BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27813_g1_i1 len=640 path=[1:0-639]

Length=640
                                                                      Score     E

ref|XP_004238750.1|  PREDICTED: thioredoxin H2-like                     164   2e-47   
ref|XP_006357246.1|  PREDICTED: thioredoxin H2-like                     163   4e-47   
ref|XP_009758326.1|  PREDICTED: thioredoxin H4-like                     163   5e-47   
ref|XP_009758325.1|  PREDICTED: thioredoxin H4-like                     161   3e-46   
emb|CDP21876.1|  unnamed protein product                                159   1e-45   
ref|XP_009783477.1|  PREDICTED: thioredoxin H2-like                     158   3e-45   
ref|XP_009614882.1|  PREDICTED: thioredoxin H2-like                     158   4e-45   
gb|EYU28689.1|  hypothetical protein MIMGU_mgv1a023737mg                156   2e-44   
ref|XP_009592735.1|  PREDICTED: thioredoxin H2-like                     155   3e-44   
ref|XP_004238752.2|  PREDICTED: thioredoxin H2-like                     154   8e-44   
ref|XP_006357248.1|  PREDICTED: thioredoxin H2-like                     154   8e-44   
ref|XP_002274663.1|  PREDICTED: thioredoxin H2                          149   7e-42   Vitis vinifera
ref|XP_006344288.1|  PREDICTED: thioredoxin H2-like                     149   9e-42   
ref|XP_009803170.1|  PREDICTED: thioredoxin H2-like                     149   1e-41   
ref|XP_004238755.1|  PREDICTED: thioredoxin H4                          148   3e-41   
ref|XP_011003195.1|  PREDICTED: thioredoxin H2-like                     148   4e-41   
emb|CAN83268.1|  hypothetical protein VITISV_040061                     147   4e-41   Vitis vinifera
gb|AGG09341.1|  thioredoxin h3                                          147   5e-41   
ref|XP_002324032.2|  thioredoxin family protein                         146   1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_004237020.1|  PREDICTED: thioredoxin H4-like                     146   2e-40   
ref|XP_011085782.1|  PREDICTED: thioredoxin H2                          146   2e-40   
ref|XP_011086414.1|  PREDICTED: thioredoxin H2-like                     147   2e-40   
ref|XP_004297814.1|  PREDICTED: thioredoxin H2-like                     145   3e-40   
ref|XP_007226116.1|  hypothetical protein PRUPE_ppa013299mg             145   3e-40   
ref|XP_008221701.1|  PREDICTED: thioredoxin H2-like                     145   4e-40   
ref|XP_006338484.1|  PREDICTED: thioredoxin H2-like                     145   4e-40   
ref|XP_002282318.1|  PREDICTED: thioredoxin H2                          145   4e-40   Vitis vinifera
emb|CAH59452.1|  thioredoxin 3                                          145   5e-40   Plantago major [cart-track plant]
gb|AAY42864.1|  thioredoxin H                                           145   6e-40   Nicotiana alata [flowering tobacco]
ref|XP_009602293.1|  PREDICTED: thioredoxin H2                          144   9e-40   
ref|XP_007157413.1|  hypothetical protein PHAVU_002G068000g             143   1e-39   
ref|NP_001236052.1|  uncharacterized protein LOC100527691               143   1e-39   
ref|XP_009795987.1|  PREDICTED: thioredoxin H2                          143   2e-39   
ref|XP_010316263.1|  PREDICTED: LOW QUALITY PROTEIN: thioredoxin H2     143   2e-39   
ref|XP_006357247.1|  PREDICTED: thioredoxin H2-like                     142   5e-39   
ref|XP_003519128.1|  PREDICTED: thioredoxin H2-like                     142   5e-39   
ref|XP_004489966.1|  PREDICTED: thioredoxin H2-like                     141   7e-39   
ref|XP_003613549.1|  Thioredoxin H2                                     141   1e-38   
ref|XP_010272215.1|  PREDICTED: thioredoxin H2                          141   2e-38   
gb|ACZ37071.1|  thioredoxin h7                                          140   3e-38   
gb|EYU34674.1|  hypothetical protein MIMGU_mgv1a014830mg                141   5e-38   
emb|CDP00271.1|  unnamed protein product                                139   5e-38   
ref|XP_011071041.1|  PREDICTED: thioredoxin H2                          139   7e-38   
ref|XP_007157414.1|  hypothetical protein PHAVU_002G068100g             139   7e-38   
ref|XP_007032429.1|  Thioredoxin 2                                      138   2e-37   
ref|XP_003517914.1|  PREDICTED: thioredoxin H2-like                     137   3e-37   
ref|XP_008352997.1|  PREDICTED: thioredoxin H2-like                     137   3e-37   
ref|XP_004135204.1|  PREDICTED: thioredoxin H2-like                     137   3e-37   
ref|XP_006431063.1|  hypothetical protein CICLE_v10013081mg             137   4e-37   
ref|XP_009335817.1|  PREDICTED: thioredoxin H2-like                     137   6e-37   
ref|XP_009360412.1|  PREDICTED: thioredoxin H2-like                     136   6e-37   
ref|XP_006482526.1|  PREDICTED: thioredoxin H2-like                     137   8e-37   
ref|XP_008446296.1|  PREDICTED: thioredoxin H-type-like                 136   9e-37   
gb|KHN13477.1|  Thioredoxin H2                                          135   1e-36   
gb|AGG19195.1|  thioredoxin H-type 4                                    135   2e-36   
ref|XP_010256143.1|  PREDICTED: thioredoxin H2-like                     135   2e-36   
ref|XP_003551992.1|  PREDICTED: thioredoxin H2-like                     135   3e-36   
ref|XP_010683288.1|  PREDICTED: thioredoxin H-type-like                 135   3e-36   
ref|XP_008350929.1|  PREDICTED: thioredoxin H2-like                     135   3e-36   
ref|XP_010029281.1|  PREDICTED: thioredoxin H2-like                     135   4e-36   
ref|NP_001237440.1|  thioredoxin                                        134   5e-36   
gb|KDP45467.1|  hypothetical protein JCGZ_09716                         134   6e-36   
ref|XP_003519131.1|  PREDICTED: thioredoxin H2-like                     134   7e-36   
ref|NP_001238074.1|  uncharacterized protein LOC100527572               133   8e-36   
ref|XP_008341530.1|  PREDICTED: thioredoxin H2-like                     134   9e-36   
ref|XP_008230720.1|  PREDICTED: thioredoxin H2                          133   1e-35   
ref|XP_010029282.1|  PREDICTED: thioredoxin H2-like                     134   1e-35   
ref|XP_010683289.1|  PREDICTED: thioredoxin H1-like                     135   1e-35   
gb|ACU15762.1|  unknown                                                 134   1e-35   Glycine max [soybeans]
gb|KHN11582.1|  Thioredoxin H2                                          134   1e-35   
gb|AAQ23133.1|  thioredoxin H2                                          133   1e-35   Ipomoea batatas [batate]
ref|XP_007153859.1|  hypothetical protein PHAVU_003G070700g             132   2e-35   
ref|XP_008389540.1|  PREDICTED: thioredoxin H-type                      133   2e-35   
ref|NP_001237844.1|  thioredoxin h2                                     133   2e-35   
ref|XP_004238753.1|  PREDICTED: thioredoxin H4                          133   2e-35   
gb|KHG03017.1|  Thioredoxin H2 -like protein                            132   2e-35   
emb|CDP02192.1|  unnamed protein product                                133   2e-35   
gb|KHG14132.1|  Thioredoxin H2 -like protein                            133   2e-35   
ref|XP_008352996.1|  PREDICTED: thioredoxin H2-like                     132   2e-35   
ref|XP_007139606.1|  hypothetical protein PHAVU_008G044000g             132   4e-35   
ref|XP_004302361.1|  PREDICTED: thioredoxin H2-like                     131   8e-35   
ref|XP_002517458.1|  Thioredoxin H-type, putative                       131   8e-35   Ricinus communis
ref|XP_003534466.1|  PREDICTED: thioredoxin H2-like                     131   1e-34   
gb|AAO12855.1|  thioredoxin h                                           130   1e-34   Pisum sativum [garden pea]
gb|AFK34683.1|  unknown                                                 130   1e-34   
ref|XP_010256168.1|  PREDICTED: thioredoxin H2-like                     130   2e-34   
ref|XP_007215973.1|  hypothetical protein PRUPE_ppa011576mg             132   2e-34   
ref|XP_009360413.1|  PREDICTED: thioredoxin H2-like                     130   2e-34   
ref|XP_003613548.1|  Thioredoxin                                        130   2e-34   
ref|XP_003621089.1|  Thioredoxin h2                                     130   3e-34   
gb|ACZ37068.1|  thioredoxin h4                                          130   3e-34   
ref|XP_010256156.1|  PREDICTED: thioredoxin H2-like                     129   5e-34   
ref|XP_007044392.1|  Thioredoxin, putative                              128   8e-34   
ref|NP_001237762.1|  uncharacterized protein LOC100527298               128   1e-33   
ref|XP_006284753.1|  hypothetical protein CARUB_v10006018mg             127   2e-33   
ref|XP_003552507.1|  PREDICTED: thioredoxin H2                          127   3e-33   
gb|KHN13657.1|  Thioredoxin H2                                          127   3e-33   
ref|XP_004302362.1|  PREDICTED: thioredoxin H2-like                     127   4e-33   
gb|KFK33151.1|  hypothetical protein AALP_AA6G337400                    125   1e-32   
ref|XP_010670327.1|  PREDICTED: thioredoxin H2                          125   2e-32   
ref|NP_001240862.1|  uncharacterized protein LOC100776312               125   2e-32   
ref|XP_002868686.1|  hypothetical protein ARALYDRAFT_493991             125   2e-32   
gb|EPS72137.1|  thioredoxin                                             125   2e-32   
ref|XP_003613544.1|  Thioredoxin-2                                      124   2e-32   
gb|AGG19202.1|  thioredoxin H-type 3                                    125   3e-32   
ref|XP_010422468.1|  PREDICTED: thioredoxin H2-like                     124   5e-32   
ref|XP_010096320.1|  Thioredoxin H2                                     126   5e-32   
ref|NP_198811.1|  thioredoxin H2                                        123   8e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010455897.1|  PREDICTED: thioredoxin H2                          123   1e-31   
emb|CDX67442.1|  BnaA07g14820D                                          122   2e-31   
gb|AAM66084.1|  thioredoxin                                             122   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|ABX10749.1|  thioredoxin                                             122   3e-31   Brassica juncea [brown mustard]
ref|XP_004489965.1|  PREDICTED: thioredoxin H2-like isoform X1          122   4e-31   
ref|XP_010531799.1|  PREDICTED: thioredoxin H2                          121   5e-31   
emb|CDY65333.1|  BnaCnng46660D                                          121   5e-31   
ref|XP_010539941.1|  PREDICTED: thioredoxin H2-like isoform X1          121   5e-31   
gb|AAC49353.1|  thioredoxin h                                           121   7e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450751.1|  PREDICTED: thioredoxin H2-like                     121   7e-31   
ref|XP_010683290.1|  PREDICTED: thioredoxin H7-like                     123   8e-31   
ref|XP_009125122.1|  PREDICTED: thioredoxin H2                          120   8e-31   
ref|XP_010431035.1|  PREDICTED: thioredoxin H2-like                     120   9e-31   
ref|XP_008443435.1|  PREDICTED: thioredoxin H2                          121   1e-30   
gb|AAN76509.1|AF352030_1  thioredoxin h                                 120   2e-30   Brassica rapa
ref|XP_008389539.1|  PREDICTED: thioredoxin H-type-like                 120   2e-30   
ref|XP_010441109.1|  PREDICTED: thioredoxin H2-like                     119   3e-30   
ref|XP_010043851.1|  PREDICTED: thioredoxin H2-like                     119   7e-30   
ref|XP_009142328.1|  PREDICTED: thioredoxin H2-like                     118   9e-30   
gb|AFK33858.1|  unknown                                                 117   9e-30   
gb|AFK36929.1|  unknown                                                 118   1e-29   
ref|XP_010087814.1|  Thioredoxin H2-2                                   118   2e-29   
gb|AAL90749.1|  thioredoxin H                                           117   2e-29   Populus tremula x Populus tremuloides
gb|ABM54166.1|  thioredoxin                                             116   3e-29   Brassica juncea [brown mustard]
emb|CDY37032.1|  BnaA04g26100D                                          117   5e-29   
ref|XP_006380026.1|  hypothetical protein POPTR_0008s19870g             116   7e-29   
ref|XP_006838793.1|  hypothetical protein AMTR_s00002p00259670          116   8e-29   
ref|XP_002520158.1|  Thioredoxin H-type, putative                       115   9e-29   Ricinus communis
ref|XP_006838794.1|  hypothetical protein AMTR_s00002p00259770          115   1e-28   
gb|ABK94905.1|  unknown                                                 115   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_011034202.1|  PREDICTED: thioredoxin H-type 2-like               115   2e-28   
ref|XP_008796645.1|  PREDICTED: thioredoxin H2-2                        114   2e-28   
ref|NP_001059090.1|  Os07g0190800                                       114   3e-28   Oryza sativa Japonica Group [Japonica rice]
emb|CDY57101.1|  BnaC04g56890D                                          114   5e-28   
ref|XP_007157415.1|  hypothetical protein PHAVU_002G068200g             113   6e-28   
ref|XP_006601734.1|  PREDICTED: uncharacterized protein LOC100305...    113   8e-28   
ref|XP_010923297.1|  PREDICTED: thioredoxin H2-2-like                   112   1e-27   
ref|XP_010923299.1|  PREDICTED: thioredoxin H2-2-like                   111   2e-27   
ref|XP_004981402.1|  PREDICTED: thioredoxin H2-2-like                   111   3e-27   
gb|KHG11415.1|  Thioredoxin H2 -like protein                            111   3e-27   
ref|XP_009631317.1|  PREDICTED: thioredoxin H2-like                     111   3e-27   
ref|XP_004489964.1|  PREDICTED: thioredoxin H2-like                     110   6e-27   
ref|XP_004147463.1|  PREDICTED: thioredoxin H2-like                     111   6e-27   
ref|XP_007158610.1|  hypothetical protein PHAVU_002G167100g             110   7e-27   
ref|XP_008379815.1|  PREDICTED: thioredoxin H2                          110   1e-26   
ref|XP_008388004.1|  PREDICTED: thioredoxin H1-like                     110   1e-26   
ref|XP_009335693.1|  PREDICTED: thioredoxin H1-like                     109   1e-26   
gb|KFK40858.1|  hypothetical protein AALP_AA2G050700                    109   2e-26   
gb|KDO82713.1|  hypothetical protein CISIN_1g0312711mg                  109   2e-26   
gb|AEC03317.1|  thioredoxin H-type 3                                    108   2e-26   
ref|NP_001237535.1|  thioredoxin h1                                     108   4e-26   
gb|EMT20503.1|  Thioredoxin H-type 2                                    108   4e-26   
ref|XP_009388459.1|  PREDICTED: thioredoxin H2-2-like                   108   5e-26   
gb|ACH61777.1|  thioredoxin h                                           108   5e-26   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011074624.1|  PREDICTED: thioredoxin H-type 1-like               108   5e-26   
ref|XP_004512082.1|  PREDICTED: thioredoxin H-type-like                 107   6e-26   
gb|AEC03322.1|  thioredoxin H-type 7                                    107   6e-26   
ref|XP_008807864.1|  PREDICTED: thioredoxin H2-1                        108   6e-26   
gb|AGG19201.1|  thioredoxin H-type 8                                    108   6e-26   
ref|XP_006438555.1|  hypothetical protein CICLE_v10033071mg             108   6e-26   
gb|AFP49340.1|  thioredoxin h                                           107   6e-26   
ref|XP_008377190.1|  PREDICTED: thioredoxin H-type-like                 108   7e-26   
ref|NP_001236481.1|  uncharacterized protein LOC100305773               107   8e-26   
gb|KCW56162.1|  hypothetical protein EUGRSUZ_I01913                     108   8e-26   
gb|AEC03323.1|  thioredoxin H-type 8                                    107   9e-26   
ref|XP_002510456.1|  Thioredoxin H-type, putative                       107   1e-25   Ricinus communis
gb|AAO12854.1|  thioredoxin h                                           107   1e-25   Pisum sativum [garden pea]
gb|AAZ32865.1|  thioredoxin h                                           107   1e-25   Medicago sativa [alfalfa]
gb|KEH36212.1|  thioredoxin H-type 1 protein                            107   1e-25   
ref|XP_008388001.1|  PREDICTED: thioredoxin H-type 2-like isoform X1    107   1e-25   
ref|XP_003527904.1|  PREDICTED: thioredoxin H-type                      106   2e-25   
ref|XP_009335682.1|  PREDICTED: LOW QUALITY PROTEIN: thioredoxin ...    106   2e-25   
ref|XP_010254672.1|  PREDICTED: thioredoxin H-type-like                 106   2e-25   
gb|ADU56183.1|  thioredoxin H-type                                      106   2e-25   
gb|KDP32674.1|  hypothetical protein JCGZ_13672                         106   2e-25   
emb|CAC36986.1|  thioredoxin h                                          106   3e-25   Pisum sativum [garden pea]
ref|XP_006425591.1|  hypothetical protein CICLE_v10026781mg             106   3e-25   
ref|XP_006658356.1|  PREDICTED: thioredoxin H2-1-like                   107   3e-25   
ref|XP_008338022.1|  PREDICTED: thioredoxin H-type-like                 105   3e-25   
ref|XP_004291829.1|  PREDICTED: thioredoxin H-type-like                 105   4e-25   
gb|AEI69283.1|  thioredoxin h 1-1                                       105   4e-25   
gb|AII71795.1|  thioredoxin                                             105   5e-25   
gb|AAZ98842.1|  thioredoxin h1                                          105   5e-25   Medicago truncatula
ref|XP_003557168.1|  PREDICTED: thioredoxin H2-2                        105   6e-25   
ref|XP_010552494.1|  PREDICTED: thioredoxin H5-like                     105   6e-25   
emb|CAC42084.1|  thioredoxin h                                          105   7e-25   Pisum sativum [garden pea]
ref|XP_010275525.1|  PREDICTED: thioredoxin H-type-like                 105   7e-25   
ref|NP_001241757.1|  thioredoxin H-type 5                               105   8e-25   
ref|XP_010061260.1|  PREDICTED: thioredoxin H1                          105   8e-25   
ref|XP_010679815.1|  PREDICTED: thioredoxin H1                          104   8e-25   
ref|XP_010532878.1|  PREDICTED: thioredoxin H8-like                     105   9e-25   
ref|XP_008361428.1|  PREDICTED: thioredoxin H-type                      104   9e-25   
ref|XP_010113482.1|  Thioredoxin H-type                                 104   9e-25   
gb|KDP21244.1|  hypothetical protein JCGZ_21715                         105   1e-24   
ref|XP_010470203.1|  PREDICTED: thioredoxin H7-like                     104   1e-24   
gb|AEC03321.1|  thioredoxin H-type 6                                    104   1e-24   
ref|XP_002463724.1|  hypothetical protein SORBIDRAFT_01g004860          105   1e-24   Sorghum bicolor [broomcorn]
ref|XP_007202766.1|  hypothetical protein PRUPE_ppa013476mg             104   1e-24   
ref|XP_010511031.1|  PREDICTED: thioredoxin H7-like                     104   1e-24   
sp|P68176.1|TRXH_BRAOL  RecName: Full=Thioredoxin H-type; Short=T...    104   2e-24   Brassica oleracea
ref|NP_001238579.1|  uncharacterized protein LOC100499701               104   2e-24   
gb|AAG35777.1|AF273844_1  thioredoxin-h-like protein 1                  103   2e-24   Brassica oleracea var. alboglabra
ref|XP_004500971.1|  PREDICTED: thioredoxin H-type-like                 103   2e-24   
ref|XP_008337832.1|  PREDICTED: thioredoxin H-type                      103   2e-24   
ref|XP_008221338.1|  PREDICTED: thioredoxin H-type-like                 104   2e-24   
ref|NP_001289650.1|  thioredoxin H-type                                 103   2e-24   
gb|KCW56688.1|  hypothetical protein EUGRSUZ_I02383                     103   2e-24   
ref|XP_004489163.1|  PREDICTED: thioredoxin H2-like                     103   2e-24   
ref|NP_001241730.1|  thioredoxin H-type 5                               104   2e-24   
ref|XP_011083608.1|  PREDICTED: thioredoxin H-type-like                 103   2e-24   
gb|AAM67018.1|  thioredoxin                                             103   3e-24   Arabidopsis thaliana [mouse-ear cress]
gb|ACU14225.1|  unknown                                                 103   3e-24   Glycine max [soybeans]
ref|XP_004287851.1|  PREDICTED: thioredoxin H-type-like                 103   3e-24   
ref|XP_009398388.1|  PREDICTED: thioredoxin H1-like                     103   3e-24   
ref|NP_001148952.1|  LOC100282572                                       103   3e-24   Zea mays [maize]
ref|XP_006281332.1|  hypothetical protein CARUB_v10027387mg             103   3e-24   
ref|XP_008241764.1|  PREDICTED: thioredoxin H-type                      103   3e-24   
ref|XP_002865467.1|  thioredoxin H-type 3                               103   4e-24   
gb|AEC03320.1|  thioredoxin H-type 5                                    103   4e-24   
gb|KHF97866.1|  Thioredoxin H-type                                      103   4e-24   
ref|NP_173403.1|  thioredoxin H4                                        103   4e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AEI69284.1|  thioredoxin h 1-2                                       102   4e-24   
emb|CAA84610.1|  thioredoxin                                            103   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001288844.1|  thioredoxin H-type                                 102   5e-24   
ref|XP_009761049.1|  PREDICTED: thioredoxin H-type 1                    102   5e-24   
ref|XP_009599959.1|  PREDICTED: thioredoxin H-type 2-like               102   6e-24   
ref|XP_002274205.1|  PREDICTED: thioredoxin H-type 2                    102   6e-24   Vitis vinifera
gb|AEC03316.1|  thioredoxin H-type 2                                    102   6e-24   
ref|XP_010442091.1|  PREDICTED: thioredoxin H3-like                     102   6e-24   
ref|XP_010540349.1|  PREDICTED: thioredoxin H5-like                     102   6e-24   
gb|ACG31323.1|  thioredoxin H-type                                      102   6e-24   Zea mays [maize]
ref|XP_010481919.1|  PREDICTED: thioredoxin H3                          102   6e-24   
gb|ACG24448.1|  thioredoxin H-type                                      102   7e-24   Zea mays [maize]
ref|XP_010494264.1|  PREDICTED: thioredoxin H3                          102   8e-24   
ref|XP_002967955.1|  hypothetical protein SELMODRAFT_88131              102   8e-24   
ref|NP_001105788.1|  thioredoxin h1 protein                             102   8e-24   Zea mays [maize]
gb|ACG24509.1|  thioredoxin H-type                                      102   8e-24   Zea mays [maize]
ref|XP_003550402.1|  PREDICTED: thioredoxin H-type                      102   9e-24   
ref|XP_007223789.1|  hypothetical protein PRUPE_ppa013161mg             102   9e-24   
emb|CDP01953.1|  unnamed protein product                                102   1e-23   
gb|AES95049.2|  thioredoxin                                             102   1e-23   
ref|XP_002963964.1|  hypothetical protein SELMODRAFT_166463             102   1e-23   
gb|ACG41127.1|  thioredoxin H-type                                      102   1e-23   Zea mays [maize]
ref|XP_010414660.1|  PREDICTED: thioredoxin H7-like                     102   1e-23   
gb|KHN13658.1|  Thioredoxin H2                                          102   1e-23   
ref|NP_176182.1|  thioredoxin H7                                        102   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb|EYU34675.1|  hypothetical protein MIMGU_mgv1a014830mg                102   1e-23   
ref|NP_199112.1|  thioredoxin H3                                        101   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAQ23135.1|  thioredoxin H3                                          101   1e-23   Ipomoea batatas [batate]
ref|XP_010672607.1|  PREDICTED: thioredoxin H-type 1-like               101   2e-23   
ref|XP_002886664.1|  thioredoxin H-type 7                               101   2e-23   
emb|CDY30901.1|  BnaC09g15050D                                          101   2e-23   
ref|XP_006302972.1|  hypothetical protein CARUB_v10021111mg             102   2e-23   
ref|XP_009113282.1|  PREDICTED: thioredoxin H7                          101   2e-23   
ref|XP_006425592.1|  hypothetical protein CICLE_v10026781mg             101   2e-23   
ref|XP_006403316.1|  hypothetical protein EUTSA_v10003293mg             101   2e-23   
ref|XP_007046793.1|  Thioredoxin H-type 1, H1,TRX1                      101   2e-23   
ref|XP_010500182.1|  PREDICTED: thioredoxin H5-like                     100   2e-23   
ref|XP_007136039.1|  hypothetical protein PHAVU_009G012800g             101   2e-23   
gb|ADN96593.1|  thioredoxin h                                           100   2e-23   
ref|XP_002307687.1|  thioredoxin h family protein                       100   2e-23   Populus trichocarpa [western balsam poplar]
gb|AFY26881.1|  thioredoxin                                             101   3e-23   
ref|XP_007017654.1|  Thioredoxin H-type 1, H1,TRX1                      100   3e-23   
ref|NP_177146.1|  thioredoxin H8                                        101   3e-23   Arabidopsis thaliana [mouse-ear cress]
pdb|1TI3|A  Chain A, Solution Structure Of The Thioredoxin H1 Fro...    100   3e-23   
ref|XP_011028925.1|  PREDICTED: thioredoxin H1-like                     100   3e-23   
gb|ACV52592.1|  thioredoxin H-type 1                                    100   3e-23   Nicotiana benthamiana
gb|AGG09340.1|  thioredoxin h2                                          100   3e-23   
ref|XP_008440779.1|  PREDICTED: thioredoxin H-type                      100   4e-23   
gb|AHF27221.1|  H-type thioredoxin                                      100   4e-23   
gb|KHN45884.1|  Thioredoxin H-type 1                                    100   4e-23   
emb|CAN78073.1|  hypothetical protein VITISV_013293                     100   4e-23   
ref|XP_009778392.1|  PREDICTED: thioredoxin H-type                      100   4e-23   
ref|XP_003589341.1|  Thioredoxin H-type                                 100   4e-23   
ref|XP_010547452.1|  PREDICTED: thioredoxin H1                          100   4e-23   
ref|XP_002534131.1|  Thioredoxin H-type                                 100   4e-23   
ref|XP_010415656.1|  PREDICTED: thioredoxin H8-like                     101   4e-23   
gb|ADN96595.1|  thioredoxin h                                           100   4e-23   
ref|XP_002440041.1|  hypothetical protein SORBIDRAFT_09g024960          100   4e-23   
gb|KHG09326.1|  Thioredoxin H-type                                      100   5e-23   
gb|ADN96594.1|  thioredoxin h                                           100   5e-23   
ref|XP_004149944.1|  PREDICTED: thioredoxin H-type-like                 100   5e-23   
ref|XP_004238306.1|  PREDICTED: thioredoxin H-type 1                    100   5e-23   
emb|CDY27290.1|  BnaC04g18700D                                          100   5e-23   
ref|XP_006654619.1|  PREDICTED: thioredoxin H-type-like                 100   5e-23   
ref|XP_009417136.1|  PREDICTED: thioredoxin H2-1-like                   100   5e-23   
ref|XP_004149979.1|  PREDICTED: thioredoxin H-type-like                 100   6e-23   
ref|XP_002893065.1|  thioredoxin H-type 4                               100   6e-23   
ref|XP_010498395.1|  PREDICTED: thioredoxin H4                          100   6e-23   
ref|XP_006341987.1|  PREDICTED: thioredoxin H-type 1-like               100   6e-23   
ref|XP_010060993.1|  PREDICTED: thioredoxin H-type 1-like             99.8    6e-23   
ref|XP_008464899.1|  PREDICTED: thioredoxin H-type-like               99.8    6e-23   
ref|XP_011083162.1|  PREDICTED: thioredoxin H-type                      100   6e-23   
ref|XP_004232447.1|  PREDICTED: thioredoxin H-type 2                  99.8    6e-23   
ref|XP_006473574.1|  PREDICTED: thioredoxin H-type-like                 100   7e-23   
ref|NP_001275313.1|  thioredoxin H-type 2-like                        99.8    7e-23   
ref|XP_006292776.1|  hypothetical protein CARUB_v10019026mg           99.8    7e-23   
ref|XP_007160713.1|  hypothetical protein PHAVU_001G010800g           99.8    7e-23   
emb|CDP07462.1|  unnamed protein product                                100   7e-23   
gb|EMS56734.1|  Thioredoxin H2-2                                        100   7e-23   
ref|XP_002300738.1|  thioredoxin h family protein                     99.8    7e-23   
ref|XP_006435075.1|  hypothetical protein CICLE_v10002859mg           99.8    7e-23   
ref|XP_006300561.1|  hypothetical protein CARUB_v10021113mg             100   7e-23   
emb|CCQ38254.1|  thioredoxin H-type protein                           99.8    7e-23   
ref|XP_006657515.1|  PREDICTED: thioredoxin H1-like                   99.8    8e-23   
ref|XP_010459650.1|  PREDICTED: thioredoxin H4-like                   99.8    8e-23   
emb|CDY39355.1|  BnaC05g15320D                                        99.8    8e-23   
gb|ACI31202.1|  TRX                                                   99.8    9e-23   
gb|KHG18714.1|  Thioredoxin H-type                                    99.4    9e-23   
ref|XP_004172945.1|  PREDICTED: thioredoxin H-type-like               99.4    9e-23   
ref|XP_010030877.1|  PREDICTED: thioredoxin H-type-like               99.8    1e-22   
sp|Q96419.1|TRXH_FAGES  RecName: Full=Thioredoxin H-type; Short=T...  99.4    1e-22   
dbj|BAB20886.1|  thioredoxin h                                        99.4    1e-22   
ref|NP_001055996.1|  Os05g0508500                                     99.4    1e-22   
ref|XP_009789451.1|  PREDICTED: thioredoxin H-type 2                  99.4    1e-22   
ref|XP_010500181.1|  PREDICTED: thioredoxin H5-like                   99.4    1e-22   
gb|AAP33009.1|  thioredoxin H                                         99.4    1e-22   
gb|AAR83852.1|  thioredoxin                                           99.4    1e-22   
gb|AAC49356.1|  thioredoxin h                                         99.0    1e-22   
gb|AAC49355.1|  thioredoxin h                                         99.0    1e-22   
gb|ACG42177.1|  thioredoxin H-type                                    99.0    1e-22   
emb|CDY28996.1|  BnaC07g32020D                                        99.0    1e-22   
gb|EYU31166.1|  hypothetical protein MIMGU_mgv1a015811mg              99.8    1e-22   
ref|NP_175128.1|  thioredoxin H5                                      99.0    1e-22   
ref|XP_010932739.1|  PREDICTED: thioredoxin H1                        99.0    1e-22   
ref|XP_010538107.1|  PREDICTED: thioredoxin H5-like                   99.0    2e-22   
emb|CCQ38247.1|  thioredoxin H-type protein                           99.4    2e-22   
ref|XP_010551638.1|  PREDICTED: thioredoxin H8                        99.8    2e-22   
gb|ABD65296.1|  thioredoxin                                           99.0    2e-22   
sp|Q39362.1|TRXH2_BRANA  RecName: Full=Thioredoxin H-type 2; Shor...  99.0    2e-22   
ref|NP_001147192.1|  thioredoxin H-type                               99.0    2e-22   
ref|NP_001268163.1|  thioredoxin H-type-like                          98.6    2e-22   
emb|CDY53958.1|  BnaCnng25840D                                        98.6    2e-22   
ref|XP_002894007.1|  thioredoxin H-type 5                             98.6    2e-22   
gb|ABK93640.1|  unknown                                               98.6    2e-22   
emb|CAB96931.1|  thioredoxin h                                        98.6    2e-22   
pdb|2VLT|A  Chain A, Crystal Structure Of Barley Thioredoxin H Is...  98.6    2e-22   
ref|XP_010110009.1|  Thioredoxin H-type 1                               100   2e-22   
ref|XP_006416468.1|  hypothetical protein EUTSA_v10009025mg           98.6    2e-22   
gb|ABK24945.1|  unknown                                               98.6    2e-22   
ref|XP_011048838.1|  PREDICTED: thioredoxin H-type                    98.2    3e-22   
sp|O65049.1|TRXH_PICMA  RecName: Full=Thioredoxin H-type; Short=T...  98.6    3e-22   
ref|XP_010461472.1|  PREDICTED: thioredoxin H5-like                   98.2    3e-22   
ref|XP_009149459.1|  PREDICTED: thioredoxin H-type 2                  98.2    3e-22   
gb|ABK21322.1|  unknown                                               98.2    3e-22   
ref|XP_006392244.1|  hypothetical protein EUTSA_v10023755mg           98.2    3e-22   
ref|NP_001051587.1|  Os03g0800700                                     98.6    3e-22   
ref|XP_010426645.1|  PREDICTED: thioredoxin H1                        98.6    3e-22   
ref|XP_009138568.1|  PREDICTED: thioredoxin H7-like                   98.2    3e-22   
ref|XP_009107463.1|  PREDICTED: thioredoxin H5                        97.8    4e-22   
emb|CAH59450.1|  thioredoxin 1                                        97.8    4e-22   
ref|XP_010033446.1|  PREDICTED: thioredoxin H-type-like               97.8    4e-22   
emb|CDX77974.1|  BnaA09g31690D                                        97.8    4e-22   
ref|XP_009136581.1|  PREDICTED: thioredoxin H1-like                   97.8    4e-22   
gb|ABK20906.1|  unknown                                               98.2    4e-22   
dbj|BAJ99002.1|  predicted protein                                    98.6    4e-22   
ref|XP_009115784.1|  PREDICTED: thioredoxin H1 isoform X1             97.4    4e-22   
sp|O64394.3|TRXH_WHEAT  RecName: Full=Thioredoxin H-type; Short=T...  97.8    4e-22   
gb|AAL24517.1|AF420472_1  thioredoxin H                               97.8    5e-22   
gb|KHN36068.1|  Thioredoxin H-type                                    96.7    5e-22   
ref|XP_010503780.1|  PREDICTED: thioredoxin H1-like                   98.6    5e-22   
ref|XP_006828537.1|  hypothetical protein AMTR_s00060p00208570        98.2    5e-22   
emb|CDY23544.1|  BnaC06g25130D                                        98.2    7e-22   
emb|CCQ38255.1|  thioredoxin H-type protein                           97.8    7e-22   
gb|ABK23262.1|  unknown                                               97.1    7e-22   
ref|XP_006416467.1|  hypothetical protein EUTSA_v10009025mg           97.8    7e-22   
ref|XP_009603030.1|  PREDICTED: thioredoxin H-type 1                  97.4    8e-22   
ref|XP_006403964.1|  hypothetical protein EUTSA_v10010795mg           97.8    8e-22   
ref|NP_190672.1|  thioredoxin H1                                      97.1    8e-22   
ref|XP_009129553.1|  PREDICTED: thioredoxin H5-like                   97.1    8e-22   
ref|XP_004499205.1|  PREDICTED: thioredoxin H-type 1-like             97.1    8e-22   
pdb|1XFL|A  Chain A, Solution Structure Of Thioredoxin H1 From Ar...  97.1    1e-21   
ref|XP_010231198.1|  PREDICTED: thioredoxin H-type-like               96.7    1e-21   
gb|AFI74352.1|  thioredoxin                                           97.4    1e-21   
emb|CDY38768.1|  BnaA07g28400D                                        97.4    1e-21   
ref|XP_009628699.1|  PREDICTED: thioredoxin H-type 2                  96.7    1e-21   
sp|Q07090.1|TRXH2_TOBAC  RecName: Full=Thioredoxin H-type 2; Shor...  96.7    1e-21   
emb|CCQ38253.1|  thioredoxin H-type protein                           97.1    1e-21   
ref|XP_010479072.1|  PREDICTED: thioredoxin H5                        96.7    1e-21   
ref|XP_004152676.1|  PREDICTED: thioredoxin H-type-like               96.7    1e-21   
ref|XP_010548397.1|  PREDICTED: thioredoxin H7                        97.4    1e-21   
emb|CDX73752.1|  BnaC08g22510D                                        99.0    1e-21   
ref|XP_004955694.1|  PREDICTED: thioredoxin H1-like                   96.3    1e-21   
emb|CDY11645.1|  BnaC06g30940D                                        97.1    1e-21   
gb|ACS96439.1|  thioredoxin-h                                         96.3    2e-21   
ref|NP_001236031.1|  uncharacterized protein LOC100306506             96.3    2e-21   
ref|XP_006305932.1|  hypothetical protein CARUB_v10011156mg           96.3    2e-21   
gb|KHN20945.1|  Thioredoxin H-type                                    96.3    2e-21   
ref|XP_009104981.1|  PREDICTED: thioredoxin H8-like                   97.1    2e-21   
ref|XP_006304308.1|  hypothetical protein CARUB_v10010677mg           95.9    2e-21   
gb|EYU32886.1|  hypothetical protein MIMGU_mgv1a015367mg              97.1    2e-21   
emb|CDY36029.1|  BnaA08g04320D                                        95.9    2e-21   
ref|NP_001059069.1|  Os07g0186000                                     95.9    2e-21   
ref|XP_009105663.1|  PREDICTED: thioredoxin H8                        96.7    3e-21   
ref|NP_001235291.1|  uncharacterized protein LOC100306454             96.3    3e-21   
emb|CCQ38271.1|  thioredoxin H-type protein                           95.9    3e-21   
ref|XP_002310830.2|  thioredoxin h family protein                     95.5    3e-21   
emb|CCQ38258.1|  thioredoxin H-type protein                           95.9    3e-21   
ref|XP_004981401.1|  PREDICTED: thioredoxin H2-2-like                 94.7    3e-21   
emb|CCQ38251.1|  thioredoxin H-type protein                           95.9    3e-21   
pdb|1WMJ|A  Chain A, Solution Structure Of Thioredoxin Type H Fro...  95.5    3e-21   
ref|XP_004961572.1|  PREDICTED: thioredoxin H-type-like isoform X1    95.5    4e-21   
ref|XP_006650741.1|  PREDICTED: thioredoxin H2-2-like                 95.1    5e-21   
ref|XP_002461568.1|  hypothetical protein SORBIDRAFT_02g004850        94.7    5e-21   
ref|XP_002863112.1|  thioredoxin H-type 8                             95.5    5e-21   
gb|ABL67652.1|  putative thioredoxin H protein                        94.4    6e-21   
gb|ACF81437.1|  unknown                                               94.7    6e-21   
ref|XP_004158908.1|  PREDICTED: thioredoxin H-type-like               94.0    6e-21   
gb|ACG30866.1|  thioredoxin H-type                                    94.7    6e-21   
gb|EPS63764.1|  hypothetical protein M569_11021                       94.0    7e-21   
emb|CDY23543.1|  BnaC06g25120D                                        95.1    7e-21   
ref|XP_009104980.1|  PREDICTED: thioredoxin H8-like                   95.1    7e-21   
ref|XP_006838688.1|  hypothetical protein AMTR_s00002p00246800        94.4    7e-21   
pdb|2IWT|A  Chain A, Thioredoxin H2 (Hvtrxh2) In A Mixed Disulfid...  94.7    7e-21   
gb|AAL67139.1|  thioredoxin H                                         94.4    8e-21   
ref|XP_010512051.1|  PREDICTED: thioredoxin H8-like                   94.7    1e-20   
ref|XP_010515484.1|  PREDICTED: thioredoxin H1-like                   94.4    1e-20   
gb|KFK34349.1|  hypothetical protein AALP_AA5G133700                  94.0    1e-20   
gb|KFK41408.1|  hypothetical protein AALP_AA2G127000                  94.7    1e-20   
ref|NP_001105811.1|  thioredoxin h homolog2                           93.6    1e-20   
gb|KCW85852.1|  hypothetical protein EUGRSUZ_B02586                   92.8    1e-20   
tpg|DAA51978.1|  TPA: hypothetical protein ZEAMMB73_680535            92.8    2e-20   
ref|XP_008444759.1|  PREDICTED: thioredoxin H1-like                   93.6    2e-20   
gb|ACG29437.1|  thioredoxin H-type                                    93.6    2e-20   
gb|ACG44359.1|  thioredoxin H-type                                    94.0    2e-20   
ref|XP_001419941.1|  predicted protein                                92.8    2e-20   
gb|KFK44092.1|  hypothetical protein AALP_AA1G215000                  93.2    2e-20   
pdb|2VM1|A  Chain A, Crystal Structure Of Barley Thioredoxin H Is...  93.2    2e-20   
ref|XP_008796609.1|  PREDICTED: thioredoxin H1-like                   93.2    2e-20   
gb|AFK40280.1|  unknown                                               92.0    3e-20   
gb|KFK33157.1|  hypothetical protein AALP_AA6G338000                  93.2    3e-20   
ref|XP_003557458.1|  PREDICTED: thioredoxin H1-like                   92.8    3e-20   
ref|XP_010470991.1|  PREDICTED: thioredoxin H8                        93.6    3e-20   
ref|XP_006393674.1|  hypothetical protein EUTSA_v10011873mg           92.4    3e-20   
ref|XP_010672602.1|  PREDICTED: thioredoxin H-type-like               92.4    4e-20   
emb|CDX92172.1|  BnaA05g22350D                                        96.7    4e-20   
gb|EPS61811.1|  thioredoxin                                           92.4    4e-20   
gb|KCW85853.1|  hypothetical protein EUGRSUZ_B02586                   92.4    5e-20   
gb|AEM42995.1|  thioredoxin H                                         92.4    5e-20   
ref|XP_006376711.1|  hypothetical protein POPTR_0012s04230g           95.9    5e-20   
gb|EMS65494.1|  Thioredoxin H-type                                    94.7    5e-20   
ref|XP_003557457.1|  PREDICTED: thioredoxin H1-like                   92.0    5e-20   
ref|XP_006390952.1|  hypothetical protein EUTSA_v10019609mg           93.2    5e-20   
emb|CDR47645.1|  CYFA0S35e00672g1_1                                   92.4    5e-20   
ref|XP_001754048.1|  predicted protein                                91.7    6e-20   
ref|XP_006451583.1|  hypothetical protein CICLE_v10010759mg           91.7    6e-20   
ref|XP_002317863.2|  TETRATRICOREDOXIN family protein                 95.9    7e-20   
gb|ETI44938.1|  hypothetical protein F443_10382                       95.5    7e-20   
ref|XP_008893470.1|  thioredoxin                                      95.1    7e-20   
gb|ETL38358.1|  thioredoxin                                           95.1    7e-20   
gb|ETM44785.1|  thioredoxin                                           95.1    7e-20   
gb|KHG03252.1|  TPR repeat-containing thioredoxin TDX -like protein   95.5    7e-20   
gb|ETL91457.1|  thioredoxin                                           95.1    7e-20   
ref|XP_009531277.1|  hypothetical protein PHYSODRAFT_510794           94.7    8e-20   
ref|XP_003612091.1|  Thioredoxin H-type                               92.0    9e-20   
gb|AAP88338.1|  At3g17880                                             91.7    1e-19   
gb|KDO82714.1|  hypothetical protein CISIN_1g0312711mg                92.4    1e-19   
ref|XP_004172283.1|  PREDICTED: thioredoxin H1-like                   90.9    1e-19   
ref|XP_006406678.1|  hypothetical protein EUTSA_v10020954mg           95.1    1e-19   
gb|AAB01771.1|  thioredoxin homolog                                   90.5    1e-19   
gb|AAQ23134.1|  thioredoxin H1                                        90.9    1e-19   
ref|XP_007215972.1|  hypothetical protein PRUPE_ppa011576mg           92.8    1e-19   
ref|XP_007160553.1|  hypothetical protein PHAVU_002G3313001g          94.4    1e-19   
gb|KFM24628.1|  Thioredoxin H-type                                    90.9    1e-19   
ref|XP_004149943.1|  PREDICTED: thioredoxin H1-like                   90.9    1e-19   
emb|CCG82164.1|  Thioredoxin-1                                        90.5    1e-19   
ref|XP_009388471.1|  PREDICTED: thioredoxin H1-like                   90.9    2e-19   
ref|XP_003631133.1|  Thioredoxin-like protein                         94.7    2e-19   
gb|KFK39114.1|  hypothetical protein AALP_AA3G202900                  94.7    2e-19   
ref|XP_006374203.1|  hypothetical protein POPTR_0015s04870g           94.4    2e-19   
gb|KHG11333.1|  Thioredoxin H-type                                    90.5    2e-19   
gb|EMT33623.1|  hypothetical protein F775_43350                       96.7    2e-19   
ref|XP_010932588.1|  PREDICTED: TPR repeat-containing thioredoxin...  94.4    2e-19   
ref|XP_010932587.1|  PREDICTED: TPR repeat-containing thioredoxin...  94.4    2e-19   
ref|XP_004147847.1|  PREDICTED: thioredoxin H-type-like               90.1    2e-19   
gb|AGO13466.1|  AaceriACL131Wp                                        90.1    2e-19   
ref|XP_003067095.1|  thioredoxin, putative                            90.1    2e-19   
dbj|BAJ97057.1|  predicted protein                                    94.0    2e-19   
ref|XP_008466520.1|  PREDICTED: thioredoxin H-type-like               90.1    2e-19   
gb|EAS28217.2|  thioredoxin                                           92.4    2e-19   
ref|XP_006374204.1|  TETRATRICOREDOXIN family protein                 94.0    3e-19   
dbj|BAB02711.1|  thioredoxin-like protein                             91.7    3e-19   
ref|XP_011072017.1|  PREDICTED: TPR repeat-containing thioredoxin...  94.0    3e-19   
ref|XP_002322119.2|  hypothetical protein POPTR_0015s04870g           94.0    3e-19   
ref|XP_002530786.1|  Hsc70-interacting protein, putative              94.0    3e-19   
ref|XP_011035572.1|  PREDICTED: LOW QUALITY PROTEIN: TPR repeat-c...  94.0    3e-19   
ref|XP_010268308.1|  PREDICTED: TPR repeat-containing thioredoxin...  93.6    4e-19   
ref|XP_001766436.1|  predicted protein                                89.7    4e-19   
ref|XP_008240130.1|  PREDICTED: TPR repeat-containing thioredoxin...  93.6    4e-19   
ref|XP_009356015.1|  PREDICTED: TPR repeat-containing thioredoxin...  93.6    5e-19   
ref|XP_010268228.1|  PREDICTED: TPR repeat-containing thioredoxin...  93.6    5e-19   
ref|XP_009356014.1|  PREDICTED: TPR repeat-containing thioredoxin...  93.6    5e-19   



