-53   
ref|XP_006340582.1|  PREDICTED: phospholipase A1-IIgamma-like           189   9e-53   
gb|KDP21073.1|  hypothetical protein JCGZ_21544                         189   1e-52   
ref|XP_002316835.2|  lipase class 3 family protein                      189   1e-52   Populus trichocarpa [western balsam poplar]
ref|XP_004232956.1|  PREDICTED: phospholipase A1-II 1-like              188   2e-52   
ref|XP_009619316.1|  PREDICTED: phospholipase A1-IIgamma-like           188   2e-52   
ref|XP_009775805.1|  PREDICTED: phospholipase A1-IIgamma-like           187   3e-52   
ref|XP_010912683.1|  PREDICTED: phospholipase A1-II 1                   187   3e-52   
emb|CDO96757.1|  unnamed protein product                                186   4e-52   
ref|XP_009787871.1|  PREDICTED: phospholipase A1-IIgamma-like           187   5e-52   
ref|XP_004231490.1|  PREDICTED: phospholipase A1-II 1                   187   6e-52   
ref|XP_011101305.1|  PREDICTED: phospholipase A1-II 1-like              187   8e-52   
ref|XP_007153707.1|  hypothetical protein PHAVU_003G058100g             186   9e-52   
ref|XP_009777406.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    186   1e-51   
ref|XP_010655496.1|  PREDICTED: phospholipase A1-IIgamma isoform X2     184   1e-51   
ref|XP_011045903.1|  PREDICTED: phospholipase A1-IIgamma                186   1e-51   
ref|XP_009628625.1|  PREDICTED: phospholipase A1-IIgamma-like           185   2e-51   
gb|EYU36835.1|  hypothetical protein MIMGU_mgv1a020546mg                186   2e-51   
ref|XP_006449477.1|  hypothetical protein CICLE_v10015361mg             186   2e-51   
ref|XP_004232966.1|  PREDICTED: phospholipase A1-IIgamma-like           185   2e-51   
ref|XP_010279083.1|  PREDICTED: phospholipase A1-IIgamma-like           185   2e-51   
ref|XP_006467671.1|  PREDICTED: phospholipase A1-IIgamma-like           185   3e-51   
ref|XP_004505133.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    184   3e-51   
ref|XP_002522554.1|  triacylglycerol lipase, putative                   185   4e-51   Ricinus communis
ref|XP_010108436.1|  Phospholipase A1-IIgamma                           185   5e-51   
ref|XP_009757709.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    184   6e-51   
gb|EYU17473.1|  hypothetical protein MIMGU_mgv1a008748mg                183   8e-51   
emb|CBI30665.3|  unnamed protein product                                182   1e-50   
ref|XP_004505132.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    183   1e-50   
ref|XP_003593747.1|  Lipase                                             183   2e-50   
ref|XP_002266982.2|  PREDICTED: phospholipase A1-IIgamma isoform X1     183   2e-50   Vitis vinifera
ref|XP_003608120.1|  Lipase                                             183   2e-50   
ref|XP_009757707.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    182   2e-50   
ref|XP_006362439.1|  PREDICTED: phospholipase A1-IIgamma-like           183   3e-50   
gb|ABQ95989.1|  phospholipase A1                                        182   4e-50   Capsicum annuum
ref|XP_007025432.1|  Alpha/beta-Hydrolases superfamily protein, p...    182   5e-50   
ref|XP_010279086.1|  PREDICTED: phospholipase A1-IIgamma-like           181   5e-50   
ref|XP_010529190.1|  PREDICTED: phospholipase A1-IIgamma-like           182   6e-50   
ref|XP_010518795.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    182   6e-50   
ref|XP_006362430.1|  PREDICTED: phospholipase A1-IIgamma-like           181   7e-50   
ref|XP_004232955.1|  PREDICTED: phospholipase A1-II 1-like isofor...    181   7e-50   
ref|XP_004232963.1|  PREDICTED: phospholipase A1-IIgamma-like           181   7e-50   
ref|XP_003528480.1|  PREDICTED: phospholipase A1-IIgamma-like           181   1e-49   
ref|XP_004232958.1|  PREDICTED: phospholipase A1-II 1-like              181   1e-49   
ref|XP_007153706.1|  hypothetical protein PHAVU_003G058000g             180   2e-49   
ref|XP_010277744.1|  PREDICTED: phospholipase A1-IIgamma-like           180   2e-49   
ref|XP_009777407.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    180   2e-49   
ref|XP_010518797.1|  PREDICTED: phospholipase A1-IIgamma-like           181   2e-49   
ref|XP_006362431.1|  PREDICTED: phospholipase A1-II 1-like              179   3e-49   
ref|XP_008812184.1|  PREDICTED: phospholipase A1-II 1                   179   4e-49   
emb|CDP11819.1|  unnamed protein product                                179   4e-49   
ref|XP_007148062.1|  hypothetical protein PHAVU_006G177300g             179   5e-49   
ref|XP_008383647.1|  PREDICTED: phospholipase A1-IIgamma                179   6e-49   
ref|XP_009795642.1|  PREDICTED: phospholipase A1-IIgamma-like           179   7e-49   
ref|XP_004232965.1|  PREDICTED: phospholipase A1-IIgamma-like           178   8e-49   
ref|XP_004969327.1|  PREDICTED: phospholipase A1-II 1-like              178   8e-49   
ref|XP_008675278.1|  PREDICTED: phospholipase A1-II 2-like              178   1e-48   
ref|XP_004232942.2|  PREDICTED: phospholipase A1-IIgamma-like           178   1e-48   
ref|XP_004485882.1|  PREDICTED: phospholipase A1-IIgamma-like           178   1e-48   
ref|XP_004232964.1|  PREDICTED: phospholipase A1-IIgamma-like           178   1e-48   
ref|XP_004134929.1|  PREDICTED: phospholipase A1-IIgamma-like           179   1e-48   
gb|KGN49294.1|  hypothetical protein Csa_6G519470                       179   1e-48   
ref|XP_008439757.1|  PREDICTED: phospholipase A1-IIgamma                179   1e-48   
ref|XP_006362445.1|  PREDICTED: phospholipase A1-IIgamma-like           178   1e-48   
ref|XP_009626666.1|  PREDICTED: phospholipase A1-IIgamma-like           177   2e-48   
ref|XP_010686320.1|  PREDICTED: phospholipase A1-IIgamma-like           177   2e-48   
ref|XP_004140112.1|  PREDICTED: phospholipase A1-IIgamma-like           177   2e-48   
ref|XP_002456058.1|  hypothetical protein SORBIDRAFT_03g029640          177   4e-48   Sorghum bicolor [broomcorn]
gb|KHN18919.1|  Phospholipase A1-IIgamma                                176   4e-48   
ref|XP_006364324.1|  PREDICTED: phospholipase A1-IIgamma-like           176   5e-48   
ref|XP_003547164.1|  PREDICTED: phospholipase A1-IIgamma-like           177   6e-48   
ref|XP_010316799.1|  PREDICTED: phospholipase A1-II 1-like isofor...    176   6e-48   
ref|XP_009352805.1|  PREDICTED: phospholipase A1-IIgamma-like           177   7e-48   
ref|XP_009773996.1|  PREDICTED: phospholipase A1-II 1-like              176   1e-47   
gb|EAY75191.1|  hypothetical protein OsI_03083                          174   1e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_010686321.1|  PREDICTED: phospholipase A1-IIgamma-like           176   1e-47   
emb|CDX76515.1|  BnaA08g08850D                                          175   1e-47   
emb|CDM83551.1|  unnamed protein product                                175   2e-47   
gb|KHN08451.1|  Phospholipase A1-IIgamma                                175   2e-47   
ref|XP_008675277.1|  PREDICTED: phospholipase A1-II 1                   174   2e-47   
gb|EMT15519.1|  Lipase                                                  174   2e-47   
ref|XP_004969328.1|  PREDICTED: phospholipase A1-II 2-like              175   2e-47   
ref|XP_008449390.1|  PREDICTED: phospholipase A1-IIgamma                176   2e-47   
dbj|BAJ96485.1|  predicted protein                                      174   2e-47   
ref|XP_003608122.1|  Lipase                                             174   3e-47   
ref|XP_003541709.1|  PREDICTED: phospholipase A1-IIgamma-like           175   3e-47   
sp|A2WT95.2|PLA1_ORYSI  RecName: Full=Phospholipase A1-II 1             174   3e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_002456057.1|  hypothetical protein SORBIDRAFT_03g029630          173   7e-47   Sorghum bicolor [broomcorn]
gb|KFK28527.1|  hypothetical protein AALP_AA7G008200                    174   8e-47   
ref|XP_002525127.1|  triacylglycerol lipase, putative                   173   9e-47   Ricinus communis
dbj|BAA89335.1|  EEF53                                                  167   1e-46   Solanum melongena [aubergine]
ref|XP_008225210.1|  PREDICTED: phospholipase A1-IIgamma                173   1e-46   
ref|XP_004961147.1|  PREDICTED: phospholipase A1-II 7-like              172   1e-46   
ref|XP_006362433.1|  PREDICTED: phospholipase A1-II 1-like              172   2e-46   
ref|XP_010439839.1|  PREDICTED: phospholipase A1-IIgamma-like           173   2e-46   
ref|XP_009353256.1|  PREDICTED: phospholipase A1-IIgamma-like           173   2e-46   
ref|XP_006362432.1|  PREDICTED: phospholipase A1-IIgamma-like           172   3e-46   
ref|XP_009108369.1|  PREDICTED: phospholipase A1-IIgamma                172   3e-46   
sp|B9EYD3.2|PLA4_ORYSJ  RecName: Full=Phospholipase A1-II 4             171   5e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007213350.1|  hypothetical protein PRUPE_ppa1027164mg            171   5e-46   
gb|EMS52156.1|  Phospholipase A1-II 2                                   171   6e-46   
ref|XP_002441554.1|  hypothetical protein SORBIDRAFT_09g029230          170   7e-46   Sorghum bicolor [broomcorn]
ref|XP_006646154.1|  PREDICTED: phospholipase A1-II 2-like              170   7e-46   
ref|XP_003569462.2|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    176   1e-45   
emb|CDY53993.1|  BnaA03g58180D                                          169   1e-45   
ref|XP_006644443.1|  PREDICTED: phospholipase A1-II 1-like isofor...    170   1e-45   
gb|KCW89613.1|  hypothetical protein EUGRSUZ_A01896                     168   1e-45   
ref|XP_009131946.1|  PREDICTED: phospholipase A1-IIgamma-like           170   2e-45   
ref|XP_010696586.1|  PREDICTED: phospholipase A1-IIgamma-like           170   2e-45   
ref|XP_004232962.1|  PREDICTED: phospholipase A1-IIgamma-like           169   2e-45   
gb|EMS63185.1|  Phospholipase A1-II 1                                   174   2e-45   
ref|XP_003566945.1|  PREDICTED: phospholipase A1-II 2-like              169   3e-45   
emb|CDY01554.1|  BnaC07g35440D                                          169   3e-45   
ref|XP_006282609.1|  hypothetical protein CARUB_v10004827mg             169   4e-45   
gb|EPS68355.1|  hypothetical protein M569_06415                         162   8e-45   
ref|XP_010070312.1|  PREDICTED: phospholipase A1-II 1                   168   1e-44   
ref|XP_008647947.1|  PREDICTED: triacylglycerol lipase isoform X1       167   1e-44   
ref|XP_006414089.1|  hypothetical protein EUTSA_v10025238mg             168   1e-44   
ref|NP_001151242.1|  triacylglycerol lipase                             167   1e-44   Zea mays [maize]
ref|XP_011027708.1|  PREDICTED: phospholipase A1-IIgamma-like           167   1e-44   
emb|CBI21954.3|  unnamed protein product                                167   1e-44   
ref|NP_193590.1|  phospholipase A1-IIgamma                              167   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006644442.1|  PREDICTED: phospholipase A1-II 1-like isofor...    166   2e-44   
emb|CDX99456.1|  BnaC01g10960D                                          166   3e-44   
ref|XP_010657149.1|  PREDICTED: phospholipase A1-IIgamma-like           166   3e-44   
ref|XP_006852476.1|  hypothetical protein AMTR_s00021p00129470          166   3e-44   
ref|XP_002867985.1|  lipase class 3 family protein                      166   5e-44   
ref|NP_001152663.1|  triacylglycerol lipase precursor                   166   7e-44   Zea mays [maize]
ref|XP_010434518.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    165   1e-43   
sp|A2WT96.2|PLA2_ORYSI  RecName: Full=Phospholipase A1-II 2             164   1e-43   Oryza sativa Indica Group [Indian rice]
ref|NP_001043730.2|  Os01g0651200                                       164   2e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002440467.1|  hypothetical protein SORBIDRAFT_09g001420          163   4e-43   Sorghum bicolor [broomcorn]
pdb|2YIJ|A  Chain A, Crystal Structure Of Phospholipase A1              163   5e-43   
gb|ABK96341.1|  unknown                                                 162   8e-43   Populus trichocarpa x Populus deltoides
ref|XP_006644445.1|  PREDICTED: phospholipase A1-II 3-like              162   1e-42   
ref|XP_002456062.1|  hypothetical protein SORBIDRAFT_03g029680          163   1e-42   Sorghum bicolor [broomcorn]
ref|XP_010496242.1|  PREDICTED: phospholipase A1-IIgamma                162   1e-42   
emb|CDM85400.1|  unnamed protein product                                162   1e-42   
ref|XP_002305084.2|  hypothetical protein POPTR_0004s05380g             161   2e-42   Populus trichocarpa [western balsam poplar]
ref|NP_001043734.1|  Os01g0651800                                       162   2e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006417941.1|  hypothetical protein EUTSA_v10007767mg             161   3e-42   
tpg|DAA53108.1|  TPA: hypothetical protein ZEAMMB73_566262              160   3e-42   
ref|XP_010557125.1|  PREDICTED: phospholipase A1-IIbeta isoform X1      161   3e-42   
gb|EMT15520.1|  Feruloyl esterase A                                     164   3e-42   
sp|A2WTA0.1|PLA3_ORYSI  RecName: Full=Phospholipase A1-II 3; Flag...    161   4e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_006646158.1|  PREDICTED: phospholipase A1-II 4-like              160   4e-42   
ref|XP_004969332.1|  PREDICTED: phospholipase A1-II 3-like              161   4e-42   
ref|XP_003528482.1|  PREDICTED: phospholipase A1-IIgamma-like           160   4e-42   
ref|NP_001132361.1|  uncharacterized protein LOC100193806 precursor     160   9e-42   Zea mays [maize]
ref|XP_008655140.1|  PREDICTED: triacylglycerol lipase isoform X1       165   1e-41   
emb|CDY34061.1|  BnaC03g62710D                                          159   1e-41   
gb|KFK42950.1|  hypothetical protein AALP_AA1G060100                    159   1e-41   
ref|XP_006654823.1|  PREDICTED: phospholipase A1-II 6-like              159   2e-41   
gb|EAZ12914.1|  hypothetical protein OsJ_02837                          158   2e-41   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA53109.1|  TPA: hypothetical protein ZEAMMB73_566262              160   3e-41   
gb|EAY75192.1|  hypothetical protein OsI_03084                          159   3e-41   Oryza sativa Indica Group [Indian rice]
emb|CDX86530.1|  BnaC08g01730D                                          158   3e-41   
ref|XP_009110999.1|  PREDICTED: phospholipase A1-IIalpha-like           158   3e-41   
dbj|BAD68802.1|  lipase-like protein                                    158   3e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004960509.1|  PREDICTED: phospholipase A1-II 7-like              158   4e-41   
gb|EMT05279.1|  Lipase                                                  155   4e-41   
ref|XP_003574515.1|  PREDICTED: phospholipase A1-II 7-like              159   4e-41   
dbj|BAJ90094.1|  predicted protein                                      157   5e-41   
gb|EMS68153.1|  Phospholipase A1-II 7                                   157   5e-41   
ref|XP_003569464.1|  PREDICTED: phospholipase A1-II 3-like              157   9e-41   
ref|XP_007209593.1|  hypothetical protein PRUPE_ppa011396mg             152   1e-40   
gb|EEE64776.1|  hypothetical protein OsJ_19632                          154   1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002525129.1|  triacylglycerol lipase, putative                   156   2e-40   Ricinus communis
ref|XP_008648636.1|  PREDICTED: phospholipase A1-II 7-like              157   2e-40   
dbj|BAJ95995.1|  predicted protein                                      157   2e-40   
ref|XP_008674529.1|  PREDICTED: phospholipase A1-II 7-like              151   2e-40   
gb|KDP46905.1|  hypothetical protein JCGZ_24114                         156   2e-40   
ref|NP_172115.1|  phospholipase A1-IIalpha                              156   3e-40   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61647.1|  lipase-like protein                                     156   3e-40   Arabidopsis thaliana [mouse-ear cress]
gb|EMT21704.1|  Putative lipase                                         156   4e-40   
gb|EMT05578.1|  hypothetical protein F775_13080                         155   4e-40   
ref|XP_004968489.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    157   4e-40   
ref|XP_008238422.1|  PREDICTED: phospholipase A1-IIgamma-like           155   5e-40   
ref|XP_010475356.1|  PREDICTED: phospholipase A1-IIalpha-like           155   5e-40   
ref|XP_010457749.1|  PREDICTED: phospholipase A1-IIalpha                155   7e-40   
ref|NP_001056387.1|  Os05g0574100                                       154   1e-39   Oryza sativa Japonica Group [Japonica rice]
gb|KDP31780.1|  hypothetical protein JCGZ_12241                         153   2e-39   
gb|ABR18391.1|  unknown                                                 154   2e-39   Picea sitchensis
ref|XP_008648833.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    155   2e-39   
ref|XP_010501341.1|  PREDICTED: phospholipase A1-IIalpha-like           154   2e-39   
gb|AFW75599.1|  hypothetical protein ZEAMMB73_741719                    158   3e-39   
gb|ABK23399.1|  unknown                                                 152   4e-39   Picea sitchensis
ref|XP_010279085.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    153   4e-39   
ref|XP_004301748.1|  PREDICTED: phospholipase A1-IIgamma-like           152   4e-39   
ref|XP_003567848.1|  PREDICTED: phospholipase A1-II 7-like              152   8e-39   
ref|XP_004301746.1|  PREDICTED: phospholipase A1-IIgamma-like           151   8e-39   
emb|CDY10187.1|  BnaC05g04300D                                          151   1e-38   
gb|KDP21071.1|  hypothetical protein JCGZ_21542                         151   1e-38   
ref|XP_009119078.1|  PREDICTED: phospholipase A1-IIalpha                152   1e-38   
ref|XP_002455039.1|  hypothetical protein SORBIDRAFT_03g003410          152   2e-38   Sorghum bicolor [broomcorn]
ref|XP_002437113.1|  hypothetical protein SORBIDRAFT_10g021260          150   2e-38   Sorghum bicolor [broomcorn]
emb|CDY57813.1|  BnaA10g28020D                                          152   2e-38   
ref|XP_007014120.1|  Alpha/beta-Hydrolases superfamily protein          150   4e-38   
gb|EMT11182.1|  hypothetical protein F775_27795                         150   8e-38   
ref|XP_006374295.1|  hypothetical protein POPTR_0015s05760g             149   8e-38   
ref|XP_006306316.1|  hypothetical protein CARUB_v10012192mg             149   1e-37   
ref|XP_006410236.1|  hypothetical protein EUTSA_v10016726mg             149   1e-37   
ref|XP_009333706.1|  PREDICTED: phospholipase A1-IIgamma-like           148   1e-37   
ref|NP_001149813.1|  triacylglycerol lipase                             148   1e-37   Zea mays [maize]
ref|XP_008345355.1|  PREDICTED: phospholipase A1-IIgamma-like           148   2e-37   
gb|AFW79273.1|  hypothetical protein ZEAMMB73_515320                    148   2e-37   
ref|XP_002522552.1|  triacylglycerol lipase, putative                   147   2e-37   Ricinus communis
ref|XP_011047741.1|  PREDICTED: phospholipase A1-IIgamma-like           148   3e-37   
ref|XP_006428509.1|  hypothetical protein CICLE_v10011873mg             147   3e-37   
ref|XP_008355592.1|  PREDICTED: phospholipase A1-IIgamma-like           144   3e-37   
ref|XP_009624926.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    144   3e-37   
gb|AFW74936.1|  hypothetical protein ZEAMMB73_664132                    147   3e-37   
gb|KDP46901.1|  hypothetical protein JCGZ_24110                         147   3e-37   
ref|XP_008355590.1|  PREDICTED: phospholipase A1-IIgamma-like           144   4e-37   
ref|XP_002440294.1|  hypothetical protein SORBIDRAFT_09g029220          147   4e-37   Sorghum bicolor [broomcorn]
ref|XP_010279084.1|  PREDICTED: phospholipase A1-II 1-like isofor...    148   4e-37   
ref|XP_010518796.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    147   4e-37   
ref|XP_006491814.1|  PREDICTED: phospholipase A1-IIgamma-like           147   5e-37   
gb|KDP46903.1|  hypothetical protein JCGZ_24112                         147   6e-37   
gb|EEE64775.1|  hypothetical protein OsJ_19631                          146   6e-37   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99121.1|  hypothetical protein OsI_21080                          146   8e-37   Oryza sativa Indica Group [Indian rice]
sp|Q6F358.1|PLA6_ORYSJ  RecName: Full=Phospholipase A1-II 6             146   8e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011047800.1|  PREDICTED: phospholipase A1-II 4-like              147   9e-37   
ref|XP_002488949.1|  hypothetical protein SORBIDRAFT_1306s002010        145   1e-36   Sorghum bicolor [broomcorn]
gb|KDP21072.1|  hypothetical protein JCGZ_21543                         145   1e-36   
gb|EMT07769.1|  hypothetical protein F775_18307                         141   2e-36   
ref|XP_009603052.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    147   2e-36   
ref|XP_007208858.1|  hypothetical protein PRUPE_ppa025833mg             145   2e-36   
emb|CDY23963.1|  BnaC03g17280D                                          145   2e-36   
ref|XP_002438517.1|  hypothetical protein SORBIDRAFT_10g021250          145   2e-36   Sorghum bicolor [broomcorn]
tpg|DAA55829.1|  TPA: hypothetical protein ZEAMMB73_274435              140   2e-36   
ref|XP_009782117.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    146   3e-36   
ref|XP_006349747.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    145   4e-36   
gb|KDP21366.1|  hypothetical protein JCGZ_21837                         145   4e-36   
ref|XP_010108435.1|  Phospholipase A1-IIgamma                           144   4e-36   
emb|CDX84801.1|  BnaA03g14290D                                          144   5e-36   
ref|XP_008655897.1|  PREDICTED: phospholipase A1-II 7-like              144   6e-36   
ref|XP_010058981.1|  PREDICTED: phospholipase A1-IIgamma-like           144   7e-36   
gb|EPS70940.1|  hypothetical protein M569_03817                         144   7e-36   
ref|XP_009132769.1|  PREDICTED: phospholipase A1-IIbeta-like            144   8e-36   
ref|XP_011032046.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    145   8e-36   
gb|KFK31237.1|  hypothetical protein AALP_AA6G086300                    144   9e-36   
ref|NP_001056386.2|  Os05g0574000                                       139   1e-35   Oryza sativa Japonica Group [Japonica rice]
gb|ABK24664.1|  unknown                                                 144   1e-35   Picea sitchensis
ref|XP_002437873.1|  hypothetical protein SORBIDRAFT_10g004170          144   1e-35   Sorghum bicolor [broomcorn]
gb|AAC63840.1|  putative lipase                                         142   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469763.1|  PREDICTED: phospholipase A1-IIbeta-like            143   2e-35   
gb|ABR16123.1|  unknown                                                 144   2e-35   Picea sitchensis
ref|XP_010102366.1|  Phospholipase A1-Igamma3                           144   3e-35   
dbj|BAJ85084.1|  predicted protein                                      142   3e-35   
ref|XP_011005461.1|  PREDICTED: phospholipase A1-IIgamma-like           142   3e-35   
ref|XP_008235325.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    143   4e-35   
ref|XP_004493750.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    143   4e-35   
ref|XP_011100290.1|  PREDICTED: phospholipase A1-IIgamma-like           141   4e-35   
gb|KDP22109.1|  hypothetical protein JCGZ_25940                         142   4e-35   
gb|KEH23856.1|  phospholipase A1                                        142   5e-35   
ref|XP_010087133.1|  Phospholipase A1-Igamma1                           142   5e-35   
sp|O82274.2|PLA19_ARATH  RecName: Full=Phospholipase A1-IIbeta          142   5e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004493749.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    142   5e-35   
gb|EEE55096.1|  hypothetical protein OsJ_02844                          139   6e-35   
ref|XP_008238420.1|  PREDICTED: phospholipase A1-IIgamma-like           140   6e-35   
ref|XP_004303191.1|  PREDICTED: phospholipase A1-IIdelta-like           142   6e-35   
ref|XP_002313345.2|  hypothetical protein POPTR_0009s05660g             142   7e-35   
ref|XP_002456959.1|  hypothetical protein SORBIDRAFT_03g046400          142   7e-35   
ref|NP_001168256.1|  hypothetical protein                               140   8e-35   
ref|XP_003538937.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    142   8e-35   
ref|XP_002522553.1|  triacylglycerol lipase, putative                   141   9e-35   
ref|XP_003565876.1|  PREDICTED: phospholipase A1-II 6-like              141   9e-35   
emb|CDM86669.1|  unnamed protein product                                142   9e-35   
gb|EPS65213.1|  hypothetical protein M569_09566                         140   9e-35   
ref|XP_010414181.1|  PREDICTED: phospholipase A1-IIbeta-like            141   1e-34   
ref|XP_006374296.1|  hypothetical protein POPTR_0015s05770g             140   1e-34   
ref|XP_010679169.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    142   1e-34   
ref|XP_006576919.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    141   1e-34   
ref|XP_007162494.1|  hypothetical protein PHAVU_001G156900g             141   1e-34   
ref|XP_006393053.1|  hypothetical protein EUTSA_v10011370mg             141   1e-34   
ref|XP_002881156.1|  hypothetical protein ARALYDRAFT_320861             139   2e-34   
ref|XP_007015095.1|  Alpha/beta-Hydrolases superfamily protein          141   2e-34   
ref|XP_006469038.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    139   2e-34   
ref|NP_849603.1|  phospholipase A1-Igamma1                              140   2e-34   
ref|XP_006295721.1|  hypothetical protein CARUB_v10024849mg             139   3e-34   
ref|XP_004962195.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    140   3e-34   
ref|XP_004505625.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    140   3e-34   
ref|XP_007050417.1|  Alpha/beta-Hydrolases superfamily protein          140   4e-34   
ref|XP_010673678.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    140   4e-34   
ref|XP_010461974.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    140   4e-34   
ref|XP_008656338.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    140   4e-34   
gb|EMT07991.1|  Lipase                                                  139   5e-34   
ref|XP_010479626.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    140   5e-34   
ref|XP_002892359.1|  lipase class 3 family protein                      139   5e-34   
ref|XP_002529326.1|  conserved hypothetical protein                     133   8e-34   
gb|EMS50697.1|  Phospholipase A1-II 1                                   137   8e-34   
dbj|BAJ99811.1|  predicted protein                                      139   9e-34   
ref|XP_010500719.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    139   9e-34   
emb|CDP03693.1|  unnamed protein product                                137   1e-33   
ref|XP_011042424.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    139   1e-33   
ref|XP_007211838.1|  hypothetical protein PRUPE_ppa004631mg             139   1e-33   
ref|XP_002306818.1|  hypothetical protein POPTR_0005s24000g             138   1e-33   
ref|XP_008227339.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    138   1e-33   
ref|XP_010031778.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    138   2e-33   
ref|XP_006853086.1|  hypothetical protein AMTR_s00038p00106840          138   2e-33   
ref|XP_006446810.1|  hypothetical protein CICLE_v10015386mg             137   2e-33   
ref|XP_007132834.1|  hypothetical protein PHAVU_011G128500g             137   2e-33   
ref|XP_009367748.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    137   2e-33   
ref|XP_004146954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    137   2e-33   
ref|XP_007201554.1|  hypothetical protein PRUPE_ppa017780mg             137   2e-33   
emb|CDM86668.1|  unnamed protein product                                137   2e-33   
ref|XP_006307213.1|  hypothetical protein CARUB_v10008812mg             137   3e-33   
ref|XP_001781080.1|  predicted protein                                  136   3e-33   
ref|XP_002522550.1|  triacylglycerol lipase, putative                   135   3e-33   
ref|XP_011005460.1|  PREDICTED: phospholipase A1-II 4-like              137   3e-33   
gb|KDO63393.1|  hypothetical protein CISIN_1g014927mg                   136   3e-33   
ref|XP_003607369.1|  Lipase                                             137   3e-33   
ref|XP_006443915.1|  hypothetical protein CICLE_v10019700mg             137   3e-33   
ref|XP_007034959.1|  Alpha/beta-Hydrolases superfamily protein, p...    137   3e-33   
ref|XP_006468997.1|  PREDICTED: phospholipase A1-IIdelta-like           136   3e-33   
ref|XP_004168244.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    137   4e-33   
ref|XP_010925002.1|  PREDICTED: phospholipase A1-II 5-like              137   4e-33   
ref|XP_008372307.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    137   4e-33   
ref|XP_008346158.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    137   5e-33   
ref|XP_009414857.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    137   5e-33   
ref|XP_006853087.1|  hypothetical protein AMTR_s00038p00110060          137   5e-33   
ref|XP_010525149.1|  PREDICTED: phospholipase A1-IIdelta-like           136   5e-33   
ref|XP_007025431.1|  Alpha/beta-Hydrolases superfamily protein          135   5e-33   
ref|XP_006655277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    136   6e-33   
ref|XP_010457830.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    136   7e-33   
ref|XP_010457831.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    136   7e-33   
ref|XP_004962194.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    137   7e-33   
ref|XP_010686472.1|  PREDICTED: phospholipase A1-II 1-like              135   7e-33   
gb|EMS63790.1|  Phospholipase A1-II 7                                   136   8e-33   
ref|XP_009354875.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    136   8e-33   
gb|EYU24809.1|  hypothetical protein MIMGU_mgv1a007765mg                135   8e-33   
ref|XP_007131548.1|  hypothetical protein PHAVU_011G022500g             136   9e-33   
ref|XP_006307284.1|  hypothetical protein CARUB_v10008898mg             136   9e-33   
ref|XP_002302074.2|  hypothetical protein POPTR_0002s04560g             136   9e-33   
ref|XP_010544180.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    136   1e-32   
ref|XP_010510242.1|  PREDICTED: phospholipase A1-IIbeta                 135   1e-32   
gb|KCW49834.1|  hypothetical protein EUGRSUZ_K03311                     135   1e-32   
ref|XP_004289898.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    135   1e-32   
ref|XP_003540985.1|  PREDICTED: phospholipase A1-IIdelta-like           132   1e-32   
ref|XP_002891639.1|  lipase class 3 family protein                      135   1e-32   
tpg|DAA45463.1|  TPA: hypothetical protein ZEAMMB73_472202              135   1e-32   
ref|XP_010038036.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    135   2e-32   
ref|XP_008807980.1|  PREDICTED: phospholipase A1-II 5                   135   2e-32   
emb|CDY22842.1|  BnaA06g02350D                                          135   2e-32   
ref|XP_008238421.1|  PREDICTED: phospholipase A1-IIgamma-like           134   2e-32   
sp|B8A8C9.1|PLA5_ORYSI  RecName: Full=Phospholipase A1-II 5             135   2e-32   
ref|XP_010058983.1|  PREDICTED: phospholipase A1-IIgamma-like           133   2e-32   
ref|XP_007210039.1|  hypothetical protein PRUPE_ppa017270mg             134   2e-32   
ref|XP_008451272.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    134   3e-32   
gb|KDO53917.1|  hypothetical protein CISIN_1g048560mg                   134   3e-32   
ref|XP_011082995.1|  PREDICTED: phospholipase A1-IIdelta                134   3e-32   
ref|XP_006420095.1|  hypothetical protein CICLE_v10006964mg             134   3e-32   
emb|CDY49813.1|  BnaC06g04560D                                          134   4e-32   
ref|NP_564590.1|  DAD1-like lipase 2                                    134   4e-32   
ref|XP_002281907.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    134   4e-32   
gb|KHN34242.1|  Phospholipase A1-IIdelta                                130   4e-32   
ref|XP_010475428.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    134   5e-32   
dbj|BAJ85518.1|  predicted protein                                      134   5e-32   
gb|EYU46244.1|  hypothetical protein MIMGU_mgv1a004190mg                134   5e-32   
ref|XP_004961148.1|  PREDICTED: phospholipase A1-II 6-like              133   5e-32   
ref|XP_009401938.1|  PREDICTED: phospholipase A1-II 5                   134   5e-32   
gb|EMS51987.1|  Phospholipase A1-II 3                                   133   5e-32   
emb|CAN74039.1|  hypothetical protein VITISV_012945                     134   5e-32   
gb|KCW74056.1|  hypothetical protein EUGRSUZ_E02682                     132   6e-32   
ref|XP_009147767.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    134   6e-32   
ref|NP_001044041.1|  Os01g0710700                                       133   8e-32   
gb|EEE55092.1|  hypothetical protein OsJ_02840                          132   8e-32   
ref|XP_002465238.1|  hypothetical protein SORBIDRAFT_01g034810          132   9e-32   
ref|XP_006644603.1|  PREDICTED: phospholipase A1-II 5-like              132   1e-31   
ref|XP_003607601.1|  Feruloyl esterase A                                132   1e-31   
gb|KDP21364.1|  hypothetical protein JCGZ_21835                         132   1e-31   
ref|XP_008450415.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    132   2e-31   
ref|XP_008783171.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    132   2e-31   
gb|EEE55280.1|  hypothetical protein OsJ_03214                          134   2e-31   
ref|XP_006294314.1|  hypothetical protein CARUB_v10023322mg             131   2e-31   
ref|XP_006428645.1|  hypothetical protein CICLE_v10011864mg             131   2e-31   
gb|EMT30117.1|  Mono- and diacylglycerol lipase                         131   2e-31   
ref|XP_003569665.1|  PREDICTED: phospholipase A1-II 5                   131   3e-31   
gb|KHN32323.1|  Phospholipase A1-Igamma1, chloroplastic                 129   3e-31   
ref|XP_010326538.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    131   3e-31   
gb|KFK35847.1|  hypothetical protein AALP_AA4G044700                    131   4e-31   
ref|XP_006417878.1|  hypothetical protein EUTSA_v10007393mg             131   4e-31   
ref|XP_010525104.1|  PREDICTED: phospholipase A1-IIdelta                130   4e-31   
ref|XP_010938535.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    130   7e-31   
ref|XP_011026041.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    130   8e-31   
ref|XP_006655614.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    130   9e-31   
gb|AAD01804.1|  lipase                                                  130   9e-31   
gb|EYU41122.1|  hypothetical protein MIMGU_mgv1a021036mg                129   9e-31   
ref|XP_009119028.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    130   1e-30   
ref|XP_004505480.1|  PREDICTED: phospholipase A1-IIdelta-like           130   1e-30   
ref|XP_008348571.1|  PREDICTED: phospholipase A1-IIdelta-like           129   1e-30   
ref|XP_006470637.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    130   2e-30   
ref|XP_006446147.1|  hypothetical protein CICLE_v10014848mg             130   2e-30   
emb|CDP15943.1|  unnamed protein product                                129   2e-30   
gb|ACJ76846.1|  chloroplast lipase protein                              129   2e-30   
ref|XP_002981063.1|  hypothetical protein SELMODRAFT_113737             129   2e-30   
ref|XP_010517807.1|  PREDICTED: phospholipase A1-IIdelta-like iso...    129   2e-30   
emb|CDY14851.1|  BnaC04g48480D                                          128   2e-30   
emb|CDY10228.1|  BnaC05g04710D                                          129   2e-30   
ref|XP_003518894.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    129   2e-30   
ref|XP_010512889.1|  PREDICTED: phospholipase A1-IIdelta-like           128   2e-30   
ref|XP_010506105.1|  PREDICTED: phospholipase A1-IIdelta-like           129   2e-30   
ref|XP_002982537.1|  hypothetical protein SELMODRAFT_445229             129   2e-30   
ref|XP_008802654.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    129   2e-30   
gb|ACJ85535.1|  unknown                                                 129   2e-30   
gb|KCW57435.1|  hypothetical protein EUGRSUZ_H00215                     129   2e-30   
ref|XP_009766306.1|  PREDICTED: phospholipase A1-IIdelta-like           129   2e-30   
ref|XP_003518892.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    129   3e-30   
ref|XP_010069172.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    129   3e-30   
emb|CDM83808.1|  unnamed protein product                                128   3e-30   
ref|XP_004139114.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    128   3e-30   
ref|XP_003518893.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    128   3e-30   
gb|KEH23857.1|  phospholipase A1                                        128   4e-30   
gb|EEE63596.1|  hypothetical protein OsJ_18413                          129   4e-30   
ref|XP_010558870.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    129   4e-30   
gb|KGN66495.1|  hypothetical protein Csa_1G614650                       128   4e-30   
ref|XP_009384367.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    128   4e-30   
ref|XP_002881867.1|  hypothetical protein ARALYDRAFT_483364             127   4e-30   
gb|KFK37118.1|  hypothetical protein AALP_AA4G215200                    126   4e-30   
ref|XP_004969721.1|  PREDICTED: phospholipase A1-II 5-like              128   4e-30   
ref|XP_010927018.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    128   5e-30   
gb|EMS63050.1|  Phospholipase A1-II 5                                   128   5e-30   
ref|XP_010246745.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    128   5e-30   
emb|CDY47985.1|  BnaA04g24630D                                          127   5e-30   
ref|XP_010517806.1|  PREDICTED: phospholipase A1-IIdelta-like iso...    127   5e-30   
gb|KHG20660.1|  Phospholipase A1-IIgamma -like protein                  127   5e-30   
ref|XP_010508539.1|  PREDICTED: phospholipase A1-IIdelta isoform X1     127   6e-30   
ref|XP_010685025.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    128   6e-30   
ref|XP_010507708.1|  PREDICTED: phospholipase A1-IIdelta-like           127   7e-30   
dbj|BAJ88202.1|  predicted protein                                      127   7e-30   
dbj|BAJ85876.1|  predicted protein                                      127   8e-30   
ref|XP_009142078.1|  PREDICTED: phospholipase A1-IIdelta                127   8e-30   
ref|XP_010938722.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    127   8e-30   
ref|XP_004154680.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    127   8e-30   
ref|XP_011028053.1|  PREDICTED: phospholipase A1-IIdelta                127   9e-30   
ref|XP_010274199.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    127   9e-30   
ref|XP_010413021.1|  PREDICTED: phospholipase A1-IIdelta-like           126   9e-30   
ref|XP_002303465.1|  lipase family protein                              126   1e-29   
gb|EEC79153.1|  hypothetical protein OsI_19824                          127   1e-29   
ref|XP_004250927.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    127   1e-29   
ref|XP_010278159.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    127   1e-29   
ref|XP_008451275.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    127   1e-29   
ref|XP_006411537.1|  hypothetical protein EUTSA_v10016724mg             126   2e-29   
ref|XP_010689845.1|  PREDICTED: phospholipase A1-IIdelta-like           126   2e-29   
gb|KCW74061.1|  hypothetical protein EUGRSUZ_E02689                     125   2e-29   
ref|XP_009801144.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    126   2e-29   
ref|XP_008451639.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    126   2e-29   
ref|XP_008675114.1|  PREDICTED: phospholipase A1-II 5                   126   2e-29   
gb|EYU41119.1|  hypothetical protein MIMGU_mgv1a025698mg                125   2e-29   
ref|NP_181797.1|  phospholipase A1-IIdelta                              125   2e-29   
gb|KDP47123.1|  hypothetical protein JCGZ_22119                         125   2e-29   
ref|XP_009629724.1|  PREDICTED: phospholipase A1-IIdelta-like           125   3e-29   
ref|XP_011079988.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    126   3e-29   
ref|XP_004146952.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    125   4e-29   
ref|XP_007217233.1|  hypothetical protein PRUPE_ppa005547mg             125   4e-29   
ref|XP_004146990.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    125   4e-29   
ref|XP_010522024.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    125   4e-29   
gb|KGN44761.1|  hypothetical protein Csa_7G378500                       125   5e-29   
ref|XP_010689863.1|  PREDICTED: phospholipase A1-IIdelta-like           125   5e-29   
emb|CDY50817.1|  BnaC04g52540D                                          124   5e-29   
ref|XP_006411539.1|  hypothetical protein EUTSA_v10017651mg             124   5e-29   
emb|CDY10774.1|  BnaA05g11620D                                          124   5e-29   
ref|XP_003566295.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    125   6e-29   
ref|XP_004148351.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...    125   7e-29   
gb|KFK42995.1|  hypothetical protein AALP_AA1G065900                    125   7e-29   
ref|XP_009622048.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    125   7e-29   
ref|XP_002879267.1|  lipase class 3 family protein                      125   7e-29   
ref|XP_010052794.1|  PREDICTED: phospholipase A1-IIdelta                124   8e-29   
emb|CBI30963.3|  unnamed protein product                                122   1e-28   
ref|XP_010925003.1|  PREDICTED: phospholipase A1-II 5-like              124   1e-28   
gb|EMT00730.1|  Lipase                                                  122   1e-28   
gb|EMS48809.1|  Phospholipase A1-II 6                                   124   1e-28   
gb|KCW51163.1|  hypothetical protein EUGRSUZ_J00755                     124   1e-28   
emb|CDO98286.1|  unnamed protein product                                123   2e-28   
ref|XP_007048712.1|  Alpha/beta-Hydrolases superfamily protein          123   2e-28   
ref|XP_009144598.1|  PREDICTED: phospholipase A1-IIbeta-like            122   2e-28   
ref|XP_007144693.1|  hypothetical protein PHAVU_007G177100g             123   2e-28   
ref|XP_009389474.1|  PREDICTED: phospholipase A1-II 5-like              122   3e-28   



>gb|AAB07724.1| Pn47p [Ipomoea nil]
Length=402

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 170/216 (79%), Gaps = 5/216 (2%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPV  181
            KSARDQIREEVARL+ELYK E+ISITVTGHSLGS++ATLNAVDLA NP+N N+   N+ V
Sbjct  190  KSARDQIREEVARLVELYKDEDISITVTGHSLGSSMATLNAVDLAANPINNNK---NILV  246

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKN--ILYEAVGV  355
            TAF +  PKVGD+NFK+  SNQ NLR +RISDVND+VT VP      G N  ILY  VGV
Sbjct  247  TAFLYASPKVGDENFKNVISNQQNLRALRISDVNDIVTAVPPFGWKEGDNTAILYGDVGV  306

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
            G +IDSKKS YLKP    +  HDLM +MH IDG+QGS+GGFE + DFD++K+NKY   LK
Sbjct  307  GLVIDSKKSHYLKPDFPNLSTHDLMLYMHAIDGYQGSQGGFERQEDFDLAKVNKYGDYLK  366

