BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27766_g1_i1 len=1018 path=[1:0-1017]

Length=1018
                                                                      Score     E

ref|XP_009377058.1|  PREDICTED: glycine cleavage system H protein...    274   3e-88   
ref|XP_009378975.1|  PREDICTED: glycine cleavage system H protein...    273   7e-88   
ref|XP_008341065.1|  PREDICTED: glycine cleavage system H protein...    272   2e-87   
ref|XP_011071934.1|  PREDICTED: glycine cleavage system H protein...    272   2e-87   
ref|XP_002280707.1|  PREDICTED: glycine cleavage system H protein...    271   2e-87   Vitis vinifera
ref|XP_002519845.1|  glycine cleavage system h protein, putative        271   3e-87   Ricinus communis
ref|XP_008374430.1|  PREDICTED: glycine cleavage system H protein...    271   5e-87   
ref|XP_009373439.1|  PREDICTED: glycine cleavage system H protein...    271   5e-87   
ref|XP_008346738.1|  PREDICTED: glycine cleavage system H protein...    271   6e-87   
ref|XP_009762877.1|  PREDICTED: glycine cleavage system H protein...    270   8e-87   
emb|CAN76620.1|  hypothetical protein VITISV_038357                     270   1e-86   Vitis vinifera
ref|XP_010053589.1|  PREDICTED: glycine cleavage system H protein...    270   2e-86   
ref|XP_008238294.1|  PREDICTED: glycine cleavage system H protein...    269   3e-86   
ref|XP_007209716.1|  hypothetical protein PRUPE_ppa012546mg             268   4e-86   
ref|XP_007039553.1|  Single hybrid motif superfamily protein            268   4e-86   
sp|P49359.1|GCSH_FLAPR  RecName: Full=Glycine cleavage system H p...    268   5e-86   Flaveria pringlei
gb|KDP39513.1|  hypothetical protein JCGZ_05079                         268   6e-86   
emb|CAB16710.1|  H protein                                              268   6e-86   Flaveria anomala
ref|XP_009624149.1|  PREDICTED: glycine cleavage system H protein...    268   9e-86   
gb|KHG14887.1|  Glycine cleavage system H, mitochondrial                268   1e-85   
sp|Q39732.1|GCSH_FLAAN  RecName: Full=Glycine cleavage system H p...    267   1e-85   Flaveria anomala
emb|CAA81073.1|  H-protein                                              267   1e-85   Flaveria cronquistii
ref|XP_006436757.1|  hypothetical protein CICLE_v10032942mg             267   2e-85   
emb|CAB16914.1|  H-Protein precursor                                    266   3e-85   Flaveria pringlei
ref|XP_010275285.1|  PREDICTED: glycine cleavage system H protein...    266   3e-85   
emb|CAA88734.1|  H-protein precursor of glycine cleavage system         266   3e-85   Flaveria trinervia
gb|KHG09409.1|  Glycine cleavage system H, mitochondrial                265   7e-85   
ref|XP_004300260.1|  PREDICTED: glycine cleavage system H protein...    265   1e-84   
gb|AFK42846.1|  unknown                                                 265   1e-84   
gb|KCW77924.1|  hypothetical protein EUGRSUZ_D02179                     265   2e-84   
ref|XP_004244544.1|  PREDICTED: glycine cleavage system H protein...    264   2e-84   
ref|XP_007156655.1|  hypothetical protein PHAVU_002G006000g             264   3e-84   
ref|XP_010269973.1|  PREDICTED: glycine cleavage system H protein...    264   3e-84   
ref|XP_009803354.1|  PREDICTED: glycine cleavage system H protein...    263   4e-84   
emb|CAA85759.1|  H-protein                                              263   4e-84   Flaveria pringlei
gb|KHN42617.1|  Glycine cleavage system H protein, mitochondrial        263   5e-84   
ref|XP_010104352.1|  Glycine cleavage system H protein                  263   6e-84   
gb|ABO61731.1|  mitochondrial glycine decarboxylase complex H-pro...    262   9e-84   Populus tremuloides
ref|NP_001238231.1|  uncharacterized protein LOC100306654               264   1e-83   
ref|XP_006362496.1|  PREDICTED: glycine cleavage system H protein...    262   1e-83   
ref|XP_009615541.1|  PREDICTED: glycine cleavage system H protein...    262   1e-83   