>ref|XP_004238750.1| PREDICTED: thioredoxin H2-like [Solanum lycopersicum]
Length=135

 Score =   164 bits (415),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 114/135 (84%), Gaps = 8/135 (6%)
 Frame = +1

Query  28   MGANHssssssTWPESYG----STTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTAT  195
            MGAN+SS    TW E++       +K+  VIAFHSS  W++HFD+ K T +L+VIDFTAT
Sbjct  1    MGANYSS----TWHETHNMPITPQSKRSQVIAFHSSTKWKLHFDSLKNTNKLIVIDFTAT  56

Query  196  WCGPCKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekII  375
            WCGPCKYMEP++++FAA+Y+DVEFVKIDVDEL DVAQ++GV++MPTFVL+KKGKVV+KI+
Sbjct  57   WCGPCKYMEPVLNDFAAKYTDVEFVKIDVDELDDVAQEYGVQAMPTFVLIKKGKVVDKIV  116

Query  376  GADREQLQKKIQKHR  420
            GAD++ LQKKIQKH+
Sbjct  117  GADKDGLQKKIQKHK  131



>ref|XP_006357246.1| PREDICTED: thioredoxin H2-like [Solanum tuberosum]
Length=135

 Score =   163 bits (412),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 113/135 (84%), Gaps = 8/135 (6%)
 Frame = +1

Query  28   MGANHssssssTWPESYG----STTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTAT  195
            MGAN+SS    TW E++        K+  VIAFHSS  W++HFD+ K T +L+VIDFTAT
Sbjct  1    MGANYSS----TWHETHNMPITPQIKRSQVIAFHSSTKWKLHFDSLKNTNKLIVIDFTAT  56

Query  196  WCGPCKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekII  375
            WCGPCKYMEP++++FAA+Y+DVEFVKIDVDEL DVAQ++GV++MPTF+L+KKGKVV+KI+
Sbjct  57   WCGPCKYMEPVLNDFAAKYTDVEFVKIDVDELDDVAQEYGVQAMPTFILIKKGKVVDKIV  116

Query  376  GADREQLQKKIQKHR  420
            GAD++ LQKKIQKH+
Sbjct  117  GADKDGLQKKIQKHK  131



>ref|XP_009758326.1| PREDICTED: thioredoxin H4-like [Nicotiana sylvestris]
Length=140

 Score =   163 bits (412),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 116/136 (85%), Gaps = 5/136 (4%)
 Frame = +1

Query  28   MGANHssssssTWPES-YGSTT----KKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTA  192
            MGAN+S++  +TWPE+ Y STT    K+  VIAFHSS  W++HFD+ K T +L+VIDFTA
Sbjct  1    MGANYSTTIPTTWPEANYMSTTIPQVKRSQVIAFHSSTKWKLHFDSLKDTNKLVVIDFTA  60

Query  193  TWCGPCKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekI  372
            TWCGPCK MEP++++ AA+Y+DVEFVKIDVDEL  VA+++GV++MPTFVL+KKG+VV+K+
Sbjct  61   TWCGPCKNMEPVMNDLAAKYTDVEFVKIDVDELDKVAEEYGVQTMPTFVLIKKGEVVDKV  120

Query  373  IGADREQLQKKIQKHR  420
            +GAD++ L+KKI+KHR
Sbjct  121  VGADKDGLKKKIEKHR  136



>ref|XP_009758325.1| PREDICTED: thioredoxin H4-like [Nicotiana sylvestris]
Length=140

 Score =   161 bits (407),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 116/140 (83%), Gaps = 5/140 (4%)
 Frame = +1

Query  28   MGANHssssssTWPES-YGSTT----KKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTA  192
            MGAN+S++  +TWPE+ Y  TT    K   VIAFHSS  W++HFD+ K T +L+VIDFTA
Sbjct  1    MGANYSTTIPTTWPEANYMPTTIPQFKSSQVIAFHSSTKWKLHFDSLKDTNKLVVIDFTA  60

Query  193  TWCGPCKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekI  372
            TWCGPCK MEP++++ AA+Y+DVEFVKIDVDEL  VA+++GV++MPTFVL+KKG+VV+K+
Sbjct  61   TWCGPCKNMEPVMNDLAAKYTDVEFVKIDVDELDKVAEEYGVQTMPTFVLIKKGEVVDKV  120

Query  373  IGADREQLQKKIQKHRY*LI  432
            +GAD++ L+KKI+KHR  LI
Sbjct  121  VGADKDGLKKKIEKHRCVLI  140



>emb|CDP21876.1| unnamed protein product [Coffea canephora]
Length=130

 Score =   159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 111/135 (82%), Gaps = 8/135 (6%)
 Frame = +1

Query  28   MGANHssssssTWPESYGSTT---KKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATW  198
            MGAN      S W E+   ++   KK  V+AFHSS  W+IHF+ASK+T +L+VIDFTA+W
Sbjct  1    MGAN-----VSAWQEANIDSSMALKKSPVVAFHSSAKWKIHFEASKETNKLIVIDFTASW  55

Query  199  CGPCKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIG  378
            CGPC+Y+EP ++E AA+Y+DVEFVKIDVDEL DVA+++GV++MPTF+L+KKGK ++KI+G
Sbjct  56   CGPCQYIEPSINELAAKYTDVEFVKIDVDELDDVAEEYGVQAMPTFILLKKGKAIDKIVG  115

Query  379  ADREQLQKKIQKHRY  423
            A +E+LQKKI+KHR+
Sbjct  116  AKKEELQKKIEKHRF  130



>ref|XP_009783477.1| PREDICTED: thioredoxin H2-like [Nicotiana sylvestris]
Length=135

 Score =   158 bits (399),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  28   MGANHssssssTWPESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGP  207
            MGAN+SS+       S  +  K   VIAFHSS  W++HF++ K T +L+VIDFTATWCGP
Sbjct  1    MGANYSSTLHEANNISTRAQVKSSQVIAFHSSTKWKLHFNSLKDTNKLVVIDFTATWCGP  60

Query  208  CKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADR  387
            CK MEP++++FAA+Y+DVEFVKIDVDEL DVAQ++GV++MPTFVL++KGK V+K++GAD+
Sbjct  61   CKTMEPVINDFAAKYTDVEFVKIDVDELADVAQEYGVQAMPTFVLIRKGKFVDKVVGADK  120

Query  388  EQLQKKIQKHR  420
            + L+KKI+KHR
Sbjct  121  DGLKKKIEKHR  131



>ref|XP_009614882.1| PREDICTED: thioredoxin H2-like [Nicotiana tomentosiformis]
Length=140

 Score =   158 bits (399),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 114/136 (84%), Gaps = 5/136 (4%)
 Frame = +1

Query  28   MGANHssssssTWPESYGSTT-----KKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTA  192
            MGAN+S++  +TWPE+    T     K+  VIAFHSS  W++HFDA K T +L+VIDFTA
Sbjct  1    MGANYSTTIPTTWPEANNMPTTMPQLKRSQVIAFHSSTKWKLHFDALKDTNKLIVIDFTA  60

Query  193  TWCGPCKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekI  372
            TWCGPCK MEP++++FAA+Y+DVEFVKIDVDEL  VA+++GV++MPTFVL+KKGKVV+K+
Sbjct  61   TWCGPCKNMEPVINDFAAKYTDVEFVKIDVDELDKVAEEYGVQAMPTFVLIKKGKVVDKV  120

Query  373  IGADREQLQKKIQKHR  420
            +GAD++ L+KKI+KHR
Sbjct  121  VGADKDGLKKKIEKHR  136



>gb|EYU28689.1| hypothetical protein MIMGU_mgv1a023737mg [Erythranthe guttata]
Length=134

 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 108/139 (78%), Gaps = 12/139 (9%)
 Frame = +1

Query  28   MGANHssssssTWPESYGSTT-------KKPLVIAFHSSMNWRIHFDASKQTKQLMVIDF  186
            MGAN      ST  E+ G+T        KK  VIA HSS NWR+HF+ASKQT +L+VIDF
Sbjct  1    MGAN-----VSTVYETNGATNTIERQPYKKNQVIAVHSSSNWRVHFEASKQTSKLIVIDF  55

Query  187  TATWCGPCKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvve  366
            TA+WCGPC+++ P V+EFA +Y DV+F+KIDVDEL DVAQ+FGV++MPTF+L+K GK V+
Sbjct  56   TASWCGPCQFILPSVNEFAEKYGDVDFIKIDVDELHDVAQEFGVQAMPTFILMKGGKEVD  115

Query  367  kIIGADREQLQKKIQKHRY  423
            K++GA RE LQKKI+KHR+
Sbjct  116  KVVGAKREDLQKKIEKHRF  134



>ref|XP_009592735.1| PREDICTED: thioredoxin H2-like [Nicotiana tomentosiformis]
Length=136

 Score =   155 bits (393),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 113/140 (81%), Gaps = 9/140 (6%)
 Frame = +1

Query  28   MGANHssssssTWPESYGSTT-----KKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTA  192
            MGAN+SS    T  E+   TT     K+  VIAFHSS  W++HFD+ K T +L+VIDFTA
Sbjct  1    MGANYSS----TLHEANNMTTTVPQVKRSQVIAFHSSTKWKLHFDSLKDTNKLVVIDFTA  56

Query  193  TWCGPCKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekI  372
             WCGPCKY+EP++++FAA+Y+DVEFVKIDVDEL  VA+++GV++MPTFVL+KKGKV++K+
Sbjct  57   AWCGPCKYIEPVINDFAAKYTDVEFVKIDVDELAKVAEEYGVQAMPTFVLIKKGKVIDKV  116

Query  373  IGADREQLQKKIQKHRY*LI  432
            +GAD++ L+KKI+KHR  LI
Sbjct  117  VGADKDGLKKKIEKHRAILI  136



>ref|XP_004238752.2| PREDICTED: thioredoxin H2-like [Solanum lycopersicum]
Length=135

 Score =   154 bits (390),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  28   MGANHssssssTWPESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGP  207
            MGAN+S++             K+  VIAFHSS  W++HFD+ K T +L+VIDFTATWCGP
Sbjct  1    MGANYSTTLHEAHNMPTTPQFKRSQVIAFHSSTKWKLHFDSLKDTNKLVVIDFTATWCGP  60

Query  208  CKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADR  387
            CKYMEP++++FA +Y+DVEFVKIDVDEL DVAQ++GV+SMPTFVL++KGKVV+KI+GAD+
Sbjct  61   CKYMEPVLNDFATKYTDVEFVKIDVDELDDVAQEYGVQSMPTFVLIRKGKVVDKIVGADK  120

Query  388  EQLQKKIQKHR  420
            + L+ KI+KH+
Sbjct  121  DGLKMKIEKHK  131



>ref|XP_006357248.1| PREDICTED: thioredoxin H2-like [Solanum tuberosum]
Length=120

 Score =   154 bits (389),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +1

Query  91   KKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFV  270
            K+  VIAFHSS  W++HFD+ K T +L+VIDFTATWCGPCKYMEP++++FA +Y+DVEFV
Sbjct  8    KRSQVIAFHSSTKWKLHFDSLKDTNKLVVIDFTATWCGPCKYMEPVLNDFATKYTDVEFV  67

Query  271  KIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            KIDVDEL DVAQ++GV+SMPTFVL++KGKVV+KI+GAD++ L+ KI+KHR
Sbjct  68   KIDVDELDDVAQEYGVQSMPTFVLMRKGKVVDKIVGADKDGLKMKIEKHR  117



>ref|XP_002274663.1| PREDICTED: thioredoxin H2 [Vitis vinifera]
 emb|CBI32032.3| unnamed protein product [Vitis vinifera]
Length=121