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDETF  643
             EY +P+ W N+KDKGMVQQ+DG YILDDHEVD+TF
Sbjct  367  AEYPIPIGWFNIKDKGMVQQDDGNYILDDHEVDKTF  402



>gb|KCW74072.1| hypothetical protein EUGRSUZ_E02710 [Eucalyptus grandis]
Length=419

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 144/213 (68%), Gaps = 12/213 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SARDQ+ +EV RL+ELYK EEISITVTGHSLG+A+ATLNAVD+  N +N  K+++    P
Sbjct  207  SARDQVLQEVKRLVELYKNEEISITVTGHSLGAAIATLNAVDIVANGLNQPKDRRGRPCP  266

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNIL-YEAVGV  355
            VTA  F  PKVGD NF +AFS   +LR +RI +  D+V   P         IL Y  VGV
Sbjct  267  VTAIVFASPKVGDSNFGEAFSEYQDLRALRIRNAFDIVPSYP---------ILDYTEVGV  317

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I+++KS+YLK        H+L  ++HG+ G QGS+GGF+ + + D+S +NK   GLK
Sbjct  318  ELGINTRKSQYLKSPGSTSSWHNLECYLHGVAGTQGSKGGFKLEINRDVSLVNKRLDGLK  377

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            DEY VPV+W   K+KGMVQQEDG++ L DHE D
Sbjct  378  DEYLVPVSWRCEKNKGMVQQEDGSWKLMDHEED  410



>ref|XP_010057070.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
Length=459

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 144/213 (68%), Gaps = 12/213 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SARDQ+ +EV RL+ELYK EEISITVTGHSLG+A+ATLNAVD+  N +N  K+++    P
Sbjct  247  SARDQVLQEVKRLVELYKNEEISITVTGHSLGAAIATLNAVDIVANGLNQPKDRRGRPCP  306

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNIL-YEAVGV  355
            VTA  F  PKVGD NF +AFS   +LR +RI +  D+V   P         IL Y  VGV
Sbjct  307  VTAIVFASPKVGDSNFGEAFSEYQDLRALRIRNAFDIVPSYP---------ILDYTEVGV  357

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I+++KS+YLK        H+L  ++HG+ G QGS+GGF+ + + D+S +NK   GLK
Sbjct  358  ELGINTRKSQYLKSPGSTSSWHNLECYLHGVAGTQGSKGGFKLEINRDVSLVNKRLDGLK  417

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            DEY VPV+W   K+KGMVQQEDG++ L DHE D
Sbjct  418  DEYLVPVSWRCEKNKGMVQQEDGSWKLMDHEED  450



>ref|XP_002305750.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE86261.2| lipase class 3 family protein [Populus trichocarpa]
Length=395

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 139/210 (66%), Gaps = 8/210 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+  EV RL++ +K EEISIT+TGHSLG+ALATLNAVD+  N  NK+ ++   PVT
Sbjct  191  SARDQVLNEVGRLVDQFKNEEISITITGHSLGAALATLNAVDIVANGFNKSHENKGCPVT  250

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            A  F  P+VGD NFK  FS   +L+ +R+ +V D+V   P+        I Y  VG   I
Sbjct  251  AMLFASPRVGDSNFKKVFSRYMDLKALRVHNVLDVVPKYPF--------IGYADVGEELI  302

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            ID+ KS+YLK   ++   H+L  ++HG+ G QGS+GGFE   + DI+ +NK   GLKDEY
Sbjct  303  IDTTKSKYLKSPGNVSSWHNLEAYLHGVAGTQGSKGGFELVANRDIALINKTTDGLKDEY  362

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
             VP +W   ++KGMVQQ DG++ L DHE D
Sbjct  363  LVPASWRIQENKGMVQQADGSWKLVDHEED  392



>ref|XP_004233849.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   199 bits (507),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 143/209 (68%), Gaps = 14/209 (7%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+  EV RL+E YK EE+SITVTGHS+G+++ATLNAVD+  N +NK       PVT
Sbjct  194  SARDQVLGEVERLMEQYKTEEVSITVTGHSMGASIATLNAVDMVFNGINKG-----FPVT  248

Query  185  AFFFGGPKVGDQNFKDAFSNQGN-LRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            AF F  P+VGD+NF   FS   N LR +R+ ++ D++   P+        I Y  VGV  
Sbjct  249  AFLFASPRVGDENFNKTFSELENQLRALRVRNIPDIIPHYPF--------IGYSDVGVEL  300

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
            I+D++KS+YLK G D    H+L  ++HG+ G QGS+ GF+ + + DIS +NK+   LKDE
Sbjct  301  IMDTRKSDYLKSGGDYWTWHNLECYLHGVAGTQGSKEGFKLEVERDISLVNKHMDTLKDE  360

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            Y VPV+W  V++KGMVQQ++G++IL DHE
Sbjct  361  YGVPVSWWVVENKGMVQQQNGSWILMDHE  389



>ref|XP_009765842.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=414

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 137/211 (65%), Gaps = 13/211 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+  EV RL+E YK EEI+ITVTGHS+G+A+ATLNAVD+  N  NK       PVT
Sbjct  216  SARDQVLGEVQRLVEQYKNEEITITVTGHSMGAAVATLNAVDIVFNEFNKG-----FPVT  270

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  P+VGD+NFK  FS   NLR +R+ +  D+V   P         + Y  VGV   
Sbjct  271  AFLFASPRVGDENFKKTFSKLVNLRALRVRNAPDIVPNYP--------LLGYSDVGVQLD  322

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            ID+ KS YLK   D    H++  ++HG+ G QGS+GGF+ +   DIS +NKY   LKDEY
Sbjct  323  IDTTKSTYLKSPGDESSWHNMDCYLHGVAGTQGSKGGFKLEVQHDISVVNKYLDALKDEY  382

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
             VP +W   K+KGMVQQ+DG++IL DHE D+
Sbjct  383  GVPASWWVEKNKGMVQQQDGSWILMDHEDDD  413



>ref|XP_004232957.2| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=429

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 139/212 (66%), Gaps = 13/212 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPV  181
            +SARDQ+  EV RL+E YK EE+SITVTGHS+G+++ATLNA D+  N +NK       PV
Sbjct  230  ESARDQVLGEVKRLMEQYKTEEVSITVTGHSMGASMATLNAGDIVFNGINKG-----FPV  284

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            TAF F  P+VGD+NFK  FS   NLR +RI +  DLV   P    + G    Y  VGV  
Sbjct  285  TAFLFASPRVGDENFKRTFSKLENLRALRIRNAPDLVPSYP----LFG----YSDVGVEL  336

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
             ID++KS YLK   D    H+   ++HGI G QGS+GGF+ + + DIS +NKY   LKDE
Sbjct  337  AIDTRKSGYLKSPGDQSSFHNTDCYLHGIAGTQGSKGGFKLEVERDISLINKYLDALKDE  396

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            Y VP +W   K+ GMVQQ++GT+IL DHE D+
Sbjct  397  YGVPTSWWVEKNNGMVQQQNGTWILVDHEDDD  428



>ref|XP_004293927.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=438

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 143/213 (67%), Gaps = 12/213 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDN---  169
            SAR+Q+  EV+RL+E YK EEISIT+TGHSLG+A+ATL+AVD+  N +NK  +Q  N   
Sbjct  227  SARNQVLAEVSRLVEQYKDEEISITITGHSLGAAIATLSAVDIVANGINKPKDQTANKLS  286

Query  170  NVPVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAV  349
            + PVTAF F  P+VGD NFK  FS+  NLR +R+S+  D+V   P+   VG     Y  V
Sbjct  287  SCPVTAFVFACPRVGDSNFKKLFSSYNNLRVLRVSNALDIVPNYPF--LVG-----YSEV  339

Query  350  GVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQG  529
            G    IDS+KS YLK    ++  H+L  ++HG+ G QGS+GGF+ +   DI+ +NK    
Sbjct  340  GEELGIDSRKSSYLKSPGSVLSWHNLEGYLHGVAGTQGSKGGFKLEVKRDIALVNKSHDA  399

Query  530  LKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            LK+EY VPV+W   KDKGMVQ EDG++ L DHE
Sbjct  400  LKEEYLVPVSWRCEKDKGMVQMEDGSWQLMDHE  432



>emb|CDO96758.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   194 bits (494),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 142/213 (67%), Gaps = 10/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQD--NNVP  178
            SARDQ+ +E+ RL+E +KGEEISITVTGHSLG+A+ATLNAVD+  N  NK+ Q+     P
Sbjct  191  SARDQVLDEIRRLVEEFKGEEISITVTGHSLGAAVATLNAVDIVANGFNKSVQNPGKACP  250

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF +  P+VGDQ F+  FS Q NL+ +RI +  D+V   P         + Y  VG  
Sbjct  251  VTAFVYASPRVGDQGFEKVFSQQQNLKVLRIRNSLDVVPNYP--------LLGYADVGEQ  302

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID+ KS+YLK   ++   H L  +MHGI G QG +GGF+   + D++ +NK+   LKD
Sbjct  303  LGIDTTKSKYLKSPGNLSSWHSLECYMHGIAGTQGLQGGFKLVANRDVALVNKHMDALKD  362

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            E+ VPV+W  +++KGMVQQ DG++ L+DHE D+
Sbjct  363  EHCVPVSWWCIQNKGMVQQSDGSWKLEDHEDDD  395



>ref|XP_011027707.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=395

 Score =   194 bits (493),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 138/210 (66%), Gaps = 8/210 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+  EV RL++ +K EEISIT+TGHSLG+ALATLNAVD+  N  N + ++   PVT
Sbjct  191  SARDQVLNEVGRLVDQFKNEEISITITGHSLGAALATLNAVDIVANGFNMSHENKGCPVT  250

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            A  F  P+VGD NFK  FS   +L+ +RI +  D+V   P+        I Y  VG   I
Sbjct  251  AMLFASPRVGDSNFKKVFSGYMDLKAIRIHNFLDVVPKYPF--------IGYADVGEELI  302

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            ID+ KS+YLK   ++   H+L  ++HG+ G QG +GGFE   + DI+ +NK   GLKDEY
Sbjct  303  IDTTKSKYLKSPGNVSSWHNLEAYLHGVAGTQGFKGGFELVVNRDIALINKTIDGLKDEY  362

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
             VPV+W   ++KGMVQ+ DG++ L+DHE D
Sbjct  363  LVPVSWRIQENKGMVQEADGSWKLEDHEED  392



>ref|XP_006362440.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=431

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 140/211 (66%), Gaps = 13/211 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+  EV RL+E YK +E++ITVTGHS+G+A+ATLNA D+  N +NK       PVT
Sbjct  233  SARDQVLGEVQRLLEQYKKDEVTITVTGHSMGAAMATLNAGDIVFNGINKG-----FPVT  287

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  P+VGD+NFK  FS   NLR +RI +  D+V   P    + G    Y  VGV  +
Sbjct  288  AFLFASPRVGDENFKKTFSKLENLRALRIRNDPDIVPNYP----LFG----YSDVGVELV  339

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            ID++KS YLK   D    H+   ++HGI G QGS+GGF+ + + DIS +NKY   LKDEY
Sbjct  340  IDTRKSGYLKSPGDQSSFHNTDCYLHGIAGTQGSKGGFKLEVERDISLINKYLDALKDEY  399

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
             VP +W   K+KGMVQQ++G++IL DHE D+
Sbjct  400  GVPTSWWVEKNKGMVQQQNGSWILVDHEDDD  430



>ref|XP_009601720.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana tomentosiformis]
Length=426

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 136/211 (64%), Gaps = 13/211 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SAR+Q+  EV RL+E YK EEI+ITVTGHS+G+A+ATLNAVD+  N  NK       PVT
Sbjct  228  SARNQVLGEVQRLVEQYKNEEITITVTGHSMGAAVATLNAVDMVFNGFNKG-----FPVT  282

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  P+VGD+N K  FS   NLR +R+ +  D+V   P         + Y  VGV   
Sbjct  283  AFLFASPRVGDENLKKTFSKLENLRTLRVRNAPDIVPNYPL--------LGYSDVGVQLD  334

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            ID+ KS YLK   D    H++  ++HG+ G QGS+GGF+ +   DIS +NKY   LKDEY
Sbjct  335  IDTTKSAYLKSPGDESSWHNMDCYLHGVAGTQGSKGGFKLQVQHDISVVNKYLGALKDEY  394

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
             VP +W   K+KGMVQQ+DG++IL DHE D+
Sbjct  395  GVPASWWVEKNKGMVQQQDGSWILMDHEDDD  425



>ref|XP_010054330.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76146.1| hypothetical protein EUGRSUZ_D00522 [Eucalyptus grandis]
Length=410

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 134/214 (63%), Gaps = 10/214 (5%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNV  175
            KSAR Q+ EE+ RL++LYK EEISITVTGHSLG+A+ATLNAVD+  N  NK    Q N  
Sbjct  202  KSARHQVLEEIRRLVDLYKNEEISITVTGHSLGAAIATLNAVDIVANAFNKPIGHQTNGC  261

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            PVTAF F  P+VGD NF+  FS   +LR +R+ +  D+V   P         + Y  VG 
Sbjct  262  PVTAFAFASPRVGDSNFRKLFSELADLRVLRVRNALDIVPNYP--------LLGYSDVGE  313

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               +DS+KS+YLK   ++   H L  ++H   G QG+ GGFE   D D++ +NK    LK
Sbjct  314  ELAVDSRKSKYLKSPGNVSSWHGLEVYLHCAAGTQGTNGGFELMVDRDVALINKSLDALK  373

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
             EY VP +W   K+KGMVQQ DG++ L DHE D+
Sbjct  374  VEYLVPASWWCPKNKGMVQQADGSWKLMDHEADD  407



>ref|XP_006364325.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=399

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 133/210 (63%), Gaps = 10/210 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+ EEV RL+E YK EE+SITVTGHSLG++LATLNAVD+A N +NK+      PVT
Sbjct  189  SARDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAYNKINKSSHGKEFPVT  248

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD NF +AF+    L  MRI ++ D+V   P         I Y  VG   I
Sbjct  249  AFVFASPKVGDLNFLNAFNKLKYLHVMRIHNILDIVPKYP--------PIGYLDVGQEII  300

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGLKD  538
            ID+ KS YL    DI+  H+L  +MHG+ G Q  G   GF+ + D DI+ +NK    LK 
Sbjct  301  IDTTKSPYLNLPGDILTWHNLECYMHGVAGTQGIGLLTGFKLEVDRDIALVNKSSGALKS  360

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            EY VP  W  VK+KGM QQEDG ++L+D E
Sbjct  361  EYLVPANWWTVKNKGMFQQEDGKWVLNDRE  390



>ref|XP_011074749.1| PREDICTED: phospholipase A1-IIgamma [Sesamum indicum]
Length=419

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 139/213 (65%), Gaps = 10/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVP  178
            SAR+Q+  EV RL+E YK EEIS+TVTGHSLG+A++TLNA+D+ VN  N+  +  D   P
Sbjct  214  SARNQVLTEVRRLVEEYKNEEISMTVTGHSLGAAVSTLNAIDIVVNGYNRPRDMPDKACP  273

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD  F+   S   NL  +R+++  D+V   P+        + Y  VG  
Sbjct  274  VTAFLFASPRVGDYKFRKFLSTLQNLHILRVTNARDIVPTYPF--------VNYAEVGQE  325

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID+ KS YLK   ++   H+L  ++HG+ G QGSRGGF+ + + DI+ +NK+  GLKD
Sbjct  326  LPIDTDKSNYLKSPGNLNSWHNLEAYLHGVAGTQGSRGGFKLEVNRDIALVNKHLDGLKD  385

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            EY VPV+W   K KGMVQQEDG++ L DHE D+
Sbjct  386  EYCVPVSWWCEKHKGMVQQEDGSWKLMDHEDDD  418



>ref|XP_004232943.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=402

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 134/211 (64%), Gaps = 10/211 (5%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPV  181
            KSARDQ+ EEV RL+E YK EE+SITVTGHSLG++LATLNA D+A N +NK  +    PV
Sbjct  191  KSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAFDIAYNKINKTSEGKEFPV  250

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            TAF F  PKVGD NF +AF+   +L  MRI +V D+V   P         + Y  VG   
Sbjct  251  TAFVFASPKVGDINFVNAFNKLKHLHVMRIHNVLDIVPKYP--------PLGYFDVGQEI  302

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGLK  535
            IID+ KS YL    DI+  H+L  ++HG+ G Q  G   GF+ + D DI+ +NK    LK
Sbjct  303  IIDTTKSPYLNLPGDILTWHNLECYLHGVAGTQGIGLLAGFKLEVDRDIALVNKSSGALK  362

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
             EY VP  W   K+KGMVQQEDG ++L+D E
Sbjct  363  SEYLVPANWWTAKNKGMVQQEDGKWVLNDRE  393



>ref|XP_010054329.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76145.1| hypothetical protein EUGRSUZ_D00520 [Eucalyptus grandis]
Length=410

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 133/214 (62%), Gaps = 10/214 (5%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNV  175
            KSAR Q+ EE+ RL++LYK EEISITVTGHSLG+A+ATLNAVD+  N  NK    Q N  
Sbjct  202  KSARHQVLEEIRRLVDLYKNEEISITVTGHSLGAAIATLNAVDITANAFNKPIGHQTNGC  261

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            PVTA  F  P+VGD NF+  FS   +LR +R+ +  D+V   P         I Y  VG 
Sbjct  262  PVTAITFASPRVGDSNFRKVFSELADLRALRVRNALDIVPNYP--------LIGYSDVGE  313

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               +DS+KS+YLK   ++   H L  ++H + G QG+  GFE   D D + +NK    LK
Sbjct  314  ELAVDSRKSKYLKSPGNVSSWHGLEVYLHCVAGTQGTNDGFELMVDHDATLINKALDALK  373

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            DEY VP +W   K+KGMVQQ DG++ L D+E D+
Sbjct  374  DEYLVPASWWCPKNKGMVQQADGSWKLMDYEADD  407



>ref|XP_003608142.1| Lipase [Medicago truncatula]
Length=349

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 138/213 (65%), Gaps = 14/213 (7%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SAR Q+  E++RL+ELYK EEISITVTGHSLG ALAT++++D+  N  N  K Q     P
Sbjct  141  SARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSMDIVANKFNIPKGQPQKTCP  200

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VT F FG P+VG+ NF+  FS+  +LR + I + ND+V             + Y  VG  
Sbjct  201  VTLFAFGSPRVGNSNFEKIFSDNNDLRALFIRNNNDIVP--------SSLRLAYSKVGEE  252

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KS+YLK G+     H++  ++HGI G QGS+GGF  + + DI+ LNK   GLKD
Sbjct  253  LEIDTEKSKYLKSGVSA---HNMEVYLHGIAGTQGSKGGFNLEVNRDIALLNKSNDGLKD  309

Query  539  EYHVPVAWMNVKDKGMVQQEDGTY-ILDDHEVD  634
            EYH+P  W  V++KGMVQQ DGT+ ++DDH  D
Sbjct  310  EYHIPENWRVVENKGMVQQSDGTWKLMDDHNDD  342



>ref|XP_009628626.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=394

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 138/208 (66%), Gaps = 9/208 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+ EEV RL+E YK EE+SITVTGHSLG++LATLNAVD+A N +NK  +    PVT
Sbjct  192  SARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGINKTSEGREFPVT  251

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD  FK AF    ++R +RI ++ D+V  VP         I Y  VG   +
Sbjct  252  AFAFASPKVGDLKFKAAFDKLKSVRTLRIHNLWDVVPKVP--------PIGYIDVGEELM  303

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            ID+ KS Y+KP  +++  H L  ++HGI G QG R GF+ + D DIS +NK    LKDEY
Sbjct  304  IDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQGLR-GFKLEVDRDISLVNKQWDILKDEY  362

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHE  628
             +P  W+  K+KGMVQQ+DG+++L D E
Sbjct  363  GIPGRWLVEKNKGMVQQKDGSWLLMDRE  390



>ref|XP_007025426.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28048.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=417

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 138/210 (66%), Gaps = 10/210 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SARDQ+  EV RL++ +K EEISITVTGHSLG+ALATLNA+D+  N  N  K+Q     P
Sbjct  209  SARDQVLNEVRRLVDQFKNEEISITVTGHSLGAALATLNAIDIVANGYNRPKSQSRKASP  268

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD +FK AF+   +LR +R+ +  D+V   P    VG     Y  VG  
Sbjct  269  VTAFLFASPRVGDSDFKKAFTGFKDLRALRVGNALDVVPNYP---LVG-----YSDVGEE  320

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KS+YL    ++   H+L  ++HG+ G QGS+GGF    + DI+ +NK   GLKD
Sbjct  321  LAIDTRKSKYLNSPGNLSSWHNLEAYLHGVAGTQGSKGGFALVVNRDIALVNKSIDGLKD  380

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            EY VPV+W   K+KGMVQQEDG++ L DHE
Sbjct  381  EYLVPVSWRIEKNKGMVQQEDGSWKLMDHE  410



>gb|AFK47098.1| unknown [Medicago truncatula]
 gb|AES90319.2| phospholipase A1 [Medicago truncatula]
Length=400

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 138/213 (65%), Gaps = 14/213 (7%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SAR Q+  E++RL+ELYK EEISITVTGHSLG ALAT++++D+  N  N  K Q     P
Sbjct  191  SARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSMDIVANKFNIPKGQPQKTCP  250

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VT F FG P+VG+ NF+  FS+  +LR + I + ND+V             + Y  VG  
Sbjct  251  VTLFAFGSPRVGNSNFEKIFSDNNDLRALFIRNNNDIVP--------SSLRLAYSKVGEE  302

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KS+YLK G+     H++  ++HGI G QGS+GGF  + + DI+ LNK   GLKD
Sbjct  303  LEIDTEKSKYLKSGVS---EHNMEVYLHGIAGTQGSKGGFNLEVNRDIALLNKSNDGLKD  359

Query  539  EYHVPVAWMNVKDKGMVQQEDGTY-ILDDHEVD  634
            EYH+P  W  V++KGMVQQ DGT+ ++DDH  D
Sbjct  360  EYHIPENWRVVENKGMVQQSDGTWKLMDDHNDD  392



>ref|XP_009393076.1| PREDICTED: phospholipase A1-II 1 [Musa acuminata subsp. malaccensis]
Length=396

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 132/212 (62%), Gaps = 10/212 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVP  178
            SAR+Q+ +EV RLIE YK EE SIT+TGHSLG+A+ATLNAVD+  N  N+  N      P
Sbjct  190  SARNQVLKEVGRLIEEYKDEETSITITGHSLGAAVATLNAVDIVANSFNRSSNPSSTGCP  249

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD  F+  FS   +LR +R+ +  DLV   P         I Y  VGV 
Sbjct  250  VTAFVFASPRVGDFEFQKLFSGTPDLRLLRVRNAPDLVPNYP--------IIPYVDVGVE  301

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KSEYLK   D+   H+L  ++HG  G QG RGGF+   D D++ +NK    LKD
Sbjct  302  LAIDTRKSEYLKAPGDLTTWHNLECYLHGTAGAQGRRGGFKLAIDRDVALVNKSTDALKD  361

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            EY VP +W   K+KGM++  DG Y L+DHE D
Sbjct  362  EYLVPDSWWVEKNKGMMKGADGHYKLEDHEED  393



>ref|XP_006340582.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=401

 Score =   189 bits (479),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 134/211 (64%), Gaps = 13/211 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            S RDQ+ EEV RL+E YK E++SIT+TGHS+G+A+ TLNA+D+ VN  NK        VT
Sbjct  199  SVRDQVVEEVKRLVEEYKSEKMSITITGHSMGAAVGTLNAIDIVVNGFNKG-----CLVT  253

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            A  F  P+VGD +F +AFS   NLR +R+++  D++   P         I Y  +GV   
Sbjct  254  AILFASPRVGDSSFVNAFSKLENLRILRVTNCLDIIPNYPL--------IDYSEIGVELA  305

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            ID+ KS+YLK   DI   H L  HMHG+ G+QG+ GGF+ +   DIS +NK+   LKDEY
Sbjct  306  IDTTKSKYLKVPGDIRSWHSLEAHMHGVAGYQGANGGFKLEVRRDISLVNKHLNALKDEY  365

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
             VP  W   K+ GMVQQ+DG++ L DHE D+
Sbjct  366  CVPTCWWVEKNNGMVQQDDGSWKLMDHEDDD  396



>gb|KDP21073.1| hypothetical protein JCGZ_21544 [Jatropha curcas]
Length=401

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 134/212 (63%), Gaps = 10/212 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNN--VP  178
            SARDQ+  EV RL+E YK EEISITV GHSLG+ALATLNAVD+  N  NK++   N   P
Sbjct  193  SARDQVLNEVRRLVEKYKNEEISITVCGHSLGAALATLNAVDIIANGFNKSKTFPNKACP  252

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P+VGD  FK  FS    LR +RI +  D+V   P         I Y  VG  
Sbjct  253  VTAIVFASPRVGDSGFKKVFSGYKELRALRIHNNLDIVPNYPL--------IGYAEVGEE  304

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
             +ID+ KS YLK   ++   H+L  ++HG+ G QGS+GGF+ + + DI+ +NK   GLKD
Sbjct  305  LVIDTTKSNYLKSPGNVSSWHNLEGYLHGVAGTQGSKGGFKLEINRDIALVNKSLDGLKD  364

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            EY VP +W   K+KGMVQQ DG++ L DHE D
Sbjct  365  EYLVPPSWRIQKNKGMVQQSDGSWKLMDHEED  396



>ref|XP_002316835.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE97447.2| lipase class 3 family protein [Populus trichocarpa]
Length=414

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 135/210 (64%), Gaps = 8/210 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+  EV RL++ Y  EEISIT+ GHSLG+A+ATLNAVD+  N  N++Q++   PVT
Sbjct  208  SARDQVLNEVRRLVDKYTNEEISITIVGHSLGAAVATLNAVDIVANGFNQSQKNKRCPVT  267

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            A  F  P+VGD NFK  FS   +LR +RI +V D+V   P         I Y  VG   +
Sbjct  268  AMLFASPRVGDSNFKRVFSGYKDLRALRIHNVRDVVPNYP--------LIGYADVGEELV  319

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            ID+ KS+YLK   ++   H+L  ++HG+ G QG +GGF+ + + DI+ LNK    LKDEY
Sbjct  320  IDTTKSKYLKSPGNLSSWHNLEGYLHGVAGTQGPKGGFKLEVNRDIALLNKTIDSLKDEY  379

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
             VP +W   ++KGMVQQ DG++ L D E D
Sbjct  380  LVPASWRVQENKGMVQQADGSWKLMDLEED  409



>ref|XP_004232956.1| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=410

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 140/213 (66%), Gaps = 11/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+ EEV RL++ YK EE+SI+VTGHSLGS+LATL A+D+AV+ VNK       PVT
Sbjct  204  SARDQVLEEVKRLMDQYKKEEVSISVTGHSLGSSLATLCAIDIAVSQVNK-----GFPVT  258

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNI---LYEAVGV  355
            AF F  P+VG+ NFK A  N  NL  +RI++ +DL+T +P   QV G      +YE VG 
Sbjct  259  AFLFASPRVGEINFKKACENLKNLHILRITNASDLITKLPDRGQVEGCETDWRVYEDVGF  318

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               ID+ KS+YLK  ++    H L  ++HGI G  G  G F+ + + DI+ +NK    LK
Sbjct  319  ELSIDTTKSDYLKKEIN---GHILEVYLHGIAGTHGFEGEFKLEMNRDIALMNKADDVLK  375

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            DEY VP +W   K+KGMVQ E+G++IL DHE D
Sbjct  376  DEYGVPASWWIEKNKGMVQHENGSWILMDHEDD  408



>ref|XP_009619316.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=402

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 135/212 (64%), Gaps = 13/212 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+ EEV RL+E YK EE+SITV GHSLG++LATLNAVD+A N +NK       PVT
Sbjct  192  SARDQVLEEVKRLVEEYKNEEVSITVAGHSLGASLATLNAVDIAFNGINKTSSGKEFPVT  251

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD NF+  FS   NL  +RI ++ D+V   P    VG     Y  VG   I
Sbjct  252  AFVFASPKVGDLNFQKTFSKLKNLHILRIHNLLDIVPKYP---PVG-----YIDVGEEII  303

Query  365  IDSKKSEYLK--PGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGL  532
            ID+ KS YLK  PG D    H+L  ++HGIDG Q  G   GF+ + + D++ +N+    L
Sbjct  304  IDTTKSPYLKLNPG-DPHTRHNLEGYLHGIDGTQGIGILAGFKLEVNRDLALVNRIWDML  362

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            KDEY +P AW   K KGMVQQEDGT++L D E
Sbjct  363  KDEYCIPAAWWTEKHKGMVQQEDGTWLLLDRE  394



>ref|XP_009775805.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=401

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 131/210 (62%), Gaps = 10/210 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            S RDQ+ EEV RL+E YK EE+SITVTGHSLG++LATLNAVD+A N +NK       PVT
Sbjct  192  SVRDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGINKTSSGKEFPVT  251

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD NF+ AFS    L  +RI ++ D+V   P         + Y  VG   I
Sbjct  252  AFVFASPKVGDLNFQMAFSKLKTLHILRIHNLLDIVPKYP--------PLGYIDVGEELI  303

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGLKD  538
            ID+ KS YLK   D++  H+L  +MHG+ G Q  G   GF+ + + D++  NK    LKD
Sbjct  304  IDTTKSPYLKLPGDVLTWHNLECYMHGVAGTQGLGLLTGFKLEVNRDLALANKSSGALKD  363

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            EY +P  W   K KGM+QQEDGT++L D E
Sbjct  364  EYCIPANWWTEKHKGMIQQEDGTWLLLDRE  393



>ref|XP_010912683.1| PREDICTED: phospholipase A1-II 1 [Elaeis guineensis]
Length=401

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/212 (48%), Positives = 138/212 (65%), Gaps = 10/212 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQ--DNNVP  178
            SARDQ+  E+ RL+E YK EE SIT+TGHSLG+ALATLNA D+A N +NK+    + N P
Sbjct  193  SARDQVLSEIGRLMEEYKDEETSITITGHSLGAALATLNAADIASNGLNKSNAHPNKNSP  252

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD +F++AFS    LR +RI +V DLV   P         + Y+ VGV 
Sbjct  253  VTAFVFASPRVGDSDFREAFSKIPELRLLRIRNVPDLVPNYPL--------LGYDDVGVE  304

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KS+YLK   ++   H+L  ++HG+ G +G + GF+ + D D++ +NK    LKD
Sbjct  305  LTIDTRKSQYLKSPGNLSSWHNLEAYLHGVAGTRGGKKGFKLEVDRDVALVNKSMDALKD  364

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            EY VP +W   K+KGMV+  DG + L DHE D
Sbjct  365  EYLVPASWRVEKNKGMVKGADGHWRLMDHEED  396



>emb|CDO96757.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 139/213 (65%), Gaps = 10/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQD--NNVP  178
            SARDQ+ +EV RL+E +K EEISITVTGHSLG+A+ATLNAVD+  N  NK+ ++     P
Sbjct  167  SARDQVLDEVRRLVEEFKDEEISITVTGHSLGAAVATLNAVDIVANGFNKSLENPGKACP  226

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF +  P+VG Q FK  FS Q NLR +RI +  D+V   P         + Y  VG  
Sbjct  227  VTAFVYASPRVGGQGFKKVFSQQQNLRVLRIQNSLDVVPNYPL--------LGYADVGEE  278

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID+ KS+YLK   ++   H L  +MHG+ G QG + GF+   + D++ LNKY   LKD
Sbjct  279  LRIDTTKSKYLKNPGNLSSWHSLECYMHGVAGKQGLQEGFKLVVNRDVALLNKYMDVLKD  338

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            E+ VPV+W  +++KGMVQQ DG++ L+DHE D+
Sbjct  339  EHCVPVSWWCIQNKGMVQQADGSWELEDHEDDD  371



>ref|XP_009787871.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=402

 Score =   187 bits (474),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 134/212 (63%), Gaps = 13/212 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+ EEV RL+E YK EE+SITV GHSLG++LATLNAVD+A N  NK       PVT
Sbjct  192  SARDQVLEEVKRLVEEYKNEEVSITVAGHSLGASLATLNAVDIAFNGFNKTSSGKEFPVT  251

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD NF+ AFS   NL  +RI ++ D+V   P         I +  VG   I
Sbjct  252  AFVFASPKVGDLNFQKAFSKLKNLHILRIHNLLDIVPKYP--------PIGFIDVGEEII  303

Query  365  IDSKKSEYLK--PGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGL  532
            ID+ KS YLK  PG D    H+L  ++HGIDG Q  G   GF+ + + D++ +N+    L
Sbjct  304  IDTTKSPYLKLNPG-DPHTRHNLEGYLHGIDGTQGIGVLAGFKLEVNRDLALVNRIWDML  362

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            KDEY +P AW   K KGMVQQEDGT++L D E
Sbjct  363  KDEYCIPAAWWTEKHKGMVQQEDGTWLLLDRE  394



>ref|XP_004231490.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=410

 Score =   187 bits (474),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 133/211 (63%), Gaps = 13/211 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            S RDQ+ EEV RL+E YK E++SIT+TGHS+G+A+ TLNA+D+ VN  NK        VT
Sbjct  208  SVRDQVVEEVKRLVEEYKSEKMSITITGHSMGAAVGTLNAIDIVVNGFNKG-----CLVT  262

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            A  F  P+VGD NF +AFS   NLR +R+++  D++   P         I Y  +GV   
Sbjct  263  AILFASPRVGDSNFVNAFSKLENLRILRVTNCLDIIPNYPL--------IDYSEIGVELG  314

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            ID+ KS+YLK   DI   H L  +MHG+ G+QG+ GGF+ +   DIS LNK+   LKDEY
Sbjct  315  IDTTKSKYLKVPGDIRSWHSLEAYMHGVAGYQGANGGFKLEVGRDISLLNKHLNALKDEY  374

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
             VP  W   K+ GMVQQ+DG + L DHE D+
Sbjct  375  CVPTCWWVEKNNGMVQQDDGYWKLMDHEDDD  405



>ref|XP_011101305.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
 ref|XP_011101310.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
Length=411

 Score =   187 bits (474),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 139/213 (65%), Gaps = 11/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQ--QDNNVP  178
            SAR Q+  EV RL+E YK EEISITVTGHSLG+A++T+NAVD+ VN  N+ Q     + P
Sbjct  207  SARHQVLGEVRRLVERYKNEEISITVTGHSLGAAVSTINAVDIVVNGYNRPQGMLHKHCP  266

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD NF+D   N  NL  +R+ +  D+V   P+        I Y  VG  
Sbjct  267  VTAFVFACPRVGDNNFRDFVLNLQNLHILRVRNARDIVPKYPF--------IDYVDVGEE  318

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID+ KS YLK G ++   H+L  ++HG+ G +GS GGF+ + + DI+ +NK+   LKD
Sbjct  319  LAIDTDKSSYLKEG-NLSSWHNLEAYLHGVAGTRGSEGGFKLEVNRDIALVNKHMDALKD  377

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            E+ VPV+W   K+KGMVQQ DG+++L DHE D+
Sbjct  378  EFCVPVSWWCEKNKGMVQQADGSWVLMDHEYDD  410



>ref|XP_007153707.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
 gb|ESW25701.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
Length=399

 Score =   186 bits (472),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 136/212 (64%), Gaps = 14/212 (7%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVP  178
            SAR+Q+ EEV RL+E YK EEISI+VTGHSLG+ALATLNAVD+A   +NK  +Q     P
Sbjct  191  SARNQVLEEVRRLVEKYKNEEISISVTGHSLGAALATLNAVDIAAQGLNKPKDQPHRVFP  250

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VG+ +F   FS   +LR +RI +  D V  +P G  V         VG  
Sbjct  251  VTAFLFASPRVGNSHFGKIFSEYKHLRALRIRNKKDQVPKLPIGLAV---------VGQE  301

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
             +ID++KS+YLK G+     H+L  ++HG+ G QG +GGF  + + DI+ LNK    LKD
Sbjct  302  LVIDTRKSKYLKEGVSA---HNLEAYLHGVAGTQGKKGGFNLEVNRDIALLNKGMDALKD  358

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            EY VPV W   ++KGMVQQ DGT+ L DH  D
Sbjct  359  EYLVPVEWRVHENKGMVQQSDGTWKLFDHNED  390



>ref|XP_009777406.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=397

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 134/210 (64%), Gaps = 10/210 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+ EEV RL+E YK EE+SITVTGHSLG++LATLNAVD+A N +NK  +    PVT
Sbjct  192  SARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGINKTSEGKEFPVT  251

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD NF  AFS   NL  +RI +V D+V   P         I Y  VG   +
Sbjct  252  AFVFASPKVGDLNFHKAFSKLNNLHILRIHNVLDIVPKYP--------PIGYIDVGEELM  303

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGLKD  538
            ID+ KS Y+KP  +++  H L  ++HG+ G Q  G   GF+ + + DIS +NK    LKD
Sbjct  304  IDTTKSPYVKPPGEVVSWHLLEPYLHGVAGTQGIGILAGFKLEVNRDISLVNKQWDILKD  363

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            EY +P  W   K KGMVQQ+DG+++L D E
Sbjct  364  EYCIPGLWWADKHKGMVQQQDGSWLLLDRE  393



>ref|XP_010655496.1| PREDICTED: phospholipase A1-IIgamma isoform X2 [Vitis vinifera]
Length=321

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 135/211 (64%), Gaps = 13/211 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+  EV RL+E +K EEISI++TGHSLG+A+ATLNAVD+  N +N+       PVT
Sbjct  121  SARDQVLGEVRRLVEEFKNEEISISLTGHSLGAAVATLNAVDIVANGLNQG-----CPVT  175

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            A  F  P+VGD NF   FS   NLR +R+ + +D++   P         + Y  VG    
Sbjct  176  AVVFASPRVGDSNFLKLFSALKNLRVLRVRNASDIIPNYP--------LLGYSDVGEELG  227

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            +D++KS+YLK   ++   H+L  H+HG+ G QGSRGGF  + + DI+ +NK    L DEY
Sbjct  228  VDTRKSKYLKSPGNLSTWHNLEAHLHGVAGTQGSRGGFRLEVNRDIALVNKSIDALNDEY  287

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
             VPV+W   K+KGMVQQ DG++ L DHE D+
Sbjct  288  LVPVSWRCEKNKGMVQQVDGSWKLMDHEEDD  318



>ref|XP_011045903.1| PREDICTED: phospholipase A1-IIgamma [Populus euphratica]
Length=414

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 135/210 (64%), Gaps = 8/210 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+  E+ RL++ Y  EEISIT+ GHSLG+A+ATLNAVD+  N  N++Q++   PVT
Sbjct  208  SARDQVLNEIRRLVDKYTNEEISITIVGHSLGAAVATLNAVDIVANGFNQSQKNKRCPVT  267

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            A  F  P+VGD NFK  FS   +LR +RI +V D+V   P         I Y  VG   +
Sbjct  268  AILFASPRVGDSNFKKVFSGYKDLRALRIHNVLDVVPSYP--------LIGYADVGEELV  319

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            ID+ KS+YLK   ++   H+L  ++HG+ G QG +GGF+ + + DI+ +NK    LKDEY
Sbjct  320  IDTTKSKYLKSPGNLSSWHNLEGYLHGVAGTQGPKGGFKLEVNRDIALVNKTIDSLKDEY  379

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
             VP +W   ++KGMVQQ DG++ L D E D
Sbjct  380  LVPASWRVQENKGMVQQADGSWKLMDVEED  409



>ref|XP_009628625.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 135/210 (64%), Gaps = 10/210 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+ EEV RL+E YK EE+SITVTGHSLG++LATLNAVD+A N +NK  +    PVT
Sbjct  192  SARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGINKTSEGKEFPVT  251

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD NF  AFS   NL  +RI +V D+V   P    VG     Y  VG   I
Sbjct  252  AFVFASPKVGDLNFHKAFSKLNNLHILRIHNVLDIVPKYP---PVG-----YIDVGEELI  303

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGLKD  538
            ID+ KS Y+KP  +++  H L  ++HG+ G Q  G   GF+ + + DIS +NK    +KD
Sbjct  304  IDTTKSPYVKPPGEVVSWHLLEPYLHGVAGTQGIGILAGFKLEVNRDISLVNKQWDIIKD  363

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            EY +P  W   K KGMVQQ+DG+++L D E
Sbjct  364  EYCIPGLWWVDKHKGMVQQQDGSWLLLDRE  393



>gb|EYU36835.1| hypothetical protein MIMGU_mgv1a020546mg [Erythranthe guttata]
Length=426

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 137/218 (63%), Gaps = 13/218 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVP  178
            SAR+Q+ EEV RL+E YK EE SITVTGHSLG+A+ TLNA D+ VN  NK  +  D + P
Sbjct  217  SARNQVLEEVKRLVEEYKNEETSITVTGHSLGAAVCTLNASDIVVNKYNKPNDMPDKSCP  276

Query  179  VTAFFFGGPKVGDQNFKDAFSN---QGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAV  349
            VT F F  P+VGD  F+   S+     NL  +R+ +  D+V   P+        I Y  V
Sbjct  277  VTVFAFASPRVGDDKFRKILSSLKTNNNLNILRVRNAKDIVPKYPF--------IDYSEV  328

Query  350  GVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQG  529
            GV  +ID+ KS YLK   ++   H L  ++HG+ G QGSRGGF+ + +  ++ +NK+  G
Sbjct  329  GVELVIDTDKSSYLKSPGNLSSWHSLEGYLHGVAGTQGSRGGFKLEVNRSLALVNKHMDG  388

Query  530  LKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDETF  643
            LKDEY VPV+W   ++K MVQ +DG++ L DHE D+ F
Sbjct  389  LKDEYCVPVSWWCERNKSMVQSDDGSWELIDHEDDDFF  426



>ref|XP_006449477.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
 gb|ESR62717.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
Length=420

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 136/214 (64%), Gaps = 11/214 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVP  178
            SARDQ+  E+ RL++ YK EEISITVTGHSLG+ALATLNAVD+A N  NK   Q +   P
Sbjct  211  SARDQVIREIRRLVDQYKNEEISITVTGHSLGAALATLNAVDIAANGFNKPGGQPNKACP  270

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA     P+VGD  FK   S   +LR +RI +  D+V   P         I YE VG  
Sbjct  271  VTAIILASPRVGDSTFKKVLSGYQDLRVLRIRNELDVVPKYPL--------IGYEDVGKE  322

Query  359  FIIDSKKSEYLKPGL-DIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
              ID+ KS+YLK G  +    H+L  ++HG+ G QG +GGF+ + + DIS +NK    LK
Sbjct  323  LTIDTTKSKYLKNGTANFSGWHNLEVYLHGVAGTQGRKGGFQLEVNRDISLVNKTMDNLK  382