 Score =   149 bits (376),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+ F+SS +W+IHF+ +K T +LMVIDF+ATWCGPC++MEP+++EFA +Y+DVEFVKIDV
Sbjct  14   VLTFNSSASWKIHFEEAKSTGKLMVIDFSATWCGPCRFMEPVINEFAEKYTDVEFVKIDV  73

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ+FGV+ MPTF+L+K+G  V+K++GA +E+LQKKI+ HR
Sbjct  74   DELSDVAQEFGVQGMPTFLLIKRGTEVDKVVGAKKEELQKKIEAHR  119



>ref|XP_006344288.1| PREDICTED: thioredoxin H2-like [Solanum tuberosum]
Length=133

 Score =   149 bits (376),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +1

Query  28   MGANHssssssTWPESYGSTTK-KPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCG  204
            MGAN+SS    T   +  ST   K  VI FHSS  W+IHFD+ KQT +L+VIDFTA+WCG
Sbjct  1    MGANNSSGWQQTNNNALTSTLPMKNQVIHFHSSATWKIHFDSLKQTNKLIVIDFTASWCG  60

Query  205  PCKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGAD  384
            PC++MEP++++FA+ Y+DVEF+KIDVDEL DVAQ++GV++MPTFVL+K+GK+V++++GAD
Sbjct  61   PCRHMEPVINDFASTYTDVEFIKIDVDELDDVAQEYGVQAMPTFVLIKQGKLVDQLVGAD  120

Query  385  REQLQKKIQKHR  420
            ++ L+KKI+ +R
Sbjct  121  KDGLKKKIEINR  132



>ref|XP_009803170.1| PREDICTED: thioredoxin H2-like [Nicotiana sylvestris]
Length=136

 Score =   149 bits (376),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 112/135 (83%), Gaps = 7/135 (5%)
 Frame = +1

Query  28   MGANHssssssTWPESYGSTT----KKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTAT  195
            MG N+SS+       +Y STT    K+  VIAFHSS  W++HFD+ K T +L+VIDFTAT
Sbjct  1    MGGNYSSTLHEA---NYMSTTIPQVKRSQVIAFHSSSKWKLHFDSLKDTNKLVVIDFTAT  57

Query  196  WCGPCKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekII  375
            WCGPCKYMEPI+++FAA+Y+DVEFVKIDVDEL  VA+++GV++MPTFVL+KKGKVV+K++
Sbjct  58   WCGPCKYMEPIMNDFAAKYTDVEFVKIDVDELDKVAEEYGVQAMPTFVLIKKGKVVDKVV  117

Query  376  GADREQLQKKIQKHR  420
            GAD++ L+KKI+KHR
Sbjct  118  GADKDGLKKKIEKHR  132



>ref|XP_004238755.1| PREDICTED: thioredoxin H4 [Solanum lycopersicum]
Length=135

 Score =   148 bits (373),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +1

Query  28   MGANHssssssTWPESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGP  207
            MGAN+S +             K+  VIAFHSS  W++HFD+ K T +L+VIDFTATWCGP
Sbjct  1    MGANYSVTLHEAHNMPITPQFKRSQVIAFHSSTKWKLHFDSLKNTNKLVVIDFTATWCGP  60

Query  208  CKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADR  387
            CKYMEPI+++FAA+Y DVEFVKIDVDEL DVAQ++GV++MPTFVL+KKGKVV+K++GAD+
Sbjct  61   CKYMEPILNDFAAKYIDVEFVKIDVDELDDVAQEYGVQAMPTFVLIKKGKVVDKVVGADK  120

Query  388  EQLQKKIQKHR  420
            + L+ KI+KH+
Sbjct  121  DGLKMKIEKHK  131



>ref|XP_011003195.1| PREDICTED: thioredoxin H2-like [Populus euphratica]
 ref|XP_011012002.1| PREDICTED: thioredoxin H2-like [Populus euphratica]
Length=140

 Score =   148 bits (373),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V AFHSS  W++HF+A K T QLMVIDF A+WCGPCK+MEP VH  AA+++DV+F KIDV
Sbjct  33   VTAFHSSARWQLHFNAIKNTNQLMVIDFAASWCGPCKHMEPAVHAMAAKFTDVQFAKIDV  92

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ+FGV++MPTFVLVKKG  V++++GA +E+LQ+KI+KHR
Sbjct  93   DELPDVAQEFGVQAMPTFVLVKKGNEVDRVVGAQKEELQRKIEKHR  138



>emb|CAN83268.1| hypothetical protein VITISV_040061 [Vitis vinifera]
Length=121

 Score =   147 bits (371),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+ F+SS +W+IHF+ +K T +LMVIDF+A WCGPC++MEP+++EFA +Y+DVEFVKIDV
Sbjct  14   VLTFNSSASWKIHFEEAKSTGKLMVIDFSAXWCGPCRFMEPVINEFAEKYTDVEFVKIDV  73

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ+FGV+ MPTF+L+K+G  V+K++GA +E+LQKKI+ HR
Sbjct  74   DELSDVAQEFGVQXMPTFLLIKRGTEVDKVVGAKKEELQKKIZAHR  119



>gb|AGG09341.1| thioredoxin h3 [Vitis vinifera]
Length=121

 Score =   147 bits (370),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+ F+SS +W+I F+ +K T +LMVIDF+ATWCGPC++MEP+++EFA +Y+DVEFVKIDV
Sbjct  14   VLTFNSSASWKIRFEEAKSTGKLMVIDFSATWCGPCRFMEPVINEFAEKYTDVEFVKIDV  73

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ+FGV+ MPTF+L+K+G  V+K++GA +E+LQKKI+ HR
Sbjct  74   DELSDVAQEFGVQGMPTFLLIKRGTEVDKVVGAKKEELQKKIEAHR  119



>ref|XP_002324032.2| thioredoxin family protein [Populus trichocarpa]
 gb|EEF04165.2| thioredoxin family protein [Populus trichocarpa]
Length=140

 Score =   146 bits (369),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V AFHSS  W++HF++ K T QLMVIDF A+WCGPCK+MEP VH  AA+++DV+F KIDV
Sbjct  33   VTAFHSSARWQLHFNSIKNTNQLMVIDFAASWCGPCKHMEPAVHAMAAKFTDVQFAKIDV  92

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ+FGV++MPTFVLVKKG  V++++GA +E+LQ+KI+KHR
Sbjct  93   DELPDVAQEFGVQAMPTFVLVKKGNEVDRVVGAQKEELQRKIEKHR  138



>ref|XP_004237020.1| PREDICTED: thioredoxin H4-like [Solanum lycopersicum]
Length=133

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +1

Query  28   MGANHssssssTWPESYGSTTK-KPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCG  204
            MGAN+SSS   T   +  ST   K  VI FHSS  W+IHFD+ KQT +L+VIDFTA+WCG
Sbjct  1    MGANNSSSWKQTNNNALASTLPMKNQVIHFHSSTTWKIHFDSLKQTNKLIVIDFTASWCG  60

Query  205  PCKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGAD  384
            PC++MEP++++FA+ Y+DV F+KIDVDEL DVAQ++GV++MPTFVL+K+GK+V++++GAD
Sbjct  61   PCRHMEPVINDFASTYTDVVFIKIDVDELDDVAQEYGVQAMPTFVLIKQGKIVDQLVGAD  120

Query  385  REQLQKKIQKHR  420
            ++ L+KKI+ ++
Sbjct  121  KDGLKKKIEINK  132



>ref|XP_011085782.1| PREDICTED: thioredoxin H2 [Sesamum indicum]
 ref|XP_011085783.1| PREDICTED: thioredoxin H2 [Sesamum indicum]
Length=139

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
             +T +   VIAFHSS  W++HF++SKQ  +LMV+DF+ATWCGPCK+MEP+ +  +A+YSD
Sbjct  19   STTDESSRVIAFHSSQRWQLHFNSSKQLNKLMVVDFSATWCGPCKFMEPVFNNLSAKYSD  78

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            V+FVKIDVDEL DV+++FGV++MPTF+L+K+GK VE+++GA +++L++KI KHR
Sbjct  79   VDFVKIDVDELSDVSREFGVQAMPTFLLLKQGKEVERVVGAKKDELEQKILKHR  132



>ref|XP_011086414.1| PREDICTED: thioredoxin H2-like [Sesamum indicum]
Length=171

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
             +  KK  VI F SS  W+IHF+ASKQT +L+VIDFTA+WCGPC+ ++P ++EFA +Y+D
Sbjct  57   STPVKKGQVITFRSSSKWKIHFEASKQTPKLIVIDFTASWCGPCQIIQPAINEFAEKYTD  116

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHRY  423
            VEF+KIDVDEL DVA++FGV++MPTF+L+KKGK ++K++GA ++ LQKKI+KHR+
Sbjct  117  VEFIKIDVDELHDVAEEFGVQAMPTFILIKKGKEIDKVVGAKKDDLQKKIEKHRF  171



>ref|XP_004297814.1| PREDICTED: thioredoxin H2-like [Fragaria vesca subsp. vesca]
Length=131

 Score =   145 bits (366),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +1

Query  70   ESYGST-TKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAA  246
            +S GS+  KK  +++FHS   W+ HF ASKQT +LMVIDFTATWCGPC+ MEP + E+A 
Sbjct  13   DSDGSSHGKKSRIMSFHSKDQWKTHFTASKQTNKLMVIDFTATWCGPCRSMEPALKEYAD  72

Query  247  QYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +Y+DVEFVK+DVDEL DVA +FGV++MP+FV +KKG+V+++++GA +E+LQKKI+KHR
Sbjct  73   KYTDVEFVKLDVDELPDVAMEFGVQAMPSFVFIKKGEVIDRVVGARKEELQKKIEKHR  130



>ref|XP_007226116.1| hypothetical protein PRUPE_ppa013299mg [Prunus persica]
 gb|EMJ27315.1| hypothetical protein PRUPE_ppa013299mg [Prunus persica]
Length=130

 Score =   145 bits (366),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 101/131 (77%), Gaps = 2/131 (2%)
 Frame = +1

Query  28   MGANHssssssTWPESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGP  207
            MG N   S    + +   S  KK  ++AFHS   W  HF+ASK++ +LMVIDFTATWCGP
Sbjct  1    MGGN--LSHIQDYSDDDSSRGKKSRIMAFHSKDQWNTHFNASKESNKLMVIDFTATWCGP  58

Query  208  CKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADR  387
            C+ MEP + E+A +Y+DVEF+K+DVDEL DVA++FGV++MP+FV VKKG VV+K++GA +
Sbjct  59   CRAMEPTLKEYADKYTDVEFIKLDVDELPDVAREFGVQAMPSFVFVKKGDVVDKVVGARK  118

Query  388  EQLQKKIQKHR  420
            E+LQKKI+KHR
Sbjct  119  EELQKKIEKHR  129



>ref|XP_008221701.1| PREDICTED: thioredoxin H2-like [Prunus mume]
Length=130

 Score =   145 bits (365),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 101/131 (77%), Gaps = 2/131 (2%)
 Frame = +1

Query  28   MGANHssssssTWPESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGP  207
            MG N   S    + +   S  KK  ++AFHS   W  HF+ASK++ +LMVIDFTATWCGP
Sbjct  1    MGGN--LSHIQDYSDDDSSRGKKSRIMAFHSKDQWSTHFNASKESNKLMVIDFTATWCGP  58

Query  208  CKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADR  387
            C+ MEP + E+A +Y+DVEF+K+DVDEL DVA++FGV++MP+FV VKKG VV+K++GA +
Sbjct  59   CRAMEPTLKEYADKYTDVEFIKLDVDELPDVAREFGVQAMPSFVFVKKGDVVDKVVGARK  118

Query  388  EQLQKKIQKHR  420
            E+LQKKI+KHR
Sbjct  119  EELQKKIEKHR  129



>ref|XP_006338484.1| PREDICTED: thioredoxin H2-like [Solanum tuberosum]
Length=142

 Score =   145 bits (366),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +1

Query  70   ESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQ  249
            E  GS ++   VIAFHSS  W++HF++SKQ  +L+V+DF A WCGPCK+MEP ++  A++
Sbjct  19   EVSGSPSEPSRVIAFHSSNRWQLHFNSSKQLNKLIVVDFAAAWCGPCKFMEPAINAMASK  78

Query  250  YSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            Y+DV+FVKIDVDEL DVA++FGV++MPTF+L+K+GK VE+++GA +++L+KKI KHR
Sbjct  79   YTDVDFVKIDVDELSDVAKEFGVQAMPTFLLLKQGKEVERVVGAKKDELEKKILKHR  135



>ref|XP_002282318.1| PREDICTED: thioredoxin H2 [Vitis vinifera]
 emb|CAN70031.1| hypothetical protein VITISV_013686 [Vitis vinifera]
 emb|CBI35034.3| unnamed protein product [Vitis vinifera]
 gb|AGG09342.1| thioredoxin h4 [Vitis vinifera]
Length=136

 Score =   145 bits (365),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +1

Query  82   STTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDV  261
            ST +   V  FHSS  W +HF+ASK++ QLMVIDF ATWCGPCK+MEP V   A++Y+DV
Sbjct  19   STLEGSGVNVFHSSERWLLHFNASKESNQLMVIDFAATWCGPCKFMEPAVKSMASKYTDV  78

Query  262  EFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +FVKIDVDEL DVAQ+F V++MPTFVL+KKGK +E++IGA +++L+KKIQKHR
Sbjct  79   DFVKIDVDELPDVAQEFTVQAMPTFVLLKKGKELERVIGAKKDELEKKIQKHR  131



>emb|CAH59452.1| thioredoxin 3 [Plantago major]
Length=142

 Score =   145 bits (365),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
            G +++   V+AFHSS  W++HF++SKQ  +LMV+DFTATWCGPCK+M P+  E + +YSD
Sbjct  22   GDSSEPSRVMAFHSSQRWQLHFNSSKQLNKLMVVDFTATWCGPCKFMAPVFAELSTKYSD  81

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            V+FVKIDVDEL DVA++FGV++MPTF+L+K+GK V  ++GA +++L+KKI +HR
Sbjct  82   VDFVKIDVDELADVAREFGVQAMPTFMLLKQGKQVGTVVGAKKDELEKKILEHR  135



>gb|AAY42864.1| thioredoxin H [Nicotiana alata]
Length=152

 Score =   145 bits (365),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIAFHSS  W++HF++SKQ  +L+V+DF ATWCGPCK MEP+++  +A+Y+DV+FVKIDV
Sbjct  30   VIAFHSSNRWQLHFNSSKQLNKLIVVDFAATWCGPCKMMEPVINAMSAKYTDVDFVKIDV  89

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ+FGV++MPTF+L+K+GK VE+++GA +++L+KKI KHR
Sbjct  90   DELSDVAQEFGVQAMPTFLLLKQGKEVERVVGAKKDELEKKILKHR  135



>ref|XP_009602293.1| PREDICTED: thioredoxin H2 [Nicotiana tomentosiformis]
Length=142

 Score =   144 bits (363),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIAFHSS  W++HF++SKQ  +L+V+DF ATWCGPCK MEP+V+  +A+Y+DV+FVKIDV
Sbjct  30   VIAFHSSNRWQLHFNSSKQLNKLIVVDFAATWCGPCKMMEPVVNAMSAKYTDVDFVKIDV  89

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVA++FGV++MPTF+L+K+GK VE+++GA +++L+KKI KHR
Sbjct  90   DELSDVAKEFGVQAMPTFLLLKQGKEVERVVGAKKDELEKKILKHR  135



>ref|XP_007157413.1| hypothetical protein PHAVU_002G068000g [Phaseolus vulgaris]
 gb|ESW29407.1| hypothetical protein PHAVU_002G068000g [Phaseolus vulgaris]
Length=128

 Score =   143 bits (361),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  100  LVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKID  279
            L++ FHS+  W+ HF ASK+T +L+VIDFTATWCGPCK+MEPI+ EFAA+Y+DVEF+KID
Sbjct  21   LILTFHSTAKWKAHFHASKETNKLLVIDFTATWCGPCKHMEPIIKEFAAKYTDVEFIKID  80

Query  280  VDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            VDEL +VAQ F V++MPTF+L+KKGK VEK++GA +E+L+K I+K R
Sbjct  81   VDELMEVAQAFQVQTMPTFILIKKGKQVEKVVGAKKEELKKLIEKRR  127



>ref|NP_001236052.1| uncharacterized protein LOC100527691 [Glycine max]
 gb|ACU16835.1| unknown [Glycine max]
 gb|KHN01161.1| Thioredoxin H2 [Glycine soja]
Length=126

 Score =   143 bits (361),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 104/131 (79%), Gaps = 6/131 (5%)
 Frame = +1

Query  28   MGANHssssssTWPESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGP  207
            MGAN S+       E    ++   LV+ FHS+  W+ HFDASK+T +LMVIDFTATWCGP
Sbjct  1    MGANFSTF------EFVEKSSHSSLVLTFHSTAKWKAHFDASKETNKLMVIDFTATWCGP  54

Query  208  CKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADR  387
            CKYM+PI+ EFAA+Y+DVEF+KIDVDEL +VA+ F V++MPTF+L+KKGKVVEK++GA +
Sbjct  55   CKYMDPIIKEFAAKYTDVEFIKIDVDELMEVAEAFQVQAMPTFILIKKGKVVEKVVGAKK  114

Query  388  EQLQKKIQKHR  420
            E+LQK I+K R
Sbjct  115  EELQKLIEKRR  125



>ref|XP_009795987.1| PREDICTED: thioredoxin H2 [Nicotiana sylvestris]
Length=142

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIAFHSS  W++HF++SKQ  +L+V+DF ATWCGPCK MEP+++  +A+Y+DV+FVKIDV
Sbjct  30   VIAFHSSNRWQLHFNSSKQLNKLIVVDFAATWCGPCKMMEPVINAMSAKYTDVDFVKIDV  89

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ+FGV++MPTF+L+K+GK VE+++G  +++L+KKI KHR
Sbjct  90   DELSDVAQEFGVQAMPTFLLLKQGKEVERVVGGKKDELEKKILKHR  135



>ref|XP_010316263.1| PREDICTED: LOW QUALITY PROTEIN: thioredoxin H2 [Solanum lycopersicum]
Length=142

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +1

Query  70   ESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQ  249
            E  GS ++   VIAFHSS  W++HF++SKQ  +L+V+DF A WCGPCK+MEP ++  A++
Sbjct  19   EVSGSPSEPSRVIAFHSSNRWQLHFNSSKQLNKLIVVDFAAAWCGPCKFMEPAINAMASK  78

Query  250  YSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            Y+DV+FVKIDVDEL DVA++FGV++MPTF+L+K+GK VE+++G  +++L+KKI KHR
Sbjct  79   YTDVDFVKIDVDELSDVAKEFGVQAMPTFLLLKQGKEVERVVGXKKDELEKKILKHR  135



>ref|XP_006357247.1| PREDICTED: thioredoxin H2-like [Solanum tuberosum]
Length=135

 Score =   142 bits (358),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 102/128 (80%), Gaps = 12/128 (9%)
 Frame = +1

Query  61   TWPESYGSTTKKPL--------VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKY  216
            TWPE      KKP+        VIAFHSS  W++HFD+ K T +L+VIDFTATWCGPCK 
Sbjct  8    TWPE----FNKKPITPQIKGSQVIAFHSSTKWKLHFDSLKDTNKLVVIDFTATWCGPCKN  63

Query  217  MEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQL  396
            M+PI+++FA++Y+DVEFVKIDVDEL DVA ++ V++MPTF L+K+GKVV+KI+GAD++ L
Sbjct  64   MDPIINDFASKYTDVEFVKIDVDELVDVALEYEVQAMPTFALMKRGKVVDKIVGADKDGL  123

Query  397  QKKIQKHR  420
            + KI+K++
Sbjct  124  KMKIEKYK  131



>ref|XP_003519128.1| PREDICTED: thioredoxin H2-like [Glycine max]
Length=127

 Score =   142 bits (357),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +1

Query  82   STTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDV  261
            S+    L++ FHS+  W+ HFD SK+T +LMVIDFTATWCGPCKYM+PI+  FAA+Y+DV
Sbjct  14   SSHSSSLILTFHSTAKWKAHFDVSKETNKLMVIDFTATWCGPCKYMDPIIKNFAAKYTDV  73

Query  262  EFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            EF+KIDVDEL +VAQ F V++MPTF+L+KKGKVVEK++GA +E+LQK I KHR
Sbjct  74   EFIKIDVDELMEVAQAFQVQAMPTFILIKKGKVVEKVVGAKKEELQKLIDKHR  126



>ref|XP_004489966.1| PREDICTED: thioredoxin H2-like [Cicer arietinum]
Length=127

 Score =   141 bits (356),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +1

Query  85   TTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVE  264
            +T+   ++ FHS+  W+ HF+ASK+T +LMVIDFTATWC PCKYM+PIV E AA+Y DVE
Sbjct  15   STQPSQILTFHSTAKWKAHFEASKETNKLMVIDFTATWCRPCKYMDPIVKELAAKYKDVE  74

Query  265  FVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            F+KIDVDEL +VA+ F V++MPTF+L+KKG VVE+++GA +E+LQK ++KH+
Sbjct  75   FIKIDVDELMEVARAFQVQTMPTFILIKKGNVVERVVGAKKEELQKLVEKHK  126



>ref|XP_003613549.1| Thioredoxin H2 [Medicago truncatula]
 gb|AES96507.1| thioredoxin [Medicago truncatula]
Length=127

 Score =   141 bits (355),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 102/132 (77%), Gaps = 7/132 (5%)
 Frame = +1

Query  28   MGANHssssssTWPESYGSTTKKP-LVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCG  204
            MGAN S+       ES    + +P L++ FHS+  W+ HF+ASK T +LMVIDFTATWCG
Sbjct  1    MGANFSNL------ESVVEKSSQPSLILTFHSTAKWKAHFEASKVTNKLMVIDFTATWCG  54

Query  205  PCKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGAD  384
            PCKYM+PI+ E AA+Y DVEF+KIDVDEL DVA  F V++MPTF+L+KKGKVVEK++GA 
Sbjct  55   PCKYMDPIIKELAAKYKDVEFIKIDVDELMDVASAFQVQAMPTFILLKKGKVVEKVVGAK  114

Query  385  REQLQKKIQKHR  420
            +EQLQK I+K R
Sbjct  115  KEQLQKLIEKRR  126



>ref|XP_010272215.1| PREDICTED: thioredoxin H2 [Nelumbo nucifera]
Length=136

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
            G+ +    V+AFHS+  WR HF+A K + QLMVIDFTA+WCGPC++++P + E AA+Y+D
Sbjct  16   GAPSGPSRVLAFHSASEWRAHFNACKDSTQLMVIDFTASWCGPCRFIQPALDELAAKYTD  75

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            VEFVKIDVDEL +VAQ+F VE+MPTFVL+K+GK V+K++GA +++L+KKI KHR
Sbjct  76   VEFVKIDVDELVEVAQEFKVEAMPTFVLIKQGKEVDKVVGAKKDELEKKILKHR  129



>gb|ACZ37071.1| thioredoxin h7 [Medicago truncatula]
Length=127

 Score =   140 bits (352),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 102/132 (77%), Gaps = 7/132 (5%)
 Frame = +1

Query  28   MGANHssssssTWPESYGSTTKKP-LVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCG  204
            MGAN S+       ES    + +P L++ FHS+  W+ HF+ASK T +LMVIDFTATWCG
Sbjct  1    MGANFSNL------ESVVEKSSQPSLILTFHSTAKWKAHFEASKVTNKLMVIDFTATWCG  54

Query  205  PCKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGAD  384
            PCKYM+PI+ E AA+Y DVEF+KIDVDEL +VA  F V++MPTF+L+KKGKVVEK++GA 
Sbjct  55   PCKYMDPIIKELAAKYKDVEFIKIDVDELMEVASAFQVQAMPTFILLKKGKVVEKVVGAK  114

Query  385  REQLQKKIQKHR  420
            +EQLQK I+K R
Sbjct  115  KEQLQKLIEKRR  126



>gb|EYU34674.1| hypothetical protein MIMGU_mgv1a014830mg [Erythranthe guttata]
Length=177

 Score =   141 bits (355),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V AFHSS  W++HF+++KQ  +LMVIDF+ATWCGPCK+MEP+ ++ +AQY+DV+F+KIDV
Sbjct  65   VTAFHSSQRWQLHFNSAKQLNKLMVIDFSATWCGPCKFMEPVFNDMSAQYTDVDFIKIDV  124

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVA++F V++MPTFVL+K+GK VE+++G  +++L+KKI KHR
Sbjct  125  DELADVAREFAVQAMPTFVLLKQGKEVERVVGGKKDELEKKILKHR  170



>emb|CDP00271.1| unnamed protein product [Coffea canephora]
Length=120

 Score =   139 bits (350),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 93/118 (79%), Gaps = 1/118 (1%)
 Frame = +1

Query  73   SYGST-TKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQ  249
            +Y ST   +  VI  HS+  WR+H++ SK T +LMVIDF+A+WCGPC YMEPIV EF+  
Sbjct  3    AYWSTGANRSKVIEIHSTKKWRVHYEESKGTDKLMVIDFSASWCGPCGYMEPIVKEFSTT  62

Query  250  YSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHRY  423
            Y+DV F KIDVDEL DVA++FGV++MPTFV +K GK V+K++GADRE+L++ I K+R+
Sbjct  63   YTDVVFFKIDVDELADVAKEFGVQAMPTFVFMKNGKEVDKLVGADREELERMIHKYRF  120



>ref|XP_011071041.1| PREDICTED: thioredoxin H2 [Sesamum indicum]
Length=125

 Score =   139 bits (350),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = +1

Query  76   YGST-TKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQY  252
            YG++ T K  VI FHSS  W++HF+A KQT +L+VIDFTA+WCGPC++++P + EFA  Y
Sbjct  9    YGTSPTTKGQVITFHSSSKWKVHFEALKQTSKLIVIDFTASWCGPCQHIQPAIKEFAEIY  68

Query  253  SDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +DV+F+KIDVDEL  VA++FGV++MPTF+L K+GK V+K++GA +E L++KI+KHR
Sbjct  69   TDVDFIKIDVDELDGVAREFGVQTMPTFILFKRGKEVDKVVGAKKEDLKEKIEKHR  124



>ref|XP_007157414.1| hypothetical protein PHAVU_002G068100g [Phaseolus vulgaris]
 gb|ESW29408.1| hypothetical protein PHAVU_002G068100g [Phaseolus vulgaris]
Length=127

 Score =   139 bits (350),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 101/130 (78%), Gaps = 5/130 (4%)
 Frame = +1

Query  28   MGANHssssssTWPESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGP  207
            MG N      S+   ++ S+     ++ FHS+  W+ HFDASKQ  +LMVIDFTATWCGP
Sbjct  1    MGGN-----LSSMENAHVSSNSSSHILTFHSTAKWKAHFDASKQINKLMVIDFTATWCGP  55

Query  208  CKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADR  387
            CK M+P++ +FAA+Y++VEF+KIDVDEL  V+++F V++MPTF+L+KKGKVV+K++GA +
Sbjct  56   CKQMDPVIQDFAAKYTNVEFIKIDVDELMGVSEEFQVQAMPTFILMKKGKVVDKVLGAKK  115

Query  388  EQLQKKIQKH  417
            E+LQK I+KH
Sbjct  116  EKLQKLIEKH  125



>ref|XP_007032429.1| Thioredoxin 2 [Theobroma cacao]
 gb|EOY03355.1| Thioredoxin 2 [Theobroma cacao]
Length=139

 Score =   138 bits (347),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+ FHSS  W++HF++ K+T +L+VIDF+A+WCGPCK++EP VH+ AA++++V+FVKIDV
Sbjct  28   VLTFHSSSRWQLHFNSVKETPKLIVIDFSASWCGPCKFIEPAVHDMAAKFTEVDFVKIDV  87

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ+FGV++MPTFVLVKKGK V++++GA +  L+KK++KHR
Sbjct  88   DELPDVAQEFGVQAMPTFVLVKKGKEVDRVVGAQKNDLEKKVEKHR  133



>ref|XP_003517914.1| PREDICTED: thioredoxin H2-like [Glycine max]
 gb|KHN01160.1| Thioredoxin H7 [Glycine soja]
Length=124

 Score =   137 bits (346),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            ++ FHS+  W+ HFDASKQT +LMVIDFTATWCGPCK M+PI+ E+AA+Y++VEF+KIDV
Sbjct  18   LLTFHSTAKWKTHFDASKQTNKLMVIDFTATWCGPCKSMDPIIQEYAAKYTNVEFIKIDV  77

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL +V+Q+F V++MPTF+L+KKGKVV+K++GA +E+LQK I+KH
Sbjct  78   DELMEVSQEFKVQAMPTFILIKKGKVVDKVVGAKKEELQKLIEKH  122



>ref|XP_008352997.1| PREDICTED: thioredoxin H2-like [Malus domestica]
Length=129

 Score =   137 bits (346),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 96/116 (83%), Gaps = 3/116 (3%)
 Frame = +1

Query  73   SYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQY  252
            S+G  ++   +++FHS   W  HF ASK + +LMVIDFTATWCGPC+ MEPI+ ++A ++
Sbjct  15   SHGHESR---IVSFHSKGQWNTHFAASKDSDKLMVIDFTATWCGPCRAMEPILRDYADKF  71

Query  253  SDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +DVEFVK+DVDEL DVA++FGV++MP+FV +KKG VV+KI+GA +++LQKKI+KHR
Sbjct  72   TDVEFVKLDVDELPDVAREFGVQAMPSFVFMKKGVVVDKIVGARKDELQKKIEKHR  127



>ref|XP_004135204.1| PREDICTED: thioredoxin H2-like [Cucumis sativus]
 ref|XP_004155328.1| PREDICTED: thioredoxin H2-like [Cucumis sativus]
 gb|KGN51870.1| Thioredoxin h [Cucumis sativus]
Length=131

 Score =   137 bits (346),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +1

Query  61   TWPESYGSTT----KKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPI  228
            T P S  S      K P +I  H    W   F+A+K+T +LMVIDFTA WCGPC++MEP 
Sbjct  6    TVPRSKSSNAMIQQKPPTIIECHDKAQWTARFEATKETNKLMVIDFTAAWCGPCRHMEPT  65

Query  229  VHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKI  408
            + E AA++ DVEFVKIDVDEL DVA+++GVE+MPTF+L+K GKV++K++GA R+ LQKKI
Sbjct  66   IKELAARFKDVEFVKIDVDELMDVAKEYGVEAMPTFILIKNGKVIDKVVGARRDDLQKKI  125

Query  409  QKH  417
            +KH
Sbjct  126  EKH  128



>ref|XP_006431063.1| hypothetical protein CICLE_v10013081mg [Citrus clementina]
 gb|ESR44303.1| hypothetical protein CICLE_v10013081mg [Citrus clementina]
Length=136

 Score =   137 bits (345),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 93/118 (79%), Gaps = 4/118 (3%)
 Frame = +1

Query  67   PESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAA  246
            P S  +T     V++FHSS  W++HFD+ K + QLMVIDF A+WCGPCK MEP + + A+
Sbjct  20   PHSESATN----VMSFHSSARWQLHFDSCKTSSQLMVIDFAASWCGPCKIMEPELRKMAS  75

Query  247  QYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
             YSDV+FVKIDVDEL DVAQ+F V++MPTFVLVK GK VE++IGA +++L KKI+KHR
Sbjct  76   TYSDVQFVKIDVDELSDVAQEFQVQAMPTFVLVKGGKEVERVIGARKDELLKKIEKHR  133



>ref|XP_009335817.1| PREDICTED: thioredoxin H2-like [Pyrus x bretschneideri]
Length=133

 Score =   137 bits (344),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
            G+  ++P V +FHSS  W++H ++ K++ QL+VIDF+A+WCGPC+++EP +H  AA+++D
Sbjct  18   GAYGEEPGVTSFHSSARWQLHLNSHKESSQLLVIDFSASWCGPCRFIEPAIHAMAAKFTD  77

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            V+F KIDVDEL +VAQ+FGV++MPTFVL+KKGK V+++IG  +++L+KK++K+R
Sbjct  78   VQFAKIDVDELSEVAQEFGVQAMPTFVLLKKGKEVDRVIGGKKDELEKKVEKYR  131



>ref|XP_009360412.1| PREDICTED: thioredoxin H2-like [Pyrus x bretschneideri]
Length=129

 Score =   136 bits (343),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +1

Query  94   KPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVK  273
            K  ++AFHS   W  HF AS  + +LMVIDFTATWCGPC+ MEPI  E+A +++DVEFVK
Sbjct  19   KSRIVAFHSKHQWNTHFAASINSDKLMVIDFTATWCGPCRAMEPIFREYADKFTDVEFVK  78

Query  274  IDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +DVDEL DVA +FGV++MP+FV VKKG+VV++I+GA +++LQKKI+KHR
Sbjct  79   LDVDELPDVAMEFGVQAMPSFVYVKKGEVVDRIVGARKDELQKKIEKHR  127



>ref|XP_006482526.1| PREDICTED: thioredoxin H2-like [Citrus sinensis]
Length=143

 Score =   137 bits (344),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 93/118 (79%), Gaps = 4/118 (3%)
 Frame = +1

Query  67   PESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAA  246
            P S  +T     V++FHSS  W++HFD+ K + QLMVIDF A+WCGPCK MEP + + A+
Sbjct  20   PHSESATN----VMSFHSSARWQLHFDSCKTSSQLMVIDFAASWCGPCKIMEPELRKMAS  75

Query  247  QYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
             YSDV+FVKIDVDEL DVAQ+F V++MPTFVLVK GK VE++IGA +++L KKI+KHR
Sbjct  76   TYSDVQFVKIDVDELSDVAQEFQVQAMPTFVLVKGGKEVERVIGARKDELLKKIEKHR  133



>ref|XP_008446296.1| PREDICTED: thioredoxin H-type-like [Cucumis melo]
Length=131

 Score =   136 bits (342),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +1

Query  61   TWPESYGSTT----KKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPI  228
            T P S  S      K P +I  H    W   F+A+K+T +LMVIDF A WCGPC++MEPI
Sbjct  6    TVPGSKSSNAMIQPKPPTIIECHDKAQWTARFEATKETNKLMVIDFAAAWCGPCRHMEPI  65

Query  229  VHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKI  408
            + EFAA++ DVEFVKIDVDEL D+A ++GVE+MPTF+L+K GKV++K++G  RE+LQKKI
Sbjct  66   IKEFAARFKDVEFVKIDVDELMDIAYEYGVEAMPTFILIKNGKVIDKVVGDRREELQKKI  125

Query  409  QKH  417
            +KH
Sbjct  126  EKH  128



>gb|KHN13477.1| Thioredoxin H2 [Glycine soja]
Length=121

 Score =   135 bits (341),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
              +++   V+ FHS+  W  HFDA KQT +LMV+DFTA+WCGPCK M+P++ EFA +Y D
Sbjct  7    ARSSESSQVLTFHSTAKWNAHFDALKQTNKLMVVDFTASWCGPCKLMDPVIQEFATKYRD  66

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            VEFVKIDVDEL +V+Q + V+ MPTF+L+KKGKV  K++G  +E+LQ+ I++HR
Sbjct  67   VEFVKIDVDELMEVSQHYQVQGMPTFMLLKKGKVANKVVGVRKEELQRLIEQHR  120



>gb|AGG19195.1| thioredoxin H-type 4, partial [Tamarix hispida]
Length=137

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +1

Query  70   ESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQ  249
            E   + +   LV++FHS+  W++H +++K++ QL+V+DFTA+WCGPCK+MEP VH  A++
Sbjct  18   EDSSTPSDSSLVMSFHSANRWQLHLNSAKESNQLLVVDFTASWCGPCKFMEPAVHGMASK  77

Query  250  YSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            ++DV F KI VDEL DVAQ FGV++MPTFVL+K+GK V++++GA +++L+ KI KHR
Sbjct  78   FTDVGFAKIGVDELPDVAQGFGVQAMPTFVLLKQGKEVDRVVGAKKDELENKIAKHR  134



>ref|XP_010256143.1| PREDICTED: thioredoxin H2-like [Nelumbo nucifera]
Length=139

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 96/131 (73%), Gaps = 0/131 (0%)
 Frame = +1

Query  28   MGANHssssssTWPESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGP  207
            MGA HS              ++   ++AFHS+  WR HFD+ K + +LMVI FTA+WCGP
Sbjct  1    MGAAHSGMYGVVSATPSNGPSEASRIVAFHSTARWRAHFDSCKNSTKLMVIYFTASWCGP  60

Query  208  CKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADR  387
            C+ MEP ++ FAA+Y+DVEFVKID DEL +V+ +FGV++MPTF+L+K+GK V+K++GA +
Sbjct  61   CRSMEPALNSFAAKYTDVEFVKIDADELMEVSAEFGVQTMPTFILIKQGKEVDKVVGAKK  120

Query  388  EQLQKKIQKHR  420
            ++L+KKI K R
Sbjct  121  DELEKKILKQR  131



>ref|XP_003551992.1| PREDICTED: thioredoxin H2-like [Glycine max]
 gb|KHN15594.1| Thioredoxin H2 [Glycine soja]
Length=121

 Score =   135 bits (339),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
              +++   V+ FHS+  W  HFDA KQT +LMV+DFTA+WCGPCK M+P++ EFA +Y D
Sbjct  7    ARSSESSQVLNFHSTAKWNAHFDALKQTNKLMVVDFTASWCGPCKLMDPVIQEFATKYRD  66

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            VEFVKIDVDEL +V+Q + V+ MPTF+L+KKG V +K++G  +E+LQ+ I++HR
Sbjct  67   VEFVKIDVDELMEVSQHYQVQGMPTFMLIKKGNVADKVVGVRKEELQRLIEQHR  120



>ref|XP_010683288.1| PREDICTED: thioredoxin H-type-like [Beta vulgaris subsp. vulgaris]
Length=156

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  91   KKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFV  270
            K P V+A HS+  W  HF+ SK + +LMV+DF+A+WCGPC+YMEPI+ + + +Y DVEFV
Sbjct  46   KPPAVVAIHSTEQWNAHFELSKSSAKLMVVDFSASWCGPCQYMEPIIKDLSTKYGDVEFV  105

Query  271  KIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
             IDVDEL DVA +FGV++MPTFV  KKGK VE+++GA++ +L++KI KHR
Sbjct  106  NIDVDELSDVASEFGVDAMPTFVFFKKGKEVERLVGANKGELKEKITKHR  155



>ref|XP_008350929.1| PREDICTED: thioredoxin H2-like [Malus domestica]
Length=129

 Score =   135 bits (339),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  82   STTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDV  261
            S   K  ++AFHS   W  HF AS  + +L+VIDFTATWCGPC+ MEPI  E+A +++DV
Sbjct  15   SHGHKSRIVAFHSKHQWNTHFAASINSDKLLVIDFTATWCGPCRAMEPIFREYADKFTDV  74

Query  262  EFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            EF+K+DVDEL DVA +FGV++MP+FV +KKG+VV++I+GA +++LQKKI+KHR
Sbjct  75   EFIKLDVDELPDVAMEFGVQAMPSFVYMKKGEVVDRIVGARKDELQKKIEKHR  127



>ref|XP_010029281.1| PREDICTED: thioredoxin H2-like [Eucalyptus grandis]
 gb|KCW56161.1| hypothetical protein EUGRSUZ_I01912 [Eucalyptus grandis]
Length=158

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V A HS+  W++HF+  K+T +LM+IDFTA+WCGPCK M+P+V   A++++DV+FVKIDV
Sbjct  47   VQALHSTPPWQLHFNTVKETPKLMLIDFTASWCGPCKSMQPVVDAMASKFTDVDFVKIDV  106

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ+FGV++MPTFVLVKKGK V++++GA +++L++KIQKHR
Sbjct  107  DELSDVAQEFGVQAMPTFVLVKKGKEVDRLVGASKDELERKIQKHR  152



>ref|NP_001237440.1| thioredoxin [Glycine max]
 gb|AAS88427.1| thioredoxin [Glycine max]
Length=135

 Score =   134 bits (338),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 95/118 (81%), Gaps = 5/118 (4%)
 Frame = +1

Query  67   PESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAA  246
            PES  S      V +FHSS  W++HF+  K+T +L+VIDF+A+WCGPCK++EP +H  + 
Sbjct  20   PESSASR-----VQSFHSSARWQLHFNELKETNKLVVIDFSASWCGPCKFIEPAIHAMSE  74

Query  247  QYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +++DV+FVKIDVDEL DVA++F VE+MPTFVL KKGK V+K++GA +++L+KKI+KHR
Sbjct  75   KFTDVDFVKIDVDELPDVAKEFNVEAMPTFVLCKKGKEVDKVVGAKKDELEKKIEKHR  132



>gb|KDP45467.1| hypothetical protein JCGZ_09716 [Jatropha curcas]
Length=137

 Score =   134 bits (338),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V  FHS   W++HF++ K + QLMVIDF A+WCGPCK MEP V   A +++DV+FVKIDV
Sbjct  26   VTTFHSPERWQLHFNSVKDSSQLMVIDFAASWCGPCKLMEPEVKGMAVKFTDVQFVKIDV  85

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ+FGV++MPTFVLVKKGK V++I+GA +++LQ+KI+KHR
Sbjct  86   DELSDVAQEFGVQAMPTFVLVKKGKEVDRIVGARKDELQRKIEKHR  131



>ref|XP_003519131.1| PREDICTED: thioredoxin H2-like [Glycine max]
 gb|KHN28713.1| Thioredoxin H2 [Glycine soja]
Length=128

 Score =   134 bits (336),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            ++ FHS+  W+ HFDASK+T +LMVIDFTATWCGPCK M+PI+ E+AA+Y++VEF+KIDV
Sbjct  22   ILTFHSTAKWKTHFDASKETNKLMVIDFTATWCGPCKSMDPIIQEYAAKYTNVEFIKIDV  81

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  V+Q+F V +MPTF+L+KKGKVV+K++GA +E+LQK I+KH
Sbjct  82   DELMGVSQEFQVHAMPTFILIKKGKVVDKVVGAKKEELQKLIEKH  126



>ref|NP_001238074.1| uncharacterized protein LOC100527572 [Glycine max]
 gb|ACU16681.1| unknown [Glycine max]
Length=121

 Score =   133 bits (335),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
              +++   V+ FHS+  W  HFDA KQ  +LMV+DFTA+WCGPCK M+P++ EFA +Y D
Sbjct  7    ARSSESSQVLTFHSTAKWNAHFDALKQANKLMVVDFTASWCGPCKLMDPVIQEFATKYRD  66

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            VEFVKIDVDEL +V+Q + V+ MPTF+L+KKGKV  K++G  +E+LQ+ +++HR
Sbjct  67   VEFVKIDVDELMEVSQHYQVQGMPTFMLLKKGKVANKVVGVRKEELQRLVEQHR  120



>ref|XP_008341530.1| PREDICTED: thioredoxin H2-like [Malus domestica]
Length=133

 Score =   134 bits (336),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +1

Query  91   KKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFV  270
            ++P V +FHSS  W++H ++ K++ QL+VIDF+A+WCGPC+++EP +H  AA+++DV+F 
Sbjct  22   EEPGVTSFHSSARWQLHLNSHKESSQLLVIDFSASWCGPCRFIEPAIHAMAAKFTDVQFA  81

Query  271  KIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            KIDVDEL + AQ+FGV+ MPTFVL+KKGK V+++IGA +++L+KK++K+R
Sbjct  82   KIDVDELSEXAQEFGVQGMPTFVLLKKGKEVDRVIGAKKDELEKKVEKYR  131



>ref|XP_008230720.1| PREDICTED: thioredoxin H2 [Prunus mume]
Length=133

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
             +++++  V +FHSS  W++HF++ K++ QL+VIDF+A WCGPC+ +EP VH  + Q++D
Sbjct  18   AASSEESRVTSFHSSARWQLHFNSHKESSQLLVIDFSAAWCGPCRLIEPAVHAMSTQFTD  77

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            V+F KIDVDEL +VAQ+FGV++MPTFVL+KKGK V+++IGA + +L+KK+QK+
Sbjct  78   VDFAKIDVDELSEVAQEFGVQAMPTFVLLKKGKEVDRVIGAKKAELEKKVQKY  130



>ref|XP_010029282.1| PREDICTED: thioredoxin H2-like [Eucalyptus grandis]
Length=138

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V AFHS+  W++HF+  K T QLMVIDF A+WCGPC+ MEP V   A++++DVEF KIDV
Sbjct  27   VQAFHSTPRWQLHFNKVKDTSQLMVIDFAASWCGPCRMMEPAVSAMASKFADVEFAKIDV  86

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVA++F V++MPTFVLVKKGK V++I+GA +++L++K+QKHR
Sbjct  87   DELSDVAREFSVQAMPTFVLVKKGKEVDRIVGAKKDELERKVQKHR  132



>ref|XP_010683289.1| PREDICTED: thioredoxin H1-like [Beta vulgaris subsp. vulgaris]
Length=207

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIAFHS+  WR +F+ASKQ+ +L+VI FTATWCGPC+YMEP ++E AA+ +DV+ VKIDV
Sbjct  101  VIAFHSATKWREYFEASKQSNKLVVIYFTATWCGPCRYMEPTINELAAKCTDVDLVKIDV  160

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL ++++ FG+++MPTF+ +KKGK V+K++GA +E  QKK++KHR
Sbjct  161  DELFNISRQFGIQTMPTFLFMKKGKQVDKVVGARKEDFQKKVEKHR  206



>gb|ACU15762.1| unknown [Glycine max]
Length=157

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 95/118 (81%), Gaps = 5/118 (4%)
 Frame = +1

Query  67   PESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAA  246
            PES  S      V +FHSS  W++HF+  K+T +L+VIDF+A+WCGPCK++EP +H  + 
Sbjct  42   PESSASR-----VQSFHSSARWQLHFNELKETNKLVVIDFSASWCGPCKFIEPAIHAMSE  96

Query  247  QYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +++DV+FVKIDVDEL DVA++F VE+MPTFVL KKGK V+K++GA +++L+KKI+KHR
Sbjct  97   KFTDVDFVKIDVDELPDVAKEFNVEAMPTFVLCKKGKEVDKVVGAKKDELEKKIEKHR  154



>gb|KHN11582.1| Thioredoxin H2 [Glycine soja]
Length=157

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 95/118 (81%), Gaps = 5/118 (4%)
 Frame = +1

Query  67   PESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAA  246
            PES  S      V +FHSS  W++HF+  K+T +L+VIDF+A+WCGPCK++EP +H  + 
Sbjct  42   PESSASR-----VQSFHSSARWQLHFNELKETNKLVVIDFSASWCGPCKFIEPAIHAMSE  96

Query  247  QYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +++DV+FVKIDVDEL DVA++F VE+MPTFVL KKGK V+K++GA +++L+KKI+KHR
Sbjct  97   KFTDVDFVKIDVDELPDVAKEFNVEAMPTFVLCKKGKEVDKVVGAKKDELEKKIEKHR  154



>gb|AAQ23133.1| thioredoxin H2 [Ipomoea batatas]
Length=143

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V  FHSS  W++HF+ASKQ  +LMV+DF A WCGPCK MEP+V + A +++DV+F+KIDV
Sbjct  31   VTVFHSSQRWQLHFNASKQLNKLMVVDFAAAWCGPCKMMEPMVKQMATKFTDVDFIKIDV  90

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ+F V++MPTF+L+K+GK V +++GA +++L++KI +H+
Sbjct  91   DELSDVAQEFSVQAMPTFLLLKQGKEVGRVVGAKKDELERKIVQHK  136



>ref|XP_007153859.1| hypothetical protein PHAVU_003G070700g [Phaseolus vulgaris]
 gb|ESW25853.1| hypothetical protein PHAVU_003G070700g [Phaseolus vulgaris]
Length=122

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 90/117 (77%), Gaps = 2/117 (2%)
 Frame = +1

Query  76   YGS--TTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQ  249
            YG   T+    V+ FHSS  W  HFDA KQT +LMV+DFTA+WCGPCK M+P++ EFAA 
Sbjct  5    YGGRPTSLPSQVLTFHSSAKWNQHFDALKQTNKLMVVDFTASWCGPCKQMDPVIQEFAAT  64

Query  250  YSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            + DVEFVKIDVDEL  V++ F V+ MPTF+L+KKGKV +K++G  +E+LQ+ I++HR
Sbjct  65   FRDVEFVKIDVDELMGVSERFQVQGMPTFMLIKKGKVADKVVGVKKEELQRLIEQHR  121



>ref|XP_008389540.1| PREDICTED: thioredoxin H-type [Malus domestica]
Length=129

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            ++AFHS   W  HF A K + +LMVIDFTA WCGPC+ MEPI  E+A +++DVEFVK+DV
Sbjct  22   IVAFHSQDQWNTHFAAVKDSNKLMVIDFTAKWCGPCRAMEPIFREYANKFTDVEFVKLDV  81

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVA +F VE+MP+FV VK G+VV+K++GA +++LQKKI+KHR
Sbjct  82   DELSDVAVEFSVEAMPSFVFVKNGEVVDKVVGARKDELQKKIEKHR  127



>ref|NP_001237844.1| thioredoxin h2 [Glycine max]
 gb|ABV71992.1| thioredoxin h2 [Glycine max]
Length=130

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V  FHSS  W++HF+  K + +L+VIDF+ATWCGPCK MEPIVH  A +++DVEF+KIDV
Sbjct  24   VKTFHSSARWQLHFNEIKDSPRLVVIDFSATWCGPCKMMEPIVHAMANEFTDVEFIKIDV  83

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ+F V++MPTF+L+K GK V+KI+GA +++L+ KI+K+R
Sbjct  84   DELSDVAQEFKVQAMPTFLLLKNGKEVDKIVGAKKDELKNKIKKYR  129



>ref|XP_004238753.1| PREDICTED: thioredoxin H4 [Solanum lycopersicum]
Length=135

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 99/128 (77%), Gaps = 12/128 (9%)
 Frame = +1

Query  61   TWPESYGSTTKKPL--------VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKY  216
            TWPE      KKP+        VI F+SS    IH +  K T +L+VIDFTATWCGPC+ 
Sbjct  8    TWPEF----NKKPITQQIKRCQVITFNSSTKCMIHLNFLKDTNKLVVIDFTATWCGPCRN  63

Query  217  MEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQL  396
            M+PI+++FAA+Y++VEFVKIDVDEL DVA+ +GV++MPTFVL+KKG+VV++I+GAD++ L
Sbjct  64   MDPIINDFAAKYTNVEFVKIDVDELVDVAEKYGVQAMPTFVLMKKGEVVDQIVGADKDGL  123

Query  397  QKKIQKHR  420
            + KI+KH+
Sbjct  124  KMKIEKHK  131



>gb|KHG03017.1| Thioredoxin H2 -like protein [Gossypium arboreum]
Length=118

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
            G+      +I   S+  WR   +ASKQ+ +L+V+DF+ATWCGPCK+MEP++ E+A  Y+D
Sbjct  2    GNKASTAKIIEMQSASQWRAQLEASKQSNKLLVVDFSATWCGPCKWMEPVIEEYANLYAD  61

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHRY  423
            VEFVKIDVD L DVA+ F VE+MPTFVLVKKGK + +++GA + +LQK I+KHR+
Sbjct  62   VEFVKIDVDTLEDVARQFKVEAMPTFVLVKKGKEICRLVGAKKTELQKLIEKHRF  116



>emb|CDP02192.1| unnamed protein product [Coffea canephora]
Length=138

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V  FHSS  W++HF++SKQ  +LMV+DF A+WCGPCK MEP+V + + +Y+D++FVKIDV
Sbjct  26   VTTFHSSNRWQLHFNSSKQLNKLMVVDFAASWCGPCKLMEPLVKDMSGKYTDIDFVKIDV  85

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ+  V++MPTF+L+K+GK V++I+GA +++L+KKI KHR
Sbjct  86   DELPDVAQEHKVQAMPTFLLLKQGKEVDRIVGAKKDELEKKILKHR  131



>gb|KHG14132.1| Thioredoxin H2 -like protein [Gossypium arboreum]
Length=134

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V  FHS+  W++HF++ K++ +LMVIDF+A+WCGPCK+MEP+++  AA+++DV+FVK+DV
Sbjct  28   VSTFHSAPRWQLHFNSVKESPKLMVIDFSASWCGPCKFMEPVLNGMAAKFTDVDFVKLDV  87

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ+FGV++MPTFVLVK+GK V++++GA + +L+KK++K+R
Sbjct  88   DELPDVAQEFGVQAMPTFVLVKQGKEVDRVVGAQKNELEKKVEKNR  133



>ref|XP_008352996.1| PREDICTED: thioredoxin H2-like [Malus domestica]
Length=129

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            ++A HS   W  HF A K + +LMVIDFTATWCGPC+ MEPI+ ++A +++DVEFV++DV
Sbjct  22   IVALHSKGQWNTHFAAFKDSNKLMVIDFTATWCGPCRAMEPILRDYADKFTDVEFVQLDV  81

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVA++FGV++MP+FV +KKG+VV+KI+GA +++LQKKI+KHR
Sbjct  82   DELPDVAREFGVQAMPSFVFMKKGEVVDKIVGARKDELQKKIEKHR  127



>ref|XP_007139606.1| hypothetical protein PHAVU_008G044000g [Phaseolus vulgaris]
 gb|ESW11600.1| hypothetical protein PHAVU_008G044000g [Phaseolus vulgaris]
Length=131

 Score =   132 bits (331),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V +FHSS  W++HF+  K T +L+V+DF+A+WCGPCK++EP +H  A +Y+DV+FVKIDV
Sbjct  25   VTSFHSSARWQLHFNELKDTSKLVVVDFSASWCGPCKFIEPAIHAMAEKYTDVDFVKIDV  84

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVA +F V++MPTFVL+KKGKV++K++GA +++L+KKI+KHR
Sbjct  85   DELSDVAGEFQVQAMPTFVLLKKGKVIDKVVGAKKDELEKKIEKHR  130



>ref|XP_004302361.1| PREDICTED: thioredoxin H2-like [Fragaria vesca subsp. vesca]
Length=133

 Score =   131 bits (330),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +1

Query  85   TTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVE  264
            +++K  V +FHS+  W++H    K T +L+VIDF+A+WCGPCK++EP +H  A +++DV+
Sbjct  22   SSEKSRVTSFHSAARWQLHLKEFKDTSKLLVIDFSASWCGPCKFIEPAIHAMAEKFTDVD  81

Query  265  FVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            F KIDVDEL +V+Q+FGV++MPTFVL+K GK V++++GA +++L+KK++KHR
Sbjct  82   FAKIDVDELSEVSQEFGVQAMPTFVLLKNGKEVDRVVGAKKDELEKKVEKHR  133



>ref|XP_002517458.1| Thioredoxin H-type, putative [Ricinus communis]
 gb|EEF45000.1| Thioredoxin H-type, putative [Ricinus communis]
Length=133

 Score =   131 bits (329),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V  FHSS  W++HF++ K + QLMV+DF A+WCGPCK+MEP +   A +YSDV+F KIDV
Sbjct  26   VQTFHSSERWQLHFNSIKDSSQLMVVDFAASWCGPCKFMEPEIKSMATKYSDVQFSKIDV  85

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL  VAQ+FGV++MPTFVLVKKGK V++++GA +++L KKI+KHR
Sbjct  86   DELPGVAQEFGVQAMPTFVLVKKGKEVDRVVGAKKDELLKKIEKHR  131



>ref|XP_003534466.1| PREDICTED: thioredoxin H2-like [Glycine max]
 gb|KHN11580.1| Thioredoxin H2 [Glycine soja]
Length=131

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+ FHSS  W++HF+  K+T +L+VIDFTA+WCGPC+++ P+ +E A ++S+ EFVKIDV
Sbjct  25   VLPFHSSERWQLHFNEVKETSKLVVIDFTASWCGPCRFIAPVFNEMAKKFSNAEFVKIDV  84

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL DVA+DF VE+MPTFVL KKGK V++++GA +++LQ KIQKH
Sbjct  85   DELPDVAKDFKVEAMPTFVLCKKGKEVDRVVGARKDELQNKIQKH  129



>gb|AAO12855.1| thioredoxin h [Pisum sativum]
Length=130

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V  FHSS  W++HF+  K + +L+VIDF+ATWCGPCK MEPIV+  A +++DVEF+KIDV
Sbjct  24   VKTFHSSARWQLHFNEIKDSPRLVVIDFSATWCGPCKMMEPIVYAMANEFTDVEFIKIDV  83

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ+F V++MPTF+L+K G+ V+KI+GA +++L+ KI+K+R
Sbjct  84   DELSDVAQEFKVQAMPTFLLLKNGEEVDKIVGAKKDELKNKIKKYR  129



>gb|AFK34683.1| unknown [Lotus japonicus]
Length=115

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 89/121 (74%), Gaps = 6/121 (5%)
 Frame = +1

Query  28   MGANHssssssTWPESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGP  207
            MGAN S+       ES  ++T  P ++ FH +  W+ H DASK+T +LMVIDFTA WCGP
Sbjct  1    MGANLSNM------ESAHASTNSPHILTFHFTAKWKAHLDASKETNKLMVIDFTAKWCGP  54

Query  208  CKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADR  387
            CK MEPI+ EF A+Y+ VEF+KIDVDEL +V Q+F V++MPTF+L+KK KV  K++GA +
Sbjct  55   CKSMEPIIQEFVAKYTKVEFIKIDVDELMEVTQEFQVQAMPTFILMKKDKVAGKVVGAKK  114

Query  388  E  390
            E
Sbjct  115  E  115



>ref|XP_010256168.1| PREDICTED: thioredoxin H2-like [Nelumbo nucifera]
Length=143

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 92/113 (81%), Gaps = 1/113 (1%)
 Frame = +1

Query  85   TTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYS-DV  261
            ++K   ++AFHS+  W+ HFD+ K + +LMVI FTA+WCGPC+ MEP + EFAA+Y+ DV
Sbjct  23   SSKASRIVAFHSTKRWKAHFDSCKNSTKLMVIYFTASWCGPCRSMEPALDEFAAKYTDDV  82