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            D+Y VPV+W  +K+KGMVQQ DG++ L DHE D+
Sbjct  383  DQYLVPVSWRILKNKGMVQQADGSWKLMDHEKDD  416



>ref|XP_004232966.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 132/210 (63%), Gaps = 10/210 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+ EEV RL+E YK EE+SITVTGHSLG++LATLNAVD+A N +NK       PVT
Sbjct  190  SARDQVMEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNKINKASNGKEFPVT  249

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD  FK AF     LR +RI ++ D+    P         I Y  VG   +
Sbjct  250  AFPFACPKVGDLQFKAAFDKIIGLRILRIDNLLDIAPKYP--------PIGYFDVGQELM  301

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGS--RGGFEPKGDFDISKLNKYRQGLKD  538
            ID+ KS Y+KP    +  H L  ++HGI G QG+    GF  + + DIS +NK   GLKD
Sbjct  302  IDTTKSPYVKPPGQPVNWHSLESYLHGIAGTQGTGLLAGFNLEVNRDISLINKQLDGLKD  361

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            EY +PV W   K+KGMVQQEDG+++L D +
Sbjct  362  EYCIPVNWWVEKNKGMVQQEDGSWLLLDRD  391



>ref|XP_010279083.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=396

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 137/212 (65%), Gaps = 10/212 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVP  178
            SAR Q+ EEV RL+E +K EEISITVTGHSLG+AL TLNAVD+  N VNK  +  +    
Sbjct  191  SARQQVLEEVKRLVEEFKDEEISITVTGHSLGAALGTLNAVDIVANGVNKPKDHPEKACL  250

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF FG P+VGD NF+   S+  NLR +R+ +  DLV   P    VG     Y  VG  
Sbjct  251  VTAFLFGCPRVGDANFQKVVSSLENLRLLRVRNSLDLVPNYP---LVG-----YSDVGQE  302

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
             +ID+++S +LK  +D    H++  ++HG+ G QG++GGF+ +   DIS +NK    LKD
Sbjct  303  LVIDTRQSSFLKSSVDPGNWHNMEGYLHGVAGTQGTKGGFKLEVGRDISLVNKSTDALKD  362

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            EY VP+ W   K+KGM+Q EDG++ L DHE D
Sbjct  363  EYLVPMMWWCEKNKGMIQGEDGSWKLVDHEPD  394



>ref|XP_006467671.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
 gb|KDO77813.1| hypothetical protein CISIN_1g014663mg [Citrus sinensis]
Length=420

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 136/214 (64%), Gaps = 11/214 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVP  178
            SARDQ+  E+ RL++ YK EEISITVTGHSLG+ALATLNAVD+A N  NK   Q +   P
Sbjct  211  SARDQVIHEIRRLVDQYKNEEISITVTGHSLGAALATLNAVDIAANGFNKPGGQPNKACP  270

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P+VGD  FK   S   +LR +RI +  D+V   P         I YE VG  
Sbjct  271  VTAIIFASPRVGDSTFKKVLSGYQDLRVLRIRNELDVVPKYPL--------IGYEDVGKE  322

Query  359  FIIDSKKSEYLKPGL-DIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
              ID+  S+YLK G  +    H+L  ++HG+ G QG +GGF+ + + DIS +NK    LK
Sbjct  323  LTIDTTNSKYLKNGAANFSGWHNLEVYLHGVAGTQGRKGGFQLEVNRDISLVNKTMDSLK  382

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            D+Y VPV+W  +K+KGMVQQ DG++ L DHE D+
Sbjct  383  DQYLVPVSWRILKNKGMVQQADGSWKLMDHEKDD  416



>ref|XP_004505133.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Cicer arietinum]
Length=364

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 139/211 (66%), Gaps = 14/211 (7%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SAR+Q+  E++RL+E YK EEISIT+TGHSLG+ALA +N+VD+  N  N  K Q   + P
Sbjct  154  SARNQVLSEISRLVEQYKNEEISITITGHSLGAALAVINSVDIVANKFNISKEQPQKSCP  213

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VT F F  P+VG+ +F + FSN  +L  + I +  D+V   P    +G     Y  VG  
Sbjct  214  VTTFAFASPRVGNSSFGNIFSNYKDLNALLIRNQTDIV---PISLFLG-----YSEVGEE  265

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
             +ID+KKS+YLK G+     H+L  ++HG+ G QGS+GGF  + + DI+ +NK   GLKD
Sbjct  266  LLIDTKKSKYLKSGVS---SHNLEVYLHGVAGTQGSKGGFNLEVNRDIALVNKSNDGLKD  322

Query  539  EYHVPVAWMNVKDKGMVQQEDGTY-ILDDHE  628
            EY VP AW  V++KGMVQQ DGT+ ++DD+E
Sbjct  323  EYRVPNAWRVVENKGMVQQFDGTWKLMDDNE  353



>ref|XP_002522554.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39854.1| triacylglycerol lipase, putative [Ricinus communis]
Length=422

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 135/212 (64%), Gaps = 10/212 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNN--VP  178
            SARDQ+  EV RL+E YK EEISITV GHSLG+A+ATLNA D+  N  NK++   N   P
Sbjct  214  SARDQVLNEVRRLVEQYKDEEISITVCGHSLGAAVATLNAADIVANGFNKSKSWPNKPCP  273

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P+VGD +FK  FS   +LR +R+ ++ D+V   P         I Y  VG  
Sbjct  274  VTAIVFASPRVGDSDFKKVFSGYKDLRVLRVHNLLDVVPNYP--------LIGYADVGEE  325

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID+ KS+YLK   ++   H+L  ++HG+ G QGS GGF+ + + DI+ +NK   GLKD
Sbjct  326  LTIDTTKSKYLKSPGNVSSWHNLEGYLHGVAGTQGSTGGFKLEVNRDIALVNKSLDGLKD  385

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            EY VP +W   K+KGM+QQ DG++ L DHE D
Sbjct  386  EYLVPTSWRIQKNKGMIQQADGSWKLMDHEED  417



>ref|XP_010108436.1| Phospholipase A1-IIgamma [Morus notabilis]
 gb|EXC19464.1| Phospholipase A1-IIgamma [Morus notabilis]
Length=426

 Score =   185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 101/212 (48%), Positives = 135/212 (64%), Gaps = 10/212 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNN--VP  178
            SAR Q+  E+ RL+E YK EEISIT+TGHSLG+A+ATLNAVD+  N  NK +   +   P
Sbjct  222  SARQQVLSEIERLVEQYKDEEISITITGHSLGAAIATLNAVDIVSNRYNKPKHHPHKPCP  281

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P+VGD +F++ FS+  +LR +R+ +  D+V   P         I Y  VG  
Sbjct  282  VTAIIFASPRVGDSDFRNLFSSYKDLRALRVRNALDIVPNYP--------IIEYSDVGEE  333

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID+ KS YLK   +I   H+L  ++HG+ G QGS+GGF+ +   DI+ +NK   GLKD
Sbjct  334  LKIDTSKSSYLKSPGNISSWHNLEGYLHGLAGTQGSKGGFKLEVHRDIALVNKTMDGLKD  393

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            EY VP +W   K+KGMVQ EDG++ L DHE D
Sbjct  394  EYLVPESWRCEKNKGMVQLEDGSWKLIDHEED  425



>ref|XP_009757709.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nicotiana 
sylvestris]
Length=397

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 135/210 (64%), Gaps = 10/210 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            S RDQ+ EEV RL+E YK EE+SITVTGHSLG++LATLNAVD+A N VNK  +     VT
Sbjct  192  SVRDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGVNKTSEGKEFQVT  251

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD  FK AF    +LR +RI ++ D+V  VP         I Y  VG   +
Sbjct  252  AFAFASPKVGDLKFKAAFDKLKSLRTLRIHNLWDVVPKVP--------PIGYIDVGEELM  303

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRG--GFEPKGDFDISKLNKYRQGLKD  538
            ID+ KS Y+KP  +++  H L  ++HGI G QG  G  GF+ + + DIS +NK    LKD
Sbjct  304  IDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQGLIGLIGFKLEVNRDISLVNKQWDILKD  363

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            EY +P  W   K+KGMVQQ+DG++IL D E
Sbjct  364  EYGIPGLWWVEKNKGMVQQQDGSWILMDRE  393



>gb|EYU17473.1| hypothetical protein MIMGU_mgv1a008748mg [Erythranthe guttata]
Length=363

 Score =   183 bits (464),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 139/213 (65%), Gaps = 10/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNN--VP  178
            SAR Q+ +EV RL+E YK EE SIT+TGHS+G+A++TLNAVD+     NK +   N   P
Sbjct  158  SARHQVLDEVRRLVEEYKNEETSITITGHSMGAAVSTLNAVDIVAQGYNKPKDMPNKACP  217

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VG+ +F+  FS+  NLR +R+ +  D+V + P         I Y  VG  
Sbjct  218  VTAFVFASPRVGNGSFQKFFSSLQNLRILRVRNARDVVPLYPL--------IGYSEVGEE  269

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
             +ID+++S YLK   +    H L  ++HG+ G QGS+GGF+ + D DI+ +NK+   LKD
Sbjct  270  LVIDTEESSYLKKPGNFSSWHTLEGYLHGVAGTQGSKGGFKLEVDRDIALVNKHMNLLKD  329

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            EY VP +W   ++KGMVQ+EDG+++L DHE D+
Sbjct  330  EYCVPESWWCERNKGMVQKEDGSWLLMDHEHDD  362



>emb|CBI30665.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 135/211 (64%), Gaps = 13/211 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+  EV RL+E +K EEISI++TGHSLG+A+ATLNAVD+  N +N+       PVT
Sbjct  168  SARDQVLGEVRRLVEEFKNEEISISLTGHSLGAAVATLNAVDIVANGLNQG-----CPVT  222

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            A  F  P+VGD NF   FS   NLR +R+ + +D++   P         + Y  VG    
Sbjct  223  AVVFASPRVGDSNFLKLFSALKNLRVLRVRNASDIIPNYPL--------LGYSDVGEELG  274

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            +D++KS+YLK   ++   H+L  H+HG+ G QGSRGGF  + + DI+ +NK    L DEY
Sbjct  275  VDTRKSKYLKSPGNLSTWHNLEAHLHGVAGTQGSRGGFRLEVNRDIALVNKSIDALNDEY  334

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
             VPV+W   K+KGMVQQ DG++ L DHE D+
Sbjct  335  LVPVSWRCEKNKGMVQQVDGSWKLMDHEEDD  365



>ref|XP_004505132.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Cicer arietinum]
Length=401

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 139/211 (66%), Gaps = 14/211 (7%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SAR+Q+  E++RL+E YK EEISIT+TGHSLG+ALA +N+VD+  N  N  K Q   + P
Sbjct  191  SARNQVLSEISRLVEQYKNEEISITITGHSLGAALAVINSVDIVANKFNISKEQPQKSCP  250

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VT F F  P+VG+ +F + FSN  +L  + I +  D+V   P    +G     Y  VG  
Sbjct  251  VTTFAFASPRVGNSSFGNIFSNYKDLNALLIRNQTDIV---PISLFLG-----YSEVGEE  302

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
             +ID+KKS+YLK G+     H+L  ++HG+ G QGS+GGF  + + DI+ +NK   GLKD
Sbjct  303  LLIDTKKSKYLKSGVS---SHNLEVYLHGVAGTQGSKGGFNLEVNRDIALVNKSNDGLKD  359

Query  539  EYHVPVAWMNVKDKGMVQQEDGTY-ILDDHE  628
            EY VP AW  V++KGMVQQ DGT+ ++DD+E
Sbjct  360  EYRVPNAWRVVENKGMVQQFDGTWKLMDDNE  390



>ref|XP_003593747.1| Lipase [Medicago truncatula]
 gb|AES63998.1| phospholipase A1 [Medicago truncatula]
Length=414

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 138/213 (65%), Gaps = 10/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDN--NVP  178
            SAR+Q+  EV RL+E YK EEISIT+TGHSLG+A+ATLNAVD+  N  NK    +    P
Sbjct  209  SARNQVLSEVRRLVEKYKNEEISITITGHSLGAAIATLNAVDIVTNGFNKPSDPSLKASP  268

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P+VGD NF+  FS+  +L  +RI +  D+V   P+        I Y  VG  
Sbjct  269  VTAIVFASPRVGDTNFQKLFSSYKDLSTLRIRNELDIVPNYPF--------IGYSDVGEE  320

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KS YLK   +I+  H+L  ++HG+ G QGS+  F+ + + DI+ +NK   GLKD
Sbjct  321  LKIDTRKSMYLKSPGNILSWHNLEAYLHGVAGTQGSKRVFKLEVNRDIALVNKTLDGLKD  380

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            EY VPV+W  V++KGMVQQ DG++ L DHE DE
Sbjct  381  EYLVPVSWRVVENKGMVQQLDGSWKLIDHEDDE  413



>ref|XP_002266982.2| PREDICTED: phospholipase A1-IIgamma isoform X1 [Vitis vinifera]
Length=406

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 135/211 (64%), Gaps = 13/211 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+  EV RL+E +K EEISI++TGHSLG+A+ATLNAVD+  N +N+       PVT
Sbjct  206  SARDQVLGEVRRLVEEFKNEEISISLTGHSLGAAVATLNAVDIVANGLNQG-----CPVT  260

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            A  F  P+VGD NF   FS   NLR +R+ + +D++   P         + Y  VG    
Sbjct  261  AVVFASPRVGDSNFLKLFSALKNLRVLRVRNASDIIPNYP--------LLGYSDVGEELG  312

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            +D++KS+YLK   ++   H+L  H+HG+ G QGSRGGF  + + DI+ +NK    L DEY
Sbjct  313  VDTRKSKYLKSPGNLSTWHNLEAHLHGVAGTQGSRGGFRLEVNRDIALVNKSIDALNDEY  372

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
             VPV+W   K+KGMVQQ DG++ L DHE D+
Sbjct  373  LVPVSWRCEKNKGMVQQVDGSWKLMDHEEDD  403



>ref|XP_003608120.1| Lipase [Medicago truncatula]
 gb|AES90317.1| phospholipase A1 [Medicago truncatula]
Length=408

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 135/213 (63%), Gaps = 14/213 (7%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SAR Q+  E++RL+ELYK EEISITVTGHSLG ALAT+++VD+  N  N  K Q     P
Sbjct  200  SARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSVDIVANKFNMPKEQPQKACP  259

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VT F FG P+VG+  F+  FS+  +L  + + + ND+V               Y  VG  
Sbjct  260  VTTFAFGAPRVGNSYFQKIFSDHKDLSALFVRNENDIVPK--------SLTFFYYKVGEE  311

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID+++S+YLK G+     H++  ++HGI G QGS+GGF  + + DI+ LNK   GLKD
Sbjct  312  LEIDTEESKYLKSGVSA---HNMEVYLHGIAGTQGSKGGFNLEVNRDIALLNKSNDGLKD  368

Query  539  EYHVPVAWMNVKDKGMVQQEDGTY-ILDDHEVD  634
            EYH+P  W  V++KGMVQQ DGT+ ++DDH  D
Sbjct  369  EYHIPENWRVVENKGMVQQSDGTWKLMDDHNDD  401



>ref|XP_009757707.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=394

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 134/208 (64%), Gaps = 9/208 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            S RDQ+ EEV RL+E YK EE+SITVTGHSLG++LATLNAVD+A N VNK  +     VT
Sbjct  192  SVRDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGVNKTSEGKEFQVT  251

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD  FK AF    +LR +RI ++ D+V  VP         I Y  VG   +
Sbjct  252  AFAFASPKVGDLKFKAAFDKLKSLRTLRIHNLWDVVPKVP--------PIGYIDVGEELM  303

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            ID+ KS Y+KP  +++  H L  ++HGI G QG   GF+ + + DIS +NK    LKDEY
Sbjct  304  IDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQGLI-GFKLEVNRDISLVNKQWDILKDEY  362

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHE  628
             +P  W   K+KGMVQQ+DG++IL D E
Sbjct  363  GIPGLWWVEKNKGMVQQQDGSWILMDRE  390



>ref|XP_006362439.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=419

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 139/213 (65%), Gaps = 11/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+ EEV RL+E YKG+++SIT++GHS+GS+LATL AVD+ VN +NK       PVT
Sbjct  210  SARDQVIEEVKRLVEQYKGDKVSITLSGHSIGSSLATLCAVDIVVNQINK-----EFPVT  264

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNI---LYEAVGV  355
            AF    P+ G+ NFK A+ N  NL+ +RI++  D V   P   QV G      +YE VG 
Sbjct  265  AFLLASPRTGEANFKKAYQNLKNLQILRITNALDEVPEKPDRGQVEGSETDWRVYEHVGF  324

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               ID+ KSEYLK  ++   +H +  ++HGI G  G+ G F+ + + DI+ +NK    LK
Sbjct  325  ELKIDTTKSEYLKKDVN---NHTVEVYLHGIAGTHGAEGEFKLEINRDIALVNKEADALK  381

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            +EY VPV W  V++KGMVQQEDG++ L+D E D
Sbjct  382  NEYGVPVYWRIVQNKGMVQQEDGSWSLNDREDD  414



>gb|ABQ95989.1| phospholipase A1 [Capsicum annuum]
Length=397

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 134/210 (64%), Gaps = 10/210 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
              RDQ+ EEV RL+E YK EE+SITVTGHSLG++LATLNAVD+A N +NK+      PVT
Sbjct  192  CVRDQVMEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGINKSSNGKEFPVT  251

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD NF  AFS   +L  +RI ++ D+V   P    VG     Y  VG   +
Sbjct  252  AFVFASPKVGDLNFHKAFSKLKHLHILRIHNLLDIVPKYP---PVG-----YFDVGQELM  303

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGLKD  538
            ID+ KS Y+KP  +++  H L  ++HGI G Q  G   GF+ + + DIS +NK    LKD
Sbjct  304  IDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQGIGMTAGFKLEVNRDISLVNKQWMILKD  363

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            EY +P  W + K KGMVQQ+DG+++L D +
Sbjct  364  EYCIPPLWWSEKHKGMVQQQDGSWLLQDRD  393



>ref|XP_007025432.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
 gb|EOY28054.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
Length=406

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 136/214 (64%), Gaps = 10/214 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKN--QQDNNVP  178
            SAR+Q+  EV RL++LY+ EEISIT+TGHSLG A+ATLNAVD+  N  NK+  + D    
Sbjct  191  SAREQVLSEVRRLVDLYQDEEISITLTGHSLGGAVATLNAVDIIANGYNKSTTKPDKEYL  250

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD  FK  FS   NL  +RI +  D+V        +    + Y  VG  
Sbjct  251  VTAFVFASPRVGDSGFKKVFSGLKNLHVLRIKNELDMVPS----LPIPLPLLHYTHVGEK  306

Query  359  FIIDSKKSEYLKPGLDI----MVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQ  526
             +IDS KS Y+K  LDI    ++ H L  ++HG+ G QG++G F+ + + DI+ LNK   
Sbjct  307  LLIDSHKSPYMKSHLDISENLVIAHQLEPYLHGVAGSQGAKGEFKLEVNRDIALLNKSLD  366

Query  527  GLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
             LKDEY VPV W   K+KGM QQ+DG++ILDDHE
Sbjct  367  ALKDEYKVPVEWWIEKNKGMAQQDDGSWILDDHE  400



>ref|XP_010279086.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 135/212 (64%), Gaps = 10/212 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SARDQ+  EV RL+E YK EEISIT+TGHSLG+AL TLNAVD+  N  N  K++ D    
Sbjct  190  SARDQVLSEVRRLVEEYKDEEISITITGHSLGAALGTLNAVDIVANGFNRPKDRPDKACL  249

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD  F+   S+  NLR +R+ +  D+V   P         I Y  VG  
Sbjct  250  VTAFLFASPRVGDDKFQKLLSSLENLRLLRVRNALDIVPNYPL--------IGYSDVGQE  301

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
             +ID++KS +LK   ++ V H+L  ++HG+ G QGS+GGF+ + + DI+ +NK   GL+D
Sbjct  302  LVIDTQKSTFLKSPANLSVSHNLEGYLHGVAGTQGSKGGFKLEVERDIALVNKSIDGLRD  361

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            EY V  +W   K+KGMVQ  DG++ L DHE D
Sbjct  362  EYLVLASWRCEKNKGMVQGADGSWKLMDHEED  393



>ref|XP_010529190.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
 ref|XP_010529191.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=425

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 136/213 (64%), Gaps = 10/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SARDQ+  E+ RL+E YK EEISIT+ GHSLG+AL+TL+A D+  N  N  KN  D + P
Sbjct  215  SARDQVLREIRRLVEKYKDEEISITICGHSLGAALSTLSAADIVANGYNRPKNLPDKSCP  274

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VT F F  P+VGD +FK  FS   +LR +RI ++ D+V + P         I Y  VG  
Sbjct  275  VTVFAFASPRVGDSDFKRLFSGLDDLRALRIRNLPDVVPIYP--------PIGYSEVGEE  326

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
             ++D++KS YLK   +  + H +  ++HGI G +G++  F+ + + DI+ +NK   GLKD
Sbjct  327  LVMDTRKSPYLKSPGNPTLFHTMEVYLHGIAGTRGTKSDFKLEIERDIALVNKPIDGLKD  386

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            E+ VP +W  +K+KGM QQ DG++ L DHE D+
Sbjct  387  EFMVPGSWRALKNKGMAQQNDGSWKLMDHETDD  419



>ref|XP_010518795.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Tarenaya 
hassleriana]
Length=412

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 137/213 (64%), Gaps = 11/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SARDQ+ +EV RL+E YK EEISITV GHSLG+ALATLNA D+  N  N  +N+ D    
Sbjct  193  SARDQVLQEVRRLVEKYKDEEISITVCGHSLGAALATLNAADIVANGYNATQNRPDKPCL  252

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VG+ +FK  FS   +LRG+R+ ++ D+V   P         + Y  VG  
Sbjct  253  VTAFVFASPRVGNPDFKKLFSGYKSLRGLRVRNLPDIVPTYP--------PLGYSDVGEE  304

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG-FEPKGDFDISKLNKYRQGLK  535
              ID++KS YLK   D++  H+L  ++HG+ G QG+    F+ +   DIS +NK    LK
Sbjct  305  LTIDTRKSPYLKTPGDLVSFHNLEANLHGVAGTQGTTTKEFKLQVKRDISLINKSIDALK  364

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            DEY VP +W  +K+KGMVQQ+DG++ L DHE+D
Sbjct  365  DEYMVPGSWRVLKNKGMVQQDDGSWKLMDHEMD  397



>ref|XP_006362430.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=394

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 136/211 (64%), Gaps = 10/211 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+ EEV RL+E YK EE+SITVTGHSLG++LATLNAVD+A N +NK  +    PVT
Sbjct  189  SARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGINKTSEGKEFPVT  248

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD  FK AF     L+ +RI  +++L+ +VP    +G     Y  VG   +
Sbjct  249  AFPFASPKVGDLQFKAAFD---KLKSLRILKIHNLLDIVPKYPPIG-----YFDVGKELM  300

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGLKD  538
            ID+ +S Y+KP  D    H L  ++HG+ G Q  G   GF+ + + DIS +NK    LKD
Sbjct  301  IDTARSPYVKPPGDPASWHLLEPYLHGVAGTQGLGLLAGFKLEVNRDISLVNKQWNVLKD  360

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEV  631
            EY +P  W   K+KGMVQQEDG+++  DH+V
Sbjct  361  EYCIPGFWWVEKNKGMVQQEDGSWLQLDHDV  391



>ref|XP_004232955.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Solanum lycopersicum]
Length=408

 Score =   181 bits (460),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 135/213 (63%), Gaps = 12/213 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+ EE+ RL++ Y  EEISI+VTG S+GS+L TL A+D+ VN +NK       PVT
Sbjct  204  SARDQVLEEIKRLLKQYSKEEISISVTGQSMGSSLGTLCAIDIVVNEINKE-----FPVT  258

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNIL----YEAVG  352
            AF F  P+VG+ NFK A+ N  NL  +RI++V D +  +    QV G  I     YE VG
Sbjct  259  AFLFSSPRVGEANFKKAYRNLKNLHILRITNVPDPIPKLMERGQVEGCAITEWRAYEDVG  318

Query  353  VGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGL  532
               +ID+ KSEYLK   DI  H  L  ++HGI G  G  G F+ + + DI+ +NK    L
Sbjct  319  FELVIDTTKSEYLKK--DIFSHF-LEVYLHGIAGTHGVEGEFKLEINRDIALVNKQGDFL  375

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEV  631
            K+EY VP AW   K+KGMVQQEDG++IL DHE 
Sbjct  376  KEEYGVPSAWWIEKNKGMVQQEDGSWILIDHET  408



>ref|XP_004232963.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 132/210 (63%), Gaps = 10/210 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
              RDQ+ EEV RL+E YK EE+SITVTGHSLG++LATLNAVD+A N +NK       PVT
Sbjct  193  CVRDQVMEEVKRLVEEYKDEEVSITVTGHSLGASLATLNAVDIAFNKINKASNGKEFPVT  252

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD NF +AFS   +L  +RI +V D+V   P         I Y  VG   +
Sbjct  253  AFVFASPKVGDVNFLNAFSKLKHLHILRIHNVLDIVPKYP--------PIGYFDVGQEIM  304

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGLKD  538
            ID+ KS Y+KP  + +  H L  ++HGI G Q  G   GF+ + + DIS +NK    LKD
Sbjct  305  IDTTKSPYVKPPGEPVSWHLLEPYLHGIAGTQGIGMLAGFKLEVNRDISLVNKQWNVLKD  364

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            E+ +P  W + K KGMVQQEDGT++L D +
Sbjct  365  EHCIPPLWWSEKHKGMVQQEDGTWLLQDRD  394



>ref|XP_003528480.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31002.1| Phospholipase A1-IIgamma [Glycine soja]
Length=402

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 141/215 (66%), Gaps = 15/215 (7%)
 Frame = +2

Query  5    SARDQIREEVARLIELY--KGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNN  172
            SAR+Q+  EV RL+E Y  K EEISI+VTGHSLG+ALATLNAVD+A   +N  KNQ    
Sbjct  191  SARNQVLGEVGRLVEEYTSKNEEISISVTGHSLGAALATLNAVDIAAQGLNIPKNQPQKA  250

Query  173  VPVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVG  352
             PVTAF +  P+VGD +F++ F+   +LR +RI +V D+V + P+        + +  VG
Sbjct  251  FPVTAFAYACPRVGDSSFEETFNGYKDLRSLRIRNVTDIVPITPF--------LGFSDVG  302

Query  353  VGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGL  532
               +ID++KS+YLK G+     H+L  ++HG+ G QG +GGF  + + DI+ +NK    L
Sbjct  303  EELVIDTRKSKYLKSGVSA---HNLEAYLHGVAGTQGEKGGFNLEVNRDIALVNKSMDAL  359

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            KDEY VPVAW   ++KGMVQQ DG++ + D   D+
Sbjct  360  KDEYLVPVAWRVQENKGMVQQSDGSWKIVDQVHDD  394



>ref|XP_004232958.1| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=419

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 138/213 (65%), Gaps = 11/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+ EEV RL+E YK +++SIT++GHS+GS+L+TL A+D+ VN +NK       PVT
Sbjct  210  SARDQVIEEVKRLVEQYKRDKVSITLSGHSIGSSLSTLCAIDIVVNKINKE-----FPVT  264

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNI---LYEAVGV  355
            AF F  P+ G+ NFK A  +  NL+ +RI++  D V   P   QV G +    +YE VG 
Sbjct  265  AFLFASPRTGEANFKKAHQHLKNLQILRITNALDEVPEKPDRGQVEGSDTDWRVYEHVGY  324

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               ID+ KSEYLK  ++   +H L  ++HGI G  G  G F+ +   DI+ +NK    LK
Sbjct  325  EVKIDTTKSEYLKKDVN---NHSLEVYLHGIAGTHGPEGEFKLEITRDIALVNKETDALK  381

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            +EY VPV W  V++KGMVQQEDG++IL+D E D
Sbjct  382  NEYGVPVYWRTVQNKGMVQQEDGSWILNDREDD  414



>ref|XP_007153706.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
 gb|ESW25700.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
Length=399

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 138/212 (65%), Gaps = 13/212 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SAR+Q+ EEV RL+E YK EEISI+VTGHSLG+ALATLNAVD+A   +N  K Q     P
Sbjct  190  SARNQVLEEVGRLVEEYKNEEISISVTGHSLGAALATLNAVDIAAQGLNKPKGQPQKACP  249

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF +  P+VGD +F+DAF+   +LR +RI +  D+   VP    +G     +  VG  
Sbjct  250  VTAFAYASPRVGDSSFEDAFNGYKDLRALRIRNETDI---VPVSLLLG-----FSDVGEE  301

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
             +ID++KS++LK G+     H+L  ++HG+ G QG +GGF  + + DI+ LNK    LKD
Sbjct  302  LLIDTRKSKFLKEGVSA---HNLEAYLHGVAGTQGKKGGFNLEVNRDIALLNKGMDALKD  358

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            EY VPV W   ++KGMVQQ DGT+ L +   D
Sbjct  359  EYLVPVEWRVQENKGMVQQLDGTWKLIEKNED  390



>ref|XP_010277744.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 135/212 (64%), Gaps = 10/212 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVP  178
            SARDQ+  EV RL+EL+K EEISIT+TGHSLG+AL TLNA D+  + +NK  N       
Sbjct  191  SARDQVLSEVRRLVELFKDEEISITITGHSLGAALGTLNAADIVAHGLNKPRNHPHRACL  250

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P+VGD NF++ FS   NLR +R+ +  D+V   P         + Y  VG  
Sbjct  251  VTAILFASPRVGDDNFQEVFSGLENLRLLRVRNALDVVPNYP--------LLGYSDVGEE  302

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID +KS+++K   +  + H+L  ++HG+ G QG++GGF+ +   DI+ +NK    LKD
Sbjct  303  LAIDFRKSKFIKASANPSLWHNLECYLHGVAGTQGAKGGFKLEVGRDIALVNKTTDALKD  362

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            E+ VPV+W   K+KGMVQ++DGT+ L DHE D
Sbjct  363  EHLVPVSWWCEKNKGMVQRDDGTWKLMDHEED  394



>ref|XP_009777407.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nicotiana 
sylvestris]
Length=391

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 133/211 (63%), Gaps = 10/211 (5%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPV  181
            +S  +Q+ EEV RL+E YK EE+SITVTGHSLG++LATLNAVD+A N +NK  +    PV
Sbjct  185  RSQFNQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGINKTSEGKEFPV  244

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            TAF F  PKVGD NF  AFS   NL  +RI +V D+V   P         I Y  VG   
Sbjct  245  TAFVFASPKVGDLNFHKAFSKLNNLHILRIHNVLDIVPKYP--------PIGYIDVGEEL  296

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGLK  535
            +ID+ KS Y+KP  +++  H L  ++HG+ G Q  G   GF+ + + DIS +NK    LK
Sbjct  297  MIDTTKSPYVKPPGEVVSWHLLEPYLHGVAGTQGIGILAGFKLEVNRDISLVNKQWDILK  356

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            DEY +P  W   K KGMVQQ+DG+++L D E
Sbjct  357  DEYCIPGLWWADKHKGMVQQQDGSWLLLDRE  387



>ref|XP_010518797.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=437

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 134/213 (63%), Gaps = 10/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVP  178
             ARDQ+ +E++RL+ELYK E+ISITV GHSLG+ALATL+A D+  N  NK   + D   P
Sbjct  229  CARDQLLQEISRLVELYKDEDISITVCGHSLGAALATLSATDIVFNGYNKPKGRPDKACP  288

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VG  +FK+ FS   NLR +R  ++ D+V   P    VG     Y  VG  
Sbjct  289  VTAFPFACPRVGASDFKNLFSGLDNLRALRTKNLPDVVCAYP---MVG-----YSDVGDE  340

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KS YLK   ++   H +  +MHG+ G  G++G F  + + DIS +NK    LKD
Sbjct  341  LAIDTRKSPYLKSPGNVTTFHSMEHYMHGVAGTHGTKGEFRLEINRDISLVNKNTDSLKD  400

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            E+ VP  W  +K+KGMVQQ DG++ L DHE D+
Sbjct  401  EHMVPDHWRVLKNKGMVQQGDGSWKLMDHEPDD  433



>ref|XP_006362431.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=389

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 133/208 (64%), Gaps = 9/208 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+ EEV RL+E YK EE+SITVTGHSLG++LATLNAVD+A N +NK  +    PVT
Sbjct  187  SARDQVIEEVKRLVEEYKHEEVSITVTGHSLGASLATLNAVDIAFNGINKTSEGKEFPVT  246

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD  FK AF    +LR ++I ++ D+    P         I Y  VG   +
Sbjct  247  AFPFASPKVGDLQFKAAFDKIKSLRILKIHNLLDIFPKYP--------PIGYFDVGQELM  298

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            ID+ KS Y++P  +    H L  ++HG+ G QG   GF+ + + DIS +NK    LKDEY
Sbjct  299  IDTTKSPYVRPPGEPFSWHLLEPYLHGVAGTQG-LAGFKLEVNRDISLVNKQWDVLKDEY  357

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHE  628
             +P  W   K+KGMVQQEDG+++L DH+
Sbjct  358  CIPGFWWVEKNKGMVQQEDGSWLLLDHD  385



>ref|XP_008812184.1| PREDICTED: phospholipase A1-II 1 [Phoenix dactylifera]
Length=401

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 137/212 (65%), Gaps = 10/212 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKN--QQDNNVP  178
            SAR+Q+  E+ RL++ Y  EE SITVTGHSLG+ALATLNA D+A N +NK+  + + + P
Sbjct  193  SARNQVLREIGRLMDEYNKEETSITVTGHSLGAALATLNAADIASNGLNKSNARPNKSSP  252

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            V AF F  P+VGD +F++AFSN   LR +RI +V DLV   P         + Y+ +GV 
Sbjct  253  VAAFVFASPRVGDSDFREAFSNIPELRLLRIRNVPDLVPNYPL--------LGYDDIGVE  304

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KS+YLK   ++   H+L  ++HG+ G  G +G F+ + D D++ +NK    LKD
Sbjct  305  LTIDTRKSQYLKSPGNLSSWHNLEAYLHGVAGTNGGKGRFKLEVDRDVALVNKGLDALKD  364

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            EY VP +W   K+KGMV+  DG + L DHE D
Sbjct  365  EYLVPASWWVEKNKGMVKGADGHWRLMDHEED  396



>emb|CDP11819.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 138/214 (64%), Gaps = 11/214 (5%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQ--QDNNV  175
            +SAR Q+ E +  L+E +K EE+SIT+ GHSLG+AL+T+NA D+  N  NK +   + + 
Sbjct  190  QSARVQVLEAIKSLVEEFKKEEVSITIAGHSLGAALSTMNAADIVANGYNKTRGMPNKSC  249

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
             VTAF FG P+VGD NF++AF +  +L  +R+ ++ DLV  VP         I Y  VG 
Sbjct  250  MVTAFAFGSPRVGDSNFRNAFESMNDLHLLRVRNIPDLVPQVP--------PIPYADVGE  301

Query  356  GFIIDSKKSEYLKPGLDIMVHHDL-MFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGL  532
              +IDS+KS YLK   ++ + H+L   ++H + G QGS+GGF  +   DIS +NK    +
Sbjct  302  ELLIDSRKSPYLKRIGNLEIWHNLEAAYLHAVAGTQGSKGGFHLEVKRDISLVNKILDAV  361

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            KDEY +P  W  +K+KGMVQQ+DG++ L+DH+ D
Sbjct  362  KDEYLIPTGWWCLKNKGMVQQDDGSWKLEDHDRD  395



>ref|XP_007148062.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
 gb|ESW20056.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
Length=424

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 136/213 (64%), Gaps = 10/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDN--NVP  178
            SAR Q+  EV RL+ELYK EEISI++TGHSLG+A+ATL+AVD+  N  NK    +    P
Sbjct  219  SARSQVLSEVKRLVELYKNEEISISITGHSLGAAIATLSAVDIVANGYNKPSDPSLKASP  278

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P+VGD NF+  FS   +L+ +RI +  D+V   P    VG     Y  VG  
Sbjct  279  VTAIVFACPRVGDTNFRKVFSGYKDLKTIRIRNELDIVPNYP---LVG-----YSDVGEE  330

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KS YLK   + +  H+L  ++HG+ G QGS+GGF+ + + DI+ LNK    LKD
Sbjct  331  LKIDTRKSMYLKSPGNPLSWHNLEGYLHGVAGTQGSKGGFKLEVNRDIALLNKTLDALKD  390

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            E  VPV+W   K+KGMVQQ DG++ L DHE D+
Sbjct  391  ELLVPVSWRIEKNKGMVQQNDGSWKLMDHEDDD  423



>ref|XP_008383647.1| PREDICTED: phospholipase A1-IIgamma [Malus domestica]
Length=430

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 137/215 (64%), Gaps = 13/215 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SAR Q+ EEV RLIE YK EEISIT+TGHSLG+A+ATL+A+D+  N +N  K+  +   P
Sbjct  222  SARHQVIEEVMRLIEQYKDEEISITITGHSLGAAVATLSAIDIVANGLNRPKDMPNKACP  281

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNIL--YEAVG  352
            VTA  F  P+VG+ NF+  FS   +LR +RI +  D+V   P         IL  Y  VG
Sbjct  282  VTAIVFASPRVGNSNFEKVFSGYKDLRALRIRNALDVVPNYP---------ILLGYSDVG  332

Query  353  VGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGL  532
                ID++KS+YLK    ++  H++  ++HG+ G QGS+GGF+ +   DI+ +NK    L
Sbjct  333  EELKIDTQKSKYLKSPGGVVSWHNMEGYLHGVAGTQGSKGGFKLEVKRDIALVNKSVDAL  392

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            K+EY +P +W   K+K M Q EDG+++L DHE D+
Sbjct  393  KEEYLIPASWRCEKNKCMTQLEDGSWVLKDHEEDD  427



>ref|XP_009795642.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=397

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 130/210 (62%), Gaps = 10/210 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
              RDQ+ EEV RL+E YK E++SITVTGHSLG++LATLNAVD+  N +NK  +    PVT
Sbjct  192  CVRDQVIEEVKRLVEEYKNEDVSITVTGHSLGASLATLNAVDITFNGINKTTEGKEFPVT  251

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD NF  AFS   NL  +RI ++ D+V   P         I Y  VG   +
Sbjct  252  AFVFASPKVGDFNFHKAFSKLNNLHILRIHNLLDIVPKYP--------PIGYIDVGKELM  303

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGLKD  538
            ID+ KS Y+KP  DI   H L  ++HG+ G Q  G   GF+ + + DIS +NK    LKD
Sbjct  304  IDTTKSPYVKPPGDIASWHLLEPYLHGVAGTQGIGILAGFKLEVNRDISLVNKMGDTLKD  363

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            E+ +P  W   K KGMVQQ+DGT++L D E
Sbjct  364  EHCIPGHWWVEKHKGMVQQQDGTWLLLDRE  393



>ref|XP_004232965.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=394

 Score =   178 bits (452),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 137/210 (65%), Gaps = 10/210 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+ EEV RL+E YK EE+SITVTGHSLG++LATLNAVD+A N +NK  +    PVT
Sbjct  189  SARDQVIEEVKRLVEEYKHEEVSITVTGHSLGASLATLNAVDIAFNGINKTSEGKEFPVT  248

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD  FK AF     ++G+R+  +++L+ +VP    +G     Y  VG   +
Sbjct  249  AFPFASPKVGDLQFKAAFD---KIKGLRVLKIHNLLDIVPKYPPIG-----YFDVGQELM  300

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGLKD  538
            ID+ KS Y+KP  + +  H L  ++HG+ G Q  G   GF+ + + DIS +NK    LKD
Sbjct  301  IDTTKSPYVKPPGEPVSWHLLEPYLHGVAGTQGLGLLAGFKLEVNRDISLVNKQWDVLKD  360

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            EY +P  W   K+KGMVQQEDG++++ D +
Sbjct  361  EYCIPGLWWVEKNKGMVQQEDGSWLMLDRD  390



>ref|XP_004969327.1| PREDICTED: phospholipase A1-II 1-like [Setaria italica]
Length=394

 Score =   178 bits (452),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 136/212 (64%), Gaps = 13/212 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPV  181
            +SAR Q+  EV R+ +LYK EE SIT+TGHSLG+ALAT+NA+D+  N  NK+      PV
Sbjct  195  ESARHQVLNEVKRIQDLYKNEETSITITGHSLGAALATINAIDIVSNGYNKS-----CPV  249

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            +AF FG P+VG+ +F+ AF +  +LR +R+ +  D+V   P         + Y  VG   
Sbjct  250  SAFVFGSPRVGNPDFQKAFDSAADLRLLRVRNSPDVVPKWP--------KLGYNDVGTEL  301

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
            +ID+ +S YLK   + +  HD+  +MHG+ G QGS GGF+   D DI+ +NK+   LK+E
Sbjct  302  MIDTGESPYLKAPGNPLTWHDMECYMHGVAGTQGSSGGFKLLVDRDIALVNKHEDALKNE  361

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            Y +P +W  V++KGMV+ +DG + L DHE D+
Sbjct  362  YSIPTSWWVVQNKGMVKGKDGRWHLADHEDDD  393



>ref|XP_008675278.1| PREDICTED: phospholipase A1-II 2-like [Zea mays]
 tpg|DAA58341.1| TPA: hypothetical protein ZEAMMB73_357723 [Zea mays]
Length=412

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 130/213 (61%), Gaps = 10/213 (5%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNV  175
            +SAR Q+  E+ RL++ YKGEE SITV GHSLG+ +ATLNAVD+A N  NK         
Sbjct  198  QSARMQVLTEIVRLMDKYKGEETSITVVGHSLGATMATLNAVDIAANAYNKIPGYDSRRA  257

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            PVTA  FG P+ GDQ+F+D F    +LR +R+ +  D +   P    VG     Y  VGV
Sbjct  258  PVTAIVFGSPRTGDQDFRDVFHRTPDLRMLRVRNRPDRIPHYP---PVG-----YADVGV  309

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
              +ID+++S +LK        HDL  H+HGI G+QG RGGFE   D D++ +NK+   L 
Sbjct  310  ELLIDTRRSPFLKHHGSESQSHDLEVHLHGIAGWQGDRGGFELVVDRDVALVNKFDDCLA  369

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            DEY VPV W    +K MV+  DG ++L+DH+ D
Sbjct  370  DEYPVPVRWKVHHNKSMVKGGDGRWVLEDHDPD  402



>ref|XP_004232942.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 134/212 (63%), Gaps = 13/212 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+ EEV RL+E YK +E+SITV GHSLG++LATLNAVD+A N +NK  +    PVT
Sbjct  192  SARDQVLEEVKRLVEEYKDDEVSITVAGHSLGASLATLNAVDIAFNGINKTSEGKEFPVT  251