Query  262  EFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            EFVKIDVDEL  V+ +FGV +MPTF+L+K+GK V+K++GA +++L+KKI KHR
Sbjct  83   EFVKIDVDELMGVSDEFGVHAMPTFILIKQGKEVDKVVGAKKDELEKKILKHR  135



>ref|XP_007215973.1| hypothetical protein PRUPE_ppa011576mg [Prunus persica]
 gb|EMJ17172.1| hypothetical protein PRUPE_ppa011576mg [Prunus persica]
Length=205

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
             ++++   V +FHSS  W++HF++ K + QL+VIDF+A+WCGPC+ +EP VH  + Q++D
Sbjct  90   AASSEDSRVTSFHSSARWQLHFNSHKDSSQLLVIDFSASWCGPCRLIEPAVHYMSTQFTD  149

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            V+F KIDVDEL +VAQ+FGV++MPTFVL+KKGK V+++IGA +++L+KKIQK++
Sbjct  150  VDFAKIDVDELSEVAQEFGVQAMPTFVLLKKGKEVDRVIGARKDELEKKIQKYQ  203



>ref|XP_009360413.1| PREDICTED: thioredoxin H2-like [Pyrus x bretschneideri]
Length=134

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +1

Query  28   MGANHssssssTWPESYG-STTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCG  204
            MG N S    S   +S G     K  ++AFHS   W  HF A K + +LMVIDFTA WCG
Sbjct  1    MGGNTSHFEDSDESQSDGFPREHKSRIVAFHSEDQWNTHFAAVKDSNKLMVIDFTAKWCG  60

Query  205  PCKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGAD  384
            PC+ M PI  E+A +++DVEFVKIDVDEL DVA +F V++MP+FV VKKG+VV+K++GA 
Sbjct  61   PCRAMVPIFREYADKFTDVEFVKIDVDELSDVAMEFSVQAMPSFVFVKKGEVVDKVVGAM  120

Query  385  REQLQKKIQKHR  420
            +++LQKKI+KHR
Sbjct  121  KDELQKKIEKHR  132



>ref|XP_003613548.1| Thioredoxin [Medicago truncatula]
 gb|ACZ37070.1| thioredoxin h6 [Medicago truncatula]
 gb|AES96506.1| thioredoxin [Medicago truncatula]
 gb|AFK41942.1| unknown [Medicago truncatula]
Length=128

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 98/118 (83%), Gaps = 3/118 (3%)
 Frame = +1

Query  76   YGSTTKKPL---VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAA  246
            +G T+ K L   ++ FHS+  W+ +FDASK+T +LMVI+FTA WCGPCKYM+PI+ +FAA
Sbjct  10   HGHTSAKSLSSHILTFHSTAKWKAYFDASKETNKLMVIEFTAAWCGPCKYMDPIIQDFAA  69

Query  247  QYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +Y  V+F+KIDVDEL  ++Q+F V++MPTF+L+KKGKVV+K++GA +E+L+K I+KH+
Sbjct  70   KYIKVDFIKIDVDELMSISQEFQVQAMPTFILMKKGKVVDKVVGAKKEELEKLIEKHQ  127



>ref|XP_003621089.1| Thioredoxin h2 [Medicago truncatula]
 gb|ABN07937.1| Thioredoxin domain 2; Thioredoxin fold [Medicago truncatula]
 gb|AES77307.1| thioredoxin H2-like protein [Medicago truncatula]
 gb|AFK45191.1| unknown [Medicago truncatula]
Length=134

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V  FHSS  W++HF+  K + +L+VIDF+ATWCGPCK MEPI+   A +++DVEF+KIDV
Sbjct  28   VKTFHSSARWQLHFNELKDSPRLVVIDFSATWCGPCKMMEPILQAMANEFTDVEFIKIDV  87

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ+F V++MPTF+L+K GK V+K++GA +++L+ K+QKH+
Sbjct  88   DELSDVAQEFKVQAMPTFLLLKNGKEVDKVVGAKKDELKNKVQKHK  133



>gb|ACZ37068.1| thioredoxin h4 [Medicago truncatula]
Length=131

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V  FHSS  W++HF+  K + +L+VIDF+ATWCGPCK MEPI+   A +++DVEF+KIDV
Sbjct  25   VKTFHSSARWQLHFNELKDSPRLVVIDFSATWCGPCKMMEPILQAMANEFTDVEFIKIDV  84

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ+F V++MPTF+L+K GK V+K++GA +++L+ K+QKH+
Sbjct  85   DELSDVAQEFKVQAMPTFLLLKNGKEVDKVVGAKKDELKNKVQKHK  130



>ref|XP_010256156.1| PREDICTED: thioredoxin H2-like [Nelumbo nucifera]
Length=135

 Score =   129 bits (324),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = +1

Query  88   TKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYS-DVE  264
            +K   ++AFHS++ W+ HFD+ K + +LMVI FTA+WCGPC+ MEP + +FAA+Y+ +VE
Sbjct  19   SKASCIVAFHSTIRWKAHFDSCKNSTKLMVIYFTASWCGPCRSMEPALDKFAAKYTGNVE  78

Query  265  FVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            FVKIDVDEL +V+ +FGV +MPTF+L+K+GK V+K++GA +++L+KKI KHR
Sbjct  79   FVKIDVDELMEVSDEFGVHAMPTFILIKQGKEVDKVVGAKKDELEKKILKHR  130



>ref|XP_007044392.1| Thioredoxin, putative [Theobroma cacao]
 gb|EOY00224.1| Thioredoxin, putative [Theobroma cacao]
Length=116

 Score =   128 bits (321),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
            G+    P +I   S   WR   +ASKQ+ +L+VID TATWCGPCK MEP + EFA  Y+D
Sbjct  2    GANASTPRIIEMQSKSQWRAQLEASKQSNKLLVIDCTATWCGPCKRMEPAIEEFATIYAD  61

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            V+F+KIDVD L DVA +  V+SMPTFVLVKKGK V++++GA +++LQ+ I+KHR
Sbjct  62   VQFIKIDVDLLADVAGELKVDSMPTFVLVKKGKEVDRLVGARKDELQRMIEKHR  115



>ref|NP_001237762.1| uncharacterized protein LOC100527298 [Glycine max]
 gb|ACU16369.1| unknown [Glycine max]
 gb|KHN01158.1| Thioredoxin H2 [Glycine soja]
Length=138

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            ++AFHS+  W  H+ A+K+T +LMV+DFTATWCGPCK M+P++ EFA  Y+DV+F+KIDV
Sbjct  32   ILAFHSTAQWNAHYKATKETNKLMVLDFTATWCGPCKLMDPVIQEFAGNYTDVDFIKIDV  91

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +EL +V+Q   V  +PTF+LVKKGKV ++++G  +E+L++ I+KHR
Sbjct  92   EELTEVSQALQVYQLPTFILVKKGKVADRVVGVKKEELKRSIEKHR  137



>ref|XP_006284753.1| hypothetical protein CARUB_v10006018mg [Capsella rubella]
 gb|EOA17651.1| hypothetical protein CARUB_v10006018mg [Capsella rubella]
Length=131

 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  61   TWPESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEF  240
            T PE  G+ ++   V  F SS  W++H++  K++ +L+V+DF+A+WCGPCK +EP +H  
Sbjct  11   TGPEDAGTESESSRVFKFSSSARWQLHYNEIKESNKLLVVDFSASWCGPCKMIEPAIHAM  70

Query  241  AAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            A +++DV+FVK+DVDEL DVA++F V +MPTFVLVK+GK +++IIGA +++L+KK+ K R
Sbjct  71   ADKFTDVDFVKLDVDELPDVAKEFNVTAMPTFVLVKRGKEIDRIIGAKKDELEKKVSKLR  130



>ref|XP_003552507.1| PREDICTED: thioredoxin H2 [Glycine max]
Length=133

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V +FHSS  W+++F+  K T +L+VIDF+A+WCGPCK++EP +H  A +++DV+FVKIDV
Sbjct  27   VSSFHSSPRWQLYFNEIKDTDKLVVIDFSASWCGPCKFIEPAIHAMADKFNDVDFVKIDV  86

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ+F V++MPTFVL KKGK V+K++GA +++L+KKI+KHR
Sbjct  87   DELPDVAQEFQVQAMPTFVLWKKGKEVDKVVGAKKDELEKKIEKHR  132



>gb|KHN13657.1| Thioredoxin H2 [Glycine soja]
Length=133

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V +FHSS  W+++F+  K T +L+VIDF+A+WCGPCK++EP +H  A +++DV+FVKIDV
Sbjct  27   VSSFHSSPRWQLYFNEIKDTDKLVVIDFSASWCGPCKFIEPAIHAMADKFNDVDFVKIDV  86

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ+F V++MPTFVL KKGK V+K++GA +++L+KKI+KHR
Sbjct  87   DELPDVAQEFQVQAMPTFVLWKKGKEVDKVVGAKKDELEKKIEKHR  132



>ref|XP_004302362.1| PREDICTED: thioredoxin H2-like [Fragaria vesca subsp. vesca]
Length=134

 Score =   127 bits (318),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +1

Query  85   TTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVE  264
            +++  LV +FHS+  W++H ++ K++ QL+VIDF+A+WCGPCK++EP +H  A +++DV 
Sbjct  20   SSEGSLVTSFHSAARWQLHLNSMKESSQLLVIDFSASWCGPCKFIEPAIHAMAEKFTDVY  79

Query  265  FVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHRY  423
            F KIDVDEL +V+Q F V++MPTFVL+KKGK V++++GA +++L+KK++K R+
Sbjct  80   FAKIDVDELSEVSQQFEVQAMPTFVLLKKGKEVDRVVGAKKDELEKKVEKFRH  132



>gb|KFK33151.1| hypothetical protein AALP_AA6G337400 [Arabis alpina]
Length=132

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+ F SS  W++HF+  K+T +LMVIDF+A+WCGPCK + P + + A ++SDV+FVK+DV
Sbjct  26   VLTFTSSARWQLHFNEVKETSKLMVIDFSASWCGPCKMIMPAIRDMAVKFSDVDFVKLDV  85

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVA++F V  MPTFVL+K+GK VE+I+GA++++L++K+ KHR
Sbjct  86   DELPDVAKEFNVTGMPTFVLMKRGKEVERIVGANKDELERKVSKHR  131



>ref|XP_010670327.1| PREDICTED: thioredoxin H2 [Beta vulgaris subsp. vulgaris]
Length=132

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  70   ESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQ  249
            E+   + ++  +I+FHS+  W +H+++ K + QL+V+DF A+WCGPCK++EP +   A +
Sbjct  15   EAAEDSGEESRIISFHSANRWELHYNSLKDSNQLLVVDFAASWCGPCKFIEPAIKAMANK  74

Query  250  YSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            +SDVEF KIDVDEL DVA+ F V++MPTF+L+K GKVV+K++GA +++L+KKI KH
Sbjct  75   FSDVEFAKIDVDELPDVARQFEVQAMPTFILLKNGKVVDKVVGAKKDELEKKIAKH  130



>ref|NP_001240862.1| uncharacterized protein LOC100776312 [Glycine max]
 gb|ACU20536.1| unknown [Glycine max]
 gb|KHN28711.1| Thioredoxin H2-1 [Glycine soja]
Length=138

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            ++AFHS   W  H+ A+K+T +LMV+DFTATWCGPCK M+P++ EFA  Y+DVEF+KIDV
Sbjct  32   ILAFHSIAQWNAHYKATKETNKLMVLDFTATWCGPCKLMDPVILEFAGNYTDVEFIKIDV  91

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            +EL +V+Q   V  +PTFVLV+KGKV ++++G  +E+L++ I+KH
Sbjct  92   EELTEVSQALQVHQLPTFVLVQKGKVADRVVGVKKEELKRSIEKH  136



>ref|XP_002868686.1| hypothetical protein ARALYDRAFT_493991 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44945.1| hypothetical protein ARALYDRAFT_493991 [Arabidopsis lyrata subsp. 
lyrata]
Length=132

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +1

Query  73   SYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQY  252
            + G+ ++   V+ F SS  W++HF+  K++ +L+V+DF+A+WCGPC+ +EP +H  A ++
Sbjct  16   AAGTESEPSRVLKFSSSARWQLHFNEIKESNKLLVVDFSASWCGPCRMIEPAIHAMANKF  75

Query  253  SDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            SDV+FVK+DVDEL DVA++F V +MPTFVLVK+GK +E+IIGA +++L+KK+ K R
Sbjct  76   SDVDFVKLDVDELPDVAKEFNVTAMPTFVLVKRGKEIERIIGAKKDELEKKVSKLR  131



>gb|EPS72137.1| thioredoxin, partial [Genlisea aurea]
Length=138

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = +1

Query  88   TKKPLVIAFHSSMNWRIHFDASKQ-TKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVE  264
            +KK  VI FHS   W+I+F+ASKQ + +L+V+ FTA+WCGPC  M+P+V +FA +Y +VE
Sbjct  27   SKKGKVIEFHSPSKWKIYFEASKQMSSKLIVVYFTASWCGPCHLMQPVVTDFADKYDNVE  86

Query  265  FVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            F+KIDVDE+  VA++F V  MPTFVL+K  K V+K++GA  E+LQKKI+KHR
Sbjct  87   FIKIDVDEMEKVAEEFSVRIMPTFVLIKGSKQVDKVVGAKAEELQKKIEKHR  138



>ref|XP_003613544.1| Thioredoxin-2 [Medicago truncatula]
 gb|ACZ37069.1| thioredoxin h5 [Medicago truncatula]
 gb|AES96502.1| thioredoxin-like protein [Medicago truncatula]
Length=126

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +1

Query  85   TTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVE  264
            +T+   V+ FHS+  W  HF+A K+T +LMVIDFTA WCGPCK M+P++ +FAA+Y+DVE
Sbjct  14   STESSHVLTFHSTAKWNAHFEAFKETNKLMVIDFTAKWCGPCKVMDPVMKDFAAKYTDVE  73

Query  265  FVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            F+K+DVDEL  V+Q F V S+PTF+L+KKGKVV+K++GA +E+LQ+ I+K R
Sbjct  74   FIKLDVDELMGVSQTFQVHSLPTFLLIKKGKVVDKVVGARKEELQRMIEKQR  125



>gb|AGG19202.1| thioredoxin H-type 3 [Tamarix hispida]
Length=135

 Score =   125 bits (313),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA+HS+  WR  F ASK++ +L+V+DFTATWC PC+ MEP +++ AA+Y DV+FVKIDV
Sbjct  29   VIAYHSTARWRAFFQASKESNKLVVVDFTATWCKPCQQMEPTLNKLAAKYGDVDFVKIDV  88

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL DVA++F V+ MPT++ +K GK ++++ GA +E+LQ KI+ H
Sbjct  89   DELMDVAREFAVQVMPTYLFLKNGKAIDRVTGARKEELQMKIEMH  133



>ref|XP_010422468.1| PREDICTED: thioredoxin H2-like [Camelina sativa]
Length=130

 Score =   124 bits (311),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = +1

Query  70   ESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQ  249
            E  G+ ++   +I F SS  W++H++  K++ +L+V+DF+A+WCGPC+ +EP +H  A +
Sbjct  13   EDAGTESEPSRLIKFSSSARWQLHYNEIKESNKLLVVDFSASWCGPCRMIEPTIHAMAEK  72

Query  250  YSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            ++DV+FVK+DVDEL DVA++F V +MPTFVLVK+GK +E+IIGA +E+L++K+ K R
Sbjct  73   FTDVDFVKLDVDELPDVAKEFNVTAMPTFVLVKRGKEIERIIGAKKEELERKVSKLR  129



>ref|XP_010096320.1| Thioredoxin H2 [Morus notabilis]
 gb|EXB63795.1| Thioredoxin H2 [Morus notabilis]
Length=217

 Score =   126 bits (317),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  112  FHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDVDEL  291
            FH    W+ +F+A K T +L+VIDFTATWCGPC+ M+P + E + +Y+DV+FV+IDVDEL
Sbjct  47   FHKKDQWQTYFNACKDTNKLVVIDFTATWCGPCRSMKPTLKECSEKYTDVDFVEIDVDEL  106

Query  292  GDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
             DVA ++GV++MPTF+ +K G  V+K++GA +E LQKKI+KHR
Sbjct  107  PDVASEYGVQAMPTFLFMKNGDQVDKVVGARKEDLQKKIEKHR  149



>ref|NP_198811.1| thioredoxin H2 [Arabidopsis thaliana]
 sp|Q38879.2|TRXH2_ARATH RecName: Full=Thioredoxin H2; Short=AtTrxh2; AltName: Full=Thioredoxin 
2; Short=AtTRX2 [Arabidopsis thaliana]
 emb|CAA84612.1| thioredoxin [Arabidopsis thaliana]
 dbj|BAB10219.1| thioredoxin (clone GIF2) [Arabidopsis thaliana]
 gb|AAK82498.1| AT5g39950/MYH19_110 [Arabidopsis thaliana]
 gb|AAM47360.1| AT5g39950/MYH19_110 [Arabidopsis thaliana]
 gb|AED94495.1| thioredoxin H2 [Arabidopsis thaliana]
Length=133

 Score =   123 bits (309),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +1

Query  73   SYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQY  252
            + G+ ++   V+ F SS  W++HF+  K++ +L+V+DF+A+WCGPC+ +EP +H  A ++
Sbjct  17   AAGTESEPSRVLKFSSSARWQLHFNEIKESNKLLVVDFSASWCGPCRMIEPAIHAMADKF  76

Query  253  SDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +DV+FVK+DVDEL DVA++F V +MPTFVLVK+GK +E+IIGA +++L+KK+ K R
Sbjct  77   NDVDFVKLDVDELPDVAKEFNVTAMPTFVLVKRGKEIERIIGAKKDELEKKVSKLR  132



>ref|XP_010455897.1| PREDICTED: thioredoxin H2 [Camelina sativa]
 ref|XP_010455899.1| PREDICTED: thioredoxin H2 [Camelina sativa]
Length=133

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +1

Query  73   SYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQY  252
            + G+ ++   +I F SS  W++H++ +K++ +L+V+DF+A+WCGPC+ +EP +H  A ++
Sbjct  17   ATGTESEPSRLIKFSSSARWQLHYNETKESNKLLVVDFSASWCGPCRMIEPTIHAMADKF  76

Query  253  SDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +DV+FVK+DVDEL DVA++F V +MPTFVLVK+GK VE+IIGA +++L++K+ K R
Sbjct  77   TDVDFVKLDVDELPDVAKEFNVTAMPTFVLVKRGKEVERIIGAKKDELERKVSKLR  132



>emb|CDX67442.1| BnaA07g14820D [Brassica napus]
Length=134

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
            G+ +++  V+ F SS  W++HF+  K++ +L+V+DF+A+WCGPC+ +EP     +A+++D
Sbjct  20   GNESEQSRVMKFSSSARWQLHFNEIKESSKLLVVDFSASWCGPCRMIEPAFIAMSAKFTD  79

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            VEFVK+DVDEL DVA++F V  MPTFVLVK GK +E+I+GA +++L+KK+ KHR
Sbjct  80   VEFVKLDVDELPDVAKEFNVTGMPTFVLVKNGKEIERIVGARKDELEKKVLKHR  133



>gb|AAM66084.1| thioredoxin [Arabidopsis thaliana]
Length=134

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 93/117 (79%), Gaps = 1/117 (1%)
 Frame = +1

Query  73   SYGSTTKKP-LVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQ  249
            + G+ + +P  V+ F SS  W++HF+  K++ +L+V+DF+A+WCGPC+ +EP +H  A +
Sbjct  17   AAGTESSEPSRVLKFSSSARWQLHFNEIKESNKLLVVDFSASWCGPCRMIEPAIHAMADK  76

Query  250  YSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            ++DV+FVK+DVDEL DVA++F V +MPTFVLVK+GK +E+IIGA +++L+KK+ K R
Sbjct  77   FNDVDFVKLDVDELPDVAKEFNVTAMPTFVLVKRGKEIERIIGAKKDELEKKVSKLR  133



>gb|ABX10749.1| thioredoxin [Brassica juncea]
Length=133

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +1

Query  70   ESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQ  249
            E+      +  V+ F SS  W++HF+  K++ +L+V+DF+A+WCGPC+ +EP     AA+
Sbjct  16   EAVAGNDSESRVMKFSSSARWQLHFNEIKESSKLLVVDFSASWCGPCRMIEPAFIAMAAK  75

Query  250  YSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            ++DVEFVK+DVDEL DVA++F V  MPTFVLVK GK +E+I+GA +++L+KK+ KHR
Sbjct  76   FTDVEFVKLDVDELPDVAKEFNVTGMPTFVLVKNGKEIERIVGARKDELEKKVLKHR  132



>ref|XP_004489965.1| PREDICTED: thioredoxin H2-like isoform X1 [Cicer arietinum]
Length=129

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD-VEFVKID  279
            ++ F+S+  W++H  AS+QT +LMV++FTATWC PCKYM+PI+ EFA +Y + V+F+KID
Sbjct  22   ILTFNSTAKWKVHLKASEQTNKLMVVEFTATWCAPCKYMDPIIQEFATKYKNIVDFIKID  81

Query  280  VDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            VD L DV Q++ V++MPTF+L+KKG+VV+K++GA +++L   I+KH+
Sbjct  82   VDVLMDVTQEYQVQAMPTFILMKKGEVVDKVVGAKKDELTMLIEKHK  128



>ref|XP_010531799.1| PREDICTED: thioredoxin H2 [Tarenaya hassleriana]
Length=132

 Score =   121 bits (304),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V  F SS  W++HF+  K++ +L+VIDFTA+WCGPCK M P+    A +++DVEF K+DV
Sbjct  25   VSKFSSSTRWQLHFNEIKESSKLLVIDFTASWCGPCKMMSPVFSGLAEKFTDVEFAKVDV  84

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DE+ DVA++FGV++MPTFVLVK+GK V++IIGA +++L++KI +H
Sbjct  85   DEVPDVAREFGVQAMPTFVLVKRGKEVDRIIGAKKDELERKIVRH  129



>emb|CDY65333.1| BnaCnng46660D [Brassica napus]
Length=133

 Score =   121 bits (304),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +1

Query  88   TKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEF  267
            +++  V+ F SS  W++HF+  K++ +L+V+DF+A+WCGPC+ +EP     AA+++DVEF
Sbjct  22   SEQSRVMKFSSSARWQLHFNEIKESSKLLVVDFSASWCGPCRMIEPAFIAMAAKFTDVEF  81

Query  268  VKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            VK+DVDEL DVA++F V  MPTFVLVK GK +E+I+GA +++L+KK+ KHR
Sbjct  82   VKLDVDELPDVAKEFNVTGMPTFVLVKNGKEIERIVGARKDELEKKVLKHR  132



>ref|XP_010539941.1| PREDICTED: thioredoxin H2-like isoform X1 [Tarenaya hassleriana]
Length=131

 Score =   121 bits (304),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V  F SS  W+++F+  K++ +L+VIDFTA+WCGPCK M P+    A +++DVEFVKIDV
Sbjct  25   VSKFSSSARWQLYFNEIKESSKLLVIDFTASWCGPCKMMAPVFQGLAEKFTDVEFVKIDV  84

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DE+ DVA++FGV++MPTFVLVK+G+ V++++GA +++L++KI  HR
Sbjct  85   DEVPDVAREFGVQAMPTFVLVKRGREVDRVVGAKKDELERKISHHR  130



>gb|AAC49353.1| thioredoxin h [Arabidopsis thaliana]
Length=134

 Score =   121 bits (303),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 93/117 (79%), Gaps = 1/117 (1%)
 Frame = +1

Query  73   SYGSTTKKP-LVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQ  249
            + G+ + +P  V+ F SS  W++HF+  K++ +L+V+DF+A+WCGPC+ +EP +H  A +
Sbjct  17   AAGTESSEPSRVLKFSSSARWQLHFNEIKESNKLLVVDFSASWCGPCRMIEPAIHAMADK  76

Query  250  YSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            ++DV+FVK+DVDEL DVA++F V +MPTFVLVK+GK +E+IIGA +++L+K++ K R
Sbjct  77   FNDVDFVKLDVDELPDVAKEFNVTAMPTFVLVKRGKEIERIIGAKKDELEKQVSKLR  133



>ref|XP_010450751.1| PREDICTED: thioredoxin H2-like [Camelina sativa]
Length=130

 Score =   121 bits (303),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = +1

Query  70   ESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQ  249
            E  G+ ++   ++ F SS  W++H++  K++ +LMV+DF+A+WCGPC+ +EP +H  A +
Sbjct  13   EDAGTESEPSRLLKFSSSARWQLHYNEIKESNKLMVVDFSASWCGPCRMIEPTIHAMADK  72

Query  250  YSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            ++DV+FVK+DVDEL DVA++F V  MPTFVL+KKGK +E+IIGA +++L+ K+ K R
Sbjct  73   FTDVDFVKLDVDELPDVAKEFNVTGMPTFVLIKKGKEIERIIGAKKDELESKVSKLR  129



>ref|XP_010683290.1| PREDICTED: thioredoxin H7-like [Beta vulgaris subsp. vulgaris]
Length=206

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            +IAFHSS  W+ +F ASK + +L+V+ FTA WCGPC+ MEP + E AA+Y+ VE VK+DV
Sbjct  100  LIAFHSSNRWKEYFQASKHSNKLIVMYFTAIWCGPCRSMEPTIKELAAKYTGVEVVKLDV  159

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL +V+++FG+++MPTF+ +K G+ V+K+IGA    LQ+KI+KHR
Sbjct  160  DELFNVSREFGIQTMPTFLFMKNGEKVDKVIGARPIDLQRKIEKHR  205



>ref|XP_009125122.1| PREDICTED: thioredoxin H2 [Brassica rapa]
Length=133

 Score =   120 bits (302),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +1

Query  70   ESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQ  249
            E+      +  V+ F SS  W++HF+  K++ +L+V+DF+A+WCGPC+ +EP     +A+
Sbjct  16   EAVAGNESESRVMKFSSSARWQLHFNEIKESSKLLVVDFSASWCGPCRMIEPAFIAMSAK  75

Query  250  YSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            ++DVEFVK+DVDEL DVA++F V  MPTFVLVK GK +E+I+GA +++L+KK+ KHR
Sbjct  76   FTDVEFVKLDVDELPDVAKEFNVTGMPTFVLVKNGKEIERIVGARKDELEKKVLKHR  132



>ref|XP_010431035.1| PREDICTED: thioredoxin H2-like [Camelina sativa]
Length=133

 Score =   120 bits (302),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
            G+ ++   +  F SS  W++H++  K++ +L+V+DF+A+WCGPC+ +EP +H  A +++D
Sbjct  19   GTESEPSRLFKFSSSARWQLHYNEIKESNKLLVVDFSASWCGPCRMIEPTIHAMADKFTD  78

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            V+FVK+DVDEL DVA++F V +MPTFVLVK GK +E+IIGA +E+L++K+ K R
Sbjct  79   VDFVKLDVDELPDVAKEFNVTAMPTFVLVKSGKEIERIIGAKKEELERKVSKLR  132



>ref|XP_008443435.1| PREDICTED: thioredoxin H2 [Cucumis melo]
Length=172

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V +FHSS  W++HF++ ++T +LMVIDF+ATWCGPC+ MEP  +  A++Y+DVEF KIDV
Sbjct  61   VQSFHSSARWQLHFNSVQETSKLMVIDFSATWCGPCRLMEPAFNAMASKYTDVEFAKIDV  120

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVAQ FGV++MPTFV +K+GKVV+ ++GA +E+L+KKI+KHR
Sbjct  121  DELADVAQHFGVQAMPTFVFLKRGKVVDTVVGARKEELEKKIEKHR  166



>gb|AAN76509.1|AF352030_1 thioredoxin h [Brassica rapa subsp. oleifera]
Length=133

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = +1

Query  70   ESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQ  249
            E       +  V+ F SS  W++HF+  K++ +L+V+DF+A+WCGPC+ +EP     +A+
Sbjct  16   EPLAGNESESRVMKFSSSARWQLHFNEIKESSKLLVVDFSASWCGPCRMIEPAFIAMSAK  75

Query  250  YSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +SDVEF+K+DVDEL DVA++F V  MPTFVLVK GK +E+I+GA +++L+KK+ KHR
Sbjct  76   FSDVEFLKLDVDELPDVAKEFNVTGMPTFVLVKNGKEIERIVGARKDELEKKVLKHR  132



>ref|XP_008389539.1| PREDICTED: thioredoxin H-type-like [Malus domestica]
Length=135

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            ++A HS   W  HFDA + + +LMVI+FTATWCGPC+ MEPI+ E+A +++DVEFVK+DV
Sbjct  22   IVACHSKEQWNTHFDAVQDSNKLMVIEFTATWCGPCRAMEPILREYADKFTDVEFVKLDV  81

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DE    A  F V+ MP+FV +K  +VV+K++GA +++LQKKI+ HR
Sbjct  82   DEFPGEAMQFSVQEMPSFVFLKGVEVVDKLVGARKDELQKKIENHR  127