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD NF + F+   NL  MRI ++ D+V   P         I Y  VG   I
Sbjct  252  AFVFASPKVGDVNFVNTFNKLKNLHIMRIDNLLDIVPKYP--------PIGYFDVGQEII  303

Query  365  IDSKKSEYLK--PGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGL  532
            ID+ KS YLK  PG D    H+L  ++HGIDG Q  G   GF+ + + D++ +N+    L
Sbjct  304  IDTTKSPYLKLNPG-DPHTRHNLEGYLHGIDGTQGIGPLDGFKLEVNRDLALVNRIWDIL  362

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            KDE+ VP AW   K  GMVQQE+G +IL DHE
Sbjct  363  KDEHLVPGAWWVEKHNGMVQQENGKWILMDHE  394



>ref|XP_004485882.1| PREDICTED: phospholipase A1-IIgamma-like [Cicer arietinum]
Length=415

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 137/211 (65%), Gaps = 12/211 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNV---  175
            SAR+Q+  EV RL+E YK EEISIT+TGHSLG+A+ATLNAVD+  N  NK   D+++   
Sbjct  210  SARNQVLSEVRRLVEKYKNEEISITITGHSLGAAIATLNAVDIVTNGYNK-PNDSSIKAS  268

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            PVTA  F  P+VGD NF+  FS+Q +L  +RI +  D+V   P+        I Y  VG 
Sbjct  269  PVTAIVFASPRVGDTNFQKVFSDQKDLSTLRIRNELDIVPNYPF--------IGYSDVGE  320

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               ID+ KS YLK   + +  H+L  ++HG+ G QGS+ GF+ + + DIS +NK    LK
Sbjct  321  ELKIDTTKSMYLKSPGNPLSWHNLEAYLHGVAGTQGSKRGFKLEVNRDISLVNKTLDVLK  380

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            DEY VP++W  V++KGMVQQ DG++ L D E
Sbjct  381  DEYLVPISWRVVENKGMVQQPDGSWKLVDPE  411



>ref|XP_004232964.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 133/210 (63%), Gaps = 10/210 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            S RDQ+ EEV RL+E YK EE+SITVTGHSLG++LATLNAVD+A N +NK  +    PVT
Sbjct  192  SVRDQVMEEVKRLVEEYKDEEVSITVTGHSLGASLATLNAVDIAFNGINKTSEGKEFPVT  251

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD NF + FS   +L  +RI ++ D+V   P         I Y  VG   +
Sbjct  252  AFVFASPKVGDINFLNKFSKLKHLHILRIHNLLDIVPKYP--------PIGYFDVGQEIM  303

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGLKD  538
            ID+ KS Y+KP  +I+  H L  ++HG+ G Q  G   GF+ + + DIS +NK    LK+
Sbjct  304  IDTTKSPYVKPPGEIVSWHLLEPYLHGVAGTQGLGLLAGFKLEVNRDISLVNKEWDILKN  363

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            EY VP  W   K KGMVQQE+G+++L D +
Sbjct  364  EYCVPAFWWTEKHKGMVQQENGSWLLMDRD  393



>ref|XP_004134929.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004155629.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
Length=437

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 134/215 (62%), Gaps = 10/215 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNV-PV  181
            S R+Q+  EV RL+E YK EEISI  TGHSLG+ALATLNA D+A N +N         PV
Sbjct  228  SVRNQVIGEVKRLVEEYKNEEISIVTTGHSLGAALATLNAFDMAANKLNVAATTGEAYPV  287

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            T+F F  P+VGD +FK AFS   ++  +R+ +  D+V   P         I Y  VG   
Sbjct  288  TSFVFASPRVGDSDFKRAFSEYKDVHVLRVKNAMDVVPNYP--------IIGYSEVGEEL  339

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQG-SRGGFEPKGDFDISKLNKYRQGLKD  538
             ID++KS+YLK    +   H+L  ++HG+ G QG ++GGF  + + DI+ LNK    LKD
Sbjct  340  EIDTRKSKYLKSPGSLSSWHNLEAYLHGVAGTQGKNKGGFRLEIERDIALLNKSLDALKD  399

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDETF  643
            EY VPVAW  +++KGMVQQ DG++ L DHE D+ F
Sbjct  400  EYLVPVAWRCLQNKGMVQQSDGSWKLMDHEEDDEF  434



>gb|KGN49294.1| hypothetical protein Csa_6G519470 [Cucumis sativus]
Length=443

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 134/215 (62%), Gaps = 10/215 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNV-PV  181
            S R+Q+  EV RL+E YK EEISI  TGHSLG+ALATLNA D+A N +N         PV
Sbjct  234  SVRNQVIGEVKRLVEEYKNEEISIVTTGHSLGAALATLNAFDMAANKLNVAATTGEAYPV  293

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            T+F F  P+VGD +FK AFS   ++  +R+ +  D+V   P         I Y  VG   
Sbjct  294  TSFVFASPRVGDSDFKRAFSEYKDVHVLRVKNAMDVVPNYP--------IIGYSEVGEEL  345

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQG-SRGGFEPKGDFDISKLNKYRQGLKD  538
             ID++KS+YLK    +   H+L  ++HG+ G QG ++GGF  + + DI+ LNK    LKD
Sbjct  346  EIDTRKSKYLKSPGSLSSWHNLEAYLHGVAGTQGKNKGGFRLEIERDIALLNKSLDALKD  405

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDETF  643
            EY VPVAW  +++KGMVQQ DG++ L DHE D+ F
Sbjct  406  EYLVPVAWRCLQNKGMVQQSDGSWKLMDHEEDDEF  440



>ref|XP_008439757.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=447

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 134/215 (62%), Gaps = 9/215 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNV-PV  181
            S R+Q+  EV RL+E YK EEISI  TGHSLG+ALATLNAVD+A N +N         PV
Sbjct  234  SVRNQVIGEVKRLVEEYKNEEISIVTTGHSLGAALATLNAVDIAANKLNIAAATGQAYPV  293

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            T+F F  P+VGD  FK AFS   ++  +R+ +  D+V   P         I Y  VG   
Sbjct  294  TSFVFACPRVGDSEFKRAFSEYKDVHVLRVKNAMDVVPNYP-------MFIGYSEVGEEL  346

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQG-SRGGFEPKGDFDISKLNKYRQGLKD  538
             ID++KS+YLK    +   H+L  ++HG+ G QG ++GGF  + + DI+ LNK    LKD
Sbjct  347  EIDTRKSKYLKSPGSLSSWHNLEGYLHGVAGTQGKNKGGFRLEIERDIALLNKSLDALKD  406

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDETF  643
            EY VPVAW  +++KGMVQQ DG++ L DHE D+ F
Sbjct  407  EYLVPVAWRCLQNKGMVQQTDGSWKLMDHEEDDEF  441



>ref|XP_006362445.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 131/210 (62%), Gaps = 10/210 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
              RDQ+ EEV RL+E YK EE+SITVTGHSLG++LATLNAVD+A N +NK       PVT
Sbjct  193  CVRDQVMEEVKRLVEEYKHEEVSITVTGHSLGASLATLNAVDIAFNKINKASNGKEFPVT  252

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD NF +AFS   +L  +RI ++ D+V   P         I Y  VG   +
Sbjct  253  AFVFASPKVGDVNFLNAFSKLKHLHILRIHNLLDIVPKYP--------PIGYFDVGQEIM  304

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGLKD  538
            ID+ KS Y+KP  + +  H L  ++HGI G Q  G   GF+ + + DIS +NK    LKD
Sbjct  305  IDTTKSPYVKPPGEPVSWHLLEPYLHGIAGTQGIGMFAGFKLEVNRDISLVNKQWNILKD  364

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            E+ +P  W + K KGMVQQEDG ++L D +
Sbjct  365  EHCIPPLWWSEKHKGMVQQEDGCWLLQDRD  394



>ref|XP_009626666.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 130/210 (62%), Gaps = 10/210 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
              RDQ+ EEV RL+E YK E++SITVTGHSLG++LATLNAVD+  N +NK  +    PVT
Sbjct  192  CVRDQVIEEVKRLVEEYKNEDVSITVTGHSLGASLATLNAVDITFNGINKTTEGKEFPVT  251

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD NF  AFS   NL  +RI +V D+V   P         I Y  VG   +
Sbjct  252  AFVFASPKVGDFNFHKAFSKLNNLHILRIHNVLDIVPKYP--------PIGYIDVGKELM  303

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSR--GGFEPKGDFDISKLNKYRQGLKD  538
            ID+ KS Y+KP  DI+  H L  ++HG+ G QG     GF+ + + +IS +NK    LKD
Sbjct  304  IDTTKSPYVKPPGDIVSWHLLEPYLHGVAGTQGISILAGFKLEVNRNISLVNKMGNILKD  363

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            E+ +P  W   K KGMVQQ+DGT++  D E
Sbjct  364  EHCIPGLWWVEKHKGMVQQQDGTWLFLDRE  393



>ref|XP_010686320.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=411

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 136/215 (63%), Gaps = 14/215 (7%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNN----  172
            SAR Q+ +E+  L+E YK EEISIT+TGHSLG+ALATLNA+D+ VN  NKN+  +N    
Sbjct  198  SARYQVLQEIENLVEQYKDEEISITITGHSLGAALATLNAIDIVVN--NKNKPKDNPQKQ  255

Query  173  VPVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVG  352
              VTA  F  P+VGD NFK  F    NL+ +R+ +  D+V   P         + Y  VG
Sbjct  256  CLVTAIIFASPRVGDSNFKKIFPKYDNLKLLRVHNTLDIVPNYPL--------LGYSDVG  307

Query  353  VGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGL  532
               +ID+ KS YLK        H++  ++HG+ G QGS+ GF+   D DI+ +NK    L
Sbjct  308  QELLIDTTKSPYLKVPGTFSNWHNMEAYLHGVAGTQGSKNGFKLVVDRDIALVNKSMDNL  367

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            KDEY +PVAW ++K+KGMVQQ DG+++L D+E+ +
Sbjct  368  KDEYLIPVAWWSLKNKGMVQQSDGSWLLMDNEMSD  402



>ref|XP_004140112.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004165194.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 gb|KGN47948.1| hypothetical protein Csa_6G419450 [Cucumis sativus]
Length=398

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 129/213 (61%), Gaps = 10/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SAR Q+  E+ +L+E ++ E+ISIT+TGHSLG+AL TLNA D+  N +N  K Q     P
Sbjct  191  SARQQVLSEIEKLLEEFQDEDISITITGHSLGAALGTLNATDIIANQINRGKKQPQKPCP  250

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VT F FG P VGD+NF+  F++   L  +R  +  D+V   P    + G    Y  VG  
Sbjct  251  VTVFLFGSPHVGDRNFRKTFNSMNELHLLRTRNKADIVPDYP----LTG----YAKVGEE  302

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
             IID++KSEYLK        H L  ++HG+ G QG+ GGF  +   DI+++NK    LK+
Sbjct  303  LIIDTRKSEYLKSPGGFKSWHSLEAYLHGVAGTQGNEGGFTLEVKRDIARVNKALNALKE  362

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            EY VP +W   ++KGMVQ  DG + LDDHE DE
Sbjct  363  EYLVPESWWCAQNKGMVQDADGFWKLDDHETDE  395



>ref|XP_002456058.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
 gb|EES01178.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
Length=436

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 129/213 (61%), Gaps = 10/213 (5%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQ--QDNNV  175
            +SAR Q+  E+ARL++ YK EE SITV GHSLG+ +ATLNA D+  N  NK         
Sbjct  194  QSARMQVLTEIARLMDKYKDEETSITVVGHSLGATMATLNAADIVANAYNKTPGYDSRRA  253

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            PVTA  FG P+ GD++F+D F    +LR +RI +  D +   P    VG     Y  VGV
Sbjct  254  PVTAIVFGSPRTGDRDFRDVFHRLPDLRMLRIRNRPDRIPHYP---PVG-----YADVGV  305

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
              +ID+++S +LKP  +    HDL  H+HG+ G+QG  GGFE   D D++ +NK+   L 
Sbjct  306  ELLIDTRRSPFLKPHGNESQSHDLEVHLHGVAGWQGDHGGFELVVDRDVALVNKFDDCLA  365

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            DEY VPV W    +K MV+  DG ++L+DHE D
Sbjct  366  DEYPVPVGWKVHHNKNMVKGPDGRWVLEDHEPD  398



>gb|KHN18919.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 133/213 (62%), Gaps = 10/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDN--NVP  178
            SAR Q+  EV RL+ELYK EEISIT+TGHSLG+A+ATLNAVD+  N  NK    +    P
Sbjct  191  SARTQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDIVTNGYNKPSDPSLKASP  250

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P+VGD NF+  FS   +L  +RI +  D+V   P    VG     Y  VG  
Sbjct  251  VTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPNYP---LVG-----YSDVGEE  302

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KS YLK   +    H+L  ++HG+ G Q S+GGF+ +   DI+ +NK    LKD
Sbjct  303  LKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQRSKGGFKLEVHRDIALVNKTLDALKD  362

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            E+ VPV+W   K+KGMVQQ DG++ L DHE D+
Sbjct  363  EFLVPVSWRTEKNKGMVQQNDGSWKLMDHEDDD  395



>ref|XP_006364324.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 133/212 (63%), Gaps = 13/212 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+ EEV RL+E YK +E+SITV GHSLG++LATLNAVD+A N +NK       PVT
Sbjct  192  SARDQVIEEVKRLVEEYKDDEVSITVAGHSLGASLATLNAVDIAYNGINKTSSGKEFPVT  251

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD NF +A +   +L  MRI ++ D+V+  P         I Y  VG   I
Sbjct  252  AFVFASPKVGDLNFVNAVNKLEHLHIMRIHNLLDIVSKYP--------PIGYFDVGQEII  303

Query  365  IDSKKSEYLK--PGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGL  532
            ID+ KS YLK  PG D    H+L  ++HGIDG Q  G   GF+ + + D+S +N+    L
Sbjct  304  IDTTKSPYLKLNPG-DPHTRHNLEGYLHGIDGTQGIGPLDGFKLEVNRDLSLVNRIWDIL  362

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            KDEY VP AW   K  GMVQQEDG +IL D E
Sbjct  363  KDEYLVPGAWWVEKHNGMVQQEDGKWILMDRE  394



>ref|XP_003547164.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=423

 Score =   177 bits (448),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 133/213 (62%), Gaps = 10/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDN--NVP  178
            SAR Q+  EV RL+ELYK EEISIT+TGHSLG+A+ATLNAVD+  N  NK    +    P
Sbjct  218  SARTQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDIVTNGYNKPSDPSLKASP  277

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P+VGD NF+  FS   +L  +RI +  D+V   P    VG     Y  VG  
Sbjct  278  VTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPNYP---LVG-----YSDVGEE  329

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KS YLK   +    H+L  ++HG+ G Q S+GGF+ +   DI+ +NK    LKD
Sbjct  330  LKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQRSKGGFKLEVHRDIALVNKTLDALKD  389

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            E+ VPV+W   K+KGMVQQ DG++ L DHE D+
Sbjct  390  EFLVPVSWRTEKNKGMVQQNDGSWKLMDHEDDD  422



>ref|XP_010316799.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Solanum lycopersicum]
Length=410

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 135/215 (63%), Gaps = 14/215 (7%)
 Frame = +2

Query  5    SARDQ--IREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVP  178
            SARDQ  + EE+ RL++ Y  EEISI+VTG S+GS+L TL A+D+ VN +NK       P
Sbjct  204  SARDQRQVLEEIKRLLKQYSKEEISISVTGQSMGSSLGTLCAIDIVVNEINKE-----FP  258

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNIL----YEA  346
            VTAF F  P+VG+ NFK A+ N  NL  +RI++V D +  +    QV G  I     YE 
Sbjct  259  VTAFLFSSPRVGEANFKKAYRNLKNLHILRITNVPDPIPKLMERGQVEGCAITEWRAYED  318

Query  347  VGVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQ  526
            VG   +ID+ KSEYLK   DI  H  L  ++HGI G  G  G F+ + + DI+ +NK   
Sbjct  319  VGFELVIDTTKSEYLKK--DIFSHF-LEVYLHGIAGTHGVEGEFKLEINRDIALVNKQGD  375

Query  527  GLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEV  631
             LK+EY VP AW   K+KGMVQQEDG++IL DHE 
Sbjct  376  FLKEEYGVPSAWWIEKNKGMVQQEDGSWILIDHET  410



>ref|XP_009352805.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=430

 Score =   177 bits (448),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 136/215 (63%), Gaps = 13/215 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SAR Q+ EEV RLIE YK EEISIT+TGHSLG+A+ATL+A+D+  N +N  K+  +   P
Sbjct  222  SARHQVIEEVMRLIEQYKDEEISITITGHSLGAAVATLSAIDIVANGLNRPKDMPNKACP  281

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNIL--YEAVG  352
            VTA  F  P+VG+ NF+  FS   +LR +RI +  D+V   P         IL  Y  VG
Sbjct  282  VTAIVFASPRVGNSNFEKVFSGYKDLRALRIRNALDVVPNYP---------ILLGYSDVG  332

Query  353  VGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGL  532
                ID++KS+YLK    +   H++  ++HG+ G QGS+GGF+ +   DI+ +NK    L
Sbjct  333  EELKIDTQKSKYLKSPGGVASWHNMEGYLHGVAGTQGSKGGFKLEVKRDIALVNKSVDAL  392

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            K+EY +P +W   ++K M Q EDG+++L DHE D+
Sbjct  393  KEEYLIPASWRCEENKCMTQLEDGSWVLKDHEDDD  427



>ref|XP_009773996.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=403

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 131/215 (61%), Gaps = 15/215 (7%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+ EEV RL+E YK E++SITVTGHSLG+ALATLNAVD+  N +NK       PVT
Sbjct  193  SARDQVLEEVKRLVEKYKNEKVSITVTGHSLGAALATLNAVDIVYNGINKKSNGKEFPVT  252

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  P VGD NF+ AFS   NL  +RI ++ D+V   P         I Y  VG   +
Sbjct  253  AFVFASPNVGDLNFRAAFSKLKNLHILRIDNLLDIVPKYP--------PIGYIDVGQVLV  304

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGS-------RGGFEPKGDFDISKLNKYR  523
            ID+ KS+Y+K   +I+  H+L  +MHG+ G QG         G F+ + + DI+ +NK  
Sbjct  305  IDTAKSDYVKSPGNILTWHNLEAYMHGVAGTQGVGILPGELLGEFKLEVNRDIALVNKSM  364

Query  524  QGLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
              LK+EY VP  W   K+ GMVQ+ D +++L D E
Sbjct  365  DALKEEYGVPANWWVEKNNGMVQRADRSWVLMDRE  399



>gb|EAY75191.1| hypothetical protein OsI_03083 [Oryza sativa Indica Group]
 gb|EAZ12913.1| hypothetical protein OsJ_02836 [Oryza sativa Japonica Group]
Length=358

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 134/212 (63%), Gaps = 13/212 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPV  181
            +SAR Q+  E+ RL ++Y+ EE SIT+TGHSLG+ALAT+NA D+  N  NK+      PV
Sbjct  160  QSARYQVLNEIKRLQDMYEHEETSITITGHSLGAALATINATDIVSNGYNKS-----CPV  214

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            +AF FG P+VG+ +F+ AF +  +LR +RI +  D+V   P         + Y   G   
Sbjct  215  SAFVFGSPRVGNPDFQKAFDSAPDLRLLRIRNSPDVVPNWP--------KLGYSDAGTEL  266

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
            +ID+ KS YLK   + +  HD+  +MHG+ G QGS GGF+ + D DI+ +NK+   LK+E
Sbjct  267  MIDTGKSPYLKAPGNPLTWHDMECYMHGVAGTQGSNGGFKLEIDRDIALVNKHEDALKNE  326

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            Y +P +W  V++KGMV+  DG + L DHE D+
Sbjct  327  YAIPSSWWVVQNKGMVKGTDGRWHLADHEDDD  358



>ref|XP_010686321.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=436

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 132/215 (61%), Gaps = 13/215 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNN---V  175
            SAR Q+  E+ +L+E YK EEISIT+TGHSLG+ALATLNA D+  N +N+ +   N    
Sbjct  230  SARQQVLTELTKLVEQYKNEEISITITGHSLGAALATLNAADIVANKINQPKNSPNSKPC  289

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
             VTA  F  P+VGD NFK   S   +L  +R+ +  D V   P         I Y  VG 
Sbjct  290  KVTAIVFASPRVGDANFKKTLSKYDDLGVLRVRNAQDFVPNYPL--------IDYSDVGE  341

Query  356  GFIIDSKKSEYLK-PGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGL  532
               ID+ +S YLK PGL + V H+L  +MHG+ G QGS  GF+   + D++ LNK+   L
Sbjct  342  ELTIDTTQSAYLKNPGL-LSVSHNLEVYMHGVAGTQGSVEGFKLVVERDVALLNKFYDFL  400

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            KD+Y VPV W   + KGMVQQ DG+++L DHE+D+
Sbjct  401  KDDYLVPVGWWVAQYKGMVQQADGSWLLMDHEMDD  435



>emb|CDX76515.1| BnaA08g08850D [Brassica napus]
Length=398

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 133/215 (62%), Gaps = 12/215 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            +ARDQ+  E+ RL+E YK E+ISI++ GHSLG+A+ATLNA D+  N  N  K++ D + P
Sbjct  186  NARDQVLREIGRLLEKYKDEKISISICGHSLGAAIATLNAADIVANGYNRPKSRPDKSCP  245

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD +FK  FS   +LR +R+ ++ D+V + P         + Y  VG  
Sbjct  246  VTAFVFASPRVGDSDFKKLFSGLKDLRVLRVRNLPDVVPIYP--------PLGYAEVGDE  297

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG--FEPKGDFDISKLNKYRQGL  532
              ID++KS YLK   D+   H L  ++HG+ G QG+     F      DI  +NK   GL
Sbjct  298  LPIDTRKSPYLKSPGDLATFHCLEVYLHGLAGTQGTSKADLFRLDVKRDIGLVNKSVDGL  357

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            KDEY VP  W  +K+KGMVQQ DG++ L DHE+D+
Sbjct  358  KDEYMVPGHWRILKNKGMVQQNDGSWKLMDHEIDD  392



>emb|CDM83551.1| unnamed protein product [Triticum aestivum]
Length=394

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 135/212 (64%), Gaps = 13/212 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPV  181
            +SAR Q+ +EV RL +LYK EE SIT+TGHSLG+ALAT++A D+  N  NK       PV
Sbjct  195  QSARYQVLDEVERLQDLYKQEETSITITGHSLGAALATISATDIVSNGYNKT-----CPV  249

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            +AF FG P+VG+ +F+ AF +  +LR +R+ +  D+V   P         + Y   G   
Sbjct  250  SAFVFGSPRVGNSDFQKAFDSAEDLRLLRVRNSPDVVPNWP--------KLGYSDAGTEL  301

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
            +ID+ +S Y+K   + +  HD+  +MHG+ G QGS GGFE + D DI+ +NK+   LK+E
Sbjct  302  MIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSNGGFELEVDRDIALVNKHEDALKEE  361

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            Y +P +W  V++KGMV+ +DG + L DHE D+
Sbjct  362  YSIPPSWWVVQNKGMVKGKDGRWHLADHEDDD  393



>gb|KHN08451.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 131/213 (62%), Gaps = 10/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDN--NVP  178
            SAR Q+  EV RL+ELYK EEISIT+TGHSLG+A+ATLNAVD+  N  NK    +    P
Sbjct  191  SARSQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDIVTNGYNKPNDPSLKASP  250

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P+VGD NF+  FS   +L  +RI +  D+V   P    VG     Y  VG  
Sbjct  251  VTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPNYP---LVG-----YSDVGEE  302

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KS YLK   +    H+L  ++HG+ G QGS+GGF  +   DI+ +NK    LKD
Sbjct  303  LKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQGSKGGFNLEVHRDIALVNKTLDALKD  362

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            E  VPV+W   K+KGM QQ DG++ L DHE D+
Sbjct  363  ELLVPVSWRIEKNKGMFQQNDGSWKLMDHEEDD  395



>ref|XP_008675277.1| PREDICTED: phospholipase A1-II 1 [Zea mays]
 tpg|DAA58340.1| TPA: hypothetical protein ZEAMMB73_464828 [Zea mays]
Length=395

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 135/212 (64%), Gaps = 12/212 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPV  181
            +SAR Q+  EV R+ +LYK EE SIT+TGHSLG+ALAT+NA D+  N  N++      PV
Sbjct  195  ESARHQVLNEVKRIQDLYKPEETSITITGHSLGAALATINATDIVSNGYNRSC----CPV  250

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            +AF FG P+VG+ +F+ AF +  +LR +R+ +  D+V   P         + Y  VG   
Sbjct  251  SAFVFGSPRVGNLDFQKAFDSAADLRLLRVRNSPDVVPKWP--------KLGYSDVGTEL  302

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
            +ID+ +S YLK   + +  HD+  +MHG+ G QGS GGFE   D D++ +NK+   L++E
Sbjct  303  MIDTGESPYLKAPGNPLTWHDMECYMHGVAGAQGSSGGFELLVDRDVALVNKHEDALRNE  362

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            + VP +W  V++KGMV+ +DG + L DHE D+
Sbjct  363  FAVPPSWWVVQNKGMVKGKDGRWHLADHEEDD  394



>gb|EMT15519.1| Lipase [Aegilops tauschii]
Length=394

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 134/212 (63%), Gaps = 13/212 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPV  181
            +SAR Q+ +EV RL +LYK EE SIT+TGHSLG+ALAT++A D+  N  NK       PV
Sbjct  195  QSARYQVLDEVKRLQDLYKQEETSITITGHSLGAALATISATDIVSNGYNKT-----CPV  249

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            +AF FG P+VG+ +F+ AF +  +LR +R+ +  D+V   P         + Y   G   
Sbjct  250  SAFVFGSPRVGNSDFRKAFDSAEDLRLLRVRNSPDVVPNWP--------KLGYSDAGTEL  301

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
            +ID+ +S Y+K   + +  HD+  +MHG+ G QGS GGFE + D DI+ +NK+   LK E
Sbjct  302  MIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSNGGFELEVDRDIALVNKHEDALKKE  361

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            Y +P +W  V++KGMV+ +DG + L DHE D+
Sbjct  362  YSIPPSWWVVQNKGMVKGKDGRWHLADHEDDD  393



>ref|XP_004969328.1| PREDICTED: phospholipase A1-II 2-like [Setaria italica]
Length=425

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 129/214 (60%), Gaps = 11/214 (5%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQ---QDNN  172
            KSAR Q+  E+ARL++ YK EE SITV GHSLG+ LATLNA D+  N  NK+        
Sbjct  211  KSARMQVLTEIARLMDKYKDEETSITVVGHSLGATLATLNAADIVANACNKSSGFDDGRR  270

Query  173  VPVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVG  352
             PVTA  FG P+ GD+ F+D F     LRG+R+  V +    +P    VG     Y  VG
Sbjct  271  APVTAVVFGSPRTGDRAFRDVFHR---LRGLRMLRVRNKPDRIPHYPPVG-----YADVG  322

Query  353  VGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGL  532
            V  +ID+++S +LKP  +    HDL  H+HG+ G+QG  GGFE   + D++ +NK+   L
Sbjct  323  VELLIDTRRSPFLKPHGNESQSHDLEVHLHGVAGWQGDGGGFELVVERDVALVNKFDDCL  382

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
             DEY VPV W    +K MV+  DG ++L+DHE D
Sbjct  383  ADEYPVPVGWKVHHNKNMVKGPDGRWVLEDHEPD  416



>ref|XP_008449390.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=479

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 130/213 (61%), Gaps = 10/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVP  178
            SAR Q+  E+ +L+E ++ E+ISIT+TGHSLG+AL TLNA D+  N +NK   Q     P
Sbjct  272  SARQQVLSEIEKLLEEFQDEDISITITGHSLGAALGTLNATDIIANRINKGKKQPQKPCP  331

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF FG P VGD+NF+  F++   L  +R  +  D+V   P    + G    Y  VG  
Sbjct  332  VTAFLFGCPHVGDRNFRKTFNSMNELHLLRTRNKADIVPDYP----LTG----YAKVGEE  383

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
             IID++KSEYLK        H L  ++HG+ G QG+ GGF  +   DI+++NK    LK+
Sbjct  384  LIIDTRKSEYLKSPGGFKSWHSLEAYLHGVAGTQGNEGGFMLEVKRDIARVNKALNALKE  443

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            EY VP +W   ++KGMVQ  DG + LDDHE +E
Sbjct  444  EYLVPGSWWCAQNKGMVQDADGFWKLDDHETEE  476



>dbj|BAJ96485.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 134/212 (63%), Gaps = 13/212 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPV  181
            +SAR Q+ +EV RL +LYK EE SIT+TGHSLG+ALAT++A D+  N  NK       PV
Sbjct  195  QSARYQVLDEVERLQDLYKQEETSITITGHSLGAALATISATDIVSNGYNKT-----CPV  249

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            +AF FG P+VG+ +F+ AF +  +LR +R+ +  D+V   P         + Y   G   
Sbjct  250  SAFVFGSPRVGNSDFQKAFDSAEDLRLLRVRNSPDVVPNWP--------KLGYSDAGTEL  301

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
            +ID+ +S Y+K   + +  HD+  +MHG+ G QGS GGFE + D DI+ +NK+   LK E
Sbjct  302  MIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSNGGFELEVDRDIALVNKHEDALKKE  361

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            Y +P +W  V++KGMV+ +DG + L DHE D+
Sbjct  362  YSIPSSWWVVQNKGMVKGKDGRWHLADHEDDD  393



>ref|XP_003608122.1| Lipase [Medicago truncatula]
Length=387

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 133/213 (62%), Gaps = 27/213 (13%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SAR Q+  E++RL+ELYK EEISITVTGHSLG ALAT++++D+  N  N  K Q     P
Sbjct  191  SARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSMDIVANKFNIPKGQPQKTCP  250

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VT F FG P+VG+ NF+  FS+  +LR + I + ND+V                 ++ + 
Sbjct  251  VTLFAFGSPRVGNSNFEKIFSDNNDLRALFIRNNNDIVP---------------SSLRLA  295

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
            +      S+YLK G+     H++  ++HGI G QGS+GGF  + + DI+ LNK   GLKD
Sbjct  296  Y------SKYLKSGVS---EHNMEVYLHGIAGTQGSKGGFNLEVNRDIALLNKSNDGLKD  346

Query  539  EYHVPVAWMNVKDKGMVQQEDGTY-ILDDHEVD  634
            EYH+P  W  V++KGMVQQ DGT+ ++DDH  D
Sbjct  347  EYHIPENWRVVENKGMVQQSDGTWKLMDDHNDD  379



>ref|XP_003541709.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=421

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 131/213 (62%), Gaps = 10/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDN--NVP  178
            SAR Q+  EV RL+ELYK EEISIT+TGHSLG+A+ATLNAVD+  N  NK    +    P
Sbjct  216  SARSQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDIVTNGYNKPNDPSLKASP  275

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P+VGD NF+  FS   +L  +RI +  D+V   P    VG     Y  VG  
Sbjct  276  VTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPNYP---LVG-----YSDVGEE  327

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KS YLK   +    H+L  ++HG+ G QGS+GGF  +   DI+ +NK    LKD
Sbjct  328  LKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQGSKGGFNLEVHRDIALVNKTLDALKD  387

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            E  VPV+W   K+KGM QQ DG++ L DHE D+
Sbjct  388  ELLVPVSWRIEKNKGMFQQNDGSWKLMDHEEDD  420



>sp|A2WT95.2|PLA1_ORYSI RecName: Full=Phospholipase A1-II 1 [Oryza sativa Indica Group]
 sp|A2ZW16.2|PLA1_ORYSJ RecName: Full=Phospholipase A1-II 1 [Oryza sativa Japonica Group]
Length=393

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 134/212 (63%), Gaps = 13/212 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPV  181
            +SAR Q+  E+ RL ++Y+ EE SIT+TGHSLG+ALAT+NA D+  N  NK+      PV
Sbjct  195  QSARYQVLNEIKRLQDMYEHEETSITITGHSLGAALATINATDIVSNGYNKS-----CPV  249

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            +AF FG P+VG+ +F+ AF +  +LR +RI +  D+V   P         + Y   G   
Sbjct  250  SAFVFGSPRVGNPDFQKAFDSAPDLRLLRIRNSPDVVPNWP--------KLGYSDAGTEL  301

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
            +ID+ KS YLK   + +  HD+  +MHG+ G QGS GGF+ + D DI+ +NK+   LK+E
Sbjct  302  MIDTGKSPYLKAPGNPLTWHDMECYMHGVAGTQGSNGGFKLEIDRDIALVNKHEDALKNE  361

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            Y +P +W  V++KGMV+  DG + L DHE D+
Sbjct  362  YAIPSSWWVVQNKGMVKGTDGRWHLADHEDDD  393



>ref|XP_002456057.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
 gb|EES01177.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
Length=393

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 135/212 (64%), Gaps = 13/212 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPV  181
            +SAR Q+  EV R+ +LYK EE SI++TGHSLG+ALAT+NA+D+  N  N++      PV
Sbjct  195  ESARHQVLNEVKRIQDLYKTEETSISITGHSLGAALATINAIDIVSNGYNRS-----CPV  249

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            +AF FG P+VG+ +F++AF +  +LR +R+ +  D+V   P         + Y  VG   
Sbjct  250  SAFVFGSPRVGNPDFQEAFDSAADLRLLRVRNSPDVVPKWP--------KLGYSDVGTEL  301

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
             ID+ +S YLK   + +  HD+  +MHG+ G QGS GGFE   D DI+ +NK+   LK+E
Sbjct  302  RIDTGESPYLKSPGNPLTWHDMECYMHGVAGAQGSSGGFELAVDRDIALVNKHEDALKNE  361

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            + VP +W  V++K MV+ +DG + L DHE D+
Sbjct  362  FAVPSSWWVVQNKDMVKGKDGRWHLADHEDDD  393



>gb|KFK28527.1| hypothetical protein AALP_AA7G008200 [Arabis alpina]
Length=417

 Score =   174 bits (440),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 134/215 (62%), Gaps = 12/215 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            +ARDQ+  E+ RL+E YK EE+SI+V GHSLG+ALATLNA D+  N  N  KN+ D + P
Sbjct  205  NARDQVLREIGRLLEKYKDEEVSISVCGHSLGAALATLNAADIVANGYNRPKNRPDKSCP  264

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD +FK  FS   +LR +RI ++ D+V + P         + Y  VG  
Sbjct  265  VTAFVFASPRVGDSDFKKLFSGLEDLRVLRIRNLPDVVPIYP--------PLGYSEVGDE  316

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG--FEPKGDFDISKLNKYRQGL  532
              ID++KS Y+K   ++   H+L  ++HG+ G QG+     F      DI  +NK   GL
Sbjct  317  LQIDNRKSPYMKSPGNLSTFHNLEGYLHGVAGTQGTTKADLFRLDVKRDIGLVNKSVDGL  376

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            KDEY VP  W  +K+KGMVQ +DG++ L DHE+D+
Sbjct  377  KDEYMVPGYWRVLKNKGMVQLDDGSWKLLDHEIDD  411



>ref|XP_002525127.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37254.1| triacylglycerol lipase, putative [Ricinus communis]
Length=398

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 130/212 (61%), Gaps = 8/212 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVP  178
            S R+QI E +  L++ Y+ E+IS+TVTGHSLG+ALATL+AVD+  N +N+  +Q     P
Sbjct  192  SVREQIFETLKELVDKYENEDISVTVTGHSLGAALATLSAVDIVANGLNRSDDQASKACP  251

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+ GD  F++   +  +LR +R+++  D++  VP         I Y  VG  
Sbjct  252  VTAFVFACPRTGDLAFREVSDSFSDLRILRVTNTPDIIPKVP------PLAIGYRDVGQN  305

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              +DS+KS YLKP    +  H+L  +MH I G QG +  F  + + DI+ +NK    LKD
Sbjct  306  LELDSRKSTYLKPTGAFITWHNLEAYMHCIAGTQGGKPDFHLEVNRDIALVNKKLNSLKD  365

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
             Y VP AW   K KGMVQQEDG++ LDDHE D
Sbjct  366  IYLVPSAWWQEKHKGMVQQEDGSWKLDDHEDD  397



>dbj|BAA89335.1| EEF53 [Solanum melongena]
Length=200

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 131/205 (64%), Gaps = 13/205 (6%)
 Frame = +2

Query  26   EEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVTAFFFGGP  205
            EEV RL+E YK +E+SITVTGHSLG++LATLNAVD+A N +NK+      PVTAF F  P
Sbjct  1    EEVKRLVEEYKDDEVSITVTGHSLGASLATLNAVDIAYNGINKSSNGKEFPVTAFVFASP  60

Query  206  KVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFIIDSKKSE  385
            KVGD NF+ AFS    L+ + I  VN+L+ +VP    +G     Y  VG   +ID+ KS 
Sbjct  61   KVGDLNFQKAFS---KLKHLHILRVNNLLDIVPKYPPIG-----YFDVGQEILIDTTKSP  112

Query  386  YLK--PGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGLKDEYHVP  553
            YLK  PG D    H+L  ++HGIDG Q  G   GF+ + + D++ +N+    LKDEY VP
Sbjct  113  YLKLNPG-DPHTRHNLEGYLHGIDGTQGVGPLDGFKLEVNRDLALVNRIWDILKDEYLVP  171

Query  554  VAWMNVKDKGMVQQEDGTYILDDHE  628
             AW   K  GMVQQE+G +IL D E
Sbjct  172  GAWWVEKHNGMVQQENGKWILMDRE  196



>ref|XP_008225210.1| PREDICTED: phospholipase A1-IIgamma [Prunus mume]
Length=431

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/206 (45%), Positives = 130/206 (63%), Gaps = 9/206 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SAR Q+ EEV RL+E +K EEISIT+TGHSLG+A+ATLNAVD+  N VN  K Q +   P
Sbjct  222  SARYQVIEEVRRLVEQFKDEEISITITGHSLGAAIATLNAVDIVANGVNRPKEQPNKACP  281

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P+VGD NF+  FS   ++R +R+ +  D+V   P         + Y  VG  
Sbjct  282  VTAIVFASPRVGDSNFEKVFSGHKDVRALRVRNALDVVPNYP-------IPLGYSNVGEE  334

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KS+YLK    +   H+L  ++HG+ G QGS+GGF+ +   DI+ +NK    LK+
Sbjct  335  LAIDTRKSKYLKSPGGLASWHNLEGYLHGVAGTQGSKGGFKLEVKRDIALVNKSADDLKE  394

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYIL  616
            EY +P +W   K+K M Q +DG+++L
Sbjct  395  EYLIPASWRCEKNKCMTQLDDGSWVL  420



>ref|XP_004961147.1| PREDICTED: phospholipase A1-II 7-like [Setaria italica]
Length=406

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 128/211 (61%), Gaps = 10/211 (5%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNN--V  175
             SARDQ+ EEV RL+ LYK E  SITVTGHSLG++LATLNAVDLA N +N     +    
Sbjct  202  SSARDQVFEEVRRLMALYKDEVTSITVTGHSLGASLATLNAVDLAANGLNAPADSSQPPC  261

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            PVTAF +  P+VGD NFK+AF++  +LR + + +  D+V + P         + Y  V V
Sbjct  262  PVTAFVYASPRVGDANFKNAFASFPDLRALHVKNAGDVVPLYP--------PLGYVDVAV  313

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               ID+ +S YL+    I   H+L  ++HG+ G QGS GGF+ + D D++  NK    LK
Sbjct  314  PLPIDTGRSPYLRQPGTIPTRHNLECYLHGVAGEQGSAGGFKLEVDRDVALANKEEGALK  373

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            D+Y VP  W   K+K MV+  DG + L D +
Sbjct  374  DQYPVPADWWVAKNKFMVKGADGHWALQDFQ  404



>ref|XP_006362433.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=403

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 129/215 (60%), Gaps = 15/215 (7%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+ EEV +L+E YK EE+SITVTGHSLG+A+ATLNAVD+  N  NK       PVT
Sbjct  193  SARDQVLEEVKKLVEKYKNEEVSITVTGHSLGAAVATLNAVDIVYNGFNKTSNGKEFPVT  252

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            A  F  P VGD NF+ AFS   NL  +R+ ++ D+V   P         I Y  VG   +
Sbjct  253  ACVFASPNVGDLNFRVAFSKLKNLHILRVDNIVDIVPKYP--------PIGYIDVGEVLV  304

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGS-------RGGFEPKGDFDISKLNKYR  523
            ID+ KS+YLK   ++   H+L  ++HG+ G QG         G F+ + D DI+ +NK  
Sbjct  305  IDTAKSDYLKSPGNLQTWHNLEAYLHGVAGTQGVGILIGEFFGDFKLEVDRDIALVNKST  364

Query  524  QGLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
              LK EY VP  W   K+KGMVQ++D T++L D E
Sbjct  365  DALKGEYGVPANWWVEKNKGMVQKKDKTWVLMDRE  399



>ref|XP_010439839.1| PREDICTED: phospholipase A1-IIgamma-like [Camelina sativa]
Length=435

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 135/215 (63%), Gaps = 12/215 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            +ARDQ+  EV RL++ YK EE+SIT+ GHSLG+ALATLNA D+  N  N  K++ D + P
Sbjct  223  NARDQVLREVGRLLDKYKDEEVSITICGHSLGAALATLNAADIVANGYNRPKSRPDKSFP  282

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD +FK  FS   +LR +R  ++ D++ + P         I Y  VG  
Sbjct  283  VTAFVFASPRVGDSDFKKLFSGLEDLRVLRTRNLPDVIPIYP--------PIGYSEVGDE  334

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDF--DISKLNKYRQGL  532
              ID++KS+Y+K   ++   H L  ++HG+ G QG+    E + D   DI  +NK   GL
Sbjct  335  LPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADEFRLDVKRDIGLVNKSVDGL  394

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            KDE  VP  W  +K+KGMVQQ+DG++ L DHE+D+
Sbjct  395  KDECMVPGKWRVLKNKGMVQQDDGSWNLLDHEIDD  429



>ref|XP_009353256.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=439

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 132/212 (62%), Gaps = 13/212 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SAR Q+ EEV RL+E YK EEISIT+TGHSLG+A+ATL+A+D+  N +N  K+  +   P
Sbjct  231  SARHQVIEEVRRLVEQYKDEEISITITGHSLGAAIATLSAIDIVANGLNRPKDLPNKACP  290

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNIL--YEAVG  352
            VTA  F  P+VG+ NF+  FS   +LR +R+ +  D+V   P         I   Y  VG
Sbjct  291  VTAILFASPRVGNSNFEKVFSGYKDLRALRVRNALDVVPNYP---------IFFGYSDVG  341