>ref|XP_010441109.1| PREDICTED: thioredoxin H2-like [Camelina sativa]
Length=130

 Score =   119 bits (298),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = +1

Query  70   ESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQ  249
            E  G+ ++   ++ F SS  W++H++  K++ +LMV+DF+A+WCGPC+ +EP +H  A +
Sbjct  13   EDAGAESEPSRLLKFSSSARWQLHYNEIKESNKLMVVDFSASWCGPCRMIEPTIHAMADK  72

Query  250  YSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            ++DV+FV +DVDEL DVA++F V  MPTFVL++KGK VE+IIGA +++L+ K+ K R
Sbjct  73   FTDVDFVNLDVDELPDVAKEFNVTGMPTFVLIQKGKEVERIIGAKKDELESKVSKLR  129



>ref|XP_010043851.1| PREDICTED: thioredoxin H2-like [Eucalyptus grandis]
 gb|KCW85850.1| hypothetical protein EUGRSUZ_B02586 [Eucalyptus grandis]
 gb|KCW85851.1| hypothetical protein EUGRSUZ_B02586 [Eucalyptus grandis]
Length=165

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = +1

Query  88   TKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEF  267
             K   V+ FHS   W  HF+ASK   +LMVIDFTATWCGPC+ MEP + E A  ++DV+F
Sbjct  39   AKASRVMEFHSKSRWDEHFEASKGNNKLMVIDFTATWCGPCRRMEPTIDELAETFADVDF  98

Query  268  VKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            +KIDVDEL +VA+ + V++MPTF+L+K GKVV+++IGA +++L+ KI+++
Sbjct  99   IKIDVDELMNVARQYEVQAMPTFLLMKNGKVVDEVIGAKKDELRNKIEQN  148



>ref|XP_009142328.1| PREDICTED: thioredoxin H2-like [Brassica rapa]
Length=130

 Score =   118 bits (295),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
            G+ ++   V    SS  W++HF+  K + QL+VIDF+A+WCGPCK  EP V   A +++D
Sbjct  14   GNESEHSGVTKLSSSAQWQLHFNGMKDSNQLLVIDFSASWCGPCKSFEPAVRHMAVKFTD  73

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            V FVK+DVDEL +VA++F V +MPTFVL+K GK V++I+GA +++L+ K+ KHR
Sbjct  74   VSFVKVDVDELPEVAKEFDVTAMPTFVLMKNGKEVDRIVGAKQDELENKVTKHR  127



>gb|AFK33858.1| unknown [Lotus japonicus]
Length=121

 Score =   117 bits (294),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
            GS++++  V + HS   W  H +   ++K+L+V+DFTA+WCGPC+++ P + E A +Y++
Sbjct  3    GSSSEEGQVFSVHSVDAWTDHLNKGNESKKLIVVDFTASWCGPCRFIAPYLGELAKKYTN  62

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            V F+K+DVDEL  VAQD+ VE+MPTF+ VK+G +V+K++GA +E+LQ+KI+KH
Sbjct  63   VIFLKVDVDELKSVAQDWAVEAMPTFMFVKEGSIVDKVVGAKKEELQQKIEKH  115



>gb|AFK36929.1| unknown [Lotus japonicus]
Length=131

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  112  FHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDVDEL  291
            FHS   W++HF+  K +  L+VIDF+A+WCGPC+++EP +H  A ++SDV F KIDVDEL
Sbjct  28   FHSPARWQLHFNEHKDSSALLVIDFSASWCGPCRFIEPAIHAMAEKFSDVVFNKIDVDEL  87

Query  292  GDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
             DVA++F V++MPTFVLVK+GK V ++IGA +++L+KK+++ R
Sbjct  88   PDVAKEFEVQAMPTFVLVKRGKEVARVIGAKKDELEKKVEQLR  130



>ref|XP_010087814.1| Thioredoxin H2-2 [Morus notabilis]
 gb|EXB30121.1| Thioredoxin H2-2 [Morus notabilis]
Length=159

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  VIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkg  354
            VIDF+ATWCGPCK+MEPI ++ AA++SDV+FVKIDVDEL DVAQ+FGV++MPTFVL KKG
Sbjct  77   VIDFSATWCGPCKFMEPIYNDMAARFSDVDFVKIDVDELSDVAQEFGVQAMPTFVLTKKG  136

Query  355  kvvekIIGADREQLQKKIQKHR  420
            K V++++GA +++L++K+QKHR
Sbjct  137  KEVDRVVGAKKDELERKVQKHR  158



>gb|AAL90749.1| thioredoxin H [Populus tremula x Populus tremuloides]
Length=143

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 85/117 (73%), Gaps = 2/117 (2%)
 Frame = +1

Query  73   SYGSTTKKPL--VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAA  246
            S G    KP   V+  HS   WR +F+A+KQ  +L+VI+FTATWCGPC+YME  + +FAA
Sbjct  24   SNGFPCTKPAAGVVDVHSVGAWRSYFEANKQNNKLLVIEFTATWCGPCRYMEQTMKDFAA  83

Query  247  QYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            +Y+DV F++IDVDEL  VAQ F V +MP F L+KKGK+V+++ G  + +LQ KI+KH
Sbjct  84   KYTDVVFIRIDVDELQHVAQQFNVTTMPAFSLLKKGKIVDEVAGVKKSELQNKIEKH  140



>gb|ABM54166.1| thioredoxin [Brassica juncea]
Length=111

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V    SS  W++HF+  K + QL+VIDF+A+WCGPCK  EP V   A +++DV FVK+DV
Sbjct  3    VTKLSSSAQWQLHFNGMKDSNQLLVIDFSASWCGPCKSFEPAVRHMAVKFTDVSFVKVDV  62

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL +VA++F V +MPTFVL+K GK V++I+GA +++L+ K+ KHR
Sbjct  63   DELPEVAKEFDVTAMPTFVLMKNGKEVDRIVGAKQDELENKVTKHR  108



>emb|CDY37032.1| BnaA04g26100D [Brassica napus]
Length=187

 Score =   117 bits (294),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
            G+ ++   V    SS  W++HF+  K + QL+VIDF+A+WCGPCK  EP V   A +++D
Sbjct  14   GNESEHSGVTKLSSSAQWQLHFNGMKDSNQLLVIDFSASWCGPCKSFEPAVRHMAVKFTD  73

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            V FVK+DVDEL +VA++F V +MPTFVL+K GK V++I+GA +++L+ K+ KHR
Sbjct  74   VSFVKVDVDELPEVAKEFDVTAMPTFVLMKNGKEVDRIVGAKQDELENKVTKHR  127



>ref|XP_006380026.1| hypothetical protein POPTR_0008s19870g [Populus trichocarpa]
 ref|XP_002312703.2| hypothetical protein POPTR_0008s19870g [Populus trichocarpa]
 gb|ERP57823.1| hypothetical protein POPTR_0008s19870g [Populus trichocarpa]
 gb|EEE90070.2| hypothetical protein POPTR_0008s19870g [Populus trichocarpa]
Length=143

 Score =   116 bits (290),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 85/117 (73%), Gaps = 2/117 (2%)
 Frame = +1

Query  73   SYGSTTKKPL--VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAA  246
            S G    KP   V+  HS   WR +F+A+KQ  +L+VI+FTATWCGPC++ME  + +FAA
Sbjct  24   SNGFPCTKPAAGVVDVHSVGAWRSYFEANKQNNKLLVIEFTATWCGPCRHMEQTIKDFAA  83

Query  247  QYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            +Y+DV F++IDVDEL  VAQ F V +MP F L+KKGK+V+++ G  + +LQ KI+KH
Sbjct  84   KYTDVVFIRIDVDELQHVAQQFNVTTMPAFSLLKKGKIVDEVAGVKKSELQNKIEKH  140



>ref|XP_006838793.1| hypothetical protein AMTR_s00002p00259670 [Amborella trichopoda]
 gb|ERN01362.1| hypothetical protein AMTR_s00002p00259670 [Amborella trichopoda]
Length=146

 Score =   116 bits (290),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+ FH S  WR +FD +K +K+L+VIDF A WCGPC+ MEP   E A ++ DVEFVK+DV
Sbjct  40   VLPFHKSSEWRAYFDTTKSSKKLIVIDFGAAWCGPCRVMEPFFKELATKFPDVEFVKLDV  99

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVA ++ ++ MPTF+L K+G+VVEK++GA ++ L  K++K+R
Sbjct  100  DELMDVADEWEIQVMPTFILAKQGRVVEKVVGARKDDLALKVEKYR  145



>ref|XP_002520158.1| Thioredoxin H-type, putative [Ricinus communis]
 gb|EEF42213.1| Thioredoxin H-type, putative [Ricinus communis]
Length=136

 Score =   115 bits (289),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +1

Query  82   STTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDV  261
            S TK+  V+  HS+  WR  FDASK+  +L+V+ FTATWC PC++M+P V EFAA+++DV
Sbjct  23   SDTKQSRVVEIHSTDQWRSFFDASKRNNKLLVVQFTATWCRPCRFMDPTVQEFAAKFTDV  82

Query  262  EFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +F+KIDVD+L  VA  F   ++P FVL+KKGK V+K++GA R  L  KI++ R
Sbjct  83   DFIKIDVDKLMKVADQFEATTLPAFVLIKKGKQVDKVVGAKRIDLHNKIEQQR  135



>ref|XP_006838794.1| hypothetical protein AMTR_s00002p00259770 [Amborella trichopoda]
 gb|ERN01363.1| hypothetical protein AMTR_s00002p00259770 [Amborella trichopoda]
Length=146

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+ FH S  WR +F+ +K +K+L+VIDF A WCGPC+ MEP   E A ++ DVEFVK+DV
Sbjct  40   VLTFHKSSEWRAYFETTKSSKKLIVIDFGAAWCGPCRVMEPFYKELATKFPDVEFVKLDV  99

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVA ++ +++MPTF+LVK+G+VVEK++GA ++ L  K++K+R
Sbjct  100  DELMDVADEWEIQAMPTFILVKQGRVVEKVVGARKDDLAMKVEKYR  145



>gb|ABK94905.1| unknown [Populus trichocarpa]
Length=143

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 85/117 (73%), Gaps = 2/117 (2%)
 Frame = +1

Query  73   SYGSTTKKPL--VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAA  246
            S G    KP   V+  HS   WR +F+A+KQ  +L+VI+FTATWCGPC++ME  + +FAA
Sbjct  24   SNGFPCTKPAAGVVDVHSVGAWRSYFEANKQNNKLLVIEFTATWCGPCRHMEQTMKDFAA  83

Query  247  QYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            +Y+DV F++IDVDEL  VAQ F V +MP F L+KKGK+V+++ G  + +LQ KI+KH
Sbjct  84   KYTDVVFIRIDVDELQHVAQQFNVTTMPAFSLLKKGKIVDEVAGVKKSELQNKIEKH  140



>ref|XP_011034202.1| PREDICTED: thioredoxin H-type 2-like [Populus euphratica]
Length=143

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 85/118 (72%), Gaps = 2/118 (2%)
 Frame = +1

Query  73   SYGSTTKKPL--VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAA  246
            S G    KP   V+  HS   WR +F+A+KQ  +L+VI+FTATWCGPC+YME  + +FAA
Sbjct  24   SDGFPCTKPAAGVVDVHSVDAWRSYFEANKQNNKLLVIEFTATWCGPCRYMEQTMKDFAA  83

Query  247  QYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +Y+DV F++IDVDEL  VAQ F V ++P F L+KKGK+V+++ G  +  L+ KI+KHR
Sbjct  84   KYTDVVFIRIDVDELQHVAQQFNVTTLPAFSLLKKGKIVDEVAGVKKSALENKIEKHR  141



>ref|XP_008796645.1| PREDICTED: thioredoxin H2-2 [Phoenix dactylifera]
Length=123

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+A HS   W  H+ + K + +LMVIDF+A+WCGPC+++EP     AA+Y+DV FVKIDV
Sbjct  17   VVAIHSENAWNDHWKSHKDSSKLMVIDFSASWCGPCRFIEPAFKAMAAKYTDVVFVKIDV  76

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL +VAQ + V++MPTFVLVK G  V +++GA +++L+KKI++ R
Sbjct  77   DELSEVAQQWQVQAMPTFVLVKGGSEVGRVVGAKKDELEKKIEQLR  122



>ref|NP_001059090.1| Os07g0190800 [Oryza sativa Japonica Group]
 sp|Q6Z4I3.1|TRH21_ORYSJ RecName: Full=Thioredoxin H2-1; Short=OsTrxh2-1; AltName: Full=OsTrx24 
[Oryza sativa Japonica Group]
 dbj|BAC83857.1| putative thioredoxin [Oryza sativa Japonica Group]
 dbj|BAF21004.1| Os07g0190800 [Oryza sativa Japonica Group]
 gb|EAZ03072.1| hypothetical protein OsI_25217 [Oryza sativa Indica Group]
 gb|EAZ38983.1| hypothetical protein OsJ_23401 [Oryza sativa Japonica Group]
 dbj|BAH01096.1| unnamed protein product [Oryza sativa Japonica Group]
Length=138

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +1

Query  73   SYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQY  252
            + G    +  V+A HS   W   +DA K T +L+VIDF+A+WCGPCK MEP+  E A ++
Sbjct  13   AAGEEGGESAVVAVHSKAKWDELWDAHKNTTKLVVIDFSASWCGPCKMMEPVFKEMAGRF  72

Query  253  SDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQ  411
            +DV F+K+DVDEL +VA+ + VE+MPTFVL + G+ V +I+GAD+++L+K I 
Sbjct  73   TDVAFLKVDVDELAEVARTWRVEAMPTFVLARGGEEVGRIVGADKDELEKTIN  125



>emb|CDY57101.1| BnaC04g56890D [Brassica napus]
Length=165

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
            G+ ++   V    SS  W++HF+  K + QL+VIDF A+WCGPCK++EP     A +++D
Sbjct  49   GNESEHSGVTKLSSSAQWQLHFNGMKDSNQLLVIDFFASWCGPCKFIEPAFRHMAVKFTD  108

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            V FVK+DVDEL +VA++F V +MPTFVLVK GK V++I+G  + +L+ K+ KHR
Sbjct  109  VSFVKVDVDELPEVAREFNVNAMPTFVLVKNGKEVDRIVGTKQAELENKVTKHR  162



>ref|XP_007157415.1| hypothetical protein PHAVU_002G068200g [Phaseolus vulgaris]
 gb|ESW29409.1| hypothetical protein PHAVU_002G068200g [Phaseolus vulgaris]
Length=136

 Score =   113 bits (283),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            ++ FHS+  W  HF A K+T +LMV+DFTATWCGPCK M+ ++ + +A+Y+D EF+KIDV
Sbjct  30   LLTFHSTDKWNAHFKAVKETNKLMVLDFTATWCGPCKLMDQVLQDLSAEYTDAEFIKIDV  89

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            +EL +V+Q   V  +PTFVLVKKGK+V++++G  +E+L++ +  H
Sbjct  90   EELNEVSQALQVNQLPTFVLVKKGKIVDRVVGVKKEELKRSVGNH  134



>ref|XP_006601734.1| PREDICTED: uncharacterized protein LOC100305773 isoform X1 [Glycine 
max]
Length=148

 Score =   113 bits (283),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  97   PLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKI  276
            P V AFHS+  W  + +  K++ +L+VI FTA+WCGPCK++ P+ +  AA++++ +FVKI
Sbjct  39   PDVKAFHSAERWESYLEKIKESPKLVVIYFTASWCGPCKFIAPVFNHMAAEFANADFVKI  98

Query  277  DVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DVDEL  VA++F VE+MPTFV  K+GK VE+++GA++++LQ KI+KH
Sbjct  99   DVDELSGVAKEFKVEAMPTFVWWKEGKEVERVVGANKDELQNKIKKH  145



>ref|XP_010923297.1| PREDICTED: thioredoxin H2-2-like [Elaeis guineensis]
Length=126

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+A HS   W  H+ + K + +LMVIDF+A+WCGPC+++EP     AA+Y+DV FVKIDV
Sbjct  20   VVAIHSESAWNDHWKSHKDSSKLMVIDFSASWCGPCRFIEPAFKAMAAKYTDVVFVKIDV  79

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL +V++ + V++MPTFVLVK G  V +++GA +++L++KIQ+ R
Sbjct  80   DELSEVSEQWKVQAMPTFVLVKGGSEVGRVVGAQKDELERKIQQLR  125



>ref|XP_010923299.1| PREDICTED: thioredoxin H2-2-like [Elaeis guineensis]
Length=126

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = +1

Query  67   PESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAA  246
            P ++ +      ++A HS   W  H+ + K + +LMVIDFTA+WCGPC+ + P V   AA
Sbjct  8    PAAFAAEEVDSPILAIHSKNAWNDHWKSHKDSSKLMVIDFTASWCGPCRSIAPAVKAMAA  67

Query  247  QYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +Y+DV FVKIDVDEL +VAQ + V++MP FVLVK G+ V +++GA +++L+KKI + R
Sbjct  68   KYTDVVFVKIDVDELSEVAQQWKVQTMPAFVLVKGGREVGRVVGAKKDELEKKIAQLR  125



>ref|XP_004981402.1| PREDICTED: thioredoxin H2-2-like [Setaria italica]
Length=132

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+A HS   +   + A+K + +LMVIDF+A+WCGPC+++EP   E A++Y+DV FVKIDV
Sbjct  22   VVAAHSKATYDEQWAAAKSSGKLMVIDFSASWCGPCRFIEPAFKEMASKYTDVAFVKIDV  81

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL DVA+ + VE+MPTFVL K GK V +++GA +++L++KI   R
Sbjct  82   DELADVARTWKVEAMPTFVLAKGGKEVSRVVGAKKDELERKIGMFR  127



>gb|KHG11415.1| Thioredoxin H2 -like protein [Gossypium arboreum]
Length=122

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 86/118 (73%), Gaps = 12/118 (10%)
 Frame = +1

Query  67   PESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAA  246
            PE   S+++   +  FHSS  W++HF++ K + QLMVIDF+A+WCGPCK+MEP+++  AA
Sbjct  11   PEKSSSSSEHSGIQTFHSSPRWQLHFNSVKDSSQLMVIDFSASWCGPCKFMEPVLNAMAA  70

Query  247  QYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +++D            DVAQ+FGV+ MPTFVL+KKGK V++++GA +  L+KKI+KHR
Sbjct  71   KFTD------------DVAQEFGVQGMPTFVLLKKGKEVDRVVGAQKNDLEKKIEKHR  116



>ref|XP_009631317.1| PREDICTED: thioredoxin H2-like [Nicotiana tomentosiformis]
Length=120

 Score =   111 bits (277),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  QLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlv  345
            Q++VIDFT  WCGPC++MEPI+++FAA+Y+DVEF+KI VDEL DVAQ++GV++MPTFVL+
Sbjct  35   QIIVIDFTTIWCGPCRHMEPIINDFAAKYTDVEFIKIGVDELADVAQEYGVQAMPTFVLI  94

Query  346  kkgkvvekIIGADREQLQKKIQKHR  420
            K+GKVV+K++ A+++ LQKKI+ +R
Sbjct  95   KQGKVVDKVVVANKDGLQKKIENNR  119



>ref|XP_004489964.1| PREDICTED: thioredoxin H2-like [Cicer arietinum]
Length=126

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+ FHS+  W  HF A K+T +LMVIDFTA WC PCK M+PI+ EFA++Y+ VEF+K+DV
Sbjct  20   VLTFHSTAKWNAHFAAFKETDKLMVIDFTAKWCRPCKLMDPIMQEFASKYTHVEFIKLDV  79

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DE+  V+Q F V ++PTF+LVKKGKVV+K++G  +E+L++ I+K+R
Sbjct  80   DEIMGVSQRFEVHALPTFILVKKGKVVDKVVGVKKEELRRMIEKNR  125



>ref|XP_004147463.1| PREDICTED: thioredoxin H2-like [Cucumis sativus]
 ref|XP_004168627.1| PREDICTED: thioredoxin H2-like [Cucumis sativus]
 gb|KGN59596.1| Thioredoxin h [Cucumis sativus]
Length=144

 Score =   111 bits (277),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +1

Query  130  WRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQD  309
            W++HF++ ++T +LMV+DF+ATWCGPC+ MEP  +  A++Y+DVEF KIDVDEL DVAQ 
Sbjct  42   WQLHFNSLQETPKLMVVDFSATWCGPCRLMEPAFNAMASKYTDVEFAKIDVDELSDVAQH  101

Query  310  FGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            FGV++MPTFV +K+GKVV+ ++GA +E+L+KKI+KHR
Sbjct  102  FGVQAMPTFVFLKRGKVVDTVVGARKEELEKKIEKHR  138



>ref|XP_007158610.1| hypothetical protein PHAVU_002G167100g [Phaseolus vulgaris]
 gb|ESW30604.1| hypothetical protein PHAVU_002G167100g [Phaseolus vulgaris]
Length=120

 Score =   110 bits (275),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA H+   W         +K+L+V+DFTA+WCGPC+++ P + E A ++++V F+K+DV
Sbjct  10   VIACHTVEAWTEQLQKGNDSKKLIVVDFTASWCGPCRFISPFLAELAKKFTNVVFLKVDV  69

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+DF VE+MPTFV VK+G ++ K++GA +E+LQ+ I+KH
Sbjct  70   DELKSVAEDFAVEAMPTFVFVKEGTLLGKVVGAKKEELQQTIEKH  114



>ref|XP_008379815.1| PREDICTED: thioredoxin H2 [Malus domestica]
Length=155

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 90/135 (67%), Gaps = 22/135 (16%)
 Frame = +1

Query  82   STTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDV  261
            S  ++  V +FHSS  W++H    +++ QL+V+DF+A+WCGPC+++EP +   AA+++DV
Sbjct  19   SAXEESGVTSFHSSERWQLHLKTHEESSQLLVVDFSASWCGPCRFIEPAIRAMAAKFTDV  78

Query  262  EFVKIDVDELG----------------------DVAQDFGVESMPTFvlvkkgkvvekII  375
            +F KIDVDEL                        VA +FGV++MPTFVL+KKGK V+++I
Sbjct  79   QFAKIDVDELSVSPSKLVLJFESELIYXXKCFYXVAXEFGVQAMPTFVLLKKGKEVDRVI  138

Query  376  GADREQLQKKIQKHR  420
            GA +++L+KK++K R
Sbjct  139  GAKKDELEKKVEKXR  153



>ref|XP_008388004.1| PREDICTED: thioredoxin H1-like [Malus domestica]
Length=125

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA HS   W  H + S   K+L+V+DFTATWCGPC+++ PI  E A +  +V F+K+DV
Sbjct  6    VIACHSVAAWTEHLEKSNVDKKLIVVDFTATWCGPCRFIAPIFAELARKNPEVTFLKVDV  65

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  V++++GVE+MPTF+ +K+GKVV+K++GA +E+LQ K+ KH
Sbjct  66   DELKTVSEEWGVEAMPTFLFLKEGKVVDKVVGAKKEELQLKVVKH  110



>ref|XP_009335693.1| PREDICTED: thioredoxin H1-like [Pyrus x bretschneideri]
 ref|XP_009335701.1| PREDICTED: thioredoxin H1-like [Pyrus x bretschneideri]
Length=121

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA HS   W  H + S   K+L+V+DFTATWCGPC+++ PI  E A +  +V F+K+DV
Sbjct  6    VIACHSVAAWTEHLEKSNVDKKLIVVDFTATWCGPCRFIAPIFAELARKNPEVTFLKVDV  65

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  V +++GVE+MPTF+ +K+GKVV+K++GA +E+LQ K+ KH
Sbjct  66   DELKTVTEEWGVEAMPTFLFLKEGKVVDKVVGAKKEELQLKVVKH  110



>gb|KFK40858.1| hypothetical protein AALP_AA2G050700 [Arabis alpina]
Length=128

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +1

Query  88   TKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEF  267
            +K  L++   S   WR+ FD+ K +K+L+VIDFTA WCGPCK MEP V E  ++Y +V F
Sbjct  17   SKNGLIVKIESRRQWRLLFDSMKGSKELLVIDFTAAWCGPCKAMEPRVKEIVSRYPEVVF  76

Query  268  VKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
             ++DVD L DVA+ +   ++P FV VK+G+ V++++GA  ++L  KI+KHR
Sbjct  77   ARVDVDRLMDVAETYKANTLPAFVFVKRGEEVDRVVGAKPDELVNKIEKHR  127



>gb|KDO82713.1| hypothetical protein CISIN_1g0312711mg [Citrus sinensis]
Length=129

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 84/112 (75%), Gaps = 1/112 (1%)
 Frame = +1

Query  88   TKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEF  267
             K PLV+   S   WR  ++ASKQ+ +L+VI +TA WCGPCK++EP V +FAA Y+DV+F
Sbjct  17   AKTPLVMELQSKHQWRSQYEASKQSDRLVVIYYTAAWCGPCKFIEPYVKDFAAMYTDVQF  76

Query  268  VKIDVDELGDVAQDFG-VESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +KIDVD L + A+ F  ++ +PTFVLVK+GK +++++GA +++LQ K +K R
Sbjct  77   IKIDVDWLPEAAKAFDLIDVLPTFVLVKRGKEIDRVVGAKKDELQMKTEKRR  128



>gb|AEC03317.1| thioredoxin H-type 3 [Hevea brasiliensis]
Length=118

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA H+   W    +  +++K+L+V+DFTA+WCGPC+++ PI+ EFA +   V F+K+DV
Sbjct  7    VIACHTVQAWTEQLEKGQESKKLIVVDFTASWCGPCRFISPILAEFAKKMPHVTFLKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+D+ VE+MPTF+ +K+GK+++K++GA +E+LQ+ I KH
Sbjct  67   DELKTVAEDWAVEAMPTFMFLKEGKIIDKVVGAKKEELQQTIAKH  111



>ref|NP_001237535.1| thioredoxin h1 [Glycine max]
 gb|ABV71991.1| thioredoxin h1 [Glycine max]
Length=120

 Score =   108 bits (269),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
              ++++  VI+ H+   W        ++K+L+V+DFTA+WCGPC+++ P + E A +++ 
Sbjct  2    AGSSEEGQVISCHTVEEWNDQLQKGNESKKLIVVDFTASWCGPCRFIAPFLAELAKKFTS  61

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            V F+K+DVDEL  V+QD+ +E+MPTFV VK+G +++K++GA +++LQ+KIQKH
Sbjct  62   VIFLKVDVDELKSVSQDWAIEAMPTFVFVKEGTLLDKVVGAKKDELQQKIQKH  114



>gb|EMT20503.1| Thioredoxin H-type 2 [Aegilops tauschii]
Length=131

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+A HS   W  H++  +   +LMVIDF+A+WCGPC+++EP   E A++++D  FVKIDV
Sbjct  23   VVAVHSKPAWDKHWEEHRNASKLMVIDFSASWCGPCRFIEPAFKEMASRFADALFVKIDV  82

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQ  411
            DEL +VA+ F VE+MPTFVLVK G+ V +++GA +++L +KI+
Sbjct  83   DELAEVAKTFRVEAMPTFVLVKGGQEVSRVVGAKKDELDRKIK  125



>ref|XP_009388459.1| PREDICTED: thioredoxin H2-2-like [Musa acuminata subsp. malaccensis]
Length=127

 Score =   108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = +1

Query  73   SYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQY  252
            +Y +      VIA HS+  W  ++++  QT +LMVIDF+A+WCGPC+++EP     A QY
Sbjct  10   AYAAEDGVSAVIAIHSAGEWTQNWESHSQTNKLMVIDFSASWCGPCRFVEPAFKAMATQY  69

Query  253  SDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            SD  FVKI+VDE+ +V++ + V++MPTFVLVK G+ V +I+GA +++L+++IQ+ 
Sbjct  70   SDAVFVKINVDEIPEVSKQWKVQAMPTFVLVKGGQEVGRIVGAKKDELERRIQEQ  124



>gb|ACH61777.1| thioredoxin h [Triticum aestivum]
Length=131

 Score =   108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+A HS   W  H++  +   +LMVIDF+A+WCGPC+++EP   E A++++D  FVKIDV
Sbjct  23   VVAVHSKPAWDKHWEEHRNASKLMVIDFSASWCGPCRFIEPAFKEMASRFADALFVKIDV  82

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQ  411
            DEL +VA+ F VE+MPTFVLVK G+ V +++GA +++L +KI+
Sbjct  83   DELAEVAKTFRVEAMPTFVLVKGGQEVSRVVGAKKDELDRKIK  125



>ref|XP_011074624.1| PREDICTED: thioredoxin H-type 1-like [Sesamum indicum]
Length=120

 Score =   108 bits (269),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +1

Query  82   STTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDV  261
            ST+++  VI  H+   W  HF   +++ +L+V+DFTA+WCGPC+++ PI+ E A + + V
Sbjct  2    STSEEGQVIGCHTEAEWEEHFKKGRESGKLVVVDFTASWCGPCRFIAPILAEIAKKTTHV  61

Query  262  EFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
             F+K+DVDEL  VAQ + VE+MPTF+ +K G+ V++++GA +E LQ  I KH
Sbjct  62   IFLKVDVDELKTVAQKYNVEAMPTFLFLKGGEEVDRLVGAKKEDLQALITKH  113



>ref|XP_004512082.1| PREDICTED: thioredoxin H-type-like [Cicer arietinum]
Length=120

 Score =   107 bits (268),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
              ++++  VI+ HS   W        ++K+L+V+DFTA+WCGPC+++ P + E A ++++
Sbjct  2    AGSSEEGQVISCHSVDTWNDILHRGNESKKLIVVDFTASWCGPCRFIAPFLGELAKKFTN  61

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            V F+K+DVDEL  VAQD+ VE+MPTFV VK+G +++K++GA +E+LQ+ I+KH
Sbjct  62   VIFIKVDVDELKSVAQDWAVEAMPTFVFVKEGTILDKVVGAKKEELQQTIEKH  114



>gb|AEC03322.1| thioredoxin H-type 7 [Hevea brasiliensis]
Length=118

 Score =   107 bits (268),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA H+   W    +  +++K+L+V+DFTA+WCGPC+++ PI+ EFA +   V F+K+D+
Sbjct  7    VIACHTVQAWTEQLEKGQESKKLIVVDFTASWCGPCRFISPILAEFAKKMPHVTFLKVDL  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+D+ VE+MPTF+ +K+GK+++K++GA +E+LQ+ I KH
Sbjct  67   DELKTVAEDWAVEAMPTFMFLKEGKIIDKVVGAKKEELQQTIAKH  111



>ref|XP_008807864.1| PREDICTED: thioredoxin H2-1 [Phoenix dactylifera]
Length=126

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +1

Query  67   PESYGSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAA  246
            P +  S      V+A HS   W  H+ +   + +LMVIDF+A+WCGPC++MEP+ +  AA
Sbjct  8    PAAAASDDGDSHVLAIHSKDAWNDHWQSHGDSSKLMVIDFSASWCGPCRFMEPVFNAMAA  67

Query  247  QYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +Y+DV FVKIDVDEL +VAQ + V++MPTFVLVK G  V +++G+ +++L KKI++ R
Sbjct  68   KYTDVVFVKIDVDELSEVAQQWRVQAMPTFVLVKGGGEVGRVVGSKKDELDKKIEQLR  125



>gb|AGG19201.1| thioredoxin H-type 8 [Tamarix hispida]
Length=133

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI   +S       ++SKQ+++LMVIDF+A WCGPCK+MEPIV E + +Y DV+F+K+DV
Sbjct  22   VIVCRTSNECESRLESSKQSRKLMVIDFSAAWCGPCKFMEPIVDELSIRYKDVQFIKVDV  81

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DE    A+ FG++ MPTFV +++GK V+++ GA + +L+ KI+ +R
Sbjct  82   DENTGFARRFGIDCMPTFVFLREGKEVDRLSGAGKVELENKIKSNR  127



>ref|XP_006438555.1| hypothetical protein CICLE_v10033071mg [Citrus clementina]
 ref|XP_006483262.1| PREDICTED: thioredoxin H7-like [Citrus sinensis]
 gb|ESR51795.1| hypothetical protein CICLE_v10033071mg [Citrus clementina]
Length=129

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 84/112 (75%), Gaps = 1/112 (1%)
 Frame = +1

Query  88   TKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEF  267
             K PLV+   S   WR  ++ASKQ+ +L+VI +TA WCGPCK+++P V +FAA Y+DV+F
Sbjct  17   AKTPLVMELQSKHQWRSQYEASKQSDRLVVIYYTAAWCGPCKFIDPYVKDFAAMYTDVQF  76

Query  268  VKIDVDELGDVAQDFG-VESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            +KIDVD L + A+ F  ++ +PTFVLVK+GK +++++GA +++LQ K +K R
Sbjct  77   IKIDVDWLPEAAKAFDLIDVLPTFVLVKRGKEIDRVVGAKKDELQMKTEKRR  128



>gb|AFP49340.1| thioredoxin h [Olea europaea]
Length=123

 Score =   107 bits (268),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  HS   W+ +F+   +TK+L+VIDFTA+WCGPC+ + PI+ E A +   V F+K+DV
Sbjct  8    VIGCHSVDQWKENFNKGIETKKLVVIDFTASWCGPCRVIAPILAEIAKKTPHVIFLKVDV  67

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL DVA++F VE+MPTFV +K GK V++++GA +E LQ  I KH
Sbjct  68   DELKDVAKEFNVEAMPTFVFLKDGKEVDRLVGARKENLQDTINKH  112



>ref|XP_008377190.1| PREDICTED: thioredoxin H-type-like [Malus domestica]
Length=127

 Score =   108 bits (269),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  HS   W  H + S  +K+L+V+DFTATWCGPC+++ PI  E A +  +V F+K+DV
Sbjct  6    VIGCHSVAAWTEHLEKSHVSKKLIVVDFTATWCGPCRFIAPIFAELARKNPEVTFLKVDV  65

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  V++++GVE+MPTF+ +K+GKVV+K++GA +++LQ K+ KH
Sbjct  66   DELKTVSEEWGVEAMPTFLFLKEGKVVDKVVGAKKDELQLKVAKH  110



>ref|NP_001236481.1| uncharacterized protein LOC100305773 [Glycine max]
 gb|ACU13630.1| unknown [Glycine max]
Length=128

 Score =   107 bits (268),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 84/112 (75%), Gaps = 5/112 (4%)
 Frame = +1

Query  97   PLVIAFHSSMNWRIHFDASKQTKQLM-----VIDFTATWCGPCKYMEPIVHEFAAQYSDV  261
            P V AFHS+  W  + +  K++ +L+     VI FTA+WCGPCK++ P+ +  AA++++ 
Sbjct  14   PDVKAFHSAERWESYLEKIKESPKLINKNQVVIYFTASWCGPCKFIAPVFNHMAAEFANA  73

Query  262  EFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            +FVKIDVDEL  VA++F VE+MPTFV  K+GK VE+++GA++++LQ KI+KH
Sbjct  74   DFVKIDVDELSGVAKEFKVEAMPTFVWWKEGKEVERVVGANKDELQNKIKKH  125



>gb|KCW56162.1| hypothetical protein EUGRSUZ_I01913 [Eucalyptus grandis]
Length=159

 Score =   108 bits (270),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  MVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPTFvlvkk  351
            MVIDF A+WCGPC+ MEP V   A++++DVEF KIDVDEL DVA++F V++MPTFVLVKK
Sbjct  71   MVIDFAASWCGPCRMMEPAVSAMASKFADVEFAKIDVDELSDVAREFSVQAMPTFVLVKK  130

Query  352  gkvvekIIGADREQLQKKIQKHR  420
            GK V++I+GA +++L++K+QKHR
Sbjct  131  GKEVDRIVGAKKDELERKVQKHR  153



>gb|AEC03323.1| thioredoxin H-type 8 [Hevea brasiliensis]
Length=118

 Score =   107 bits (267),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA H+   W    +  +++K+L+V+DFTA+WCGPC+++ PI+ EFA +   V F+K+DV
Sbjct  7    VIACHTVQAWTEQLEKGQESKKLIVVDFTASWCGPCRFISPILAEFAKKMPHVTFLKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+D+ V++MPTF+ +K+GK+++K++GA +E+LQ+ I KH
Sbjct  67   DELKTVAEDWAVKAMPTFMFLKEGKIIDKVVGAKKEELQQTIAKH  111



>ref|XP_002510456.1| Thioredoxin H-type, putative [Ricinus communis]
 gb|EEF52643.1| Thioredoxin H-type, putative [Ricinus communis]
Length=118

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA H+   W    +  ++TK+L+V+DFTA+WCGPC+++ PI+ E A +  +V F+K+DV
Sbjct  7    VIACHTVEAWTEQLEKGQETKKLIVVDFTASWCGPCRFIAPILAEMAKKMPNVTFLKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+D+ VE+MPTF+ +K+GK+V K++GA++E+LQ  I K+
Sbjct  67   DELKSVAEDWAVEAMPTFMFLKEGKIVHKVVGANKEELQMTIAKY  111



>gb|AAO12854.1| thioredoxin h [Pisum sativum]
Length=113

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  H+   W+   +  K +K+L+V+DFTA+WCGPC+++ PI+ E A + + V F+K+DV
Sbjct  7    VIGVHTVDAWKEQLEKGKASKKLIVVDFTASWCGPCRFIAPILAEIAKKLTHVTFLKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  V++++G+E+MPTF+ +K G++V+K++GA +E+LQ KI KH
Sbjct  67   DELKTVSEEWGIEAMPTFLFLKDGELVDKVVGAKKEELQLKIDKH  111



>gb|AAZ32865.1| thioredoxin h [Medicago sativa]
Length=117

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  H+   W+ H +    +K+L+V+DFTA+WCGPC+++ PI+ E A +  +V F+K+DV
Sbjct  8    VIGVHTVEAWKEHLEKGNGSKKLIVVDFTASWCGPCRFIAPILAEIAKKLPNVTFLKVDV  67

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+++ V++MPTF+ +K+GK+V+K++GA +EQLQ  I KH
Sbjct  68   DELKTVAEEWAVDAMPTFLFLKEGKLVDKVVGAQKEQLQAAITKH  112



>gb|KEH36212.1| thioredoxin H-type 1 protein [Medicago truncatula]
Length=117

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  H+   W+ H +    +K+L+V+DFTA+WCGPC+++ PI+ E A +  +V F+K+DV
Sbjct  8    VIGVHTVEAWKEHLEKGNGSKKLIVVDFTASWCGPCRFIAPILAEIAKKLPNVTFLKVDV  67

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+++ V++MPTF+ +K+GK+V+K++GA +EQLQ  I KH
Sbjct  68   DELKTVAEEWAVDAMPTFLFLKEGKLVDKVVGAQKEQLQAAITKH  112



>ref|XP_008388001.1| PREDICTED: thioredoxin H-type 2-like isoform X1 [Malus domestica]
Length=121

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA HS   W  H + S   K+L+V+DFTA WCGPC+++ PI  E A +  +V F+K+DV
Sbjct  6    VIACHSVAAWTEHLEKSHVDKKLVVVDFTAIWCGPCRFIAPIFAELARKNPEVTFLKVDV  65

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  V +++GVE+MPTF+++K+GKVV+K++GA +E+LQ K+ KH
Sbjct  66   DELKTVTEEWGVEAMPTFLILKEGKVVDKVVGAKKEELQLKVVKH  110



>ref|XP_003527904.1| PREDICTED: thioredoxin H-type [Glycine max]
 gb|KHN22220.1| Thioredoxin H-type [Glycine soja]
Length=117

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  HS   W+ H    +++K+L+V+DFTA+WCGPC+++ PI+ EFA +  +V F+K+DV
Sbjct  7    VIGVHSVEEWKEHLKKGEESKKLIVVDFTASWCGPCRFIAPILAEFAKKLPNVTFLKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQ  399
            DEL  V++++G+E+MPTF+ +K+GK+V+K++GA +E+LQ
Sbjct  67   DELETVSKEWGIEAMPTFLFLKEGKLVDKVVGAKKEELQ  105



>ref|XP_009335682.1| PREDICTED: LOW QUALITY PROTEIN: thioredoxin H-type 2-like [Pyrus 
x bretschneideri]
Length=121

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA HS   W  H + S   K+L+V+DFTA WCGPC+++ PI  E A +  +V F+K+DV
Sbjct  6    VIACHSVAAWTEHLEKSHVDKKLIVVDFTARWCGPCRFIAPIFAELARKSPEVTFLKVDV  65

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  V +++GVE+MPTF+ +K+GKVV+K++GA +E+LQ K+ KH
Sbjct  66   DELKTVTEEWGVEAMPTFLFLKEGKVVDKVVGAKKEELQLKVVKH  110



>ref|XP_010254672.1| PREDICTED: thioredoxin H-type-like [Nelumbo nucifera]
Length=114

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI+ H+   W        ++K+L+V+DFTA+WCGPC++M PI+ E A +  +V F+K+DV
Sbjct  7    VISCHTVEAWNEQLQKGNESKKLVVVDFTASWCGPCRFMAPILAELAKKLPNVIFLKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA D+ VE+MPTF+ +K+GK+V+KI+GA +E+LQ+KI  H
Sbjct  67   DELKTVATDWAVEAMPTFMFLKEGKIVDKIVGARKEELQQKITAH  111



>gb|ADU56183.1| thioredoxin H-type [Jatropha curcas]
 gb|KDP38568.1| hypothetical protein JCGZ_04493 [Jatropha curcas]
Length=118

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA H+   W    +  K++K L+V+DFTATWCGPC+++ PI+ + A +   V F+K+DV
Sbjct  7    VIACHTVEAWNEQLEKGKESKTLIVVDFTATWCGPCRFITPILQDLAKKMPHVTFLKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+D+ VE+MPTF+ +K+GK+V+K++GA +E+LQ  I KH
Sbjct  67   DELRTVAEDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQMTIVKH  111



>gb|KDP32674.1| hypothetical protein JCGZ_13672 [Jatropha curcas]
Length=122

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  H+   W        ++K+L+V+DFTA+WCGPC+++ P++ E A +  +V F+K+DV
Sbjct  8    VIGCHTVEAWNEQLQKGNESKKLVVVDFTASWCGPCRFISPLLAELAKKLPNVIFLKVDV  67

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VAQD+ VE+MPTF+ +K+G +++K++GA++++LQ+KI KH
Sbjct  68   DELQTVAQDWAVEAMPTFIFLKEGNILDKMLGANKDELQQKIAKH  112



>emb|CAC36986.1| thioredoxin h [Pisum sativum]
Length=120

 Score =   106 bits (264),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
              ++++  VI+ HS   W        ++K+L+V+DFTA+WCGPC+++ P + E A ++++
Sbjct  2    AGSSEEGQVISCHSVDAWNDILHRGNESKKLIVVDFTASWCGPCRFIAPFLGELAKKFTN  61

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            V F+K+DVDEL  VAQD+ VE+MPTFV VK+G ++ K++GA +E+LQ+ I++H
Sbjct  62   VIFLKVDVDELKSVAQDWAVEAMPTFVFVKEGTILGKVVGAKKEELQQTIERH  114



>ref|XP_006425591.1| hypothetical protein CICLE_v10026781mg [Citrus clementina]
 ref|XP_006466877.1| PREDICTED: thioredoxin H-type-like [Citrus sinensis]
 gb|ABL67654.1| putative H-type thioredoxin [Citrus hybrid cultivar]
 gb|ESR38831.1| hypothetical protein CICLE_v10026781mg [Citrus clementina]
 gb|KDO71055.1| hypothetical protein CISIN_1g033426mg [Citrus sinensis]
Length=119

 Score =   106 bits (264),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  H+   W      S +TKQL+V+DFTA+WCGPC+++ P + E A +  +V F+K+DV
Sbjct  9    VIGCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDV  68

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA D+ VE+MPTF+ +K+GK+V+K++G+ +E+LQ+ I KH
Sbjct  69   DELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKH  113



>ref|XP_006658356.1| PREDICTED: thioredoxin H2-1-like [Oryza brachyantha]
Length=157

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+A HS   W   ++A K T +L+VIDF+A+WCGPCK +EP+  E + +++DV F+K+DV
Sbjct  39   VVAVHSKAKWDELWEAHKTTTKLVVIDFSASWCGPCKMIEPVFKEMSGRFTDVVFLKVDV  98

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DEL +VA+ + VE+MPTFVL + G+ V +I+GA++++L++ I   R
Sbjct  99   DELAEVARTWRVEAMPTFVLARGGEEVGRIVGANKDELERSINTFR  144



>ref|XP_008338022.1| PREDICTED: thioredoxin H-type-like [Malus domestica]
Length=118

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +1

Query  85   TTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVE  264
             T++  V + H+   W         +K+LMVIDFTA+WCGPC+++ P + E A +  DV 
Sbjct  2    ATEEGQVFSCHTVEAWEQQLQKGNDSKKLMVIDFTASWCGPCRFIAPFLAELAKKLPDVI  61

Query  265  FVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            FVK+DVDEL  VAQD+ VE+MPTF+ +K+GK+V+K++GA +++LQ+ I KH
Sbjct  62   FVKVDVDELKTVAQDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQRTIAKH  112



>ref|XP_004291829.1| PREDICTED: thioredoxin H-type-like [Fragaria vesca subsp. vesca]
Length=122

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA H+  +W        +TK+L+V+DFTA+WCGPC+++ PI+ E A +  DV F+K+DV
Sbjct  8    VIACHTPESWEEELRKGNETKKLIVVDFTASWCGPCRFIAPILAELAKKTPDVTFLKVDV  67

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+D+ VE+MPTF+ +K+GK+V+K++GA +++L +K+ +H
Sbjct  68   DELKKVAEDWAVEAMPTFMFLKEGKIVDKVVGAKKDELVQKVGQH  112



>gb|AEI69283.1| thioredoxin h 1-1 [Galega orientalis]
Length=120

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
             S++++  VI+ HS   W        ++K+L+V+DFTA+WCGPC+++ P + + A ++++
Sbjct  2    ASSSEEGQVISCHSVDAWNDILHKGNESKKLIVVDFTASWCGPCRFIAPFLADLAKKFTN  61

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            V F+K+DVDEL  VAQD+ VE+MPTFV VK+G ++ K++GA +++LQ+ I+KH
Sbjct  62   VIFLKVDVDELKSVAQDWAVEAMPTFVFVKEGTILGKVVGAKKDELQQTIEKH  114



>gb|AII71795.1| thioredoxin [Zostera marina]
Length=116

 Score =   105 bits (262),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +1

Query  100  LVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKID  279
            LV+A HS   W  H   +  +K+++V+DFTA+WCGPC+++ P+  + A ++ +  F+K+D
Sbjct  6    LVLACHSVEEWDAHLQQANASKKVVVVDFTASWCGPCRFIAPVFADLAKKFVNSVFLKVD  65

Query  280  VDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            VDEL  VAQD+ VE+MPTF+++K+G ++E+I+GA ++QL  K+ +H
Sbjct  66   VDELKSVAQDWAVEAMPTFIIMKEGTILERIVGAQKDQLSAKVAEH  111



>gb|AAZ98842.1| thioredoxin h1 [Medicago truncatula]
Length=117

 Score =   105 bits (262),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  H+   W+ H +    +K+L+V+DFTA+WCGPC+++ PI+ E A +  +V F+K+DV
Sbjct  8    VIGVHTVEAWKEHLEKGNGSKKLIVVDFTASWCGPCRFIAPILAEIAKKLPNVTFLKVDV  67

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+++ V++MPTF+ +K+GK+V+K++GA ++QLQ  I KH
Sbjct  68   DELKTVAEEWAVDAMPTFLFLKEGKLVDKVVGAQKDQLQAAITKH  112



>ref|XP_003557168.1| PREDICTED: thioredoxin H2-2 [Brachypodium distachyon]
Length=134

 Score =   105 bits (263),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 78/105 (74%), Gaps = 2/105 (2%)
 Frame = +1

Query  103  VIAFHSSMNW--RIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKI  276
            V+A HS  +W  ++    S    +LMVIDF+ATWCGPC+++EP   E A++++D  FVKI
Sbjct  22   VVAVHSKASWDEQLKIHGSATANKLMVIDFSATWCGPCRFIEPAFKEMASRFTDAVFVKI  81

Query  277  DVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQ  411
            DVDEL +VA+ F VE+MPTFVL+K G+ V +++GA +++L +KI+
Sbjct  82   DVDELSEVAKTFCVEAMPTFVLLKGGQEVSRVVGAKKDELDRKIK  126



>ref|XP_010552494.1| PREDICTED: thioredoxin H5-like [Tarenaya hassleriana]
Length=117

 Score =   105 bits (261),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA H+   W  +F A+ ++K+L+VIDFTA+WC PC+++ P+  E A ++ +V F KIDV
Sbjct  7    VIACHTLDAWNENFKAANESKKLVVIDFTASWCPPCRFIAPVFVELAKRFLNVVFFKIDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL DVA++F VE+MPTFV +K+GK VE+++GAD+ ++++ + KH
Sbjct  67   DELQDVAKEFQVEAMPTFVYLKEGKEVERVVGADKVKIEQTLSKH  111



>emb|CAC42084.1| thioredoxin h [Pisum sativum]
Length=118

 Score =   105 bits (261),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA HS  +W+       ++K+L+V+DFTA+WCGPC+++ PI+ E A +   V F+K+D+
Sbjct  7    VIAVHSDESWKEQIQKGTESKKLIVVDFTASWCGPCRFIAPILAEIAKKTPQVIFLKVDI  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+++ +E+MPTF+L+K+G  V+K++GA +E+LQ  I KH
Sbjct  67   DELESVAEEWSIEAMPTFLLLKEGMEVDKVVGAKKEELQLAITKH  111



>ref|XP_010275525.1| PREDICTED: thioredoxin H-type-like [Nelumbo nucifera]
Length=115

 Score =   105 bits (261),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  HS   W        ++K+L+V+DFTA+WCGPC+ M PI+ E A +  +V F+K+DV
Sbjct  7    VIGCHSVEAWNEQLQKGNESKKLVVVDFTASWCGPCRLMTPILAELAKKLPNVIFLKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA D+ VE+MPTF+ +K+GK+V+KI+GA +E+LQ+KI  H
Sbjct  67   DELKSVATDWEVEAMPTFIFLKEGKIVDKIVGARKEELQQKITTH  111



>ref|NP_001241757.1| thioredoxin H-type 5 [Zea mays]
 gb|ACG35640.1| thioredoxin H-type 5 [Zea mays]
 gb|AFW67323.1| thioredoxin H-type 5 [Zea mays]
Length=132

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+A HS   +   + A K + +LMVIDF+A+WCGPC+++EP   E A+++SD  FVK+DV
Sbjct  22   VVAAHSKATYDEQWAAHKSSSKLMVIDFSASWCGPCRFIEPAFKELASRFSDAIFVKVDV  81

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQ  411
            DEL +VA+ + VE+MPTFVLVK GK V +++GA +++L++KI+
Sbjct  82   DELAEVARTWKVEAMPTFVLVKDGKEVSRVVGAKKDELERKIR  124



>ref|XP_010061260.1| PREDICTED: thioredoxin H1 [Eucalyptus grandis]
 gb|KCW68185.1| hypothetical protein EUGRSUZ_F01854 [Eucalyptus grandis]
Length=118

 Score =   105 bits (261),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI+ H+  +W        ++K+L+V+DF+ATWCGPC+ + P++   A + +DV F+K+DV
Sbjct  7    VISCHTVDSWNQQLQTGAESKKLVVVDFSATWCGPCRLISPVLDNLARKLTDVIFLKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+D+ VE+MPTF+ +K+G VV+K++GA+++ LQ KI KH
Sbjct  67   DELRSVAEDWAVEAMPTFIFIKEGAVVDKVVGANKDDLQMKIAKH  111



>ref|XP_010679815.1| PREDICTED: thioredoxin H1 [Beta vulgaris subsp. vulgaris]
Length=115

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI+ H+   W      + ++K+LMV+DFTA+WCGPC+ + P + E A ++  V FVK+DV
Sbjct  7    VISCHTDQAWEEQLTKANESKKLMVVDFTASWCGPCRAIAPFLAELARKFPGVIFVKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA D+ +E+MPTF+L+ +GK+V K++GA +++LQ+ I+KH
Sbjct  67   DELKQVASDWAIEAMPTFMLLLEGKIVGKVVGAKKDELQQAIEKH  111



>ref|XP_010532878.1| PREDICTED: thioredoxin H8-like [Tarenaya hassleriana]
Length=150

 Score =   105 bits (263),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 75/109 (69%), Gaps = 0/109 (0%)
 Frame = +1

Query  94   KPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVK  273
            KP V    +   WR   +A K T +L+VIDFTA WCGPCK +EP + EFAA+Y+DVEFVK
Sbjct  39   KPRVAEIKNKSQWRARLNALKDTDKLLVIDFTAKWCGPCKSLEPKLEEFAAKYTDVEFVK  98

Query  274  IDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            IDVD L  VA  F V ++P  V VK+G+ +++++G   ++L +KI+K R
Sbjct  99   IDVDVLMSVAMQFNVHTLPAMVFVKRGQELDRVVGLKVDELLRKIEKFR  147



>ref|XP_008361428.1| PREDICTED: thioredoxin H-type [Malus domestica]
Length=118

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +1

Query  85   TTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVE  264
             T++  V + H+   W         +K+LMVIDFTA+WCGPC+++ P + E A +  DV 
Sbjct  2    ATEEGQVFSCHTVEAWEQQLQKGNDSKKLMVIDFTASWCGPCRFIAPFLAELAKKLPDVI  61

Query  265  FVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            FVK+DVDEL  VAQD+ VE+MPTF+ +K+GK+V+K++GA +++LQ  I KH
Sbjct  62   FVKVDVDELKTVAQDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQXTIAKH  112



>ref|XP_010113482.1| Thioredoxin H-type [Morus notabilis]
 gb|EXC35509.1| Thioredoxin H-type [Morus notabilis]
Length=119

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V++ H+   W        ++K+L+V+DFTA+WC PC+++ P + E A +  DV F+K+DV
Sbjct  8    VVSCHTLEAWNEQLQKGNESKKLVVVDFTASWCAPCRFITPFLVELAKRLPDVTFLKVDV  67

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VAQD+ VE+MPTF+ +K+G +V+K++GA RE+LQ+ I KH
Sbjct  68   DELKPVAQDWAVEAMPTFMFLKEGTIVDKVVGARREELQQTIAKH  112



>gb|KDP21244.1| hypothetical protein JCGZ_21715 [Jatropha curcas]
Length=127

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 82/115 (71%), Gaps = 1/115 (1%)
 Frame = +1

Query  79   GSTTKKPL-VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYS  255
            G T  +P  ++   S   W+ +F+A+K   +L+VI FTATWCGPC+ ++P + EFAA+Y 
Sbjct  12   GLTDTQPSGIVEIRSVDQWKAYFEATKGNNKLLVIQFTATWCGPCRLIDPAIKEFAAKYK  71

Query  256  DVEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKHR  420
            DV+F+KIDVD+L  VAQ F   ++P FVL+KKGK V+KI+G  + +LQ KI++ R
Sbjct  72   DVDFIKIDVDKLFLVAQQFEANTLPAFVLIKKGKEVDKIVGVKKIELQNKIEQLR  126



>ref|XP_010470203.1| PREDICTED: thioredoxin H7-like [Camelina sativa]
Length=128

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 74/110 (67%), Gaps = 0/110 (0%)
 Frame = +1

Query  88   TKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEF  267
            TK  + +   S   WR  FD+ K +  L+VIDFTA WCGPCK MEP V E A++YSDV F
Sbjct  17   TKNAMAVEIESRRQWRSLFDSMKGSNNLLVIDFTAAWCGPCKAMEPRVKEIASKYSDVVF  76

Query  268  VKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
             ++DVD+L DVA  +   ++P FV VK+G+ +++++GA   +L  KI+KH
Sbjct  77   ARVDVDKLMDVAATYKAITLPAFVFVKRGEEIDRVVGAKPVELVNKIEKH  126



>gb|AEC03321.1| thioredoxin H-type 6 [Hevea brasiliensis]
Length=117

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI+ H+   W    D  +++K+L+V+DFTA+WCGPC+ + PI+ E A +  +V F+K+DV
Sbjct  7    VISCHTVEAWTDQLDKGQESKKLIVVDFTASWCGPCRLINPILAELAKKMPNVIFLKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+D+ VE+MPTF+ +K+G +V+K++GA +E+L+  I KH
Sbjct  67   DELKSVAEDWAVEAMPTFMFLKEGTIVDKVVGAKKEELELTIAKH  111



>ref|XP_002463724.1| hypothetical protein SORBIDRAFT_01g004860 [Sorghum bicolor]
 gb|EER90722.1| hypothetical protein SORBIDRAFT_01g004860 [Sorghum bicolor]
Length=133

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+A HS   +   + A K   +LMVIDF+A+WCGPC+++EP   E A++++D  FVKIDV
Sbjct  22   VVAAHSKTTYDEQWAAHKNGGKLMVIDFSASWCGPCRFIEPAFKELASRFTDAIFVKIDV  81

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQ  411
            DEL +VA+ + VE+MPTFVLVK GK V ++IGA +++L++KIQ
Sbjct  82   DELAEVARTWKVEAMPTFVLVKDGKEVSRVIGAKKDELERKIQ  124



>ref|XP_007202766.1| hypothetical protein PRUPE_ppa013476mg [Prunus persica]
 gb|EMJ03965.1| hypothetical protein PRUPE_ppa013476mg [Prunus persica]
Length=120

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V++ H+   W         +K+LMVIDFTA+WCGPC+++ P + E A +  +V FVK+DV
Sbjct  8    VVSCHTLDAWNEQLQKGNDSKKLMVIDFTASWCGPCRFIAPFLAELAKKLPNVIFVKVDV  67

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VAQD+ VE+MPTF+ +K+GK+V+K++GA +++LQ+ I KH
Sbjct  68   DELKSVAQDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKH  112



>ref|XP_010511031.1| PREDICTED: thioredoxin H7-like [Camelina sativa]
Length=128

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 77/109 (71%), Gaps = 0/109 (0%)
 Frame = +1