Query  353  VGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGL  532
                ID++KS+YLK    +   H++  ++HG+ G QGS+ GF+ +   DI+ +NK    L
Sbjct  342  EELTIDTQKSKYLKSPGGVASWHNMEGYLHGVAGTQGSKRGFKLEVKRDIALVNKSTDAL  401

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            K+EY +P +W   K+K M Q EDG+++L DHE
Sbjct  402  KEEYLIPASWRCEKNKCMTQLEDGSWVLMDHE  433



>ref|XP_006362432.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=397

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 130/210 (62%), Gaps = 10/210 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            S RDQ+ +EV RL+E YK EE+SITVTGHSLG++LATLNAVD+  N +NK  +    PVT
Sbjct  192  SVRDQVIKEVKRLVEEYKHEEVSITVTGHSLGASLATLNAVDITFNGINKTSEGKEFPVT  251

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD  FK AF    +L  +RI ++ D+V   P         I Y  VG   +
Sbjct  252  AFAFASPKVGDLQFKAAFDKLKHLHVLRIHNLMDIVPKYP--------PIGYFDVGKELM  303

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGS--RGGFEPKGDFDISKLNKYRQGLKD  538
            ID+ KS Y+KP  + +  H L  ++HG+ G QG     GF+ + + DIS +NK    LKD
Sbjct  304  IDTTKSPYVKPPGEPLSWHLLEPYLHGVAGTQGLGIFAGFKLEVNRDISLVNKQWNILKD  363

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            EY +P  W   K KGMVQQEDG++++ D +
Sbjct  364  EYCIPGRWWVEKCKGMVQQEDGSWLMLDRD  393



>ref|XP_009108369.1| PREDICTED: phospholipase A1-IIgamma [Brassica rapa]
Length=434

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 132/215 (61%), Gaps = 12/215 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            +ARDQ+  E+ RL+E YK E+ISI++ GH LG+A+ATLNA D+  N  N  K++ D + P
Sbjct  222  NARDQVLREIGRLLEKYKDEKISISICGHILGAAIATLNAADIVANGYNRPKSRPDKSCP  281

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD +FK  FS   +LR +R+ ++ D+V + P         + Y  VG  
Sbjct  282  VTAFVFASPRVGDSDFKKLFSGLKDLRVLRVRNLPDVVPIYP--------PLGYAEVGDE  333

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG--FEPKGDFDISKLNKYRQGL  532
              ID++KS YLK   D+   H L  ++HG+ G QG+     F      DI  +NK   GL
Sbjct  334  LPIDTRKSPYLKSPGDLATFHCLEVYLHGLAGTQGTSKADLFRLDVKRDIGLVNKSVDGL  393

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            KDEY VP  W  +K+KGMVQQ DG++ L DHE+D+
Sbjct  394  KDEYMVPGHWRILKNKGMVQQNDGSWKLMDHEIDD  428



>sp|B9EYD3.2|PLA4_ORYSJ RecName: Full=Phospholipase A1-II 4 [Oryza sativa Japonica Group]
Length=396

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 129/212 (61%), Gaps = 11/212 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SAR+QI +E+ RL++ YK EE SITV GHSLG+A+ATLNA D+  N +N   Q    PVT
Sbjct  192  SAREQISDEIKRLMDKYKDEETSITVVGHSLGAAVATLNAADIVSNGLN---QHGACPVT  248

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            A  F  P+VGD  F+  F     LR +R+ +  D+V   P         + Y  VGV   
Sbjct  249  AVAFACPRVGDSGFRKLFDELPGLRLLRVCNSPDVVPKYP--------PMGYADVGVELP  300

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            +D+++S YLK   +  V H L  +MHG+ G QG RGGF+ + D D++ +NK    LK+EY
Sbjct  301  VDTRRSPYLKSPGNQAVWHSLECYMHGVAGAQGKRGGFKLEVDRDVALVNKNVDALKEEY  360

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHEVDET  640
            HVP +W   +DKGMV+  DG + L D+E +E+
Sbjct  361  HVPPSWSVQRDKGMVRGADGHWKLMDYEGEES  392



>ref|XP_007213350.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
 gb|EMJ14549.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
Length=402

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 130/206 (63%), Gaps = 9/206 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SAR Q+ EEV RL+E +K EEISIT+TGHSLG+A+ATLNAVD+  N VN  K Q +   P
Sbjct  193  SARYQVIEEVRRLVEQFKDEEISITITGHSLGAAIATLNAVDIVANGVNRPKEQPNKACP  252

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P+VGD NF+  FS   ++R +R+ +  D+V   P         + Y  VG  
Sbjct  253  VTAIVFASPRVGDSNFEKVFSGHKDVRTLRVRNALDVVPNYP-------IPLGYSNVGEE  305

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KS+YLK    +   H+L  ++HG+ G QGS+GGF+ +   DI+ +NK    L++
Sbjct  306  LAIDTRKSKYLKSPGGLASWHNLEGYLHGVAGTQGSKGGFKLEVKRDIALVNKSADDLEE  365

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYIL  616
            EY +P +W   K+K M Q +DG+++L
Sbjct  366  EYLIPASWRCEKNKCMTQLDDGSWVL  391



>gb|EMS52156.1| Phospholipase A1-II 2 [Triticum urartu]
Length=386

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 128/210 (61%), Gaps = 11/210 (5%)
 Frame = +2

Query  14   DQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKN---QQDNNVPVT  184
            +Q+  E+ARL++ YK E+ SITV GHSLG+ LATLNAVD+A N  NK+      +  PVT
Sbjct  177  EQVLTEIARLMDKYKDEQTSITVVGHSLGATLATLNAVDIAANYYNKSALCTAGSRAPVT  236

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            A  FG P+ GD +F+D F     LR +R+ +  D + + P    VG     Y  VGV  +
Sbjct  237  AVVFGSPRTGDHDFRDIFHRLPGLRMLRVRNRPDRIPLYP---PVG-----YADVGVELL  288

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            ID+++S +LKP  +    HDL  H+HG+ G+QG  G FE   D DI+ +NK+   L DE+
Sbjct  289  IDTRRSPFLKPHGNESQSHDLECHLHGVAGWQGEHGEFELVVDRDIALVNKFDDCLTDEH  348

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
             VPV W    +K MV+  DG ++L+DHE D
Sbjct  349  PVPVGWKVHHNKNMVKGPDGRWVLEDHESD  378



>ref|XP_002441554.1| hypothetical protein SORBIDRAFT_09g029230 [Sorghum bicolor]
 gb|EES19984.1| hypothetical protein SORBIDRAFT_09g029230 [Sorghum bicolor]
Length=361

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 126/211 (60%), Gaps = 11/211 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK---NQQDNNV  175
            SARDQ+  EV+RL+ LYK E  SITVTGHSLG++LATLNAVDLA N VN           
Sbjct  157  SARDQVLAEVSRLMALYKDEVTSITVTGHSLGASLATLNAVDLAANGVNAPPAGSAQPAC  216

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            PVTAF F  P+VGD NFK AF++  +LR + + +  D+V   P         + Y  V V
Sbjct  217  PVTAFVFASPRVGDGNFKRAFASFPDLRALHVKNAGDVVPTYP--------PLGYVDVAV  268

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I + +S YLK    I+  H+L  ++HG+ G QGS GGF+ + D D++  NK    LK
Sbjct  269  QLPIATGRSPYLKQPGTILTLHNLECYLHGVAGEQGSAGGFKLEVDRDVALANKGEDALK  328

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            ++Y VPV+W   K+  MV+  DG + L D E
Sbjct  329  NQYPVPVSWWVAKNNFMVKGTDGHWALQDFE  359



>ref|XP_006646154.1| PREDICTED: phospholipase A1-II 2-like [Oryza brachyantha]
Length=361

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 126/214 (59%), Gaps = 13/214 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN-----KNQQD  166
            +SAR Q+  E+ARL++ YK EE SITV GHSLG+ LATLNA D+A N  N     +   +
Sbjct  147  QSARMQVLTEIARLMDKYKDEERSITVIGHSLGATLATLNAADIAANSYNASGLGRAAGE  206

Query  167  NNVPVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEA  346
            +  PVTA  FG P+ GD++F+D F    +LR +R+ +  D +   P    VG     Y  
Sbjct  207  SRAPVTAVVFGSPRTGDRDFRDVFHRLPDLRMLRVRNRPDRIPHYP---PVG-----YAD  258

Query  347  VGVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQ  526
            VGV  +ID++ S +LKP       HDL  H+HG+ G+ G R  FE   D D++ +NK+  
Sbjct  259  VGVELLIDTRLSPFLKPHGSESQSHDLECHLHGVAGWHGDRRAFELVVDRDVALVNKFDD  318

Query  527  GLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
             L DEY VPV W    DK MV+  DG ++L DHE
Sbjct  319  CLADEYPVPVRWKVHHDKSMVKGPDGRWVLQDHE  352



>ref|XP_003569462.2| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At5g52630 [Brachypodium distachyon]
Length=990

 Score =   176 bits (446),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 89/212 (42%), Positives = 136/212 (64%), Gaps = 13/212 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPV  181
            +SAR Q+ +E+ RL ++YK EE SIT+TGHSLG+ALAT++A D+  N  N++      PV
Sbjct  792  QSARYQVLDEIKRLQDVYKQEETSITITGHSLGAALATISATDIVSNGYNQS-----CPV  846

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            +AF FG P+VG+ +F+ AF +  +LR +R+ +  D+V   P         + Y   G   
Sbjct  847  SAFVFGSPRVGNSDFQKAFDSADDLRLLRVENSPDVVPKWP--------KLGYSEAGTEL  898

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
            +ID+ +S Y+K   + +  HD+  +MHGI G QGS GGFE + D DI+ +NK+   LK+E
Sbjct  899  MIDTGESPYIKTPGNPLTWHDMECYMHGIAGTQGSNGGFELEVDRDIALVNKHEDALKNE  958

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            Y +P +W  +++KGMV+ +DG + L DHE D+
Sbjct  959  YSIPSSWWVMQNKGMVKGKDGRWHLADHEDDD  990



>emb|CDY53993.1| BnaA03g58180D [Brassica napus]
Length=351

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 133/215 (62%), Gaps = 12/215 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            +ARDQ+  E+ RL+E YK EE+SI++ GHSLG+ALATLNA D+  N  N  K++ D + P
Sbjct  139  NARDQVLREIGRLLEKYKDEEVSISICGHSLGAALATLNASDIVANGYNRPKSRPDKSCP  198

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD +++  FS   +LR +R+ ++ D+V + P         + Y  VG  
Sbjct  199  VTAFVFASPRVGDSDYRKLFSGLEDLRVLRVKNLPDVVPIYP--------PLGYAEVGEE  250

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG--FEPKGDFDISKLNKYRQGL  532
              ID++KS+Y+K   +    H L  ++HG+ G QG+     F      DI  +NK   GL
Sbjct  251  LSIDTRKSQYMKSPGNFATFHCLESYLHGVAGTQGTSKSDIFRLDVKRDIGLVNKSVDGL  310

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
             DE  VP  W  +K+KGMVQQ+DG+++L DHE+D+
Sbjct  311  TDECMVPGNWRVLKNKGMVQQDDGSWVLLDHEIDD  345



>ref|XP_006644443.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Oryza brachyantha]
Length=396

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 133/212 (63%), Gaps = 13/212 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPV  181
            +SAR Q+  E+ RL ++Y+ EE SIT+TGHSLG+ALAT++A D+  N  NK+      PV
Sbjct  198  QSARYQVLNEIKRLQDVYEHEETSITITGHSLGAALATISATDIVSNGYNKS-----CPV  252

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            + F FG P+VG+ +F+ AF +  +LR +RI +  D+V   P         + Y   G   
Sbjct  253  STFVFGSPRVGNSDFQKAFDSAPDLRLLRIRNSPDVVPNWP--------KLGYSDAGTEL  304

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
            +ID+ +S YLK   + +  HD+  +MHG+ G QGS GGF+ + D DIS +NK+   LK+E
Sbjct  305  MIDTGESPYLKAPGNPLTWHDMECYMHGVAGTQGSNGGFKLEIDRDISLVNKHEDALKNE  364

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            Y +P +W  V++KGMV+  DG + L DHE D+
Sbjct  365  YAIPSSWWVVQNKGMVKGTDGRWHLADHEDDD  396



>gb|KCW89613.1| hypothetical protein EUGRSUZ_A01896, partial [Eucalyptus grandis]
Length=330

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 138/213 (65%), Gaps = 11/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKN---QQDNNV  175
            SAR+Q+  EV RL++ YK EEISITV GHSLG+ALA+LNAVD+A N  N++   Q     
Sbjct  118  SAREQVLTEVQRLVDQYKDEEISITVAGHSLGAALASLNAVDIAWNGYNRSCGIQSQQPC  177

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            PVTAF +  P+VG+  F +  ++  +LR +R +++ D+V  VP           Y   G 
Sbjct  178  PVTAFVYASPRVGNLKFCNIANSIPSLRLLRTANLLDVVPKVPGAG--------YSDAGQ  229

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
              +I+++ S+YLK   +I   H +  ++HG+ G QG++GGF+ +   D++ +NK++  ++
Sbjct  230  ELLINTQLSKYLKNPGNISKWHSVETYLHGLAGTQGTKGGFKLEVKRDVALVNKHQSFVR  289

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            DEY VP  W  +K++GMVQ EDG++ L+DHE+D
Sbjct  290  DEYLVPDEWWVMKNRGMVQMEDGSWQLEDHEMD  322



>ref|XP_009131946.1| PREDICTED: phospholipase A1-IIgamma-like [Brassica rapa]
Length=435

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/216 (42%), Positives = 136/216 (63%), Gaps = 12/216 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            +ARDQ+ +E+ RL+E YK EE+SI++ GHSLG+ALATLNA D+  N  N  K++   + P
Sbjct  223  NARDQVLQELGRLLEKYKDEEVSISICGHSLGAALATLNATDIVANGYNRPKSRLGKSCP  282

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VG+  +K  FS   ++R +R+ ++ D+V + P         + Y  VG  
Sbjct  283  VTAFVFASPRVGNSEYKKLFSGLEDIRVLRVRNLPDVVPIYP--------PLGYAEVGDE  334

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG--FEPKGDFDISKLNKYRQGL  532
            F ID++KS+Y+K   +    H L  ++HG+ G QG+     F      DI  +NK   GL
Sbjct  335  FPIDTRKSQYMKTPGNFATFHCLESYLHGVAGTQGTSSADLFRLDVKRDIGLVNKSVDGL  394

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDET  640
            KD+Y +P  W  +K+KGMVQQ+DG+++L DHE+D++
Sbjct  395  KDQYMIPGHWRVLKNKGMVQQDDGSWVLLDHEIDDS  430



>ref|XP_010696586.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=432

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 131/214 (61%), Gaps = 11/214 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SARDQ+  E+  L+E YK EEISIT+TGHS+G+ALATLNAVDL  N +N  K+   N   
Sbjct  220  SARDQVLLEIQSLMEQYKNEEISITITGHSMGAALATLNAVDLVANNINIPKSSPKNPCL  279

Query  179  VTAFFFGGPKVGDQNFKDAFSNQG-NLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            VTA  F  P+VGD NFK+  S    +L+ +R+ +  D+V   P         I Y  VG 
Sbjct  280  VTAILFASPRVGDFNFKNIISKYDHSLKLLRVCNALDVVLHYP--------PIGYCHVGK  331

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               ID+ +S YLK   +    H+   ++HGI G QGS   F+   D D+S LNK+   LK
Sbjct  332  ELSIDTIRSPYLKFPGNFWTWHNSEAYLHGIAGGQGSEEEFKLVVDRDLSLLNKHWDNLK  391

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            DEY +P  W  +++KGMVQQ DG+++L DHE+D+
Sbjct  392  DEYLIPAFWWTLRNKGMVQQSDGSWLLMDHEMDD  425



>ref|XP_004232962.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 130/210 (62%), Gaps = 10/210 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            S RDQ+ +EV RL+E YK EE+SITVTGHSLG++LAT+NAVD+A N +NK       PVT
Sbjct  192  SVRDQVIKEVKRLVEEYKDEEVSITVTGHSLGASLATMNAVDIAFNKINKASNGKEFPVT  251

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  PKVGD  FK  F    +L  +RI ++ D+V   P         I Y  VG   +
Sbjct  252  AFAFASPKVGDIQFKATFDKLKHLHILRIHNLLDIVPKYP--------PIGYFDVGKELM  303

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGLKD  538
            ID+ KS Y+KP  + +  H L  ++HG+ G Q  G   GF+ + + DIS +NK    LKD
Sbjct  304  IDTTKSPYVKPPGENVSWHLLEPYLHGVAGTQGLGLFAGFKLEVNRDISLVNKQWNILKD  363

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            EY +P  W   K+KGMVQQEDG++++ D +
Sbjct  364  EYCIPGMWWVEKNKGMVQQEDGSWLMLDRD  393



>gb|EMS63185.1| Phospholipase A1-II 1 [Triticum urartu]
Length=797

 Score =   174 bits (440),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 134/212 (63%), Gaps = 13/212 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPV  181
            +SAR Q+ +EV RL +LYK EE SIT+TGHSLG+ALAT++A D+  N  NK       PV
Sbjct  598  QSARYQVLDEVERLQDLYKQEETSITITGHSLGAALATISATDIVSNGYNKT-----CPV  652

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            +AF FG P+VG+ +F+ AF +  +LR +R+ +  D+V   P         + Y   G   
Sbjct  653  SAFVFGSPRVGNSDFQKAFDSAEDLRLLRVRNSPDVVPNWP--------KLGYSDAGTEL  704

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
            +ID+ +S Y+K   + +  HD+  +MHG+ G QGS GGFE + D DI+ +NK+   LK E
Sbjct  705  MIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSNGGFELEVDRDIALVNKHEDALKKE  764

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            Y +P +W  V++KGMV+ +DG + L DHE D+
Sbjct  765  YSIPPSWWVVQNKGMVKGKDGRWHLADHEDDD  796



>ref|XP_003566945.1| PREDICTED: phospholipase A1-II 2-like [Brachypodium distachyon]
Length=410

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 125/207 (60%), Gaps = 10/207 (5%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNN--V  175
            +SAR Q+  E+ARL++ YK EE SITV GHSLG+ LATLNAVD+A N  N+   +     
Sbjct  195  QSARMQVLTEIARLMDKYKDEETSITVIGHSLGATLATLNAVDIAANSYNRFALNGRRAT  254

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            PVTA  FG P+ GD++F+DAF     LR +R+ +  D + + P    VG     Y  VGV
Sbjct  255  PVTAVVFGSPRTGDRDFRDAFHRVPGLRMLRVRNRPDRIPLYP---PVG-----YADVGV  306

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
              +ID+++S +LKP       HDL  H+HGI G+ G  G FE   D D++ +NK+   L 
Sbjct  307  ELLIDTRRSPFLKPHGSESQSHDLECHLHGIAGWHGEHGAFELVVDRDVALVNKFDDCLA  366

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYIL  616
            DEY VPV W    +K MV+  DG ++L
Sbjct  367  DEYPVPVGWKVNHNKNMVKGRDGRWVL  393



>emb|CDY01554.1| BnaC07g35440D [Brassica napus]
Length=433

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 133/215 (62%), Gaps = 12/215 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            +ARDQ+  E+ RL+E YK EE+SI++ GHSLG+ALATLNA D+  N  N  K++ D + P
Sbjct  221  NARDQVLREIGRLLEKYKDEEVSISICGHSLGAALATLNATDIVANGYNRPKSRPDKSCP  280

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD +++  FS   +LR +R+ ++ D+V + P         + Y  VG  
Sbjct  281  VTAFVFASPRVGDSDYRKLFSGFEDLRVLRVKNLPDIVPIYP--------PLGYAEVGEE  332

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG--FEPKGDFDISKLNKYRQGL  532
              ID++KS+Y+K   +    H L  ++HG+ G QG+     F      DI  +NK   GL
Sbjct  333  LSIDTRKSQYMKSPGNFATFHCLESYLHGVAGTQGTSKNDIFRLDVKRDIGLVNKSVDGL  392

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
             DE  VP  W  +K+KGMVQQ+DG+++L DHE+D+
Sbjct  393  TDECMVPGNWRVLKNKGMVQQDDGSWVLLDHEIDD  427



>ref|XP_006282609.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
 gb|EOA15507.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
Length=440

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 131/215 (61%), Gaps = 12/215 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            +AR+Q+  EV RL++ YK EE+SIT+ GHSLG+ALATLNA D+  N  N  K++ D   P
Sbjct  228  NAREQVLREVGRLLDRYKDEEVSITICGHSLGAALATLNAADIVANGYNRPKSRPDKACP  287

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD +FK  F    NLR +R  ++ D++ + P         I Y  VG  
Sbjct  288  VTAFVFASPRVGDSDFKKLFYGLENLRVLRTRNLPDVIPIYP--------PIGYSEVGDE  339

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG--FEPKGDFDISKLNKYRQGL  532
              ID++KS+Y+K   ++  +H L  ++HG+ G QG+     F      DI  +NK   GL
Sbjct  340  LPIDTRKSQYMKSPGNLASYHCLEAYLHGVAGTQGTAKADIFRLDVKRDIGLVNKSVDGL  399

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            KDE  VP  W  +K+KGMVQQ+DG++ L DHE D+
Sbjct  400  KDECMVPGKWRVLKNKGMVQQDDGSWKLLDHETDD  434



>gb|EPS68355.1| hypothetical protein M569_06415, partial [Genlisea aurea]
Length=197

 Score =   162 bits (410),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 129/209 (62%), Gaps = 14/209 (7%)
 Frame = +2

Query  17   QIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVTAFFF  196
            Q+ EEV+RLIE Y+ EE SITV GHSLG+A++T+NAVD+  N  NK+      PVTAF F
Sbjct  1    QVLEEVSRLIEEYRNEETSITVVGHSLGAAISTVNAVDIVANGRNKSS-----PVTAFLF  55

Query  197  GGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFIIDSK  376
            G P++GD  F  A +    LR +R+ +  D+V   P         +LY  VG    ID+ 
Sbjct  56   GSPRIGDYRFSRAVAALDGLRVLRVRNARDVVPAYP-------PPLLYFDVGQELAIDTD  108

Query  377  KSEYLKPGLDIMVHHDLMFHMHGIDGFQ--GSRGGFEPKGDFDISKLNKYRQGLKDEYHV  550
            +SEYLK   +++  H+L  ++HG+ G Q  G  GGF  + D  +  +NK    LKDEY V
Sbjct  109  RSEYLKLPGNVLTWHNLEVYLHGVAGTQGGGGGGGFRLEVDRFVGLVNKRYDFLKDEYCV  168

Query  551  PVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            PV+W   K+KGMVQ EDG+++L DH+ DE
Sbjct  169  PVSWWCEKNKGMVQMEDGSWMLVDHDDDE  197



>ref|XP_010070312.1| PREDICTED: phospholipase A1-II 1 [Eucalyptus grandis]
Length=422

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 138/213 (65%), Gaps = 11/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKN---QQDNNV  175
            SAR+Q+  EV RL++ YK EEISITV GHSLG+ALA+LNAVD+A N  N++   Q     
Sbjct  210  SAREQVLTEVQRLVDQYKDEEISITVAGHSLGAALASLNAVDIAWNGYNRSCGIQSQQPC  269

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            PVTAF +  P+VG+  F +  ++  +LR +R +++ D+V  VP           Y   G 
Sbjct  270  PVTAFVYASPRVGNLKFCNIANSIPSLRLLRTANLLDVVPKVPGAG--------YSDAGQ  321

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
              +I+++ S+YLK   +I   H +  ++HG+ G QG++GGF+ +   D++ +NK++  ++
Sbjct  322  ELLINTQLSKYLKNPGNISKWHSVETYLHGLAGTQGTKGGFKLEVKRDVALVNKHQSFVR  381

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            DEY VP  W  +K++GMVQ EDG++ L+DHE+D
Sbjct  382  DEYLVPDEWWVMKNRGMVQMEDGSWQLEDHEMD  414



>ref|XP_008647947.1| PREDICTED: triacylglycerol lipase isoform X1 [Zea mays]
 gb|ACN26514.1| unknown [Zea mays]
 gb|AFW79274.1| triacylglycerol lipase [Zea mays]
Length=402

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 123/211 (58%), Gaps = 11/211 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNN---V  175
            SARDQ+  EV+RL+ LYK E  SITV GHSLG++LATLNAVDLA N VN     ++    
Sbjct  198  SARDQVLAEVSRLVALYKDEVTSITVCGHSLGASLATLNAVDLAANGVNAPPAGSSQPPC  257

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            PVTA  F  P+VGD NFK A ++  +LR + + +  D+V   P         + Y  V V
Sbjct  258  PVTALVFASPRVGDGNFKRAIASFPDLRALHVKNAGDIVPTYP--------PLGYVDVAV  309

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I + +S YL+    I   H+L  ++HG+ G QGS GGF  + D D++ +NK    LK
Sbjct  310  QLPIATGRSPYLRQPGTIATLHNLECYLHGVAGEQGSAGGFRLEVDRDVALVNKGEDALK  369

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            D+Y VP  W   K+K MV+  DG Y L D E
Sbjct  370  DQYPVPAQWWVAKNKCMVKGADGHYALQDFE  400



>ref|XP_006414089.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
 gb|ESQ55542.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
Length=436

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 131/215 (61%), Gaps = 12/215 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            +ARDQ+  E+ RL+E YK EE+SITV GHSLG+ALATLNA D+  N  N  K++ D + P
Sbjct  224  NARDQVLREIGRLLEKYKEEEVSITVCGHSLGAALATLNATDIVANGYNRPKSRPDKSCP  283

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD +F   F    +LR +RI ++ D+V + P         + Y  VG  
Sbjct  284  VTAFVFASPRVGDSDFMKLFYGLQDLRVLRIRNLPDVVPIYP--------PLGYAEVGDE  335

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG--FEPKGDFDISKLNKYRQGL  532
              ID++KS+Y+K   +    H L  ++HG+ G QG+     F      DI  +NK   GL
Sbjct  336  LPIDTRKSQYMKSPGNFATFHCLEAYLHGVAGTQGTAKSDLFRLDVKRDIGLVNKSVDGL  395

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            KDE  +P  W  +K+KGMVQQ+DG++ L DHE+D+
Sbjct  396  KDECMIPGHWRVLKNKGMVQQDDGSWKLLDHEIDD  430



>ref|NP_001151242.1| triacylglycerol lipase [Zea mays]
 gb|ACG42106.1| triacylglycerol lipase [Zea mays]
Length=402

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 123/211 (58%), Gaps = 11/211 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNN---V  175
            SARDQ+  EV+RL+ LYK E  SITV GHSLG++LATLNAVDLA N VN     ++    
Sbjct  198  SARDQVLAEVSRLVALYKDEVTSITVCGHSLGASLATLNAVDLAANGVNAPPAGSSQPPC  257

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            PVTA  F  P+VGD NFK A ++  +LR + + +  D+V   P         + Y  V V
Sbjct  258  PVTALVFASPRVGDGNFKRAIASFPDLRALHVKNAGDIVPTYP--------PLGYVDVAV  309

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I + +S YL+    I   H+L  ++HG+ G QGS GGF  + D D++ +NK    LK
Sbjct  310  QLPIATGRSPYLRQPGTIATLHNLECYLHGVAGEQGSAGGFRLEVDRDVALVNKGEDALK  369

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            D+Y VP  W   K+K MV+  DG Y L D E
Sbjct  370  DQYPVPAQWWVAKNKCMVKGADGHYALQDFE  400



>ref|XP_011027708.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
 ref|XP_011015585.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=396

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/207 (45%), Positives = 129/207 (62%), Gaps = 6/207 (3%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKN--QQDNNVP  178
            SARDQ+   V++L+E YK EEISITVTGHSLG+A+ATLNA+D+ V   NK   +Q+   P
Sbjct  189  SARDQVLAAVSKLVEQYKDEEISITVTGHSLGAAIATLNALDIVVKGCNKTTGEQNKAFP  248

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P+VGD NFK     Q +L  +R+++  D+V  +P           ++ VG  
Sbjct  249  VTAIVFASPRVGDANFKKLCEGQEDLHVLRVTNERDIVPNLPLDMP---PYFSFKHVGEE  305

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KS Y+K   D+   H+L  ++HG+ G QGS GGF  + D DI+ +NK   GLKD
Sbjct  306  LRIDTRKSPYVKSMDDLGDFHNLELYIHGVAGTQGSEGGFNLEVDRDIALVNKDLDGLKD  365

Query  539  EYHVPVAWMNVKD-KGMVQQEDGTYIL  616
            EY +P  W  ++D KGMV  +DG + L
Sbjct  366  EYKIPAGWWGIEDNKGMVLGDDGRWKL  392



>emb|CBI21954.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 132/216 (61%), Gaps = 16/216 (7%)
 Frame = +2

Query  2    KSARDQIREEV-ARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNN  172
            +SARDQ+   +  RL++ YK EEISIT+TGHSLG+AL TL A D+  N  NK  N+   +
Sbjct  190  QSARDQVYIYIPTRLVDKYKDEEISITITGHSLGAALGTLCAADIVANKFNKPKNKPQKS  249

Query  173  VPVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVG  352
             PVTAF FG P+VGD NF++   +  NL  +R+++V D+VT +P           Y  VG
Sbjct  250  CPVTAFLFGSPRVGDLNFRNMLLSLENLHLIRVTNVPDIVTTLP-------PEGYYSEVG  302

Query  353  VGFIIDSKKSEYLK-PGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQG  529
               +ID++ S +LK PG      H L  H+HG+ G QGS+GGF  + D  I+ +NK    
Sbjct  303  QELVIDTRFSNFLKFPGC-YDTWHSLEAHLHGVAGTQGSKGGFHLEVDRSIALVNKMLDA  361

Query  530  LKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            LKDEY VP +W  +++KGM     G++ L DHE D+
Sbjct  362  LKDEYPVPASWWCMRNKGM----KGSWELKDHEKDD  393



>ref|NP_193590.1| phospholipase A1-IIgamma [Arabidopsis thaliana]
 sp|O49523.1|DSEL_ARATH RecName: Full=Phospholipase A1-IIgamma; AltName: Full=DAD1-like 
seedling establishment-related lipase; Short=AtDSEL; Short=Phospholipase 
DSEL [Arabidopsis thaliana]
 emb|CAA16735.1| lipase-like protein [Arabidopsis thaliana]
 emb|CAB78857.1| lipase-like protein [Arabidopsis thaliana]
 gb|ABN04794.1| At4g18550 [Arabidopsis thaliana]
 gb|AEE84060.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=419

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 132/215 (61%), Gaps = 12/215 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            +ARDQ+  EV RL+E YK EE+SIT+ GHSLG+ALATL+A D+  N  N  K++ D + P
Sbjct  207  NARDQVLREVGRLLEKYKDEEVSITICGHSLGAALATLSATDIVANGYNRPKSRPDKSCP  266

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD +F+  FS   ++R +R  ++ D++ + P         I Y  VG  
Sbjct  267  VTAFVFASPRVGDSDFRKLFSGLEDIRVLRTRNLPDVIPIYP--------PIGYSEVGDE  318

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG--FEPKGDFDISKLNKYRQGL  532
            F ID++KS Y+K   ++   H L  ++HG+ G QG+     F    +  I  +NK   GL
Sbjct  319  FPIDTRKSPYMKSPGNLATFHCLEGYLHGVAGTQGTNKADLFRLDVERAIGLVNKSVDGL  378

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            KDE  VP  W  +K+KGM QQ+DG++ L DHE+D+
Sbjct  379  KDECMVPGKWRVLKNKGMAQQDDGSWELVDHEIDD  413



>ref|XP_006644442.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Oryza brachyantha]
Length=397

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 133/213 (62%), Gaps = 14/213 (7%)
 Frame = +2

Query  2    KSAR-DQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVP  178
            +SAR  Q+  E+ RL ++Y+ EE SIT+TGHSLG+ALAT++A D+  N  NK+      P
Sbjct  198  QSARYQQVLNEIKRLQDVYEHEETSITITGHSLGAALATISATDIVSNGYNKS-----CP  252

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            V+ F FG P+VG+ +F+ AF +  +LR +RI +  D+V   P         + Y   G  
Sbjct  253  VSTFVFGSPRVGNSDFQKAFDSAPDLRLLRIRNSPDVVPNWP--------KLGYSDAGTE  304

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
             +ID+ +S YLK   + +  HD+  +MHG+ G QGS GGF+ + D DIS +NK+   LK+
Sbjct  305  LMIDTGESPYLKAPGNPLTWHDMECYMHGVAGTQGSNGGFKLEIDRDISLVNKHEDALKN  364

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            EY +P +W  V++KGMV+  DG + L DHE D+
Sbjct  365  EYAIPSSWWVVQNKGMVKGTDGRWHLADHEDDD  397



>emb|CDX99456.1| BnaC01g10960D [Brassica napus]
Length=402

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 131/213 (62%), Gaps = 12/213 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            +ARDQ+ +E+ RL+E YK EE+SI++ GHSLG+ALATLNA D+  N  N  K++   + P
Sbjct  190  NARDQVLQELGRLLEKYKDEEVSISICGHSLGAALATLNATDIVANGYNRPKSRPGKSCP  249

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VG+  +K  FS   ++R +R+ ++ D+V + P         + Y  VG  
Sbjct  250  VTAFVFASPRVGNSEYKKLFSRLEDIRVLRVRNLPDVVPIYP--------PLGYAEVGDE  301

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG--FEPKGDFDISKLNKYRQGL  532
              ID++KS+Y+K   +    H L  ++HG+ G QG+  G  F       I  +NK   GL
Sbjct  302  LPIDTRKSQYMKTPGNFATFHCLESYLHGVAGTQGTSSGDLFRLDVKRAIGLVNKSVDGL  361

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEV  631
            KDEY VP  W  +K+KGMVQQ+DG++IL DHE 
Sbjct  362  KDEYMVPGHWRVLKNKGMVQQDDGSWILLDHET  394



>ref|XP_010657149.1| PREDICTED: phospholipase A1-IIgamma-like [Vitis vinifera]
Length=407

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 97/227 (43%), Positives = 133/227 (59%), Gaps = 27/227 (12%)
 Frame = +2

Query  2    KSARDQI------------REEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNP  145
            +SARDQ+              EV RL++ YK EEISIT+TGHSLG+AL TL A D+  N 
Sbjct  190  QSARDQVIVGICAHKQMRFLSEVKRLVDKYKDEEISITITGHSLGAALGTLCAADIVANK  249

Query  146  VNK--NQQDNNVPVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQV  319
             NK  N+   + PVTAF FG P+VGD NF++   +  NL  +R+++V D+VT +P     
Sbjct  250  FNKPKNKPQKSCPVTAFLFGSPRVGDLNFRNMLLSLENLHLIRVTNVPDIVTTLP-----  304

Query  320  GGKNILYEAVGVGFIIDSKKSEYLK-PGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDF  496
                  Y  VG   +ID++ S +LK PG      H L  H+HG+ G QGS+GGF  + D 
Sbjct  305  --PEGYYSEVGQELVIDTRFSNFLKFPGC-YDTWHSLEAHLHGVAGTQGSKGGFHLEVDR  361

Query  497  DISKLNKYRQGLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
             I+ +NK    LKDEY VP +W  +++KGM     G++ L DHE D+
Sbjct  362  SIALVNKMLDALKDEYPVPASWWCMRNKGM----KGSWELKDHEKDD  404



>ref|XP_006852476.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
 gb|ERN13943.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
Length=398

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 131/215 (61%), Gaps = 10/215 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SAR+Q+  EV RL+E YK EE+SIT+TGHSLG+AL TLNA+D+  N  N  K +    +P
Sbjct  192  SAREQVMSEVRRLVEAYKDEEMSITITGHSLGAALTTLNAIDIVANGTNIPKGRPGTQIP  251

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VT   F  P+VG+  FK  F     L+ +R+++  D+V   P         I Y+ VGV 
Sbjct  252  VTGIVFASPRVGNTEFKKRFEGSQGLKLLRVTNALDIVPNYPL--------ISYDDVGVN  303

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KS++LK  +     H+L  ++HG+ G QG +GGF+ +   DI+ +NK    LK 
Sbjct  304  LGIDTRKSDFLKSPVGPSGVHNLEIYLHGVAGTQGKKGGFKLEIPRDIALVNKSLDVLKV  363

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDETF  643
            +Y VP +W   K+KGMVQ  DG++ L DHE ++ F
Sbjct  364  DYTVPASWKVEKNKGMVQLPDGSWKLMDHENEDGF  398



>ref|XP_002867985.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44244.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=418

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 131/215 (61%), Gaps = 12/215 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            +ARDQ+  E+ RL+E YK EE+SIT+ GHSLG+ALATLNA D+  N  N  K++ D + P
Sbjct  206  NARDQVLRELGRLLEKYKDEEVSITICGHSLGAALATLNATDIVANGYNRPKSRPDKSCP  265

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD +FK   S   ++R +R  ++ D++ + P         I Y  VG  
Sbjct  266  VTAFVFASPRVGDSDFKKLLSILEDMRVLRTRNLPDVIPIYP--------PIGYSEVGDE  317

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG--FEPKGDFDISKLNKYRQGL  532
              ID++KS+Y+K   ++   H L  ++HG+ G QG+     F       I  +NK   GL
Sbjct  318  LPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADLFRLDVKRAIGLVNKSVDGL  377

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            KDE  VP  W  +K+KGMVQQ+DG++ L DHE+D+
Sbjct  378  KDECMVPGKWRVLKNKGMVQQDDGSWKLLDHEIDD  412



>ref|NP_001152663.1| triacylglycerol lipase precursor [Zea mays]
 gb|ACF88339.1| unknown [Zea mays]
 gb|ACG48810.1| triacylglycerol lipase [Zea mays]
 gb|AFW83435.1| Triacylglycerol lipase [Zea mays]
Length=430

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 131/214 (61%), Gaps = 13/214 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN-KNQQDNNVP  178
            +SAR+Q+  E+ RL++ YKGE  SIT+TGHSLG+AL+TL A+D+  N +N +   ++ VP
Sbjct  219  QSAREQVLAEIRRLLDAYKGENCSITLTGHSLGAALSTLTAIDIVANGLNVRGPNNDTVP  278

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLV-TMVPWGSQVGGKNILYEAVGV  355
            V A  FG P+VGD  FK AF +    R +R+ +  D+V T++P        N  Y+ VGV
Sbjct  279  VAAIVFGSPRVGDDQFKKAFDSTPGARLLRVRNAPDVVPTVLP--------NAFYKDVGV  330

Query  356  GFIIDSKKSEYLK-PGLDIMVHHDLMFHMHGIDGFQGS--RGGFEPKGDFDISKLNKYRQ  526
              ++D++KS +LK PG      H+L  ++HG+ G QG+    GF  + D D++ +NK   
Sbjct  331  ELLLDTRKSPHLKRPGPGPAAWHNLECYLHGVAGTQGAGDAAGFSLEVDRDVALVNKEVD  390

Query  527  GLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
             L D+Y VP AW    +KGM +   G ++L DHE
Sbjct  391  ALSDDYPVPAAWWVEGNKGMTRDASGRWVLQDHE  424



>ref|XP_010434518.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Camelina 
sativa]
 ref|XP_010434519.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Camelina 
sativa]
Length=435

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 131/215 (61%), Gaps = 12/215 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            +ARDQ+  EV RL++ YK EE+SIT+ GHSLG+ALATLNA D+  N  N  K++ D + P
Sbjct  223  NARDQVLREVGRLLDKYKDEEVSITICGHSLGAALATLNAADIVANGYNRPKSRPDKSFP  282

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD +FK  FS   +LR +R  ++ D++ + P         I Y  VG  
Sbjct  283  VTAFVFASPRVGDSDFKKLFSGLEDLRVLRTRNLPDVIPIYP--------PIGYSEVGDE  334

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG--FEPKGDFDISKLNKYRQGL  532
              ID++KS+Y+K   ++   H L  ++HG+ G QG+     F      D+  +NK   GL
Sbjct  335  IPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADLFRLDVKRDVGLVNKSVDGL  394

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
              E  VP  W  +K+KGMVQQ+DG++ L DHE+D+
Sbjct  395  NVECMVPGKWRVLKNKGMVQQDDGSWKLLDHEIDD  429



>sp|A2WT96.2|PLA2_ORYSI RecName: Full=Phospholipase A1-II 2 [Oryza sativa Indica Group]
Length=403

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 124/213 (58%), Gaps = 12/213 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQ----DN  169
            +SAR Q+  E+ARL++ YK EE SITV GHSLG+ LATLNA D+A N  N +      + 
Sbjct  188  QSARMQVLTEIARLMDKYKDEETSITVIGHSLGATLATLNAADIAANSYNTSSLSPSGET  247

Query  170  NVPVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAV  349
              PVTA  FG P+ GD+ F+DAF    +LR +R+ +  D +   P    VG     Y  V
Sbjct  248  RAPVTAVVFGSPRTGDRGFRDAFHRLRDLRMLRVRNRPDRIPHYP---PVG-----YADV  299

Query  350  GVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQG  529
            GV  +ID++ S +L+        HDL  H+HG+ G+ G   GFE   D D++ +NK+   
Sbjct  300  GVELLIDTRLSPFLRRHGSESQSHDLECHLHGVAGWHGDHRGFELVVDRDVALVNKFDDC  359

Query  530  LKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            L DEY VPV W    +K MV+  DG ++L DHE
Sbjct  360  LADEYPVPVRWKVHHNKSMVKGPDGRWVLQDHE  392



>ref|NP_001043730.2| Os01g0651200 [Oryza sativa Japonica Group]
 sp|Q0JKT4.1|PLA2_ORYSJ RecName: Full=Phospholipase A1-II 2 [Oryza sativa Japonica Group]
 dbj|BAF05644.2| Os01g0651200 [Oryza sativa Japonica Group]
Length=408

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 124/213 (58%), Gaps = 12/213 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQ----DN  169
            +SAR Q+  E+ARL++ YK EE SITV GHSLG+ LATLNA D+A N  N +      + 
Sbjct  193  QSARMQVLTEIARLMDKYKDEETSITVIGHSLGATLATLNAADIAANSYNTSSLSPSGET  252

Query  170  NVPVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAV  349
              PVTA  FG P+ GD+ F+DAF    +LR +R+ +  D +   P    VG     Y  V
Sbjct  253  RAPVTAVVFGSPRTGDRGFRDAFHRLRDLRMLRVRNRPDRIPHYP---PVG-----YADV  304

Query  350  GVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQG  529
            GV  +ID++ S +L+        HDL  H+HG+ G+ G   GFE   D D++ +NK+   
Sbjct  305  GVELLIDTRLSPFLRRHGSESQSHDLECHLHGVAGWHGDHRGFELVVDRDVALVNKFDDC  364

Query  530  LKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            L DEY VPV W    +K MV+  DG ++L DHE
Sbjct  365  LADEYPVPVRWKVHHNKSMVKGPDGRWVLQDHE  397



>ref|XP_002440467.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
 gb|EES18897.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
Length=408

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 130/212 (61%), Gaps = 12/212 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQ---QDNNV  175
            SARDQ+ EEV RL+ELYK EE+SIT+TGHSLG+A++ LNAVD+  N VN           
Sbjct  203  SARDQVFEEVRRLVELYKDEELSITITGHSLGAAISILNAVDIVSNGVNVPAGGGGSAAC  262

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            PVTAF F  P VGD+ F+ AF +  +LR + + +  D+V M P         + Y  V V
Sbjct  263  PVTAFVFACPHVGDRFFRAAFHSFRDLRALHVKNAGDVVPMYP--------PLAYVDVAV  314

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I++ +S YLK    ++  H+L  ++HG+ G QGS GGF+ +   D++ +NK    LK
Sbjct  315  TLNINTGRSPYLKWPGTVLTLHNLECYLHGVAGEQGSAGGFKLEVKRDVALVNKGADALK  374

Query  536  DEYHVPVAWMNVKDKGMVQQE-DGTYILDDHE  628
            DEY VP +W  +++KGMV+ + DG   L+D +
Sbjct  375  DEYPVPASWWALENKGMVKDDADGLLKLNDFQ  406



>pdb|2YIJ|A Chain A, Crystal Structure Of Phospholipase A1
 pdb|2YIJ|B Chain B, Crystal Structure Of Phospholipase A1
Length=419

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 130/215 (60%), Gaps = 12/215 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            +ARDQ+  EV RL+E YK EE+SIT+ GHSLG+ALATL+A D+  N  N  K++ D + P
Sbjct  207  NARDQVLREVGRLLEKYKDEEVSITICGHSLGAALATLSATDIVANGYNRPKSRPDKSCP  266

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD +F+  FS   ++R +R  ++ D++ + P         I Y  VG  
Sbjct  267  VTAFVFASPRVGDSDFRKLFSGLEDIRVLRTRNLPDVIPIYP--------PIGYSEVGDE  318

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG--FEPKGDFDISKLNKYRQGL  532
            F ID++KS Y K   ++   H L  ++HG+ G QG+     F    +  I  +NK   GL
Sbjct  319  FPIDTRKSPYXKSPGNLATFHCLEGYLHGVAGTQGTNKADLFRLDVERAIGLVNKSVDGL  378

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            KDE  VP  W  +K+KG  QQ+DG++ L DHE+D+
Sbjct  379  KDECXVPGKWRVLKNKGXAQQDDGSWELVDHEIDD  413



>gb|ABK96341.1| unknown [Populus trichocarpa x Populus deltoides]
Length=396

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 130/207 (63%), Gaps = 6/207 (3%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKN--QQDNNVP  178
            SARDQ    V++L++ YK EEISITVTGHSLG+A+ATLNA+D+ V   NK   +Q+   P
Sbjct  189  SARDQALAAVSKLVDQYKDEEISITVTGHSLGAAIATLNALDIVVKGYNKTTGEQNKAFP  248

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P+VGD NFK       +L  +R+++  D+V  +P+       +  ++ VG  
Sbjct  249  VTAIVFASPRVGDTNFKKLCEGLEDLHVLRVTNEKDIVPNLPFDIP---PSFSFKHVGEE  305

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KS Y+K   D+   H+L  ++HG+ G QGS GGF  + D DI+ +NK   GLKD
Sbjct  306  LRIDTRKSPYVKSMDDLGDFHNLELYIHGVAGTQGSEGGFNLEVDRDIALVNKDLDGLKD  365

Query  539  EYHVPVAWMNVKD-KGMVQQEDGTYIL  616
            EY++P  W  ++D KGMV  +DG + L
Sbjct  366  EYNIPAGWWGIEDNKGMVLGDDGRWKL  392



>ref|XP_006644445.1| PREDICTED: phospholipase A1-II 3-like [Oryza brachyantha]
Length=426

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 124/212 (58%), Gaps = 12/212 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN-KNQQDNNVPV  181
            SAR+Q+  E+ARL+  YK E  SIT+TGHSLG+AL+TLNAVD+  N  N +      VPV
Sbjct  217  SAREQVLAEIARLLRAYKNENCSITITGHSLGAALSTLNAVDIVANGYNVRGPSRVPVPV  276

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLV-TMVPWGSQVGGKNILYEAVGVG  358
            TA     P+VGD  FK AF +   +  +R+ +  D+V T++P        +  ++ VG  
Sbjct  277  TAIALASPRVGDDQFKRAFDSMAGVSLLRVRNAPDIVPTILP--------SAFFKDVGAE  328

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGS--RGGFEPKGDFDISKLNKYRQGL  532
             ++D+++S YLK        H+L  ++H + G QG+    GF    D D++ +NK    L
Sbjct  329  LLVDTRRSPYLKSPAGPAQWHNLECYLHAVAGTQGAGDGAGFSLAVDRDVALVNKEVDAL  388

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            +DEY VP AW   K+KGMVQ   G ++L DHE
Sbjct  389  RDEYQVPAAWWGEKNKGMVQNASGRWVLQDHE  420



>ref|XP_002456062.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
 gb|EES01182.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
Length=440

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 131/220 (60%), Gaps = 19/220 (9%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN---KNQQDNN  172
            +SAR+Q+  EV RL++ YKGE  SIT+TGHSLG+ALATL A+D+  N +N    +  ++ 
Sbjct  223  QSAREQVLSEVRRLLDAYKGENCSITLTGHSLGAALATLTAIDIVANGLNVRGGSNSNDT  282

Query  173  VPVTAFFFGGPKVGDQNFKDAFSNQ----GNLRGMRISDVNDLV-TMVPWGSQVGGKNIL  337
            VPV A  FG P+VGD  FK AF +     G  R +R+ +  D+V T++P           
Sbjct  283  VPVAAIVFGSPRVGDDQFKKAFESPSTPGGGARLLRVRNAPDIVPTILP--------AAF  334

Query  338  YEAVGVGFIIDSKKSEYLK-PGLDIMVHHDLMFHMHGIDGFQGS--RGGFEPKGDFDISK  508
            Y  VGV  ++D++KS +LK PG      H+L  ++HG+ G QG+    GF  + D D++ 
Sbjct  335  YRDVGVELLLDTRKSPHLKRPGPGPAAWHNLECYLHGVAGTQGAGDGAGFRLEVDRDVAL  394

Query  509  LNKYRQGLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            +NK    L DEY VP AW    +KGM + + G ++L DHE
Sbjct  395  VNKEVDALSDEYPVPAAWWVEGNKGMTRDKSGRWVLQDHE  434



>ref|XP_010496242.1| PREDICTED: phospholipase A1-IIgamma [Camelina sativa]
Length=435

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 134/215 (62%), Gaps = 12/215 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            +ARDQ+  EV RL++ YK EE+SIT+ GHSLG+ALATLNA D+  N  N  K++ D + P
Sbjct  223  NARDQVLREVGRLLDKYKDEEVSITICGHSLGAALATLNAADIVANGYNRPKSRPDKSFP  282

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD +FK  FS   +LR +R     +L  ++P    +G     Y  VG  
Sbjct  283  VTAFVFASPRVGDSDFKKLFSGLEDLRVLR---TRNLPDIIPIYPPIG-----YSEVGDE  334

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDF--DISKLNKYRQGL  532
              ID++KS+Y+K   ++   H L  ++HG+ G QG+    E + D   DI  +NK   GL
Sbjct  335  LPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADEFRLDVKRDIGLVNKSVDGL  394

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            KDE  VP  W  +K+KGMVQQ+DG++ L DHE+D+
Sbjct  395  KDECMVPGKWRVLKNKGMVQQDDGSWNLLDHEIDD  429



>emb|CDM85400.1| unnamed protein product [Triticum aestivum]
Length=416

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 128/213 (60%), Gaps = 12/213 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN-KNQQDNNVP  178
            +SAR+ +  EV  L++ YK E+ SI++TGHSLG AL TLNA+DL  N  N +    + VP
Sbjct  206  RSARELVLTEVRGLLDTYKNEDCSISITGHSLGGALTTLNAIDLVANGFNVRGPSRSPVP  265

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLV-TMVPWGSQVGGKNILYEAVGV  355
            VTA  FG P+VGD+ FK AF +   L  +R+ +V D+V T++P         ++Y  VGV
Sbjct  266  VTAIHFGAPRVGDEQFKKAFHSMAGLSLLRVRNVPDIVPTILP--------PVIYADVGV  317

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSR--GGFEPKGDFDISKLNKYRQG  529
              ++D++KS YLK        H+L  ++HG+ G  G+R   GF  + D D++ +NK    
Sbjct  318  ELLVDTRKSPYLKEKAGPAQWHNLEGYLHGVAGTHGARDSAGFGMEVDRDLALINKEEDA  377

Query  530  LKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            L+DEY VP  W    +KGMV+   G ++L DHE
Sbjct  378  LRDEYPVPAMWWAENNKGMVKNATGHWVLHDHE  410



>ref|XP_002305084.2| hypothetical protein POPTR_0004s05380g [Populus trichocarpa]
 gb|EEE85595.2| hypothetical protein POPTR_0004s05380g [Populus trichocarpa]
Length=396

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 129/207 (62%), Gaps = 6/207 (3%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKN--QQDNNVP  178
            SARDQ    V++L++ YK EEISITVTGHSLG+A+ATLNA+D+ V   NK   +Q+   P
Sbjct  189  SARDQALAAVSKLVDQYKDEEISITVTGHSLGAAIATLNALDIVVKGYNKTTGEQNKAFP  248

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P+VGD NFK       +L  +R+++  D+V  +P        +  ++ VG  
Sbjct  249  VTAIVFASPRVGDANFKKLCEGLEDLHVLRVTNEKDIVPNLPLDIP---PSFSFKHVGEE  305

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KS Y+K   D+   H+L  ++HG+ G QGS GGF  + D DI+ +NK   GLKD
Sbjct  306  LRIDTRKSPYVKSMDDLGDFHNLELYIHGVAGTQGSEGGFNLEVDRDIALVNKDLDGLKD  365

Query  539  EYHVPVAWMNVKD-KGMVQQEDGTYIL  616
            EY++P  W  ++D KGMV  +DG + L
Sbjct  366  EYNIPAGWWGIEDNKGMVLGDDGRWKL  392



>ref|NP_001043734.1| Os01g0651800 [Oryza sativa Japonica Group]
 sp|Q8RZ40.1|PLA3_ORYSJ RecName: Full=Phospholipase A1-II 3; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAB89211.1| lipase-like [Oryza sativa Japonica Group]
 dbj|BAF05648.1| Os01g0651800 [Oryza sativa Japonica Group]
Length=420

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 124/212 (58%), Gaps = 12/212 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN-KNQQDNNVPV  181
            SAR+Q+  E+ RL+  YK E  SIT+TGHSLG+AL+TLNA+D+  N  N +      VPV
Sbjct  211  SAREQVLAEITRLLRAYKNENCSITITGHSLGAALSTLNAIDIVANGYNVRGSSRVPVPV  270

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLV-TMVPWGSQVGGKNILYEAVGVG  358
            TA     P+VGD  FK AF +  NL  +R+ +  D+V T++P        +  ++ VG  
Sbjct  271  TAIALASPRVGDDQFKRAFDSTSNLSLLRVRNAPDIVPTILP--------SAFFKDVGAE  322

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGS--RGGFEPKGDFDISKLNKYRQGL  532
             ++D+++S YLK        H+L  ++H + G QG+    GF    D D++ +NK    L
Sbjct  323  LLVDTRRSPYLKNPAGPAQWHNLECYLHAVAGTQGAGDGAGFSLVVDRDLALVNKEVDAL  382

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            +DEY VP AW   K+KGMVQ   G ++L DHE
Sbjct  383  RDEYQVPAAWWVEKNKGMVQNASGRWVLQDHE  414



>ref|XP_006417941.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
 gb|ESQ36294.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
Length=411

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 124/211 (59%), Gaps = 11/211 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQ---QDNNV  175
            SAR+Q++ E+ RL+E+YK EE+SIT TGHSLG  ++TL A DL     NKN    Q N V
Sbjct  194  SAREQVQGELKRLLEVYKNEEVSITFTGHSLGGVMSTLAAADLVHARKNKNNTSLQRNQV  253

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            P+T F FG P++GDQ+FK    +   L  +RI +V D+    P         +LY  VG 
Sbjct  254  PITVFAFGCPRIGDQDFKKIVDSLQPLNILRIVNVPDVAPHYPL--------LLYAEVGE  305

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I++  S YLK  L+   +H+L  ++HGI G Q   G F+ +   D+S +NK    LK
Sbjct  306  VLEINTLNSTYLKRSLNFRNYHNLEIYLHGIAGMQDRAGVFKLEVGRDVSLVNKGLDALK  365

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            DEY VP  W  + +KGMVQ +DGT+ LD H 
Sbjct  366  DEYLVPSTWRCLANKGMVQMDDGTWKLDVHR  396



>tpg|DAA53108.1| TPA: hypothetical protein ZEAMMB73_566262 [Zea mays]
Length=370

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 134/233 (58%), Gaps = 24/233 (10%)
 Frame = +2

Query  5    SARDQIREEVARLIELY--KGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVP  178
            SAR+Q+  EV +L++LY  +GE++S+TVTGHSLGSALA L A D+A    N +  D   P
Sbjct  127  SAREQVLAEVRKLVDLYHGRGEQVSVTVTGHSLGSALAMLCAFDIAETRANVSPGDRVAP  186

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVP--------------WGSQ  316
            V  F F GP+VG+  F+  F  +  +R +R+ +V+D V  VP                + 
Sbjct  187  VCVFSFAGPRVGNVAFRRRFERELGVRALRVVNVHDSVPKVPGVFFNESAFPELVLRAAD  246

Query  317  VGGKNILYEAVGVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDF  496
              G   +Y  +GV   +D K S +LK  LD+  +H+L  H+H +DGF+GS  GFEP+G  
Sbjct  247  RLGLGGVYTHLGVLLQLDHKVSPFLKETLDLSCYHNLEAHLHLLDGFRGSGAGFEPRGR-  305

Query  497  DISKLNKYRQGLKDEYHVPVAWMNVKDKGMVQQEDGTY-------ILDDHEVD  634
            D + +NK    L++++ VP  W   ++KGMV+ EDG +       +LDDH  D
Sbjct  306  DPALVNKSTDFLREDHMVPPVWYQAENKGMVRTEDGRWVLPPRQRVLDDHPED  358



>ref|XP_010557125.1| PREDICTED: phospholipase A1-IIbeta isoform X1 [Tarenaya hassleriana]
Length=403

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 132/211 (63%), Gaps = 10/211 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVP--  178
            SAR+Q+  EV RL+E YK EE+SIT+TGHSLG+ ++TL A D+A N   K +   + P  
Sbjct  194  SAREQVLGEVNRLLEQYKDEEVSITLTGHSLGATMSTLCATDIAYNGHKKMKSLQHKPFY  253

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VGD+NFK    +  NL  +RI++V D+V   P         + Y+  G  
Sbjct  254  VTAFAFASPRVGDKNFKMLVDSIENLNILRITNVPDVVPRYPL--------LGYDDAGEV  305

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              I++ KS+YLK  L++  +H++  ++HG+ G QGS GGF+ + + DIS +NK    L D
Sbjct  306  LTINTLKSKYLKQSLNLRNYHNIDIYLHGVAGTQGSLGGFKLEIEKDISSVNKRLDALDD  365

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEV  631
            EY +P +W  V++KGMVQ +DG++ L  H  
Sbjct  366  EYLIPGSWWCVENKGMVQMDDGSWKLYTHRT  396



>gb|EMT15520.1| Feruloyl esterase A [Aegilops tauschii]
Length=663

 Score =   164 bits (414),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 126/206 (61%), Gaps = 11/206 (5%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKN---QQDNN  172
            +SAR Q+  E+AR+++ YK E+ SITV GHSLG+ LATLNAVD+A N  NK+      + 
Sbjct  397  QSARMQVLTEIARMMDKYKDEQTSITVVGHSLGATLATLNAVDIAANYYNKSALCTAGSR  456

Query  173  VPVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVG  352
             PVTA  FG P+ GD++F+D F     LR +R+ +  D + + P    VG     Y  VG
Sbjct  457  APVTAVVFGSPRTGDRDFRDIFHRLPGLRMLRVRNRPDRIPLYP---PVG-----YADVG  508

Query  353  VGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGL  532
            V  +ID+++S +LKP  +    HDL  H+HGI G+QG  G FE   D DI+ +NK+   L
Sbjct  509  VELLIDTRRSLFLKPHGNESQSHDLECHLHGIAGWQGEHGEFELVVDRDIALVNKFDDCL  568

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTY  610
             DE+ VPV W    +K MV+  DG++
Sbjct  569  TDEHPVPVGWKVHHNKNMVKGTDGSW  594



>sp|A2WTA0.1|PLA3_ORYSI RecName: Full=Phospholipase A1-II 3; Flags: Precursor [Oryza 
sativa Indica Group]
 gb|EAY75196.1| hypothetical protein OsI_03088 [Oryza sativa Indica Group]
Length=420

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 124/212 (58%), Gaps = 12/212 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN-KNQQDNNVPV  181
            SAR+Q+  E+ RL+  YK E  SIT+TGHSLG+AL+TLNA+D+  N  N +      VPV
Sbjct  211  SAREQVLAEITRLLRAYKNENCSITITGHSLGAALSTLNAIDIVANGYNVRGSSRVPVPV  270

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLV-TMVPWGSQVGGKNILYEAVGVG  358
            TA     P+VGD  FK AF +  NL  +R+ +  D+V T++P        +  ++ VG  
Sbjct  271  TAIALASPRVGDDQFKRAFDSTPNLSLLRVRNAPDIVPTILP--------SAFFKDVGAE  322

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGS--RGGFEPKGDFDISKLNKYRQGL  532
             ++D+++S YLK        H+L  ++H + G QG+    GF    D D++ +NK    L
Sbjct  323  LLVDTRRSPYLKNPAGPAQWHNLECYLHAVAGTQGAGDGAGFSLVVDRDLALVNKEVDAL  382

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            +DEY VP AW   K+KGMVQ   G ++L DHE
Sbjct  383  RDEYQVPAAWWVEKNKGMVQNASGRWVLQDHE  414



>ref|XP_006646158.1| PREDICTED: phospholipase A1-II 4-like [Oryza brachyantha]
Length=367

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 123/211 (58%), Gaps = 11/211 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVP--  178
            SAR+QI  E+ RL++ YK EE SITV GHSLG+A+ATL A D+  N +N+   D+  P  
Sbjct  157  SAREQIWHEIKRLMDKYKDEETSITVVGHSLGAAVATLTAADIVSNGLNRRGSDDQCPAC  216

Query  179  -VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
             VTA     P+VGD  FK  F +   LR +R+ +  D+V   P         + Y  VGV
Sbjct  217  PVTAVAIACPRVGDSGFKKLFDDLPGLRMLRVRNWPDVVPRYP--------PMGYADVGV  268

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               ID+ +S YLK   +  V H L  ++HG+ G QG RGGF+ + D D++ +NK    LK
Sbjct  269  ELPIDTGRSPYLKSPGNQAVWHSLECYLHGVAGAQGKRGGFKLEVDRDVALVNKNVDALK  328

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            DEYHVP +W   ++ GM +  DG + L D+E
Sbjct  329  DEYHVPPSWSVQRNTGMARGADGHWKLMDYE  359



>ref|XP_004969332.1| PREDICTED: phospholipase A1-II 3-like [Setaria italica]
Length=424

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 129/214 (60%), Gaps = 13/214 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN-KNQQDNNVP  178
            +SAR+Q+  E+ RL++ YKGE  SIT+TGHSLG+AL+TL A+D+  N VN +   ++ VP
Sbjct  213  QSAREQVLAEIKRLLDAYKGENCSITITGHSLGAALSTLTAIDIVSNGVNVRGSTNDTVP  272

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLV-TMVPWGSQVGGKNILYEAVGV  355
            V A  FG P+VGD+  K AF +    R +R+ +  D+V T++P           Y+ VGV
Sbjct  273  VAAIVFGSPRVGDEQLKKAFDSTPGARLLRVRNAPDIVPTILP--------AAFYKDVGV  324

Query  356  GFIIDSKKSEYLK-PGLDIMVHHDLMFHMHGIDGFQGS--RGGFEPKGDFDISKLNKYRQ  526
              ++D++KS +LK PG      H+L  ++HG+ G QG+    GF    D D++ +NK   
Sbjct  325  ELLVDTRKSPHLKQPGPGPAAWHNLECYLHGVAGTQGAGDGAGFGLVVDRDLALVNKEVD  384

Query  527  GLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
             L DEY VP  W    +KGMV+   G ++L DHE
Sbjct  385  ALDDEYPVPAGWWVEGNKGMVKDGSGRWVLQDHE  418



>ref|XP_003528482.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31003.1| Phospholipase A1-IIgamma [Glycine soja]
Length=408

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 96/220 (44%), Positives = 131/220 (60%), Gaps = 19/220 (9%)
 Frame = +2

Query  5    SARDQIREEVARLIELY--KGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNN  172
              R Q+ EEV RL+E Y  K EEISITV GHSLG+ALAT+NAVD+    +N  K+Q +  
Sbjct  189  CVRHQVLEEVRRLVEEYNRKNEEISITVIGHSLGAALATINAVDIVAKGLNIPKDQPEKA  248

Query  173  VPVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILY----  340
              VT F F  P+VG+ +F   F+   +LR +RI +  D+V  +P       K++ +    
Sbjct  249  CSVTTFVFASPRVGNSHFAKIFTGHKHLRALRIRNETDVVPKLPL------KHLFFLDGF  302

Query  341  EAVGVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG-FEPKGDF-DISKLN  514
              VG   +ID+ KS+YLK  +     H+L  ++HG+ G QG  G  F+      DI+ LN
Sbjct  303  SDVGEELVIDTTKSKYLKKEVSA---HNLEVYLHGVAGTQGKNGEIFDLDESLRDIALLN  359

Query  515  KYRQGLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            K +  LKDEYH PVAW   ++KGMVQQ+DGT+ L DH  D
Sbjct  360  KSKDALKDEYHCPVAWRVHENKGMVQQKDGTWKLMDHNKD  399



>ref|NP_001132361.1| uncharacterized protein LOC100193806 precursor [Zea mays]
 gb|ACF81176.1| unknown [Zea mays]
 gb|AFW74937.1| hypothetical protein ZEAMMB73_515693 [Zea mays]
Length=427

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 128/215 (60%), Gaps = 14/215 (7%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK---NQQDNN  172
             SARDQ+ EEV RL+ELYKGE  SITV GHSLG+ALATLNAVD+A N +N+   + Q   
Sbjct  219  ASARDQVLEEVRRLMELYKGEATSITVVGHSLGAALATLNAVDIAANGLNEGSGSSQQLP  278

Query  173  VPVTAFFFGGPKVGDQNFKDAFSNQ-GNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAV  349
             PVTA  F  P VGD+ F+ AF     +LR + + +  D+V +VP         + Y  V
Sbjct  279  CPVTAILFACPHVGDRFFRAAFVGYFRDLRALHVRNAGDVVPVVP--------PLAYVDV  330

Query  350  GVGFI-IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGS-RGGFEPKGDFDISKLNKYR  523
             V  + ID+ +S YL+        H+L  ++HG+ G QGS  GGF  + D D++ +NK  
Sbjct  331  AVAVLPIDTSRSPYLRSPGPAGTLHNLECYLHGVAGEQGSAAGGFRLEVDRDVALVNKGA  390

Query  524  QGLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
              L+DEY VP  W   +++ MV+  DG ++L D E
Sbjct  391  DALRDEYPVPANWWVPENRWMVRGSDGHWVLKDFE  425



>ref|XP_008655140.1| PREDICTED: triacylglycerol lipase isoform X1 [Zea mays]
Length=1067

 Score =   165 bits (418),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 88/214 (41%), Positives = 131/214 (61%), Gaps = 13/214 (6%)
 Frame = +2

Query  2     KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN-KNQQDNNVP  178
             +SAR+Q+  E+ RL++ YKGE  SIT+TGHSLG+AL+TL A+D+  N +N +   ++ VP
Sbjct  856   QSAREQVLAEIRRLLDAYKGENCSITLTGHSLGAALSTLTAIDIVANGLNVRGPNNDTVP  915

Query  179   VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLV-TMVPWGSQVGGKNILYEAVGV  355
             V A  FG P+VGD  FK AF +    R +R+ +  D+V T++P        N  Y+ VGV
Sbjct  916   VAAIVFGSPRVGDDQFKKAFDSTPGARLLRVRNAPDVVPTVLP--------NAFYKDVGV  967

Query  356   GFIIDSKKSEYLK-PGLDIMVHHDLMFHMHGIDGFQGS--RGGFEPKGDFDISKLNKYRQ  526
               ++D++KS +LK PG      H+L  ++HG+ G QG+    GF  + D D++ +NK   
Sbjct  968   ELLLDTRKSPHLKRPGPGPAAWHNLECYLHGVAGTQGAGDAAGFSLEVDRDVALVNKEVD  1027

Query  527   GLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
              L D+Y VP AW    +KGM +   G ++L DHE
Sbjct  1028  ALSDDYPVPAAWWVEGNKGMTRDASGRWVLQDHE  1061



>emb|CDY34061.1| BnaC03g62710D [Brassica napus]
Length=402

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 130/216 (60%), Gaps = 10/216 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            +ARDQ+  E+ RL+E YK E+ISI++ GHSLG+A+ATLNA D+  N  N  K++ D + P
Sbjct  186  NARDQVLREIGRLLEKYKDEKISISICGHSLGAAIATLNAADIVANGYNRPKSRPDKSCP  245

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLR-GMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            VTAF F  P VGD +FK  FS    L   +  S + +L  +VP    +G     Y  VG 
Sbjct  246  VTAFVFASPHVGDSDFKKLFSGYVLLNIYIYNSFILNLPDVVPIYPPLG-----YAEVGD  300

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG--FEPKGDFDISKLNKYRQG  529
               ID++KS YLK   D+   H L  ++HG+ G QG+     F      DI  +NK   G
Sbjct  301  ELPIDTRKSPYLKSPGDLATFHCLEAYLHGLAGTQGTSKADLFRLVVKRDIGLVNKSVDG  360

Query  530  LKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            LKDEY VP  W  +K+KGMVQQ+DG++ L DHE+D+
Sbjct  361  LKDEYMVPGHWRILKNKGMVQQKDGSWKLMDHEIDD  396



>gb|KFK42950.1| hypothetical protein AALP_AA1G060100 [Arabis alpina]
Length=412

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 123/213 (58%), Gaps = 11/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLA---VNPVNKNQQDNNV  175
            SA++Q++ E+ RL+ELYK EEISIT TGHSLG  ++TL A DL     N +N   Q   V
Sbjct  194  SAQEQVQGELTRLLELYKNEEISITFTGHSLGGVMSTLAAADLVHNRKNTINTGLQKKTV  253

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            P+T F FG P++GDQ+FK    +   +  +RI +V D+    P         +LY  VG 
Sbjct  254  PITVFAFGCPRIGDQDFKKLVDSLQQINILRIVNVPDVAPHYPL--------LLYAEVGE  305

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I++  S YLK  L+   +H+L  ++HG+ G Q   G F  +   D+S +NK    LK
Sbjct  306  ELQINTLNSTYLKRSLNFRNYHNLEIYLHGLAGMQDRAGVFTLQVGRDVSLVNKGLDALK  365

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            DEY VP  W  + +KGMVQ +DGT+ LD H  D
Sbjct  366  DEYLVPSIWRCLANKGMVQMDDGTWQLDVHRRD  398



>ref|XP_006654823.1| PREDICTED: phospholipase A1-II 6-like [Oryza brachyantha]
Length=408

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 126/219 (58%), Gaps = 15/219 (7%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQ-----DN  169
            SARDQ+  EVARL+ +Y GEE+SITVTGHSLG+AL TLNA D+A N  N++ +       
Sbjct  194  SARDQVLSEVARLVSMYDGEELSITVTGHSLGAALGTLNAFDIAANGYNRSPRAAAATAT  253

Query  170  NVPVTAFFFGGPKVGDQNFKDAF--SNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYE  343
              PVTAF F  P+VG   F+  F  +    LR +R+ +  D+V   P         +LY 
Sbjct  254  GCPVTAFAFASPRVGGHGFRRRFDGARGAGLRLLRVRNARDIVPRYP-------TALLYH  306

Query  344  AVGVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG-FEPKGDFDISKLNKY  520
             VG    ID+ +S YL+   + ++ H+L  ++HG+ G +G   G FE   + D++  NK+
Sbjct  307  DVGAELAIDTGESPYLRNPGNELLWHNLESYLHGVAGARGGEAGRFELAVERDVALTNKF  366

Query  521  RQGLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
               L+DE+ VP  W    ++GMV+  DG + L D E DE
Sbjct  367  YGALRDEHPVPAGWWIPSNRGMVRGADGRWTLMDCEEDE  405



>gb|EAZ12914.1| hypothetical protein OsJ_02837 [Oryza sativa Japonica Group]
Length=373

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 120/208 (58%), Gaps = 12/208 (6%)
 Frame = +2

Query  17   QIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQ----DNNVPVT  184
            ++  E+ARL++ YK EE SITV GHSLG+ LATLNA D+A N  N +      +   PVT
Sbjct  163  KVLTEIARLMDKYKDEETSITVIGHSLGATLATLNAADIAANSYNTSSLSPSGETRAPVT  222

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            A  FG P+ GD+ F+DAF    +LR +R+ +  D +   P    VG     Y  VGV  +
Sbjct  223  AVVFGSPRTGDRGFRDAFHRLRDLRMLRVRNRPDRIPHYP---PVG-----YADVGVELL  274

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            ID++ S +L+        HDL  H+HG+ G+ G   GFE   D D++ +NK+   L DEY
Sbjct  275  IDTRLSPFLRRHGSESQSHDLECHLHGVAGWHGDHRGFELVVDRDVALVNKFDDCLADEY  334

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHE  628
             VPV W    +K MV+  DG ++L DHE
Sbjct  335  PVPVRWKVHHNKSMVKGPDGRWVLQDHE  362



>tpg|DAA53109.1| TPA: hypothetical protein ZEAMMB73_566262 [Zea mays]
Length=505

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 134/233 (58%), Gaps = 24/233 (10%)
 Frame = +2

Query  5    SARDQIREEVARLIELY--KGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVP  178
            SAR+Q+  EV +L++LY  +GE++S+TVTGHSLGSALA L A D+A    N +  D   P
Sbjct  262  SAREQVLAEVRKLVDLYHGRGEQVSVTVTGHSLGSALAMLCAFDIAETRANVSPGDRVAP  321

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVP--------------WGSQ  316
            V  F F GP+VG+  F+  F  +  +R +R+ +V+D V  VP                + 
Sbjct  322  VCVFSFAGPRVGNVAFRRRFERELGVRALRVVNVHDSVPKVPGVFFNESAFPELVLRAAD  381

Query  317  VGGKNILYEAVGVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDF  496
              G   +Y  +GV   +D K S +LK  LD+  +H+L  H+H +DGF+GS  GFEP+G  
Sbjct  382  RLGLGGVYTHLGVLLQLDHKVSPFLKETLDLSCYHNLEAHLHLLDGFRGSGAGFEPRGR-  440

Query  497  DISKLNKYRQGLKDEYHVPVAWMNVKDKGMVQQEDGTY-------ILDDHEVD  634
            D + +NK    L++++ VP  W   ++KGMV+ EDG +       +LDDH  D
Sbjct  441  DPALVNKSTDFLREDHMVPPVWYQAENKGMVRTEDGRWVLPPRQRVLDDHPED  493



>gb|EAY75192.1| hypothetical protein OsI_03084 [Oryza sativa Indica Group]
Length=418

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 120/208 (58%), Gaps = 12/208 (6%)
 Frame = +2

Query  17   QIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQ----DNNVPVT  184
            ++  E+ARL++ YK EE SITV GHSLG+ LATLNA D+A N  N +      +   PVT
Sbjct  208  KVLTEIARLMDKYKDEETSITVIGHSLGATLATLNAADIAANSYNTSSLSPSGETRAPVT  267

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            A  FG P+ GD+ F+DAF    +LR +R+ +  D +   P    VG     Y  VGV  +
Sbjct  268  AVVFGSPRTGDRGFRDAFHRLRDLRMLRVRNRPDRIPHYP---PVG-----YADVGVELL  319

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            ID++ S +L+        HDL  H+HG+ G+ G   GFE   D D++ +NK+   L DEY
Sbjct  320  IDTRLSPFLRRHGSESQSHDLECHLHGVAGWHGDHRGFELVVDRDVALVNKFDDCLADEY  379

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHE  628
             VPV W    +K MV+  DG ++L DHE
Sbjct  380  PVPVRWKVHHNKSMVKGPDGRWVLQDHE  407



>emb|CDX86530.1| BnaC08g01730D [Brassica napus]
Length=408

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 126/214 (59%), Gaps = 11/214 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDL---AVNPVNKNQQDNNV  175
            SAR+Q++ E+ RL+E+YK EE+SIT TGHSLG  ++TL A DL   + N ++   Q   V
Sbjct  194  SAREQVQAELKRLLEVYKNEEVSITFTGHSLGGVMSTLAAADLVHSSQNKIHTGIQSKQV  253

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            P+T F FG P++GDQ+FK   S+   L  +RI +V D+    P          +Y  VG 
Sbjct  254  PITVFAFGCPRIGDQDFKKVVSSHKQLNILRIVNVPDVAPNYPL--------FMYAEVGE  305

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I++  S YLK  L+   +H+L  ++HGI G Q   G F+ +   D+S +NK    LK
Sbjct  306  VLQINTLNSTYLKRSLNWRNYHNLEIYLHGIAGMQDKSGVFKLEIGRDVSLVNKGLDALK  365

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            D+Y VP  W  + ++GMVQ +DGT+ LD H  ++
Sbjct  366  DKYLVPSVWRCLANRGMVQMDDGTWKLDVHRYED  399



>ref|XP_009110999.1| PREDICTED: phospholipase A1-IIalpha-like [Brassica rapa]
 emb|CDY15570.1| BnaA08g28540D [Brassica napus]
Length=408

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 125/214 (58%), Gaps = 11/214 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDL---AVNPVNKNQQDNNV  175
            SAR+Q++ E+ RL+E+YK EE+SIT TGHSLG  ++TL A DL   + N ++   Q   V
Sbjct  194  SAREQVQAELKRLLEVYKNEEVSITFTGHSLGGVMSTLAAADLVHSSQNKIHTGLQSKQV  253

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            P+T F FG P++GDQ+FK   S+   L  +RI +V D+    P          +Y  VG 
Sbjct  254  PITVFAFGCPRIGDQDFKKVVSSHKQLNILRIVNVPDVAPNYPL--------FMYAEVGE  305

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I++  S YLK  L+   +H+L  ++HGI G Q   G F  +   D+S +NK    LK
Sbjct  306  VLQINTLNSTYLKRSLNWRNYHNLEIYLHGIAGMQDKTGVFRLEIGRDVSLVNKGLDALK  365

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            D+Y VP  W  + ++GMVQ +DGT+ LD H  ++
Sbjct  366  DKYLVPSVWRCLANRGMVQMDDGTWKLDVHRYED  399



>dbj|BAD68802.1| lipase-like protein [Oryza sativa Japonica Group]
Length=418

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 120/208 (58%), Gaps = 12/208 (6%)
 Frame = +2

Query  17   QIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQ----DNNVPVT  184
            ++  E+ARL++ YK EE SITV GHSLG+ LATLNA D+A N  N +      +   PVT
Sbjct  208  KVLTEIARLMDKYKDEETSITVIGHSLGATLATLNAADIAANSYNTSSLSPSGETRAPVT  267

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            A  FG P+ GD+ F+DAF    +LR +R+ +  D +   P    VG     Y  VGV  +
Sbjct  268  AVVFGSPRTGDRGFRDAFHRLRDLRMLRVRNRPDRIPHYP---PVG-----YADVGVELL  319

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            ID++ S +L+        HDL  H+HG+ G+ G   GFE   D D++ +NK+   L DEY
Sbjct  320  IDTRLSPFLRRHGSESQSHDLECHLHGVAGWHGDHRGFELVVDRDVALVNKFDDCLADEY  379

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDDHE  628
             VPV W    +K MV+  DG ++L DHE
Sbjct  380  PVPVRWKVHHNKSMVKGPDGRWVLQDHE  407



>ref|XP_004960509.1| PREDICTED: phospholipase A1-II 7-like [Setaria italica]
Length=420

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 125/206 (61%), Gaps = 8/206 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SARDQ+ EEV RL++LYK EE SIT+TGHSLG+ALA LNAVD+A N +N        PVT
Sbjct  219  SARDQVFEEVRRLMQLYKDEETSITITGHSLGAALAVLNAVDIAANGLNAASSQPPCPVT  278

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            A  F  P VGD++FK AF +  +LR + + +  D+V +VP    V    +L         
Sbjct  279  AVVFACPHVGDRSFKAAFDSFEHLRALHVKNAGDVVPIVPPVVYVDVGVLL--------A  330

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEY  544
            ID+ +S YLK    +   H+L  ++HG+ G QG  GGF+ + D D++ +NK    L+DEY
Sbjct  331  IDTGRSPYLKKPGTVQTLHNLECYLHGVAGEQGRAGGFKLEVDRDVALVNKGVDALEDEY  390

Query  545  HVPVAWMNVKDKGMVQQEDGTYILDD  622
             VP  W   K+K MV+  DG + L+D
Sbjct  391  PVPANWWVPKNKWMVRGADGHWKLED  416



>gb|EMT05279.1| Lipase [Aegilops tauschii]
Length=300

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/218 (40%), Positives = 127/218 (58%), Gaps = 12/218 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNN-VP  178
            K+    +  EV  L++ YK E+ SI++TGHSLG AL+TLNA+DL  N  N +    + VP
Sbjct  29   KTNEIAVLTEVRGLLDTYKNEDCSISITGHSLGGALSTLNAIDLVANGFNVHGPSRSPVP  88

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLV-TMVPWGSQVGGKNILYEAVGV  355
            VTA  FG P+VGD+ FK AF +   L  +R+ +V D+V T++P         ++Y  VGV
Sbjct  89   VTAIHFGAPRVGDEQFKKAFHSMAGLSLLRVRNVPDIVPTILP--------PVIYADVGV  140

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSR--GGFEPKGDFDISKLNKYRQG  529
              ++D++KS YLK        H+L  ++HG+ G  G+R   GF  + D D++ +NK    
Sbjct  141  ELLVDTRKSPYLKEKAGPAQWHNLEGYLHGVAGTHGARDVAGFGLEVDRDLALINKEEDA  200

Query  530  LKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDETF  643
            L+DEY VP  W    +KGMV+   G ++L DHE D   
Sbjct  201  LRDEYPVPAMWWAENNKGMVKNATGHWVLHDHEEDRAL  238



>ref|XP_003574515.1| PREDICTED: phospholipase A1-II 7-like [Brachypodium distachyon]
Length=438

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 125/211 (59%), Gaps = 14/211 (7%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNN----  172
            SARDQ+ EEV RL+EL+K EE SITVTGHSLG++LATLNAVDL  +  NK    +     
Sbjct  233  SARDQVLEEVRRLVELHKDEETSITVTGHSLGASLATLNAVDLVSSGTNKPSSSDGDKKP  292

Query  173  VPVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVG  352
             PVTA  F  P VGD+ F+ AF +  +L+ + + +V D+V + P         + Y  V 
Sbjct  293  FPVTAIVFASPHVGDRFFRSAFGSFPDLKALHVQNVGDIVPLYP--------PLGYVDVA  344

Query  353  VGFIIDSKKSEYLK-PGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQG  529
                I + +S YL  PG  + + H+L  ++HG+ G QGSRGGF+ +   D++ +NK    
Sbjct  345  TELTIRTIRSPYLSVPGTPVTL-HNLECYLHGVAGEQGSRGGFKLEVARDVALVNKGVDA  403

Query  530  LKDEYHVPVAWMNVKDKGMVQQEDGTYILDD  622
            L DE+ VP  W   K + MV+ +DG + L D
Sbjct  404  LTDEHPVPAGWWTPKHRCMVRGDDGRWTLQD  434



>dbj|BAJ90094.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=359

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 125/207 (60%), Gaps = 9/207 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQ-QDNNVPV  181
            SARDQ+ +EV RL+ELYK EE+SITV GHSLG+++ATLNAVD+  + +NK +    + PV
Sbjct  157  SARDQVVKEVKRLVELYKDEEVSITVCGHSLGASIATLNAVDMVSSGINKPEGATKSFPV  216

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            TA  F  P VG + F+ AF +  +L+ + + +V D+V + P         + Y  V V  
Sbjct  217  TAIVFASPHVGCRFFRSAFHSFPDLKALHVQNVGDVVPLYP--------PLGYVDVAVQL  268

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
             I + +S YL+    +   H+L  ++HG+ G QGS GGF+ + D DI+ +NK    L DE
Sbjct  269  TITTIRSPYLRVPATVGTLHNLECYLHGVAGEQGSAGGFKLEVDRDIALVNKGADALADE  328

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDD  622
            + VP +W   K K MV+  DG + L D
Sbjct  329  HPVPASWWVPKHKFMVKGGDGRWTLQD  355



>gb|EMS68153.1| Phospholipase A1-II 7 [Triticum urartu]
Length=388

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 126/207 (61%), Gaps = 9/207 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDN-NVPV  181
            SA+DQ+ +EV RL+ELYK EE+SITV GHSLG++LATLNAVDL  +  NK +    + PV
Sbjct  186  SAKDQVLKEVRRLVELYKDEEVSITVCGHSLGASLATLNAVDLVSSGANKPESSTKSFPV  245

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            TA  F  P VGD+ F+ AF++  +L+ + + +  D+V M P         + Y  V V  
Sbjct  246  TAIVFASPHVGDRFFRSAFNSFPDLKALHVQNAGDIVPMYP--------PLGYVDVAVEL  297

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
             I + +S Y++    ++  H+L  ++HG+ G QGS GGF+ + + D++ +NK    L +E
Sbjct  298  TIRTIRSPYMRMPATVLTLHNLECYLHGVAGEQGSAGGFKLEVERDVALVNKGADALTNE  357

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDD  622
            + VP  W   K K MV+ +DG + L D
Sbjct  358  HPVPAEWWVPKHKFMVKGKDGRWALQD  384



>ref|XP_003569464.1| PREDICTED: phospholipase A1-II 3-like [Brachypodium distachyon]
Length=418

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 89/217 (41%), Positives = 128/217 (59%), Gaps = 16/217 (7%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN---KNQQDN-  169
            +SAR+Q+  EV RL++ YK E  S+T+TGHSLG+AL+TLNA+D+  N +N    +  DN 
Sbjct  204  QSAREQVLTEVRRLLDTYKDENCSVTLTGHSLGAALSTLNAIDIVANGINALRSSSGDNI  263