Query  88   TKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEF  267
            TK  +++   S   WR  FD+ K + +L+VIDFTA WCGPCK MEP V E A++YSDV F
Sbjct  17   TKSAMIVEIESRRQWRSLFDSMKGSNKLLVIDFTAAWCGPCKAMEPRVKEIASKYSDVVF  76

Query  268  VKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQK  414
             ++DVD+L DVA+ +   ++P FVLVK+G+ +++++GA   +L  KI+K
Sbjct  77   ARVDVDKLMDVAETYKAITLPAFVLVKRGEEIDRVVGAKPVELVNKIEK  125



>sp|P68176.1|TRXH_BRAOL RecName: Full=Thioredoxin H-type; Short=Trx-H; AltName: Full=Pollen 
coat protein [Brassica oleracea]
 sp|P68177.1|TRXH1_BRANA RecName: Full=Thioredoxin H-type 1; Short=Trx-H-1 [Brassica napus]
 emb|CAA61908.1| pollen coat protein [Brassica oleracea]
 gb|AAB53694.1| thioredoxin-h-like-1 [Brassica napus]
 emb|CDY43592.1| BnaC09g17310D [Brassica napus]
Length=123

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA H+  +W     A+K++ +L+VIDFTA WC PC+++ PI  E A ++ DV F K+DV
Sbjct  13   VIACHTVEDWNNKLKAAKESNKLIVIDFTAVWCPPCRFIAPIFVELAKKHLDVVFFKVDV  72

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VAQ+F V++MPTFV +K  + ++K++GA +E+++ K+ KH
Sbjct  73   DELATVAQEFDVQAMPTFVYMKGEEKLDKVVGAAKEEIEAKLLKH  117



>ref|NP_001238579.1| uncharacterized protein LOC100499701 [Glycine max]
 gb|ACU13298.1| unknown [Glycine max]
 gb|KHN41934.1| Thioredoxin H-type [Glycine soja]
Length=120

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI+ H+   W        Q+K+L+V+DFTA+WCGPC+++ P + E A +++ V F+K+DV
Sbjct  10   VISCHTVDAWNDQLQKGNQSKKLIVVDFTASWCGPCRFIAPFLAELAKKFTSVVFLKVDV  69

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  V+QD+ +E+MPTFV VK+G ++ K++GA +++LQ+ I+K+
Sbjct  70   DELKSVSQDWAIEAMPTFVFVKEGTLLSKVVGAKKDELQQTIEKY  114



>gb|AAG35777.1|AF273844_1 thioredoxin-h-like protein 1 [Brassica oleracea var. alboglabra]
Length=116

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA H+  +W     A+K++ +L+VIDFTA WC PC+++ PI  E A ++ DV F K+DV
Sbjct  6    VIACHTVEDWNNKLKAAKESNKLIVIDFTAVWCPPCRFIAPIFVELAKKHLDVVFFKVDV  65

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VAQ+F V++MPTFV +K  + ++K++GA +E+++ K+ KH
Sbjct  66   DELATVAQEFDVQAMPTFVYMKGEEKLDKVVGAAKEEIEAKLLKH  110



>ref|XP_004500971.1| PREDICTED: thioredoxin H-type-like [Cicer arietinum]
Length=113

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  H+   W+       ++ +L+V+DFTA+WCGPC+++ PI+ E A +  +V F+K+DV
Sbjct  8    VIGVHTVDAWKDQIQKGNESGKLIVVDFTASWCGPCRFIAPILAEIAKKLPNVTFLKVDV  67

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+++GVE+MPTF+ +K+GK+V+K++GA +E+LQ  I KH
Sbjct  68   DELKTVAEEWGVEAMPTFLFLKEGKLVDKVVGAQKEKLQSTIAKH  112



>ref|XP_008337832.1| PREDICTED: thioredoxin H-type [Malus domestica]
 ref|XP_008363096.1| PREDICTED: thioredoxin H-type [Malus domestica]
Length=118

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +1

Query  85   TTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVE  264
             T++  V + H+   W      +  +K+LMV+DFTA+WCGPC+++ P + E A +  +V 
Sbjct  2    ATEEGQVFSCHTVEAWEQQLQKANDSKKLMVVDFTASWCGPCRFIAPFLAELAKKLPNVI  61

Query  265  FVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            FVK+DVDEL  VAQD+ VE+MPTF+ +K+GK+V+K++GA +++LQ+ I KH
Sbjct  62   FVKVDVDELKTVAQDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTISKH  112



>ref|XP_008221338.1| PREDICTED: thioredoxin H-type-like [Prunus mume]
Length=132

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  H++  W       K++K+L+V+DFTATWCGPC+ + PI+ E A +  +V F+K+DV
Sbjct  7    VIGCHTTQAWEDQLHKGKESKKLVVVDFTATWCGPCRMIAPILAELAKKTPEVTFLKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  V++++GVE+MPTF+ +K+GK+V+K++GA +++L  K+ KH
Sbjct  67   DELRTVSEEWGVEAMPTFLFLKEGKIVDKVVGAKKDELLNKVAKH  111



>ref|NP_001289650.1| thioredoxin H-type [Eucalyptus grandis]
 gb|ABB53600.1| thioredoxin h [Eucalyptus grandis]
Length=117

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI+ HS+ +W      S ++ +L+V+DFTA+WCGPC+++ P + E A ++ +V F+K+DV
Sbjct  7    VISCHSAESWSEQIAKSNESDKLVVVDFTASWCGPCRFIAPFLAELAKRFPNVLFLKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VAQ++ VE+MPTF+ VK GK+V++++GA ++QLQ  + KH
Sbjct  67   DELKTVAQEWAVEAMPTFMFVKGGKIVDRVVGAQKDQLQMTLAKH  111



>gb|KCW56688.1| hypothetical protein EUGRSUZ_I02383 [Eucalyptus grandis]
Length=117

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI+ HS+ +W      S ++ +L+V+DFTA+WCGPC+++ P + E A ++ +V F+K+DV
Sbjct  7    VISCHSAESWSEQIAKSNESDKLVVVDFTASWCGPCRFIAPFLAELAKKFPNVLFLKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VAQ++ VE+MPTF+ VK GK+V++++GA ++QLQ  + KH
Sbjct  67   DELKTVAQEWAVEAMPTFMFVKGGKIVDRVVGAQKDQLQMTLAKH  111



>ref|XP_004489163.1| PREDICTED: thioredoxin H2-like [Cicer arietinum]
Length=131

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +1

Query  154  KQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDVDELGDVAQDFGVESMPT  333
             +T +L+VIDF+A+WCGPCK MEPI+   A + +DV+FVKIDVDEL DVAQ F V++MPT
Sbjct  42   NETSRLVVIDFSASWCGPCKIMEPIIRAMANEITDVDFVKIDVDELSDVAQKFEVQAMPT  101

Query  334  FvlvkkgkvvekIIGADREQLQKKIQKH  417
            FVL K+ K +++++GA +++L+  IQKH
Sbjct  102  FVLWKERKEIDRLVGARKDELKTMIQKH  129



>ref|NP_001241730.1| thioredoxin H-type 5 [Zea mays]
 gb|ACG25593.1| thioredoxin H-type 5 [Zea mays]
 gb|ACR38780.1| unknown [Zea mays]
 tpg|DAA51980.1| TPA: Thioredoxin H-type 5 [Zea mays]
Length=133

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+A HS   +   + A K + +LMVIDF+A+WCGPC+++EP   E A++++D  FVK+DV
Sbjct  22   VVAAHSKATYDEQWAAHKSSSKLMVIDFSASWCGPCRFIEPAFKELASRFTDAIFVKVDV  81

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQ  411
            DEL +VA+ + VE+MPTFVLVK GK V ++IGA +++L++KI+
Sbjct  82   DELAEVARTWKVEAMPTFVLVKDGKEVGRVIGAKKDELERKIR  124



>ref|XP_011083608.1| PREDICTED: thioredoxin H-type-like [Sesamum indicum]
Length=119

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  H+   W+  F     +K+L+V+DFTA+WCGPC+++ PI+ E A +   V F+K+DV
Sbjct  8    VIGCHTVDEWKQLFQKGVDSKKLVVVDFTASWCGPCRFIAPILAEIAKRTPHVMFLKVDV  67

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VAQ++ VESMPTF+ +K+GKVV+KI+GA +E LQ+KI +H
Sbjct  68   DELKSVAQEYEVESMPTFLFLKEGKVVDKIVGARKEALQEKIAEH  112



>gb|AAM67018.1| thioredoxin [Arabidopsis thaliana]
Length=119

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQY-SDVEFVKID  279
            VI+ H++  W +  D +K++ +L+VIDFTA+WC PC+ + PI ++ A ++ S   F K+D
Sbjct  8    VISCHTNDVWTVQLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVD  67

Query  280  VDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            VDEL  VA++FGVE+MPTFV +K G+VV+K++GA++E LQ KI KH
Sbjct  68   VDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKH  113



>gb|ACU14225.1| unknown [Glycine max]
Length=120

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
              ++++  VI+ H+   W        ++K+L+V+DFTA+ CGPC+++ P + E A +++ 
Sbjct  2    AGSSEEGQVISCHTVEEWNDQLQKGNESKKLIVVDFTASGCGPCRFIAPFLAELAKKFTS  61

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            V F+K+DVDEL  V+QD+ +E+MPTFV VK+G +++K++GA +++LQ+KIQKH
Sbjct  62   VIFLKVDVDELKSVSQDWAIEAMPTFVFVKEGTLLDKVVGAKKDELQQKIQKH  114



>ref|XP_004287851.1| PREDICTED: thioredoxin H-type-like [Fragaria vesca subsp. vesca]
Length=118

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+  H+   W         TK+LMV+DFTA+WCGPC+ + P + E A +  +V FVKIDV
Sbjct  8    VVGVHTVDAWTELLQKGNDTKKLMVVDFTASWCGPCRIIAPFLSELAKKLPNVIFVKIDV  67

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+D+ VE+MPTF+ +K+GK+V+K++GA +E+LQ+ + KH
Sbjct  68   DELKSVAEDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTVAKH  112



>ref|XP_009398388.1| PREDICTED: thioredoxin H1-like [Musa acuminata subsp. malaccensis]
Length=114

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  HS   W+ H   + ++K+L+VIDFTA+WCGPC+ + PI  + A +Y +V F+K+DV
Sbjct  7    VIGCHSVDEWKQHLLQANESKKLVVIDFTASWCGPCRAIAPIFADLAKRYPNVIFLKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+D+ +E+MPTF+ +K+G +V+KI+GA +++L ++I+ H
Sbjct  67   DELKPVAEDWAIEAMPTFIFLKEGTIVDKIVGAHKDELPRRIELH  111



>ref|NP_001148952.1| LOC100282572 [Zea mays]
 gb|ACG31558.1| thioredoxin H-type 5 [Zea mays]
 gb|ACG31997.1| thioredoxin H-type 5 [Zea mays]
 gb|ACG33627.1| thioredoxin H-type 5 [Zea mays]
Length=134

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V+A HS   +   + A K + +LMVIDF+A+WCGPC+++EP   E A++++D  F+K+DV
Sbjct  23   VVAAHSKATYDEQWAAHKSSSKLMVIDFSASWCGPCRFIEPAFKELASRFTDAIFIKVDV  82

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQ  411
            DEL +VA+ + VE+MPTFVLVK GK V ++IGA +++L++KI+
Sbjct  83   DELAEVARTWKVEAMPTFVLVKDGKEVGRVIGAKKDELERKIR  125



>ref|XP_006281332.1| hypothetical protein CARUB_v10027387mg [Capsella rubella]
 gb|EOA14230.1| hypothetical protein CARUB_v10027387mg [Capsella rubella]
Length=119

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA H+   W      +  +K+L+VIDFTATWC PC+++ PI  E A ++ DV F K+DV
Sbjct  7    VIACHNVEEWNEKLKTASDSKKLIVIDFTATWCPPCRFIAPIFAELAKKHLDVVFFKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+DF V++MPTF+ +K+G VV+ ++GA +E++  K++KH
Sbjct  67   DELNSVAKDFDVQAMPTFIFMKEGVVVDTVVGAAKEEIVSKLEKH  111



>ref|XP_008241764.1| PREDICTED: thioredoxin H-type [Prunus mume]
Length=120

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V + H+   W         +K+LMVIDFTA+WCGPC+++ P + E A +  +V FVK+DV
Sbjct  8    VFSCHTLDAWNEQLQKGNDSKKLMVIDFTASWCGPCRFIAPFLAELAKKLPNVIFVKVDV  67

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VAQD+ VE+MPTF+ +K+GK+V+K++GA +++LQ+ I KH
Sbjct  68   DELKSVAQDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKH  112



>ref|XP_002865467.1| thioredoxin H-type 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41726.1| thioredoxin H-type 3 [Arabidopsis lyrata subsp. lyrata]
Length=117

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA H+   W     A+ ++K+L+VIDFTATWC PC+++ PI  E A ++ DV F K+DV
Sbjct  7    VIACHTVEEWTEKLKAANESKKLIVIDFTATWCPPCRFIAPIFPELAKKHLDVVFFKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA++F V++MPT + +K+G+V + ++GAD+ ++  K+QKH
Sbjct  67   DELNAVAKEFDVQAMPTIIFMKEGEVKDTVVGADKNEILTKLQKH  111



>gb|AEC03320.1| thioredoxin H-type 5 [Hevea brasiliensis]
Length=117

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI+ H+   W    D  + +K+L+V+DFTA+WCGPC+ + PI+ E A +  +V F+K+DV
Sbjct  7    VISCHTVEAWTDQLDKGQGSKKLIVVDFTASWCGPCRLINPILAELAKKMPNVIFLKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+D+ VE+MPTF+ +K+GK+V+K++GA +E+L+  I KH
Sbjct  67   DELKSVAEDWAVEAMPTFMFLKEGKIVDKVVGAKKEELELTIAKH  111



>gb|KHF97866.1| Thioredoxin H-type [Gossypium arboreum]
Length=120

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI+ H+  +W+       Q+K+L+V+DFTA+WCGPC+++ P + E A ++ +V F+K+DV
Sbjct  8    VISCHTLDSWKEQLQKGGQSKKLVVVDFTASWCGPCRFISPFLAELAKKFPNVMFLKVDV  67

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL +VA ++ V++MPTF+ +K+GK VEK++GA +E+LQ+ + KH
Sbjct  68   DELKEVAAEWDVDAMPTFLFLKEGKAVEKVVGAKKEELQQAVTKH  112



>ref|NP_173403.1| thioredoxin H4 [Arabidopsis thaliana]
 sp|Q39239.2|TRXH4_ARATH RecName: Full=Thioredoxin H4; Short=AtTrxh4; AltName: Full=Thioredoxin 
4; Short=AtTRX4 [Arabidopsis thaliana]
 gb|AAG12565.1|AC007797_25 Unknown protein [Arabidopsis thaliana]
 dbj|BAC43145.1| putative thioredoxin [Arabidopsis thaliana]
 gb|AAO42956.1| At1g19730 [Arabidopsis thaliana]
 gb|AEE29892.1| thioredoxin H4 [Arabidopsis thaliana]
Length=119

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQY-SDVEFVKID  279
            VI  H++  W +  D +K++ +L+VIDFTA+WC PC+ + PI ++ A ++ S   F K+D
Sbjct  8    VIGCHTNDVWTVQLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVD  67

Query  280  VDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            VDEL  VA++FGVE+MPTFV +K G+VV+K++GA++E LQ KI KH
Sbjct  68   VDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKH  113



>gb|AEI69284.1| thioredoxin h 1-2 [Galega orientalis]
Length=117

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  HS   W+ H      +K L+V+DFTA+WCGPC+++ PI+ E A    +V F+K+DV
Sbjct  8    VIGVHSVDAWKEHMLKGNDSKNLIVVDFTASWCGPCRFIAPILAEIAKTLPNVTFLKVDV  67

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+++ +E+MPTF+ +K+GK+V+K++GA +E LQ  I KH
Sbjct  68   DELKTVAEEWAIEAMPTFLFLKEGKLVDKVVGAQKETLQLAISKH  112



>emb|CAA84610.1| thioredoxin [Arabidopsis thaliana]
Length=125

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQY-SDVEFVKID  279
            VI  H++  W +  D +K++ +L+VIDFTA+WC PC+ + PI ++ A ++ S   F K+D
Sbjct  8    VIGCHTNDVWTVQLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVD  67

Query  280  VDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            VDEL  VA++FGVE+MPTFV +K G+VV+K++GA++E LQ KI KH
Sbjct  68   VDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKH  113



>ref|NP_001288844.1| thioredoxin H-type [Brassica rapa]
 sp|O64432.1|TRXH_BRACM RecName: Full=Thioredoxin H-type; Short=Trx-H [Brassica rapa]
 dbj|BAA25681.1| Thioredoxin [Brassica rapa]
 emb|CDY32970.1| BnaA09g16230D [Brassica napus]
Length=123

 Score =   102 bits (255),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA H+  +W     A+K++ +L+VIDFTA WC PC+++ PI  E A ++ DV F K+DV
Sbjct  13   VIACHTVEDWNNKLKAAKESNKLIVIDFTAVWCPPCRFIAPIFVELAKKHLDVVFFKVDV  72

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA++F V++MPTFV +K  + ++K++GA +E+++ K+ KH
Sbjct  73   DELATVAKEFDVQAMPTFVYMKGEEKLDKVVGAAKEEIEAKLLKH  117



>ref|XP_009761049.1| PREDICTED: thioredoxin H-type 1 [Nicotiana sylvestris]
Length=123

 Score =   102 bits (255),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
             +++++  V   H    W  HF    +TK+L+V+DFTA+WCGPC+++ PI+ E A +   
Sbjct  3    AASSEEGQVFGCHKIEEWNEHFQKGVETKKLVVVDFTASWCGPCRFIAPILAEIAKKMPH  62

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            V F+K+DVDEL  VA+++ VE+MPTFV +K GK V++++GA +E+LQ+ I KH
Sbjct  63   VIFLKVDVDELKTVAEEWSVEAMPTFVFLKDGKEVDRVVGAKKEELQQTIVKH  115



>ref|XP_009599959.1| PREDICTED: thioredoxin H-type 2-like [Nicotiana tomentosiformis]
Length=117

 Score =   102 bits (255),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  H+   W        +TK+L+V+DFTA+WCGPC+++ P + E A +  +V F+K+DV
Sbjct  7    VIGCHTVDAWNEQLQKGIETKKLIVVDFTASWCGPCRFIAPFLSELANKLPNVTFLKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA D+ VE+MPTF+ +K+G +V+K++GA +E+LQ+ I KH
Sbjct  67   DELKSVATDWAVEAMPTFMFLKEGDIVDKVVGAKKEELQQAIAKH  111



>ref|XP_002274205.1| PREDICTED: thioredoxin H-type 2 [Vitis vinifera]
 gb|AGG09339.1| thioredoxin h1 [Vitis vinifera]
Length=115

 Score =   102 bits (254),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  HS   W  H     ++ +L+V+DFTA+WCGPC+++ P + E A +   V F+K+DV
Sbjct  7    VIGVHSVEAWNDHLQKCNESNKLIVVDFTASWCGPCRFITPFLVELAKKIPTVTFLKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA D+ VE+MPTF+ +K+GK+V+K++GA+++ LQ+ I KH
Sbjct  67   DELKSVATDWAVEAMPTFMFLKQGKIVDKVVGANKDSLQQTIAKH  111



>gb|AEC03316.1| thioredoxin H-type 2 [Hevea brasiliensis]
Length=118

 Score =   102 bits (255),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  H+   W  +   + Q+K+L+V+DFTA+WCGPC+++ P + E A +  +V F+K+DV
Sbjct  8    VIGCHTVELWNENLQKANQSKKLVVVDFTASWCGPCRFISPFLVELAKKLPNVIFLKVDV  67

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VAQD+ VE+MPTF+ +++G +++K++GA++++L + I KH
Sbjct  68   DELKTVAQDWAVEAMPTFIFLREGTILDKVVGANKDKLHETIAKH  112



>ref|XP_010442091.1| PREDICTED: thioredoxin H3-like [Camelina sativa]
Length=117

 Score =   102 bits (254),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA H+   W      + ++K+L+VIDFTATWC PC+++ PI  E A ++ +V F K+DV
Sbjct  7    VIACHNVEEWNEKLKTASESKKLIVIDFTATWCPPCRFIAPIFAELAKKHLNVVFFKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+DF V++MPTF+ +K+G V++ ++GA +E++  K++KH
Sbjct  67   DELNTVAKDFDVQAMPTFIFMKEGVVLDTVVGAAKEEILAKLEKH  111



>ref|XP_010540349.1| PREDICTED: thioredoxin H5-like [Tarenaya hassleriana]
Length=118

 Score =   102 bits (254),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA HS   W   F  + ++K+L+VIDFTA+WC PC+++ P+  E A ++ +V F KIDV
Sbjct  7    VIACHSVEAWTEKFKEANESKKLVVIDFTASWCPPCRFIAPVFAELAKRFLNVVFFKIDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA++F VE+MPTFV +K+G  VE+++GAD+ ++++ + KH
Sbjct  67   DELQSVAKEFDVEAMPTFVFLKEGTEVERVVGADKVKIEQTLNKH  111



>gb|ACG31323.1| thioredoxin H-type [Zea mays]
Length=128

 Score =   102 bits (255),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA HS   W I  + +   K+L+VIDFTATWC PC+ M PI  + A +  +V F+K+DV
Sbjct  21   VIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMSPIFADMAKKSPNVVFLKVDV  80

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DE+  +A+ F VE+MPTF+ +++G V ++++GA +E+L +K++ H
Sbjct  81   DEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEELARKLELH  125



>ref|XP_010481919.1| PREDICTED: thioredoxin H3 [Camelina sativa]
Length=117

 Score =   102 bits (254),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA H+   W      + ++K+L+VIDFTATWC PC+++ PI  E A ++ +V F K+DV
Sbjct  7    VIACHNVEEWNEKLKTASESKKLIVIDFTATWCPPCRFIAPIFAELAKKHLNVVFFKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+DF V++MPTF+ +K+G VV+ ++GA +E++  K++KH
Sbjct  67   DELNTVAKDFDVQAMPTFIFMKEGVVVDTVVGAAKEEILAKLEKH  111



>gb|ACG24448.1| thioredoxin H-type [Zea mays]
 gb|ACG24731.1| thioredoxin H-type [Zea mays]
 gb|ACG32454.1| thioredoxin H-type [Zea mays]
 gb|AFW78615.1| thioredoxin h-like protein [Zea mays]
Length=128

 Score =   102 bits (255),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA HS   W I  + +   K+L+VIDFTATWC PC+ M PI  + A +  +V F+K+DV
Sbjct  21   VIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMAPIFADMAKKSPNVVFLKVDV  80

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DE+  +A+ F VE+MPTF+ +++G V ++++GA +E+L +K++ H
Sbjct  81   DEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEELARKLELH  125



>ref|XP_010494264.1| PREDICTED: thioredoxin H3 [Camelina sativa]
Length=117

 Score =   102 bits (254),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA H+   W      + ++K+L+VIDFTATWC PC+++ PI  E A ++ +V F K+DV
Sbjct  7    VIACHNVEEWTEKLKTASESKKLIVIDFTATWCPPCRFIAPIFAELAKKHLNVVFFKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VA+DF V++MPTF+ +K+G VV+ ++GA +E++  K++KH
Sbjct  67   DELNTVAKDFDVQAMPTFIFMKEGVVVDTVVGAAKEEILAKLEKH  111



>ref|XP_002967955.1| hypothetical protein SELMODRAFT_88131 [Selaginella moellendorffii]
 gb|EFJ31302.1| hypothetical protein SELMODRAFT_88131 [Selaginella moellendorffii]
Length=117

 Score =   102 bits (254),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V A  S   W+  F  +++ K+L+V+DFTATWCGPCK + PI  E++  ++D  FVK+DV
Sbjct  6    VCAITSVELWQAKFKEAEEGKKLLVVDFTATWCGPCKAIAPIFLEYSKTFTDAIFVKVDV  65

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            D++  +  ++ VE+MPTF+L+K+GKVVEKI+GAD++QL+KK+Q H
Sbjct  66   DQMPAITTEWKVEAMPTFLLIKEGKVVEKIVGADKDQLKKKLQLH  110



>ref|NP_001105788.1| thioredoxin h1 protein [Zea mays]
 emb|CAI64400.1| thioredoxin h1 protein [Zea mays]
Length=128

 Score =   102 bits (254),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA HS   W I  + +   K+L+VIDFTATWC PC+ M PI  + A +  +V F+K+DV
Sbjct  21   VIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMAPIFADMAKKSPNVVFLKVDV  80

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DE+  +A+ F VE+MPTF+ +++G V ++++GA +E+L +K++ H
Sbjct  81   DEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEELARKLELH  125



>gb|ACG24509.1| thioredoxin H-type [Zea mays]
 gb|ACG25250.1| thioredoxin H-type [Zea mays]
 gb|ACG25603.1| thioredoxin H-type [Zea mays]
Length=129

 Score =   102 bits (254),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VIA HS   W I  + +   K+L+VIDFTATWC PC+ M PI  + A +  +V F+K+DV
Sbjct  22   VIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMAPIFADMAKKSPNVVFLKVDV  81

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DE+  +A+ F VE+MPTF+ +++G V ++++GA +E+L +K++ H
Sbjct  82   DEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEELARKLELH  126



>ref|XP_003550402.1| PREDICTED: thioredoxin H-type [Glycine max]
 gb|KHN12674.1| Thioredoxin H-type [Glycine soja]
Length=123

 Score =   102 bits (254),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  H+   W++    +K +K+L+V+DFTA+WCGPC++M P++ E A +  ++ F+K+DV
Sbjct  9    VIGVHTVDEWKLQLQNAKDSKKLIVVDFTASWCGPCRFMAPVLAEIAKKTPELIFLKVDV  68

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DE+  VA+++ +E+MPTF+ +K G++V+K++GA ++ LQ  I KH
Sbjct  69   DEVRPVAEEYSIEAMPTFLFLKDGEIVDKVVGASKDDLQATIAKH  113



>ref|XP_007223789.1| hypothetical protein PRUPE_ppa013161mg [Prunus persica]
 gb|AAL26915.1|AF323593_1 thioredoxin H [Prunus persica]
 gb|EMJ24988.1| hypothetical protein PRUPE_ppa013161mg [Prunus persica]
Length=136

 Score =   102 bits (255),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI  H++  W        + K+L+V+DFTA+WCGPC+ + PI+ E A +  +V F+K+DV
Sbjct  7    VIGCHTTQAWEEQLHKGNENKKLVVVDFTASWCGPCRLIAPILAELAKKTPEVTFLKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  V++++GVE+MPTF+ +K+GK+V+K++GA +++LQ K+ KH
Sbjct  67   DELRTVSEEWGVEAMPTFLFLKEGKIVDKVVGAKKDELQIKVAKH  111



>emb|CDP01953.1| unnamed protein product [Coffea canephora]
Length=121

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            VI+ H+   W         +K+L+V+DFTA+WCGPC+++ P + E A +   V F+K+DV
Sbjct  7    VISCHTVEAWTEQLQKGNDSKKLIVVDFTASWCGPCRFIAPFLAELAKKLPTVTFIKVDV  66

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            DEL  VAQD+ VE+MPTF+ +K+GK+V+K++GA+++ LQ+ I KH
Sbjct  67   DELKSVAQDWAVEAMPTFMFLKEGKIVDKVVGANKDLLQQSIAKH  111



>gb|AES95049.2| thioredoxin [Medicago truncatula]
Length=120

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +1

Query  79   GSTTKKPLVIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSD  258
              ++++  VI  H+   W        ++K+L+V+DFTA+WCGPC+++ P + E A +Y++
Sbjct  2    AGSSEEGQVIGVHNVDAWNDILHRGNESKKLIVVDFTASWCGPCRFIAPFLAELAKKYTN  61

Query  259  VEFVKIDVDELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
              F+K+DVDEL  VAQD+ +E+MPTFV VK+G ++ K++GA +++L + I+KH
Sbjct  62   AIFLKVDVDELKSVAQDWAIEAMPTFVFVKEGTILGKVVGAKKDELTQTIEKH  114



>ref|XP_002963964.1| hypothetical protein SELMODRAFT_166463 [Selaginella moellendorffii]
 gb|EFJ34297.1| hypothetical protein SELMODRAFT_166463 [Selaginella moellendorffii]
Length=117

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  VIAFHSSMNWRIHFDASKQTKQLMVIDFTATWCGPCKYMEPIVHEFAAQYSDVEFVKIDV  282
            V A  S   W+  F  +++ K+L+V+DFTATWCGPCK + PI  E++  ++D  FVK+DV
Sbjct  6    VCAITSVELWQAKFKEAEEGKKLLVVDFTATWCGPCKAIAPIFLEYSKTFTDAIFVKVDV  65

Query  283  DELGDVAQDFGVESMPTFvlvkkgkvvekIIGADREQLQKKIQKH  417
            D++  +  ++ VE+MPTF+L+K+GKVV+KI+GAD++QL+KK+Q H
Sbjct  66   DQMPAITTEWKVEAMPTFLLIKEGKVVDKIVGADKDQLKKKLQLH  110



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893394614630