Query  170  NVPVTAFFFGGPKVGDQNFKDAF-SNQGNLRGMRISDVNDLV-TMVPWGSQVGGKNILYE  343
             VPVTA  FG P+VGD+ FK A  S  G +  +R+ +  D+V T++P           Y 
Sbjct  264  TVPVTAILFGSPRVGDEQFKKALDSMAGAVSLLRVRNAPDIVPTILP--------TPFYR  315

Query  344  AVGVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGS--RGGFEPKGDFDISKLNK  517
             VGV  ++D+ KS YLK        H+L  ++H + G QG     GF  + D D++ +NK
Sbjct  316  DVGVELLVDTLKSPYLKTPAGPAQWHNLECYLHAVAGTQGPGDDAGFSLEVDRDVALVNK  375

Query  518  YRQGLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
                LK EY VP +W    +KGMV+   G ++L+DHE
Sbjct  376  EEDALKGEYPVPASWWAENNKGMVKNATGHWVLEDHE  412



>ref|XP_007209593.1| hypothetical protein PRUPE_ppa011396mg [Prunus persica]
 gb|EMJ10792.1| hypothetical protein PRUPE_ppa011396mg [Prunus persica]
Length=212

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 121/206 (59%), Gaps = 13/206 (6%)
 Frame = +2

Query  17   QIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVP-VTAFF  193
            Q+   V  L++ YK EEISITVTGHS+GSA+A LNA D+  N  NK    NNV  VTA  
Sbjct  8    QVLAAVRELVDEYKEEEISITVTGHSMGSAIAVLNATDIVYNGYNKPTNSNNVSLVTAIV  67

Query  194  FGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNIL-YEAVGVGFIID  370
            F  P VGDQ FK  FS+  NLR +RI++  D V  +P         IL Y  VG   +ID
Sbjct  68   FACPNVGDQGFKKVFSSLENLRVLRITNEWDPVPKLP---------ILPYVPVGKELVID  118

Query  371  SKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEYHV  550
            + KS YLK  +D +  H L  ++HG+ G QG    F+ + + D++ +N+   GL D+YH+
Sbjct  119  TLKSPYLKNAIDSV--HQLEVYLHGVAGTQGRNNDFKLEINRDLALVNRILDGLDDKYHI  176

Query  551  PVAWMNVKDKGMVQQEDGTYILDDHE  628
               W   ++  MVQ EDG++ L DHE
Sbjct  177  IPKWWIERNNSMVQMEDGSWELMDHE  202



>gb|EEE64776.1| hypothetical protein OsJ_19632 [Oryza sativa Japonica Group]
Length=287

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 122/213 (57%), Gaps = 13/213 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN-----KNQQDN  169
            SARDQ+ EEV RL+ELYK E  SITV GHSLG++LATLNAVD+  N  N      +    
Sbjct  81   SARDQVLEEVRRLMELYKDEVTSITVVGHSLGASLATLNAVDIVANGANCPPASSSSSQP  140

Query  170  NVPVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAV  349
              PVTA  F  P+VGD  FK AF++  +LR + + +  D+V M P         + Y  V
Sbjct  141  PCPVTAIVFASPRVGDGFFKAAFASFPDLRALHVKNAGDVVPMYP--------PLGYVDV  192

Query  350  GVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQG  529
             V   I + +S YL+    I   H+L  ++HG+ G QGS GGF+ + D D++  NK    
Sbjct  193  AVKLRISTSRSPYLRSPGTIETLHNLECYLHGVAGEQGSAGGFKLEVDRDVALANKGVDA  252

Query  530  LKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            LKD+Y VP  W   K++ MV+  DG + L D E
Sbjct  253  LKDKYPVPPRWWVSKNRCMVKDADGHWALHDFE  285



>ref|XP_002525129.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37256.1| triacylglycerol lipase, putative [Ricinus communis]
Length=402

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 124/213 (58%), Gaps = 8/213 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKN--QQDNNVP  178
            SAR Q+ + +  L+  Y+ EEIS+TV GHSLG+ALATL+A D+  N  N+   Q + + P
Sbjct  195  SARQQVLDGLRELVNKYENEEISVTVVGHSLGAALATLSAADIVANGFNRTDKQANKSCP  254

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+ G++ FK    +  +LR +RI++  D+V  VP    + G    Y  VG  
Sbjct  255  VTAFAFACPRTGNRGFKQVCDSLEDLRILRITNTPDMVPKVP--PLIAG----YSEVGEN  308

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              IDS+KS YLKP    +  H+L  ++H I G QG R  F  +   DIS +NK    LK+
Sbjct  309  LEIDSRKSMYLKPTGGFISWHNLETYLHTIAGTQGKRSAFRLECQRDISLVNKNLDALKE  368

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            +Y VP  W    + GM+QQEDG + L D + D+
Sbjct  369  KYMVPGNWWCGLNNGMIQQEDGLWKLFDRDKDD  401



>ref|XP_008648636.1| PREDICTED: phospholipase A1-II 7-like [Zea mays]
Length=446

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 127/214 (59%), Gaps = 14/214 (7%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK---NQQDNNV  175
            SARDQ+ EEV RL+ELYKGE  SITV GHSLG+ALATLNAVD+A N +N+   + Q    
Sbjct  239  SARDQVLEEVRRLMELYKGEATSITVVGHSLGAALATLNAVDIAANGLNEGSGSSQQLPC  298

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQ-GNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVG  352
            PVTA  F  P VGD+ F+ AF     +LR + + +  D+V +VP         + Y  V 
Sbjct  299  PVTAILFACPHVGDRFFRAAFVGSFRDLRALHVRNAGDVVPLVP--------PLAYVDVA  350

Query  353  VGFI-IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGS-RGGFEPKGDFDISKLNKYRQ  526
            V  + ID+ +S YL+        H+L  ++HG+ G Q S  GGF  + D D++ +NK   
Sbjct  351  VAVLPIDTSRSPYLRSPGPAGTLHNLECYLHGVAGKQSSAAGGFRLEVDRDVALVNKGAD  410

Query  527  GLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
             L+DEY VP  W   +++ MV+  +G ++L D E
Sbjct  411  ALRDEYPVPANWWVPENRWMVRGSEGHWMLKDFE  444



>dbj|BAJ95995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 125/207 (60%), Gaps = 9/207 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQ-QDNNVPV  181
            SARDQ+ +EV RL+ELYK EE+SITV GHSLG+++ATLNAVD+  + +NK +    + PV
Sbjct  232  SARDQVVKEVKRLVELYKDEEVSITVCGHSLGASIATLNAVDMVSSGINKPEGATKSFPV  291

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            TA  F  P VG + F+ AF +  +L+ + + +V D+V + P         + Y  V V  
Sbjct  292  TAIVFASPHVGCRFFRSAFHSFPDLKALHVQNVGDVVPLYP--------PLGYVDVAVQL  343

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
             I + +S YL+    +   H+L  ++HG+ G QGS GGF+ + D DI+ +NK    L DE
Sbjct  344  TITTIRSPYLRVPATVGTLHNLECYLHGVAGEQGSAGGFKLEVDRDIALVNKGADALADE  403

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDD  622
            + VP +W   K K MV+  DG + L D
Sbjct  404  HPVPASWWVPKHKFMVKGGDGRWTLQD  430



>ref|XP_008674529.1| PREDICTED: phospholipase A1-II 7-like, partial [Zea mays]
Length=213

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 124/210 (59%), Gaps = 14/210 (7%)
 Frame = +2

Query  17   QIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK---NQQDNNVPVTA  187
            Q+ EEV RL+ELYKGE  SITV GHSLG+ALATLNAVD+A N +N+   + Q    PVTA
Sbjct  10   QVLEEVRRLMELYKGEATSITVVGHSLGAALATLNAVDIAANGLNEGSGSSQQLPCPVTA  69

Query  188  FFFGGPKVGDQNFKDAFSNQ-GNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
              F  P VGD+ F+ AF     +LR + + +  D+V +VP         + Y  V V  +
Sbjct  70   ILFACPHVGDRFFRAAFVGYFRDLRALHVRNAGDVVPVVP--------PLAYVDVAVAVL  121

Query  365  -IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGS-RGGFEPKGDFDISKLNKYRQGLKD  538
             ID+ +S YL+        H+L  ++HG+ G QGS  GGF  + D D++ +NK    L+D
Sbjct  122  PIDTSRSPYLRSPGPAGTLHNLECYLHGVAGEQGSAAGGFRLEVDRDVALVNKGADALRD  181

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            EY VP  W   +++ MV+  DG ++L D E
Sbjct  182  EYPVPANWWVPENRWMVRGSDGHWVLKDFE  211



>gb|KDP46905.1| hypothetical protein JCGZ_24114 [Jatropha curcas]
Length=403

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 126/207 (61%), Gaps = 6/207 (3%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQ--QDNNV  175
            KSARDQ+ + V++L++ YK EE+SIT+TGHSLGSALATLNAVD+A   +NK     + + 
Sbjct  189  KSARDQVLDAVSKLVDQYKDEEVSITLTGHSLGSALATLNAVDIAYKGINKPTGISNKSF  248

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            PVTA  FG P VG++ FK  F    ++R +R+ + ND V  +P    +      Y  VG 
Sbjct  249  PVTAIVFGCPMVGNEGFKKVFDELSDVRVLRVENANDPVPKLPPNELILMPQHRYYHVGE  308

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               ID+  S +LK   D+   HDL  ++HG+ G QGS+GGF  +   D + +NK    L 
Sbjct  309  SLPIDTTLSPFLKTS-DVN-PHDLNVYLHGVAGTQGSKGGFNLEYPLDTALINKRGDDLN  366

Query  536  DE--YHVPVAWMNVKDKGMVQQEDGTY  610
             E  Y++P  W   ++KGMV Q+DGTY
Sbjct  367  AENNYNIPPIWWVEENKGMVLQDDGTY  393



>ref|NP_172115.1| phospholipase A1-IIalpha [Arabidopsis thaliana]
 sp|Q9LNC2.1|PLA18_ARATH RecName: Full=Phospholipase A1-IIalpha [Arabidopsis thaliana]
 gb|AAF80222.1|AC025290_11 Contains similarity to petal abundant lipase-like protein Pn47p 
mRNA from Ipomoea nil gb|U55867 and contains a lipase PF|01764 
domain [Arabidopsis thaliana]
 gb|AEE27968.1| phospholipase A1-IIalpha [Arabidopsis thaliana]
Length=423

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 124/207 (60%), Gaps = 11/207 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAV---NPVNKNQQDNNV  175
            SA++Q++ E+ RL+ELYK EEISIT TGHSLG+ ++ L+A DL     N +N N Q   V
Sbjct  194  SAQEQVQGELKRLLELYKDEEISITFTGHSLGAVMSVLSAADLVYGKKNNININLQKKQV  253

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            P+T F FG P++GD NFK+   +   L  +RI +V D+    P         +LY  +G 
Sbjct  254  PITVFAFGSPRIGDHNFKNVVDSLQPLNILRIVNVPDVAPHYPL--------LLYSEIGE  305

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I++  S YLK  L+   +H+L  ++HG+ G Q + G F+ +   DIS +NK    LK
Sbjct  306  VLEINTLNSTYLKRSLNFRNYHNLEIYLHGMAGMQDTDGVFKLEIGRDISLVNKGLDALK  365

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYIL  616
            DEY VP  W  + +KGM+Q +DGT+ L
Sbjct  366  DEYLVPSTWRCLANKGMLQMDDGTWKL  392



>gb|AAM61647.1| lipase-like protein [Arabidopsis thaliana]
Length=423

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 124/207 (60%), Gaps = 11/207 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAV---NPVNKNQQDNNV  175
            SA++Q++ E+ RL+ELYK EEISIT TGHSLG+ ++ L+A DL     N +N N Q   V
Sbjct  194  SAQEQVQGELKRLLELYKDEEISITFTGHSLGAVMSVLSAADLVYGKKNNININLQKKQV  253

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            P+T F FG P++GD NFK+   +   L  +RI +V D+    P         +LY  +G 
Sbjct  254  PITVFAFGSPRIGDHNFKNVVDSLQPLNILRIVNVPDVAPHYPL--------LLYSEIGE  305

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I++  S YLK  L+   +H+L  ++HG+ G Q + G F+ +   DIS +NK    LK
Sbjct  306  VLEINTLNSTYLKRSLNFRNYHNLEIYLHGMAGMQDTDGVFKLEIGRDISLVNKGLDALK  365

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYIL  616
            DEY VP  W  + +KGM+Q +DGT+ L
Sbjct  366  DEYLVPSTWRCLANKGMLQMDDGTWKL  392



>gb|EMT21704.1| Putative lipase [Aegilops tauschii]
Length=433

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/207 (40%), Positives = 126/207 (61%), Gaps = 9/207 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDN-NVPV  181
            SA++Q+ +EV RL+ELYK EE+SITV GHSLG++LATLNAVDL  +  NK +    + PV
Sbjct  231  SAKEQVLKEVRRLVELYKDEEVSITVCGHSLGASLATLNAVDLVSSGANKPESSTKSFPV  290

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            TA  F  P VGD+ F+ AF++  +L+ + + +  D+V M P         + Y  V V  
Sbjct  291  TAIVFASPHVGDRFFRSAFNSFPDLKALHVQNAGDIVPMYP--------PLGYVDVAVEL  342

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
             I + +S Y++    ++  H+L  ++HG+ G QGS GGF+ + + D++ +NK    L +E
Sbjct  343  TIRTIRSPYMRMPATVLTLHNLECYLHGVAGEQGSAGGFKLEVERDVALVNKGVDALTNE  402

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDD  622
            + VP  W   K K MV+ +DG + L D
Sbjct  403  HPVPAEWWVPKHKFMVKGKDGRWTLQD  429



>gb|EMT05578.1| hypothetical protein F775_13080 [Aegilops tauschii]
Length=414

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 127/213 (60%), Gaps = 11/213 (5%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN----KNQQDN  169
            +SARDQ+ EEV RL+E +K E  SITVTGHSLG++LATLNAVD+  + VN      QQ  
Sbjct  207  QSARDQVTEEVRRLMEAHKEEATSITVTGHSLGASLATLNAVDMVSHGVNVPPSSPQQQP  266

Query  170  NVPVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAV  349
              PVTA  F  P VGD +FK AF++  +LR + + +  D+V + P    V       +A 
Sbjct  267  PCPVTAILFASPHVGDDSFKSAFASFPDLRALHVRNAGDVVPLYPPLGYV-------DAA  319

Query  350  GVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQG  529
                 +D+ +S YLK    +   H+L  ++HG+ GFQG+ GGF+ + D D++ +NK    
Sbjct  320  TAVLPVDTGRSPYLKQPGTVQTRHNLECYLHGVAGFQGASGGFKLEVDRDVALVNKGADA  379

Query  530  LKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            LKD+Y VP  W  + +K MV+  DG + L D E
Sbjct  380  LKDKYPVPPNWHVINNKSMVRDSDGHWKLRDFE  412



>ref|XP_004968489.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Setaria 
italica]
Length=570

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 127/226 (56%), Gaps = 17/226 (8%)
 Frame = +2

Query  5    SARDQIREEVARLIELY--KGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVP  178
            SAR+Q   EV +L+ELY  +GEE+S+T+TGHSLGSALA LNA D+A    N        P
Sbjct  274  SAREQALAEVRKLVELYHGRGEEVSVTITGHSLGSALAMLNAFDVAETGANATPSGGAAP  333

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWG------------SQVG  322
            V  F F GP+VG+  F++ F  +  +R +R+ +V+D V  VP                V 
Sbjct  334  VCVFSFAGPRVGNLGFRERFERELGVRALRVVNVHDWVPKVPGAIFNEAAFPEAVLRAVD  393

Query  323  GKNI--LYEAVGVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDF  496
            G  +  +Y  +GV   +D + S +LK  +DI  +H+L  H+H +DGF+    GFE  G  
Sbjct  394  GLGVAGVYTHLGVALELDHRASPFLKDTIDITCYHNLEAHLHLLDGFRSRGEGFELSGR-  452

Query  497  DISKLNKYRQGLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            D + +NK    L+DE+ VP  W   ++KG+V+ EDG ++L     D
Sbjct  453  DPALVNKSTDFLRDEHKVPPVWYQAENKGLVKTEDGRWVLRPRHRD  498



>ref|XP_008238422.1| PREDICTED: phospholipase A1-IIgamma-like [Prunus mume]
Length=390

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 91/209 (44%), Positives = 122/209 (58%), Gaps = 11/209 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVP-V  181
            S RDQ+   V  L++  K EEISITVTGHS+GSA+A LNA D+  N  NK    NNV  V
Sbjct  178  SCRDQVLAAVRELVDQNKDEEISITVTGHSMGSAIAVLNATDIVYNGYNKPTNSNNVSLV  237

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            TA  F  P VGDQ FK  FS+  NLR +RI++  D V  +P         + Y  VG   
Sbjct  238  TAIVFACPNVGDQGFKKVFSSLENLRVLRITNEWDPVPKLP--------ILPYVPVGKEL  289

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
            +ID+ KS YLK  +D +  H L  ++HG+ G QG    F+ + + D++ +NK   GL D+
Sbjct  290  VIDTLKSPYLKNAIDSV--HQLEVYLHGVAGTQGRNNDFKLEINRDLALVNKILDGLDDK  347

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            YH+   W   ++  MVQ EDG++ L DHE
Sbjct  348  YHIIPKWWIERNNSMVQMEDGSWELMDHE  376



>ref|XP_010475356.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
 ref|XP_010475357.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
Length=423

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 125/211 (59%), Gaps = 11/211 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAV---NPVNKNQQDNNV  175
            SAR+Q++ E+ RL+E+YK EE+SIT TGHSLG+ ++ L+A D+     + +N + Q   V
Sbjct  194  SAREQVQGELKRLLEVYKNEEVSITFTGHSLGAVMSVLSAADIVYGKNSIINISLQKKQV  253

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            P+T F FG P++GDQ+FK    +   L  +RI +V D+    P         +LY  +G 
Sbjct  254  PITVFAFGSPRIGDQDFKKIVDSLKPLNILRIVNVPDVAPHYPL--------LLYAEIGE  305

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I++  S YLK  L+   +H+L  ++HGI G Q + G F+ +   DIS +NK    LK
Sbjct  306  VLEINTLNSTYLKRSLNFRNYHNLEIYLHGIAGMQDTAGVFKLEIGRDISLVNKGLDALK  365

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            DEY VP  W  + +KGMVQ  DGT+ L+ H 
Sbjct  366  DEYLVPSTWRCLANKGMVQMNDGTWKLNVHR  396



>ref|XP_010457749.1| PREDICTED: phospholipase A1-IIalpha [Camelina sativa]
Length=423

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 125/211 (59%), Gaps = 11/211 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAV---NPVNKNQQDNNV  175
            SAR+Q++ E+ RL+E+YK EE+SIT TGHSLG+ ++ L+A D+     + +N + Q   V
Sbjct  194  SAREQVQGELKRLLEVYKNEEVSITFTGHSLGAVMSVLSAADIVYGKNSNINISLQKKQV  253

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            P+T F FG P++GDQ+FK    +   L  +RI +V D+    P         +LY  +G 
Sbjct  254  PITVFAFGSPRIGDQDFKKIVDSLQPLNILRIVNVPDVAPHYPL--------LLYAEIGE  305

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I++  S YLK  L+   +H+L  ++HGI G Q + G F+ +   DIS +NK    LK
Sbjct  306  VLEINTLNSTYLKRSLNFRNYHNLEIYLHGIAGMQDAAGVFKLEIGRDISLVNKGLDALK  365

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            DEY VP  W  + +KGMVQ  DGT+ L+ H 
Sbjct  366  DEYLVPSTWRCLANKGMVQMNDGTWKLNVHR  396



>ref|NP_001056387.1| Os05g0574100 [Oryza sativa Japonica Group]
 sp|Q6F357.1|PLA7_ORYSJ RecName: Full=Phospholipase A1-II 7 [Oryza sativa Japonica Group]
 sp|A2Y7R2.1|PLA7_ORYSI RecName: Full=Phospholipase A1-II 7 [Oryza sativa Indica Group]
 gb|AAT69581.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAU44111.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAF18301.1| Os05g0574100 [Oryza sativa Japonica Group]
 gb|EAY99122.1| hypothetical protein OsI_21081 [Oryza sativa Indica Group]
Length=407

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 122/213 (57%), Gaps = 13/213 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN-----KNQQDN  169
            SARDQ+ EEV RL+ELYK E  SITV GHSLG++LATLNAVD+  N  N      +    
Sbjct  201  SARDQVLEEVRRLMELYKDEVTSITVVGHSLGASLATLNAVDIVANGANCPPASSSSSQP  260

Query  170  NVPVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAV  349
              PVTA  F  P+VGD  FK AF++  +LR + + +  D+V M P         + Y  V
Sbjct  261  PCPVTAIVFASPRVGDGFFKAAFASFPDLRALHVKNAGDVVPMYP--------PLGYVDV  312

Query  350  GVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQG  529
             V   I + +S YL+    I   H+L  ++HG+ G QGS GGF+ + D D++  NK    
Sbjct  313  AVKLRISTSRSPYLRSPGTIETLHNLECYLHGVAGEQGSAGGFKLEVDRDVALANKGVDA  372

Query  530  LKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            LKD+Y VP  W   K++ MV+  DG + L D E
Sbjct  373  LKDKYPVPPRWWVSKNRCMVKDADGHWALHDFE  405



>gb|KDP31780.1| hypothetical protein JCGZ_12241 [Jatropha curcas]
Length=372

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 132/213 (62%), Gaps = 9/213 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN-KNQQDNNVPV  181
            SAR+Q+ EEV RL++ +K EE S+TVTGHSLG+ALATLNA+D+A N  N  ++     PV
Sbjct  165  SAREQVIEEVKRLMQEFKHEETSLTVTGHSLGAALATLNAIDIAANGFNIGDESKERSPV  224

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            TAF F  P+VGD+NFK+   +  NL  ++I ++NDLV + P       K   Y  VG   
Sbjct  225  TAFVFASPRVGDRNFKELSESVENLHILKIKNLNDLVPLTP------PKESGYADVGKEL  278

Query  362  IIDSKKSEYL-KPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
            ++++  S ++ +PG   +  H+L  ++HG+ G QG +  F  +   DI+ LNK    L+ 
Sbjct  279  LLNTLISPFVNRPG-GPLSWHNLEAYLHGVAGTQGDKPVFHLEVKRDIALLNKEISNLQP  337

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            +Y +P AW   ++ GMV+ +DG++ L D E +E
Sbjct  338  DYLIPPAWRCPRNTGMVKMKDGSWELRDQENEE  370



>gb|ABR18391.1| unknown [Picea sitchensis]
Length=412

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 124/206 (60%), Gaps = 10/206 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEE-ISITVTGHSLGSALATLNAVDLAVNPVNKNQ-QDNNVP  178
            SAR+Q+  EV RL+E YK EE ISIT TGHSLG+ LATL A D+ +N +NK   +   +P
Sbjct  205  SAREQVLREVKRLLEKYKDEEEISITTTGHSLGATLATLCAFDIVINGLNKPSGRAIPIP  264

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P+VG+  FK       +LR +R+++  DLV + P+        + Y  VGV 
Sbjct  265  VTAIVFASPRVGNDAFKKVVDKLPDLRVLRVTNNPDLVPLHPF--------LGYVEVGVE  316

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              +D+ KS YLK   D    H+L  ++H + G QG  G F+ + D DI+ +NK    LKD
Sbjct  317  LPVDTVKSPYLKNPGDASRWHNLEAYLHTVAGTQGKNGAFKLEVDRDIALVNKSTDWLKD  376

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYIL  616
            EY VPV+W   K+KGMVQ  DG +++
Sbjct  377  EYLVPVSWWVEKNKGMVQGNDGHWLM  402



>ref|XP_008648833.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Zea 
mays]
Length=492

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/229 (39%), Positives = 130/229 (57%), Gaps = 23/229 (10%)
 Frame = +2

Query  5    SARDQIREEVARLIELY--KGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVP  178
            SAR+Q   EV + +ELY  +GE++S+TVTGHSLGSALA LNA D+A    N +      P
Sbjct  245  SAREQALAEVRKQVELYHGRGEQVSVTVTGHSLGSALAMLNAFDVAETGANASPDGRKAP  304

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPW-----------------  307
            V  F F GP+VG+  F++ F  +  +R +R+ +V+D V  VP                  
Sbjct  305  VCVFSFAGPRVGNLRFRERFQRELGVRALRVFNVHDGVPKVPGVFFNDAAFPEAVLRVVD  364

Query  308  GSQVGGKNILYEAVGVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPK  487
            G   GG   +Y  +GV   +D K S +LK  +DI  +H+L  H+H +DG++GS  GF+ +
Sbjct  365  GLGAGG---VYTHLGVPLALDHKVSPFLKETMDISCYHNLEAHLHLLDGYRGSGEGFQLR  421

Query  488  GDFDISKLNKYRQGLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            G  D + +NK    L+DE+ VP  W   ++KGMV+ EDG ++L     D
Sbjct  422  GR-DPALVNKSADFLRDEHMVPPVWYQAENKGMVRTEDGRWVLPPRHRD  469



>ref|XP_010501341.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
Length=424

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 125/211 (59%), Gaps = 11/211 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAV---NPVNKNQQDNNV  175
            SAR+Q++ E+ RL+E+YK EE+SIT TGHSLG+ ++ L+A D+     + ++ + Q   V
Sbjct  194  SAREQVQGELKRLLEVYKNEEVSITFTGHSLGAVMSVLSAADIVYGKNSKIDISLQKKQV  253

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            P+T F FG P++GDQ+FK    +   L  +RI +V D+    P         +LY  +G 
Sbjct  254  PITVFAFGSPRIGDQDFKKIVDSLKPLNILRIVNVPDVAPHYPL--------LLYAEIGE  305

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I++  S YLK  L+   +H+L  ++HGI G Q + G F+ +   DIS +NK    LK
Sbjct  306  VLEINTLNSTYLKRSLNFRNYHNLEIYLHGIAGMQDAAGVFKLEIGRDISLVNKGLDALK  365

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            DEY VP  W  + +KGMVQ  DGT+ L+ H 
Sbjct  366  DEYLVPSTWRCLANKGMVQMNDGTWKLNVHR  396



>gb|AFW75599.1| hypothetical protein ZEAMMB73_741719 [Zea mays]
Length=1364

 Score =   158 bits (400),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 93/247 (38%), Positives = 137/247 (55%), Gaps = 30/247 (12%)
 Frame = +2

Query  5     SARDQIREEVARLIELY--KGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVP  178
             SAR+Q   EV + +ELY  +GE++S+TVTGHSLGSALA LNA D+A    N +      P
Sbjct  1117  SAREQALAEVRKQVELYHGRGEQVSVTVTGHSLGSALAMLNAFDVAETGANASPDGRKAP  1176

Query  179   VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPW-----------------  307
             V  F F GP+VG+  F++ F  +  +R +R+ +V+D V  VP                  
Sbjct  1177  VCVFSFAGPRVGNLRFRERFQRELGVRALRVFNVHDGVPKVPGVFFNDAAFPEAVLRVVD  1236

Query  308   GSQVGGKNILYEAVGVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPK  487
             G   GG   +Y  +GV   +D K S +LK  +DI  +H+L  H+H +DG++GS  GF+ +
Sbjct  1237  GLGAGG---VYTHLGVPLALDHKVSPFLKETMDISCYHNLEAHLHLLDGYRGSGEGFQLR  1293

Query  488   GDFDISKLNKYRQGLKDEYHVPVAWMNVKDKGMVQQEDGTYIL-------DDHEVDETF*  646
             G  D + +NK    L+DE+ VP  W   ++KGMV+ EDG ++L       D+H  D    
Sbjct  1294  GR-DPALVNKSADFLRDEHMVPPVWYQAENKGMVRTEDGRWVLPPRHRDIDEHPDDTDHH  1352

Query  647   VQLFHVV  667
             +Q   V+
Sbjct  1353  LQQLGVI  1359



>gb|ABK23399.1| unknown [Picea sitchensis]
Length=412

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 123/206 (60%), Gaps = 10/206 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEE-ISITVTGHSLGSALATLNAVDLAVNPVNKNQ-QDNNVP  178
            SAR+Q+  EV RL+E YK EE ISIT TGHSLG+ LATL A D+ +N +NK   +   +P
Sbjct  205  SAREQVLREVKRLLEKYKDEEEISITTTGHSLGATLATLCAFDIVINGLNKPSGRAIPIP  264

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P+VG+  FK       +LR +R+++  DLV + P+        + Y  VGV 
Sbjct  265  VTAIVFASPRVGNDAFKKVVDKLPDLRVLRVTNNPDLVPLHPF--------LGYVEVGVE  316

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              +D+ KS YLK   D    H+L  ++H + G QG  G F+ + D DI+ +NK    LKD
Sbjct  317  LRVDTVKSPYLKNPGDASRWHNLEAYLHTVAGTQGKNGAFKLEVDRDIALVNKSTDWLKD  376

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYIL  616
            EY VPV+W   K+KGMVQ  DG + +
Sbjct  377  EYLVPVSWWVEKNKGMVQGNDGHWFM  402



>ref|XP_010279085.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nelumbo 
nucifera]
Length=452

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 100/265 (38%), Positives = 133/265 (50%), Gaps = 62/265 (23%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVP  178
            SAR Q+ EEV RL+E +K EEI+IT+TGHSLG+AL  LNAVD+  N +NK  +  D    
Sbjct  191  SARQQVLEEVKRLVEEFKDEEINITITGHSLGAALGILNAVDIVANGLNKPTDHPDKACL  250

Query  179  VTAFFFGGPKVGDQNFKDAFS---NQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAV  349
            VTAF FG P VGD NF++ FS   +  +LR +RI +  D+V   P         I Y  V
Sbjct  251  VTAFLFGCPLVGDANFRNVFSILNSTQHLRLLRIRNAIDVVPNYP-------PMIGYTQV  303

Query  350  GVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSR--------------------  469
            G   +I++  S +LK   + M  H+L  ++HGI G QGS                     
Sbjct  304  GEELVINTDTSPFLKESAEPMSWHNLEIYLHGIAGTQGSSVLPATTNKTRTRSRSGSSSS  363

Query  470  ------------------------GGFEPKGDF------DISKLNKYRQGLKDEYHVPVA  559
                                     G    G+F      DI+ +NK    LKDE+HVP  
Sbjct  364  SKHPVIHHLMGLACPCFVAAASSAQGTSEGGEFKLVVKRDITLVNKVMDALKDEFHVPAK  423

Query  560  WMNVKDKGMVQQEDGTYILDDHEVD  634
            W   K+KGMVQ++DG++ L DHE D
Sbjct  424  WWCEKNKGMVQEDDGSWKLMDHESD  448



>ref|XP_004301748.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=392

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 88/222 (40%), Positives = 133/222 (60%), Gaps = 16/222 (7%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVP  178
            S RDQ    +  +++ YK EEISIT+TGHS+G+A+A LNA D+  N  NK   Q +  +P
Sbjct  175  SCRDQAVAALKEILDEYKDEEISITITGHSMGAAMAILNAADIVHNGYNKLACQPNKLIP  234

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P++G++ F++ FS   NL  +RI++  D+V  +P           Y  VG  
Sbjct  235  VTAIVFACPRLGNKGFENVFSGLENLHVLRITNDQDIVPNLPDLED-------YAHVGKE  287

Query  359  FIIDSKKSEYLKPGLDIMVH------HDLMFHMHGIDGFQGSRG-GFEPKGDFDISKLNK  517
              ID+ KS +LK   D +V       H+L  ++HG+ G QG +  GF+ + D D++ +NK
Sbjct  288  LRIDTLKSPFLKVIPDTLVTERIGNLHNLEVYLHGVAGTQGVKSSGFKMEVDRDLALVNK  347

Query  518  YRQGLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDETF  643
            +  GLKDE++V   W   K+K M+Q++DG+++LDDHE D T 
Sbjct  348  HIDGLKDEHNVVAQWWTEKNKSMIQKDDGSWVLDDHEEDATI  389



>ref|XP_003567848.1| PREDICTED: phospholipase A1-II 7-like [Brachypodium distachyon]
Length=425

 Score =   152 bits (384),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 89/216 (41%), Positives = 127/216 (59%), Gaps = 15/216 (7%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK-------NQQ  163
            SARDQ+ EEV RL+EL+KGE  SIT+TGHSLG++LA LNAVD+  N +N        + Q
Sbjct  215  SARDQVLEEVKRLMELHKGEVTSITLTGHSLGASLAILNAVDIVSNGLNTPSTSSSSSSQ  274

Query  164  DNNVPVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYE  343
                PVTA  F  P VG+ +FK AF++  +LR + + +  D+V + P    +G  ++   
Sbjct  275  LPPCPVTAIVFACPHVGNDDFKSAFASFSDLRALHVINARDIVPLYP---PIGYVDVATA  331

Query  344  AVGVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRG-GFEPKGDFDISKLNKY  520
            A+     ID+ +S YL+        H+L  ++HG+ G QG +G GF  + D D++ +NK 
Sbjct  332  ALR----IDTSRSPYLRSPGTPQTWHNLECYLHGVAGEQGGQGRGFRLEVDRDVALVNKG  387

Query  521  RQGLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
               LKDEY VP  W  V +KGMV+   G + L D E
Sbjct  388  SDALKDEYPVPANWWVVSNKGMVRGAGGHWKLKDFE  423



>ref|XP_004301746.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=392

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 131/222 (59%), Gaps = 17/222 (8%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN---KNQQDNNV  175
            ++RDQ    +  ++  YKGEEISITVTGHS+G+A+ATL A D+  N  N   ++Q +  +
Sbjct  176  NSRDQALAALKEVLNEYKGEEISITVTGHSMGAAMATLKATDIVRNGYNILLEDQPNKVI  235

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            PVTAF F  P+VG++ F + FS   NL  +R+++  D+V   P  +        Y  VG 
Sbjct  236  PVTAFVFACPRVGNEGFGNVFSGLENLHVLRVTNDQDIVPKQPETAD-------YVHVGK  288

Query  356  GFIIDSKKSEYLKPGLDIMVH------HDLMFHMHGIDGFQG-SRGGFEPKGDFDISKLN  514
                DS KS ++K   D+++       HDL  ++HG+ G  G +   F+ + D D+S +N
Sbjct  289  ELRFDSVKSPFMKVIPDVVIKEKVGILHDLEVYLHGVAGTHGINSSDFKLEVDRDLSLVN  348

Query  515  KYRQGLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDET  640
            KY  G+KDEY++   W   K+K M+Q  DG ++LDDHE DE+
Sbjct  349  KYIDGVKDEYNIVAEWWTEKNKSMIQTSDGFWVLDDHEKDES  390



>emb|CDY10187.1| BnaC05g04300D [Brassica napus]
Length=402

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 123/213 (58%), Gaps = 11/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLA---VNPVNKNQQDNNV  175
            SAR+Q++ E+ RL+++YK EE+SIT TGHSLG  ++TL A DL     N ++   +   V
Sbjct  194  SAREQVQGELKRLLDVYKNEEVSITFTGHSLGGVMSTLAAADLVNGKKNTISSGLERKQV  253

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            P+T F FG P++GDQ+F     +   L  +RI +V D+    P         +LY  VG 
Sbjct  254  PITVFAFGCPRIGDQDFVKIVDSLKQLNILRIVNVPDVAPHYPL--------LLYAEVGQ  305

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I++  S YLK  L+   +H+L  ++HG+ G Q   G F+     DIS +NK    LK
Sbjct  306  ELQINTLNSTYLKRSLNFRNYHNLEIYLHGMAGMQDKAGLFKLVIGRDISLVNKGLDALK  365

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            DE+ VP  W  + +KGMVQ++DGT+ LD H  D
Sbjct  366  DEFLVPSTWRCLANKGMVQKDDGTWQLDVHRKD  398



>gb|KDP21071.1| hypothetical protein JCGZ_21542 [Jatropha curcas]
Length=407

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/218 (44%), Positives = 135/218 (62%), Gaps = 13/218 (6%)
 Frame = +2

Query  2    KSARDQIREEVARL--IELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK-NQQDNN  172
            +SAR+Q+     R    ++   E++SIT+TGHSLGSALATLNA+D+A N  NK +  D  
Sbjct  179  RSAREQVLAAARRNGDKDVALKEDVSITITGHSLGSALATLNAMDIAFNGYNKPSGSDTG  238

Query  173  VPVTAFFFGGPKVGDQNFKDAFS---NQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYE  343
             PVTAF F  P+VG++ F+D F+   + G L  +RI + ND+V  +P   ++   +  YE
Sbjct  239  YPVTAFVFASPRVGNKEFQDVFNGLQDAGTLHLLRIRNYNDIVPELP--PKI--LDFTYE  294

Query  344  AVGVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYR  523
             VGV   +D+ KS Y+K G  I   HDL  +MHG+ G+QG+   F+   + DI+ LNKY 
Sbjct  295  DVGVELYLDTTKSPYIK-GESITEAHDLNLYMHGVAGYQGNE-DFKLVINLDIALLNKYN  352

Query  524  QGLKDEYHVPVAWM-NVKDKGMVQQEDGTYILDDHEVD  634
              LKD Y VP  W  NV  +GM+Q +DGT+ L+D+  D
Sbjct  353  DLLKDSYGVPPNWWSNVFRQGMIQFDDGTWKLNDYVPD  390



>ref|XP_009119078.1| PREDICTED: phospholipase A1-IIalpha [Brassica rapa]
Length=440

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 123/213 (58%), Gaps = 11/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLA---VNPVNKNQQDNNV  175
            SAR+Q++ E+ RL+++YK EE+SIT TGHSLG  ++TL A DL     N ++   +   V
Sbjct  232  SAREQVQGELKRLLDVYKNEEVSITFTGHSLGGVMSTLAAADLVNGKKNTISSGLERKQV  291

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            P+T F FG P++GDQ+F     +   L  +RI +V D+    P         +LY  VG 
Sbjct  292  PITVFAFGCPRIGDQDFVKIVDSLKQLNILRIVNVPDVAPHYPL--------LLYAEVGQ  343

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I++  S YLK  L+   +H+L  ++HG+ G Q   G F+     DIS +NK    LK
Sbjct  344  ELQINTLNSTYLKRSLNFRNYHNLEIYLHGMAGMQDKAGLFKLVIGRDISLVNKGLDALK  403

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            DE+ VP  W  + +KGMVQ++DGT+ LD H  D
Sbjct  404  DEFLVPSTWRCLANKGMVQKDDGTWQLDVHRKD  436



>ref|XP_002455039.1| hypothetical protein SORBIDRAFT_03g003410 [Sorghum bicolor]
 gb|EES00159.1| hypothetical protein SORBIDRAFT_03g003410 [Sorghum bicolor]
Length=513

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 130/223 (58%), Gaps = 20/223 (9%)
 Frame = +2

Query  5    SARDQIREEVARLIELY--KGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNV-  175
            SAR+Q   EV +L+ELY  +GE++S+TVTGHSLGS LA L A D+A    N +  D  V 
Sbjct  265  SAREQALAEVRKLVELYHGRGEQVSVTVTGHSLGSGLAMLCAFDVAETRANASPDDGRVR  324

Query  176  --PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVP--WGSQVGGKNILYE  343
              PV  F F GP+VG+  F+  F  +  +R +R+ +V+D V  VP  + ++     ++  
Sbjct  325  VAPVCVFSFAGPRVGNVGFRRRFERELGVRALRVVNVHDRVPKVPGVFFNEAAFPELVLR  384

Query  344  AVG------------VGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPK  487
            AVG            V   +D + S +LK  LDI  +H+L  H+H +DGF+GS  GFE +
Sbjct  385  AVGRLGVGGVYTHLGVALELDHRASPFLKETLDISCYHNLEAHLHLLDGFRGSGEGFELR  444

Query  488  GDFDISKLNKYRQGLKDEYHVPVAWMNVKDKGMVQQEDGTYIL  616
            G  D + +NK    L++++ VP  W   ++KGMV+ EDG ++L
Sbjct  445  GR-DPALVNKSSDFLREDHMVPPVWYQAENKGMVRTEDGRWVL  486



>ref|XP_002437113.1| hypothetical protein SORBIDRAFT_10g021260 [Sorghum bicolor]
 ref|XP_002438518.1| hypothetical protein SORBIDRAFT_10g021270 [Sorghum bicolor]
 gb|EER88480.1| hypothetical protein SORBIDRAFT_10g021260 [Sorghum bicolor]
 gb|EER89885.1| hypothetical protein SORBIDRAFT_10g021270 [Sorghum bicolor]
Length=401

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 119/210 (57%), Gaps = 8/210 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN-KNQQDNNVPV  181
            SAR Q+ EEV  L+E YK E  SITV GHSLG++LATLNA+D+  N VN  + Q    PV
Sbjct  198  SARAQVLEEVRNLVEQYKDEVTSITVAGHSLGASLATLNAIDMVANGVNGASSQPPPCPV  257

Query  182  TAFFFGGPKVGDQNFKDAFSNQGN-LRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            +A  F  P+VGD++F  AF + G+ LR + + +  D VT+ P            + V V 
Sbjct  258  SAVVFASPRVGDESFAAAFRSFGDQLRALHVKNSGDQVTLYPTAKGYS------DDVAVT  311

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ++   S YL+        H+L  ++HG+ G QGS GGF  +   D + +NK   GLKD
Sbjct  312  LPVNPSLSPYLRSPATQQTLHNLECYLHGVAGEQGSAGGFNLEVCRDEALVNKDADGLKD  371

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            EYHVP +W  V +K MV+   G + L D E
Sbjct  372  EYHVPASWWVVLNKSMVKNAKGKWELRDFE  401



>emb|CDY57813.1| BnaA10g28020D [Brassica napus]
Length=545

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 123/213 (58%), Gaps = 11/213 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLA---VNPVNKNQQDNNV  175
            SAR+Q++ E+ RL+++YK EE+SIT TGHSLG  ++TL A DL     N ++   +   V
Sbjct  337  SAREQVQGELKRLLDVYKNEEVSITFTGHSLGGVMSTLAAADLVNGKKNTISAGLERKQV  396

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            P+T F FG P++GDQ+F     +   L  +RI +V D+    P         +LY  VG 
Sbjct  397  PITVFAFGCPRIGDQDFVKIVDSLKQLNILRIVNVPDVAPHYPL--------LLYAEVGQ  448

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I++  S YLK  L+   +H+L  ++HG+ G Q   G F+     DIS +NK    LK
Sbjct  449  ELQINTLNSTYLKRSLNFRNYHNLEIYLHGMAGMQDKAGLFKLVIGRDISLVNKGLDALK  508

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            DE+ VP  W  + +KGMVQ++DGT+ LD H  D
Sbjct  509  DEFLVPSTWRCLANKGMVQKDDGTWQLDVHRKD  541



>ref|XP_007014120.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY31739.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=428

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 131/212 (62%), Gaps = 16/212 (8%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVP  178
            SARDQ+RE V +L++ Y+ E+ISITVTG+SLG+ALATL+A+D+  +  NK     + +  
Sbjct  219  SARDQVREAVRKLVDKYQDEDISITVTGYSLGAALATLSAMDIVASGYNKPTGNSEKSCM  278

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVP--WGSQVGGKNILYEAVG  352
            VT F + GP+VG++ FK  F    +L  +RI++  D+V  +P  +G        +Y  VG
Sbjct  279  VTTFTYAGPRVGNEGFKKVFEGLSDLHLLRITNSTDIVPKIPILFG--------IYTHVG  330

Query  353  VGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGL  532
                ID+ KS+YLK   D    H+L  ++HG+ G Q + G F  + D DI+ +NK+  GL
Sbjct  331  EELEIDTTKSDYLKSNADA---HNLDVYLHGVAGVQETNGDFTLEVDHDIALINKHLDGL  387

Query  533  KDEYHVPVAWMNVKD-KGMVQQEDGTYILDDH  625
            KD+Y +P  W N ++ K MVQ +DG + L D+
Sbjct  388  KDDYKIPPEWWNNENFKNMVQMDDGHWKLVDN  419



>gb|EMT11182.1| hypothetical protein F775_27795 [Aegilops tauschii]
Length=474

 Score =   150 bits (379),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 120/202 (59%), Gaps = 9/202 (4%)
 Frame = +2

Query  20   IREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQ-QDNNVPVTAFFF  196
            + +EV RL+ELYK EE+SITV GHSLG+++ATLNAVDL  + +NK +    + PVTA  F
Sbjct  277  VVKEVRRLVELYKNEEVSITVCGHSLGASVATLNAVDLVSSGINKPEGSTKSFPVTAIVF  336

Query  197  GGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFIIDSK  376
              P VG + F+ AF++  +L+ + + +  D+V M P         + Y  V V   I + 
Sbjct  337  ASPHVGCRFFRSAFNSFPDLKALHVQNAGDVVPMYP--------PLGYVDVAVELTIRTI  388

Query  377  KSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEYHVPV  556
            +S Y++    +   H+L  ++HG+ G QGS GGF+ + D DI+ +NK    L DE+ VP 
Sbjct  389  RSPYIRKPATVGTLHNLECYLHGVAGEQGSAGGFKLEVDRDIALVNKGADALTDEHPVPA  448

Query  557  AWMNVKDKGMVQQEDGTYILDD  622
             W   + K MV+ EDG + L D
Sbjct  449  CWWVPRHKFMVKGEDGRWTLQD  470



>ref|XP_006374295.1| hypothetical protein POPTR_0015s05760g [Populus trichocarpa]
 gb|ERP52092.1| hypothetical protein POPTR_0015s05760g [Populus trichocarpa]
Length=412

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 124/214 (58%), Gaps = 15/214 (7%)
 Frame = +2

Query  5    SARDQIREEVARLIELY--KGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQ-QDNNV  175
            SAR+Q+  EV RL++ Y   GEE+SITV GHSLG+ALATLNA+D+  N  NK    D   
Sbjct  198  SAREQVLAEVRRLVDRYALNGEEVSITVAGHSLGAALATLNAMDIVANGYNKPSGSDIGF  257

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGN-LRGMRISDVNDLVTMVPWGSQVGGKNILYEAVG  352
            PVT F +  P+VGDQ F+D F+   N L  +RI +  D V   P         +LY+ VG
Sbjct  258  PVTVFAYACPRVGDQGFQDVFNGLTNDLHVLRIKNSKDPVPRHP--------VLLYQDVG  309

Query  353  VGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGL  532
                IDS KS Y K   D    HDL  ++H I G+QG    F+   D DI+ LNK    L
Sbjct  310  KELEIDSIKSPYPK---DPTKPHDLELYLHTIAGYQGKEEEFKLVVDRDIALLNKGLDLL  366

Query  533  KDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
             D+Y +P  W NVK+ GM+Q ++G + L+D+  D
Sbjct  367  PDKYKIPPNWWNVKNNGMIQTDNGFWKLNDYVPD  400



>ref|XP_006306316.1| hypothetical protein CARUB_v10012192mg [Capsella rubella]
 gb|EOA39214.1| hypothetical protein CARUB_v10012192mg [Capsella rubella]
Length=423

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 122/208 (59%), Gaps = 11/208 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAV---NPVNKNQQDNNV  175
            SAR+Q++ E+ RL+E+YK EE+SIT TGHSLG+ ++ L+A D      N  N +     V
Sbjct  194  SAREQVQGELKRLLEVYKNEEVSITFTGHSLGAVMSVLSAADFVYGKNNKTNISLPKKQV  253

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            P+T F FG P++GDQ+FK    +   +  +RI +V D+    P         +LY  +G 
Sbjct  254  PITVFAFGSPRIGDQDFKKIVDSLQQINILRIVNVPDVAPHYPL--------LLYAEIGE  305

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I++  S YLK  L+   +H+L  ++HG+ G + + G F+ +   DIS +NK    LK
Sbjct  306  VLEINTLNSTYLKRSLNFRNYHNLEIYLHGMAGMKDTAGVFKLEIGRDISLVNKGLDALK  365

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILD  619
            DEY VP  W  + +KGMVQ +DGT+ L+
Sbjct  366  DEYLVPSTWRCLANKGMVQMDDGTWKLN  393



>ref|XP_006410236.1| hypothetical protein EUTSA_v10016726mg [Eutrema salsugineum]
 gb|ESQ51689.1| hypothetical protein EUTSA_v10016726mg [Eutrema salsugineum]
Length=414

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 128/208 (62%), Gaps = 11/208 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQ---QDNNV  175
            SA++Q++ E+ RL+ELYK EE++IT+TGHSLG+ L+ L+A D   N   K     QD   
Sbjct  197  SAQEQVQGELKRLLELYKDEEVTITLTGHSLGAVLSILSATDFLHNEWPKTTTSLQDRLS  256

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
             VT F FG P++GD NFK    +   L  +RIS+V DL+   P           +  +G 
Sbjct  257  CVTVFAFGSPRIGDLNFKRLVESLKKLNILRISNVPDLIPRYP--------VFRFADIGE  308

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I++ KSEYLK  L+I   H+L  ++HG+ G Q ++G F+ + + DI+ +NK    L+
Sbjct  309  ELQINTLKSEYLKRSLNIKHFHNLEAYLHGVAGTQQNQGEFKLEINRDIALVNKGLDALE  368

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILD  619
            D+Y VP  W  +++KGMVQ++DGT++L+
Sbjct  369  DKYLVPDHWWVLENKGMVQRDDGTWMLN  396



>ref|XP_009333706.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=378

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 124/213 (58%), Gaps = 12/213 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVP  178
            S R Q+   +  +++ YK EEISITV GHS+G A A LNA+D+  N  NK  ++ D    
Sbjct  175  SCRAQVLTAIKEVVDQYKDEEISITVCGHSMGGAFAILNAIDIVCNGYNKPTDRPDKACL  234

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VT+  F  P++GDQ F + FS+  NL  +R+++  D+V  +P   +       Y  VG  
Sbjct  235  VTSIVFASPRLGDQGFHNVFSSLNNLHVLRVTNSYDIVPYLPPLEK-------YVDVGKE  287

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID+ KS YLK        H L  ++HG+ G QG R GF+   + DI+ +NK   GLKD
Sbjct  288  LKIDTLKSPYLKNAKKDA--HRLEIYLHGVAGTQG-RNGFQLVINRDIALVNKKLDGLKD  344

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            EY+V V W   K+K MVQ +DG+++L DHE D+
Sbjct  345  EYNVIVNWWTEKNKSMVQMDDGSWVLLDHEKDD  377



>ref|NP_001149813.1| triacylglycerol lipase [Zea mays]
 gb|ACG36877.1| triacylglycerol lipase [Zea mays]
Length=400

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 114/205 (56%), Gaps = 9/205 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQ-DNNVPV  181
            SAR Q   EV RL++ Y+GEE+SITVTGHSLG+ALATLNA D+A N  N         PV
Sbjct  194  SARHQALGEVRRLVDAYRGEELSITVTGHSLGAALATLNAFDIAANGYNVTATGAAACPV  253

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            T+F F  P+VG   FK  F     LR +R+ +  D+V   P         + Y  VG   
Sbjct  254  TSFAFASPRVGGGGFKKRFDAVPGLRLLRVRNARDVVPKYP--------VVFYHDVGAEL  305

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
             ID+ +S YL+        H+L  ++HG+ G +G+RGGFE     D++ +NK    L+D 
Sbjct  306  AIDTGESPYLRSPGGEQTWHNLEVYLHGVAGTRGARGGFELAVARDVALVNKAYDALRDH  365

Query  542  YHVPVAWMNVKDKGMVQQEDGTYIL  616
            + VP  W    ++GMV+  DG + L
Sbjct  366  HGVPPGWWVPLNRGMVEGADGRWSL  390



>ref|XP_008345355.1| PREDICTED: phospholipase A1-IIgamma-like [Malus domestica]
Length=407

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 123/213 (58%), Gaps = 12/213 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVP  178
            S R Q+   +  +++ YK EEISITV GHS+G A A LNA D+  N  NK  ++ D    
Sbjct  204  SCRAQVLTAIKEVVDQYKDEEISITVCGHSMGGAFAILNATDIVCNGYNKPTDRPDKACL  263

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VT+  F  P++GDQ F D FS+  NL  +R+++  D+V  +P   +       Y  VG  
Sbjct  264  VTSIVFASPRLGDQGFHDVFSSLKNLHVLRVTNSYDIVPHLPPLEK-------YVDVGKE  316

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID+ KS YLK        H L  ++HG+ G QG R GF+   + DI+ +NK   GLKD
Sbjct  317  LKIDTLKSPYLKNAKKDA--HRLEIYLHGVAGTQG-RNGFQLVINRDIALVNKKLDGLKD  373

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            EY+V V W   K+K MVQ +DG+++L DHE D+
Sbjct  374  EYNVIVKWWTEKNKSMVQMDDGSWVLLDHEKDD  406



>gb|AFW79273.1| hypothetical protein ZEAMMB73_515320 [Zea mays]
Length=400

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 114/205 (56%), Gaps = 9/205 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN-KNQQDNNVPV  181
            SAR Q   EV RL++ Y+GEE+SITVTGHSLG+ALATLNA D+A N  N         PV
Sbjct  194  SARHQALGEVRRLVDAYRGEELSITVTGHSLGAALATLNAFDIAANGYNVAATGAAACPV  253

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            T+F F  P+VG   FK  F     LR +R+ +  D+V   P         + Y  VG   
Sbjct  254  TSFAFASPRVGGGGFKKRFDAVPGLRLLRVRNARDVVPKYP--------VVFYHDVGAEL  305

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
             ID+ +S YL+        H+L  ++HG+ G +G+RGGFE     D++ +NK    L+D 
Sbjct  306  AIDTGESPYLRSPGGEQTWHNLEVYLHGVAGTRGARGGFELAVARDVALVNKAYDALRDH  365

Query  542  YHVPVAWMNVKDKGMVQQEDGTYIL  616
            + VP  W    ++GMV+  DG + L
Sbjct  366  HGVPPGWWVPLNRGMVEGADGRWSL  390



>ref|XP_002522552.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39852.1| triacylglycerol lipase, putative [Ricinus communis]
Length=403

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/216 (41%), Positives = 121/216 (56%), Gaps = 10/216 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELY----KGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDN-  169
            S R+Q+   V RL++ +      E +SITV GHSLG+ALATLNAVD+  N  N+      
Sbjct  180  SVREQVLAAVRRLVDKHYEAGSNEVVSITVIGHSLGAALATLNAVDIVANEYNRPTGSTV  239

Query  170  NVPVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAV  349
             +PV +F FG P+VGD+ F D FS   NL  +RI +  D +  +P    +G     Y  V
Sbjct  240  ELPVASFVFGSPRVGDKGFLDVFSGLKNLHLLRIRNAQDFIPELPPKKILGYS---YADV  296

Query  350  GVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQG  529
            G    ID+  S Y+K     M  HDL  + HGI G+QG    F+   DFD++ +NKY   
Sbjct  297  GAELDIDTSLSPYIKKAT-FMEPHDLNLYCHGISGYQGKDRKFKLAVDFDLALVNKYNDL  355

Query  530  LKDEYHVPVAWM-NVKDKGMVQQEDGTYILDDHEVD  634
            L ++Y VP  W  NV +KGM Q +DG++ L D+  D
Sbjct  356  LLEDYKVPPKWWSNVMNKGMAQMDDGSWKLHDYVPD  391



>ref|XP_011047741.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=411

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 128/215 (60%), Gaps = 13/215 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELY--KGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQ-QDNNV  175
            SAR+Q+  EV RL+++Y   GEE+SITV GHSLG+ALATLN VD+  N  NK    D   
Sbjct  183  SAREQVLAEVRRLVDMYALNGEEVSITVAGHSLGAALATLNGVDMVANGFNKPSGSDVGF  242

Query  176  PVTAFFFGGPKVGDQNFKDAFSN-QGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVG  352
            PVT F +  P+VGDQ F+D F+    +L  +RI +  D++  +P    +G     Y+ VG
Sbjct  243  PVTVFAYASPRVGDQGFQDVFNGLTTDLHVLRIKNSKDIIPRLPPVFLLG-----YQDVG  297

Query  353  VGFIIDSKKSEYLK-PGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQG  529
                IDS KS YLK P       H+L  ++H I G+QG    F+   D DI+ LNK    
Sbjct  298  EKLEIDSIKSPYLKDPKAQ---PHNLELYLHTIAGYQGQEEEFKLVVDRDIALLNKSLDL  354

Query  530  LKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            + D+Y++P  W NVK+ GM+Q ++G + L+D+  D
Sbjct  355  VLDKYNIPPTWWNVKNNGMIQIDNGFWKLNDYVPD  389



>ref|XP_006428509.1| hypothetical protein CICLE_v10011873mg [Citrus clementina]
 gb|ESR41749.1| hypothetical protein CICLE_v10011873mg [Citrus clementina]
Length=407

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 129/221 (58%), Gaps = 19/221 (9%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK---NQQDNNV  175
            SA+DQ+R  V  L++ Y  EE+SITV GHSLGSALATLNA DLA N  NK   +   +  
Sbjct  185  SAKDQVRSAVRTLVDKYGDEEMSITVIGHSLGSALATLNAADLAANGYNKPTGSDTASGC  244

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
             VT   F  P+VGD  FK AF +Q  LR +RI++ ND+V  VP      G    Y  VG 
Sbjct  245  MVTTIVFASPRVGDSAFKTAFEDQKLLRLLRITNKNDIVPNVP--PVFSG----YVDVGR  298

Query  356  GFIIDSKKSEYLK---PGLDI-MVHHDLMFHMHGIDGFQGSRG----GFEPKGDFDISKL  511
               +D+ KS Y+K   P L +  V H+L  ++HGI G   S+G     FE   D DI+ L
Sbjct  299  ELKVDTTKSTYVKTVIPPLSLPSVLHNLENYLHGIAG--TSQGDDDDDFELAIDRDIALL  356

Query  512  NKYRQGLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            NK    LKDEY VP  W  VK+KGMVQ ++G + L+D+  D
Sbjct  357  NKGLDLLKDEYGVPPNWWTVKNKGMVQLDNGFWKLEDYVPD  397



>ref|XP_008355592.1| PREDICTED: phospholipase A1-IIgamma-like [Malus domestica]
Length=255

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 122/212 (58%), Gaps = 12/212 (6%)
 Frame = +2

Query  8    ARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVPV  181
             + ++   +  +++ YK EEISITV GHS+G A A LNA D+  N  NK  ++ D    V
Sbjct  53   TKGEVLTAIKEVVDQYKDEEISITVCGHSMGGAFAILNATDIVCNGYNKPTDRPDKACLV  112

Query  182  TAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
            T+  F  P++GDQ F D FS+  NL  +R+++  D+V  +P   +       Y  VG   
Sbjct  113  TSIVFASPRLGDQGFHDVFSSLKNLHVLRVTNSYDIVPHLPPLEK-------YVDVGKEL  165

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
             ID+ KS YLK        H L  ++HG+ G QG R GF+   + DI+ +NK   GLKDE
Sbjct  166  KIDTLKSPYLKNAKKDA--HRLEIYLHGVAGTQG-RNGFQLVINRDIALVNKKLDGLKDE  222

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
            Y+V V W   K+K MVQ +DG+++L DHE D+
Sbjct  223  YNVIVKWWTEKNKSMVQMDDGSWVLLDHEKDD  254



>ref|XP_009624926.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A1-II 1-like [Nicotiana 
tomentosiformis]
Length=257

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 118/186 (63%), Gaps = 11/186 (6%)
 Frame = +2

Query  11   RDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVTAF  190
            +D + EEV RL++ YK +E+SIT++GHSLGS++ATL A+D+  N +NK       PVTAF
Sbjct  59   KDYVLEEVKRLVDQYKRKEVSITLSGHSLGSSVATLCAIDVVFNQINK-----EFPVTAF  113

Query  191  FFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNI---LYEAVGVGF  361
             FG P++G++NFK A+    NL+ +RIS+  D +  +P   QV G      +YE VG+  
Sbjct  114  VFGCPRLGEENFKKAYDKLRNLQILRISNAADPIPKMPDRGQVEGSATDWRMYEVVGIEL  173

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
             ID+ KS YLK  ++    H L  ++HGI G QG++G F+ + + DI+ + K    LK+E
Sbjct  174  SIDTXKSXYLKKDIN---GHILEVYLHGIAGTQGTKGEFKLELNRDIALVIKEADLLKNE  230

Query  542  YHVPVA  559
            Y VPV 
Sbjct  231  YGVPVC  236



>gb|AFW74936.1| hypothetical protein ZEAMMB73_664132 [Zea mays]
Length=401

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 122/209 (58%), Gaps = 14/209 (7%)
 Frame = +2

Query  20   IREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK---NQQDNNVPVTAF  190
            + EEV RL+ELYKGE  SITV GHSLG+ALATLNAVD+A N +N+   + Q    PVTA 
Sbjct  199  VLEEVRRLMELYKGEATSITVVGHSLGAALATLNAVDIAANGLNEGSGSSQQLPCPVTAI  258

Query  191  FFGGPKVGDQNFKDAFSNQ-GNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI-  364
             F  P VGD+ F+ AF     +LR + + +  D+V +VP         + Y  V V  + 
Sbjct  259  LFACPHVGDRFFRAAFVGSFRDLRALHVRNAGDVVPLVP--------PLAYVDVAVAVLP  310

Query  365  IDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGS-RGGFEPKGDFDISKLNKYRQGLKDE  541
            ID+ +S YL+        H+L  ++HG+ G Q S  GGF  + D D++ +NK    L+DE
Sbjct  311  IDTSRSPYLRSPGPAGTLHNLECYLHGVAGKQSSAAGGFRLEVDRDVALVNKGADALRDE  370

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            Y VP  W   +++ MV+  +G ++L D E
Sbjct  371  YPVPANWWVPENRWMVRGSEGHWMLKDFE  399



>gb|KDP46901.1| hypothetical protein JCGZ_24110 [Jatropha curcas]
Length=403

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 120/207 (58%), Gaps = 6/207 (3%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNV  175
            KSARDQ+   V++L++ YK EE+SITVTGHSLGSALATLNA+D+    +NK     + + 
Sbjct  189  KSARDQVLNAVSKLVDQYKDEEVSITVTGHSLGSALATLNAMDIVYKGINKPTGTANKSF  248

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            PVTA  F  P VG++ FK  F    ++  +R+ +  D V  +P    +      Y  VG 
Sbjct  249  PVTAIVFASPMVGNEGFKKVFDELSDIHVLRVENAKDPVPTLPPNKLIVIPQHRYYHVGE  308

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGL-  532
               ID+  S +LK   D+   HDL  ++HG+ G QGS+GGF      D + +NK   GL 
Sbjct  309  SLPIDTTLSPFLKTS-DVN-PHDLNVYLHGVAGTQGSKGGFNLDYPLDTALINKTVDGLN  366

Query  533  -KDEYHVPVAWMNVKDKGMVQQEDGTY  610
             K  Y++P  W   ++ GMV Q+DGTY
Sbjct  367  EKHNYNIPPNWWVEENNGMVLQDDGTY  393



>ref|XP_008355590.1| PREDICTED: phospholipase A1-IIgamma-like [Malus domestica]
Length=276

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 121/209 (58%), Gaps = 12/209 (6%)
 Frame = +2

Query  17   QIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVPVTAF  190
            Q+   +  +++ YK EEISITV GHS+G A A LNA D+  N  NK  ++ D    VT+ 
Sbjct  77   QVLTAIKEVVDQYKDEEISITVCGHSMGGAFAILNATDIVCNGYNKPTDRPDKACLVTSI  136

Query  191  FFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFIID  370
             F  P++GDQ F D FS+  NL  +R+++  D+V  +P   +       Y  VG    ID
Sbjct  137  VFASPRLGDQGFHDVFSSLKNLHVLRVTNSYDIVPHLPPLEK-------YVDVGKELKID  189

Query  371  SKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDEYHV  550
            + KS YLK        H L  ++HG+ G QG R GF+   + DI+ +NK   GLKDEY+V
Sbjct  190  TLKSPYLKNAKKDA--HRLEIYLHGVAGTQG-RNGFQLVINRDIALVNKKLDGLKDEYNV  246

Query  551  PVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
             V W   K+K MVQ +DG+++L DHE D+
Sbjct  247  IVKWWTEKNKSMVQMDDGSWVLLDHEKDD  275



>ref|XP_002440294.1| hypothetical protein SORBIDRAFT_09g029220 [Sorghum bicolor]
 gb|EES18724.1| hypothetical protein SORBIDRAFT_09g029220 [Sorghum bicolor]
Length=408

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 114/207 (55%), Gaps = 10/207 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SAR Q   EV RL++ Y  EE SITV GHSLG+ALATLNA D+A N  N        PVT
Sbjct  203  SARHQALSEVRRLVDAYSDEERSITVVGHSLGAALATLNAFDIAANGYNVATGAAACPVT  262

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGFI  364
            AF F  P+VG   FK  F     LR +R+ +  D+V   P         + Y  VG    
Sbjct  263  AFAFASPRVGGGGFKKRFDAVPGLRLLRVRNARDVVPKYP--------IVFYHDVGAELA  314

Query  365  IDSKKSEYLK-PGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKDE  541
            ID+ +S YL+ PG +    H+L  ++HG+ G +G+RGGFE     D++ +NK    L D+
Sbjct  315  IDTGESPYLRSPGRE-HTWHNLEVYLHGVAGTRGARGGFELAVARDVALVNKLYDVLWDD  373

Query  542  YHVPVAWMNVKDKGMVQQEDGTYILDD  622
            Y VP  W    +KGMV+  DG + L D
Sbjct  374  YGVPPGWWVPLNKGMVEGADGRWSLMD  400



>ref|XP_010279084.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Nelumbo nucifera]
Length=459

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 97/261 (37%), Positives = 130/261 (50%), Gaps = 62/261 (24%)
 Frame = +2

Query  17   QIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVPVTAF  190
            Q+ EEV RL+E +K EEI+IT+TGHSLG+AL  LNAVD+  N +NK  +  D    VTAF
Sbjct  202  QVLEEVKRLVEEFKDEEINITITGHSLGAALGILNAVDIVANGLNKPTDHPDKACLVTAF  261

Query  191  FFGGPKVGDQNFKDAFS---NQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVGF  361
             FG P VGD NF++ FS   +  +LR +RI +  D+V   P         I Y  VG   
Sbjct  262  LFGCPLVGDANFRNVFSILNSTQHLRLLRIRNAIDVVPNYP-------PMIGYTQVGEEL  314

Query  362  IIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSR------------------------  469
            +I++  S +LK   + M  H+L  ++HGI G QGS                         
Sbjct  315  VINTDTSPFLKESAEPMSWHNLEIYLHGIAGTQGSSVLPATTNKTRTRSRSGSSSSSKHP  374

Query  470  --------------------GGFEPKGDF------DISKLNKYRQGLKDEYHVPVAWMNV  571
                                 G    G+F      DI+ +NK    LKDE+HVP  W   
Sbjct  375  VIHHLMGLACPCFVAAASSAQGTSEGGEFKLVVKRDITLVNKVMDALKDEFHVPAKWWCE  434

Query  572  KDKGMVQQEDGTYILDDHEVD  634
            K+KGMVQ++DG++ L DHE D
Sbjct  435  KNKGMVQEDDGSWKLMDHESD  455



>ref|XP_010518796.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Tarenaya 
hassleriana]
Length=383

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 119/212 (56%), Gaps = 38/212 (18%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN--KNQQDNNVP  178
            SARDQ+ +EV RL+E YK EEISITV GHSLG+ALATLNA D+  N  N  +N+ D    
Sbjct  193  SARDQVLQEVRRLVEKYKDEEISITVCGHSLGAALATLNAADIVANGYNATQNRPDKPCL  252

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTAF F  P+VG+ +FK  FS   +LRG+R+ ++ D+V   P         + Y  VG  
Sbjct  253  VTAFVFASPRVGNPDFKKLFSGYKSLRGLRVRNLPDIVPTYP--------PLGYSDVGEE  304

Query  359  FIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLKD  538
              ID++KS YLK   D++  H+L  ++HG+ G QG+                        
Sbjct  305  LTIDTRKSPYLKTPGDLVSFHNLEANLHGVAGTQGT------------------------  340

Query  539  EYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
                      +++KGMVQQ+DG++ L DHE+D
Sbjct  341  ----TTKEFKLQNKGMVQQDDGSWKLMDHEMD  368



>ref|XP_006491814.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
Length=407

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 100/221 (45%), Positives = 129/221 (58%), Gaps = 19/221 (9%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK---NQQDNNV  175
            SA+DQ+R  V  L++ Y  EE+SITV GHSLGSALATLNA DLA N  NK   +   +  
Sbjct  185  SAKDQVRSAVRTLVDKYGDEEMSITVIGHSLGSALATLNAADLAANGYNKPTGSDTASGC  244

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
             VT   F  P+VGD  FK AF +Q  LR +R+++ ND+V  VP      G    Y  VG 
Sbjct  245  MVTTIVFASPRVGDSAFKTAFEDQKLLRLLRVTNKNDIVPNVP--PVFSG----YVDVGR  298

Query  356  GFIIDSKKSEYLK---PGLDI-MVHHDLMFHMHGIDGFQGSRG----GFEPKGDFDISKL  511
               +D+ KS Y+K   P L +  V H+L  ++HGI G   S+G     FE   D DI+ L
Sbjct  299  ELKVDATKSTYVKTVIPPLSLPSVLHNLENYLHGIAG--TSQGDDDDDFELAIDRDIALL  356

Query  512  NKYRQGLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            NK    LKDEY VP  W  VK+KGMVQ ++G + L+D+  D
Sbjct  357  NKGLDLLKDEYGVPPNWWTVKNKGMVQLDNGFWKLEDYVPD  397



>gb|KDP46903.1| hypothetical protein JCGZ_24112 [Jatropha curcas]
Length=402

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 123/207 (59%), Gaps = 7/207 (3%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNV  175
            KSARDQ+   V++L++ YK EE+SITVTGHSLGSALATLNA+D+    +NK     + + 
Sbjct  189  KSARDQVLNAVSKLVDQYKDEEVSITVTGHSLGSALATLNAMDIVYKGINKPTGTANKSF  248

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            PVTA  F  P VG++ FK  F    ++  +R+ + ND V  +P    +  ++  Y  VG 
Sbjct  249  PVTAIVFASPMVGNEGFKKVFDELSDIHVLRVENANDPVPKLPPNDILIPQHRYYH-VGE  307

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGL-  532
               ID+  S +LK   D+   HDL  ++HG+ G QGS+GGF      D + +NK   GL 
Sbjct  308  SLPIDTTLSPFLKTS-DVN-PHDLNVYLHGVAGTQGSKGGFNLDYPLDTALINKTVDGLN  365

Query  533  -KDEYHVPVAWMNVKDKGMVQQEDGTY  610
             K  Y++P  W   ++ GMV Q+DGTY
Sbjct  366  EKHNYNIPPNWWVEENNGMVLQDDGTY  392



>gb|EEE64775.1| hypothetical protein OsJ_19631 [Oryza sativa Japonica Group]
Length=387

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 119/218 (55%), Gaps = 14/218 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN----KNQQDNN  172
            SARDQ+  EVA+L+ +Y+ EE+SITVTGHSLG+ALATLNA D+  N  N           
Sbjct  173  SARDQVLSEVAKLVSMYQDEELSITVTGHSLGAALATLNAFDIVENGYNRAPRAAAAAAG  232

Query  173  VPVTAFFFGGPKVGDQNFKDAFSNQG--NLRGMRISDVNDLVTMVPWGSQVGGKNILYEA  346
             PVTAF F  P+VG   FK  F       LR +R+ +  D+V   P           Y  
Sbjct  233  CPVTAFVFASPRVGGHGFKRRFDGARGLGLRLLRVRNARDVVPRYP-------PAPPYHG  285

Query  347  VGVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG-FEPKGDFDISKLNKYR  523
            VG    ID+ +S YL+   + +V H+L  ++HG+ G +G   G F+   + D++  NK  
Sbjct  286  VGTELAIDTGESPYLRRPGNELVWHNLECYLHGVAGARGGEAGRFKLAVERDVALANKSY  345

Query  524  QGLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
              L+DE+ VP  W    ++GMV+  DG + L D E DE
Sbjct  346  GALRDEHAVPAGWWIPSNRGMVRGADGRWTLMDREEDE  383



>gb|EAY99121.1| hypothetical protein OsI_21080 [Oryza sativa Indica Group]
Length=399

 Score =   146 bits (368),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 119/218 (55%), Gaps = 14/218 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN----KNQQDNN  172
            SARDQ+  EVA+L+ +Y+ EE+SITVTGHSLG+ALATLNA D+  N  N           
Sbjct  185  SARDQVLSEVAKLVSMYQDEELSITVTGHSLGAALATLNAFDIVENGYNRAPRAAAAAAG  244

Query  173  VPVTAFFFGGPKVGDQNFKDAFSNQG--NLRGMRISDVNDLVTMVPWGSQVGGKNILYEA  346
             PVTAF F  P+VG   FK  F       LR +R+ +  D+V   P           Y  
Sbjct  245  CPVTAFVFASPRVGGHGFKRRFDGARGLGLRLLRVRNARDVVPRYP-------PAPPYHG  297

Query  347  VGVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG-FEPKGDFDISKLNKYR  523
            VG    ID+ +S YL+   + +V H+L  ++HG+ G +G   G F+   + D++  NK  
Sbjct  298  VGTELAIDTGESPYLRRPGNELVWHNLECYLHGVAGARGGEAGRFKLAVERDVALANKSY  357

Query  524  QGLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
              L+DE+ VP  W    ++GMV+  DG + L D E DE
Sbjct  358  GALRDEHAVPAGWWIPSNRGMVRGADGRWTLMDREEDE  395



>sp|Q6F358.1|PLA6_ORYSJ RecName: Full=Phospholipase A1-II 6 [Oryza sativa Japonica Group]
 gb|AAT69580.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAU44110.1| putative lipase [Oryza sativa Japonica Group]
Length=411

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 119/218 (55%), Gaps = 14/218 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN----KNQQDNN  172
            SARDQ+  EVA+L+ +Y+ EE+SITVTGHSLG+ALATLNA D+  N  N           
Sbjct  197  SARDQVLSEVAKLVSMYQDEELSITVTGHSLGAALATLNAFDIVENGYNRAPRAAAAAAG  256

Query  173  VPVTAFFFGGPKVGDQNFKDAFSNQG--NLRGMRISDVNDLVTMVPWGSQVGGKNILYEA  346
             PVTAF F  P+VG   FK  F       LR +R+ +  D+V   P           Y  
Sbjct  257  CPVTAFVFASPRVGGHGFKRRFDGARGLGLRLLRVRNARDVVPRYP-------PAPPYHG  309

Query  347  VGVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGG-FEPKGDFDISKLNKYR  523
            VG    ID+ +S YL+   + +V H+L  ++HG+ G +G   G F+   + D++  NK  
Sbjct  310  VGTELAIDTGESPYLRRPGNELVWHNLECYLHGVAGARGGEAGRFKLAVERDVALANKSY  369

Query  524  QGLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
              L+DE+ VP  W    ++GMV+  DG + L D E DE
Sbjct  370  GALRDEHAVPAGWWIPSNRGMVRGADGRWTLMDREEDE  407



>ref|XP_011047800.1| PREDICTED: phospholipase A1-II 4-like [Populus euphratica]
Length=448

 Score =   147 bits (370),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 128/215 (60%), Gaps = 13/215 (6%)
 Frame = +2

Query  5    SARDQIREEVARLIELYK--GEEISITVTGHSLGSALATLNAVDLAVNPVNKNQ-QDNNV  175
            SAR+Q+  EV RL+++Y   GEE+SITV GHSLG+ALATLN +D+  N  NK    D   
Sbjct  220  SAREQVLAEVRRLVDMYALNGEEVSITVAGHSLGAALATLNGMDMVANGFNKPSGSDIGF  279

Query  176  PVTAFFFGGPKVGDQNFKDAFSN-QGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVG  352
            PVT F +  P+VGDQ F+D F+    +L  +RI +  D++  +P    +G     Y+ VG
Sbjct  280  PVTVFAYASPRVGDQGFQDVFNGLTTDLHVLRIKNSKDIIPRLPPVFLLG-----YQDVG  334

Query  353  VGFIIDSKKSEYLK-PGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQG  529
                IDS KS YLK P       H+L  ++H I G+QG    F+   D DI+ LNK    
Sbjct  335  EKLEIDSIKSPYLKDPKAQ---PHNLELYLHTIAGYQGQEEEFKLVVDRDIALLNKSLDL  391

Query  530  LKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVD  634
            + D+Y++P  W NVK+ GM+Q ++G + L+D+  D
Sbjct  392  VLDKYNIPPTWWNVKNNGMIQIDNGFWKLNDYVPD  426



>ref|XP_002488949.1| hypothetical protein SORBIDRAFT_1306s002010 [Sorghum bicolor]
 gb|EES20262.1| hypothetical protein SORBIDRAFT_1306s002010 [Sorghum bicolor]
Length=396

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 124/213 (58%), Gaps = 22/213 (10%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGE--EISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVP  178
            SARDQ+ +EV+RL+ELYK E  E+SITV GHSLG+AL+ LNAVDL  N VN     N+ P
Sbjct  197  SARDQVLQEVSRLVELYKDEDQEMSITVVGHSLGAALSILNAVDLVSNGVN-----NSCP  251

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMV-PWGSQVGGKNILYEAVGV  355
            V A  F  P VG+ +FKDAF +  +L+ + + +  DLV ++  W             +GV
Sbjct  252  VAAVVFACPHVGNNSFKDAFDSFDDLKALHVKNKIDLVPLLMDW----------LPDLGV  301

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSR--GGFEPKGDFDISKLNKYRQG  529
               ID+  S YLK   +    H+L  ++HG+ G QGS   GGF+   D D++ LN+    
Sbjct  302  TLPIDTSLSPYLKDPQNTA--HELECYLHGVAGVQGSDAGGGFDLVVDRDVALLNRSADA  359

Query  530  LKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHE  628
            LKDE+ VP +W   + K MV+   G + L D E
Sbjct  360  LKDEHPVPASWWVAEHKSMVKNAKGKWELKDFE  392



>gb|KDP21072.1| hypothetical protein JCGZ_21543 [Jatropha curcas]
Length=407

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 132/215 (61%), Gaps = 13/215 (6%)
 Frame = +2

Query  2    KSARDQIREEVARLIELYKG--EEISITVTGHSLGSALATLNAVDLAVNPVNK-NQQDNN  172
            +SAR+Q+   V R  + Y    E++SIT+TGHSLGSALATLNA+D+A N  NK +  D  
Sbjct  179  RSAREQVLAAVRRNADKYAALKEDVSITITGHSLGSALATLNAMDIAFNGYNKPSGSDTG  238

Query  173  VPVTAFFFGGPKVGDQNFKDAFS---NQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYE  343
             PVTAF F  P+VG++ F+D FS   + G L  +RI +  D+V  +P   ++   + +YE
Sbjct  239  YPVTAFVFASPRVGNKEFQDVFSGLQDAGTLHLLRIRNHKDIVPELP--PKI--FDFIYE  294

Query  344  AVGVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYR  523
             VGV   +D+ KS  +K G  I   HDL  +MHG+ G+QG+   F+   + D + LNKY 
Sbjct  295  DVGVELYLDTTKSPNIK-GESIPEAHDLNLYMHGVAGYQGNE-DFKLVINLDFALLNKYN  352

Query  524  QGLKDEYHVPVAWM-NVKDKGMVQQEDGTYILDDH  625
              L+D   VP  W  NV  +GM+Q +DGT+ L+D+
Sbjct  353  DLLQDSCGVPPKWWSNVFRQGMIQLDDGTWKLNDY  387



>gb|EMT07769.1| hypothetical protein F775_18307 [Aegilops tauschii]
Length=229

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/209 (40%), Positives = 123/209 (59%), Gaps = 9/209 (4%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVN---KNQQDNNV  175
            SARDQ+ EEV RL+E++K E  SITVTGHSLG++LA LN VD+  N VN    + +    
Sbjct  23   SARDQVLEEVRRLMEVHKDEVTSITVTGHSLGASLAILNTVDMVANSVNVPLNSAKQPPC  82

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
            PVTA  F  P+VG+  FK AF++  +L  + + +  D++  +P G  +G  ++    V  
Sbjct  83   PVTAIMFASPQVGNNKFKSAFASFRDLHAIHVKNAPDIIPTLP-GPLLGYVDVATATVP-  140

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I++ +S YL P  +   +H+L  ++HG+ G QG    F+   D D++ +NK    LK
Sbjct  141  ---INTNRSPYLYPN-NRDTYHNLECYLHGVAGDQGDGMDFKLVVDRDVALVNKKVNILK  196

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILDD  622
            D+Y VP  W   K+K MV+  DG + LDD
Sbjct  197  DQYPVPENWYVAKNKWMVKGADGHWKLDD  225



>ref|XP_009603052.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=522

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 124/228 (54%), Gaps = 19/228 (8%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQDNNVPVT  184
            SAR+QI  EV RL+E Y  EE+SITVTGHSLGSALA L+A D+    +N       VP+ 
Sbjct  283  SAREQILTEVKRLVEKYPNEEMSITVTGHSLGSALAILSAYDIVETGLNIRADTRTVPIG  342

Query  185  AFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVP-------WGSQV----GGKN  331
             F F GP+VG+  FK+     G ++ +R+ +V+D+V   P         S V     G  
Sbjct  343  VFSFAGPRVGNARFKERLEKLG-VKVLRVVNVHDIVPKSPGLVFNEHSPSMVMKICEGLP  401

Query  332  ILYEAVGVGFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKL  511
              Y  VGV   +D K S +LKP  D++  H+L  H+H +DG+ G    F      DI+ +
Sbjct  402  WSYSHVGVELALDHKNSPFLKPTNDLVCAHNLEAHLHLLDGYHGKGRRFVLAKGRDIALV  461

Query  512  NKYRQGLKDEYHVPVAWMNVKDKGMVQQEDGTYI-------LDDHEVD  634
            NK    LKD Y VP  W   ++KGM++ +DG +I       LDDH  D
Sbjct  462  NKACDFLKDHYCVPPNWRQDENKGMIRDKDGRWIQPERPRVLDDHPPD  509



>ref|XP_007208858.1| hypothetical protein PRUPE_ppa025833mg [Prunus persica]
 gb|EMJ10057.1| hypothetical protein PRUPE_ppa025833mg [Prunus persica]
Length=379

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 124/220 (56%), Gaps = 17/220 (8%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNK--NQQDNNVP  178
            S R+Q    V  L++ YKGEEISITVTGHS+G+A+  LNA D+A N  NK  +       
Sbjct  166  SCRNQALAAVKELLKKYKGEEISITVTGHSMGAAIGILNATDIAYNGYNKLSDNPGKASL  225

Query  179  VTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGVG  358
            VTA  F  P +GD  F   FS+  NL  +R+++ NDL  ++       GK   Y  VG  
Sbjct  226  VTAIVFACPGLGDSGFNKVFSSLKNLHVLRVANTNDLAPIL----SAEGK---YVHVGKE  278

Query  359  FIIDSKKSEYLKPGLD-------IMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNK  517
               +S  S YLK   D       + + HDL  ++HG+ G QG   GF+ + D DI+ +NK
Sbjct  279  LRFNSLMSPYLKALSDYDDWIGIVEMFHDLEVYLHGVAGTQG-ENGFKLEVDRDIALVNK  337

Query  518  YRQGLKDEYHVPVAWMNVKDKGMVQQEDGTYILDDHEVDE  637
                +KDEY + V W   K+K MVQQ+DG+++L DHE D+
Sbjct  338  LLDAVKDEYRIVVKWWIEKNKSMVQQDDGSWVLMDHEKDD  377



>emb|CDY23963.1| BnaC03g17280D [Brassica napus]
Length=414

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 124/208 (60%), Gaps = 11/208 (5%)
 Frame = +2

Query  5    SARDQIREEVARLIELYKGEEISITVTGHSLGSALATLNAVDLAVNPVNKNQQ---DNNV  175
            SA++Q++ E+ RL+ELYK EE+SIT TGHSLG+ L+ L+A D   N   K      D   
Sbjct  197  SAQEQVQGELKRLLELYKHEEVSITFTGHSLGAVLSILSATDFLHNEWPKTTTSLGDRLS  256

Query  176  PVTAFFFGGPKVGDQNFKDAFSNQGNLRGMRISDVNDLVTMVPWGSQVGGKNILYEAVGV  355
             VT F FG P++GD NF+    +   L  +RI++V DL+   P           +  VG 
Sbjct  257  CVTVFAFGSPRIGDLNFRRLVESLKKLNILRITNVPDLIPHYP--------VFRFRDVGE  308

Query  356  GFIIDSKKSEYLKPGLDIMVHHDLMFHMHGIDGFQGSRGGFEPKGDFDISKLNKYRQGLK  535
               I++ KSEYLK  L++   H+L  ++HG+ G Q ++  F+ + + DI+ +NK    L+
Sbjct  309  ELEINTLKSEYLKRSLNLAHFHNLEAYLHGVAGTQHNQAEFKLEINRDIALVNKELDALQ  368

Query  536  DEYHVPVAWMNVKDKGMVQQEDGTYILD  619
            D+Y VP  W  V+++GMVQ +DGT+IL+
Sbjct  369  DKYLVPSHWWVVENRGMVQADDGTWILN  396



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1924132229272