gb|EYU22153.1|  hypothetical protein MIMGU_mgv1a015161mg                262   1e-83   
ref|XP_006361175.1|  PREDICTED: glycine cleavage system H protein...    261   2e-83   
ref|XP_004148493.1|  PREDICTED: glycine cleavage system H protein...    261   2e-83   
sp|P46485.1|GCSH_FLATR  RecName: Full=Glycine cleavage system H p...    261   3e-83   Flaveria trinervia
ref|XP_004241973.1|  PREDICTED: glycine cleavage system H protein...    261   3e-83   
ref|XP_003539169.1|  PREDICTED: glycine cleavage system H protein...    261   4e-83   
ref|XP_008465945.1|  PREDICTED: glycine cleavage system H protein...    261   4e-83   
ref|XP_011028218.1|  PREDICTED: glycine cleavage system H protein...    259   2e-82   
ref|XP_006385625.1|  glycine cleavage system protein H precursor        259   2e-82   
ref|XP_011018608.1|  PREDICTED: glycine cleavage system H protein...    259   3e-82   
emb|CDP12988.1|  unnamed protein product                                258   4e-82   
gb|ACJ85876.1|  unknown                                                 258   7e-82   Medicago truncatula
gb|ABK96453.1|  unknown                                                 257   1e-81   Populus trichocarpa x Populus deltoides
ref|XP_008799361.1|  PREDICTED: glycine cleavage system H protein...    257   1e-81   
ref|XP_006368429.1|  glycine cleavage system protein H precursor        257   1e-81   
ref|XP_009114880.1|  PREDICTED: glycine cleavage system H protein...    256   2e-81   
gb|AAQ67414.2|  mitochondrial glycine decarboxylase complex H-pro...    256   4e-81   Populus tremuloides
ref|XP_009395148.1|  PREDICTED: glycine cleavage system H protein...    253   6e-80   
ref|XP_010531734.1|  PREDICTED: glycine cleavage system H protein...    252   9e-80   
ref|XP_010461070.1|  PREDICTED: glycine cleavage system H protein...    252   1e-79   
ref|XP_010941216.1|  PREDICTED: glycine cleavage system H protein...    254   1e-79   
ref|XP_010538375.1|  PREDICTED: glycine cleavage system H protein...    252   1e-79   
ref|XP_010478667.1|  PREDICTED: glycine cleavage system H protein...    251   3e-79   
ref|XP_009387258.1|  PREDICTED: glycine cleavage system H protein...    251   3e-79   
emb|CAA85757.1|  H-protein                                              250   5e-79   Flaveria chlorifolia
ref|XP_006847689.1|  hypothetical protein AMTR_s00149p00054540          250   7e-79   
sp|P49360.1|GCSH_FLAPU  RecName: Full=Glycine cleavage system H p...    249   7e-79   Flaveria pubescens
emb|CAA85756.1|  H-protein                                              249   1e-78   Flaveria cronquistii
emb|CAA85755.1|  H-protein                                              249   1e-78   Flaveria cronquistii
ref|XP_003611464.1|  Glycine cleavage system H protein                  249   2e-78   
ref|NP_001065060.1|  Os10g0516100                                       246   2e-77   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010677275.1|  PREDICTED: glycine cleavage system H protein...    246   2e-77   
ref|NP_174525.1|  probable glycine cleavage system H protein 2          246   4e-77   Arabidopsis thaliana [mouse-ear cress]
emb|CDY32279.1|  BnaC05g28570D                                          245   5e-77   
sp|P16048.1|GCSH_PEA  RecName: Full=Glycine cleavage system H pro...    245   8e-77   Pisum sativum [garden pea]
ref|XP_003574175.1|  PREDICTED: glycine cleavage system H protein...    244   1e-76   
ref|XP_010505041.1|  PREDICTED: glycine cleavage system H protein...    244   1e-76   
ref|XP_004511777.1|  PREDICTED: glycine cleavage system H protein...    244   1e-76   
emb|CDY65367.1|  BnaA05g34950D                                          244   1e-76   
ref|XP_006415191.1|  hypothetical protein EUTSA_v10008944mg             244   2e-76   
ref|XP_009107967.1|  PREDICTED: glycine cleavage system H protein...    244   2e-76   
emb|CAJ13723.1|  H-protein of the glycine decarboxylase multi-enz...    243   3e-76   Pisum sativum var. pumilio [Syrian fodder pea]
emb|CDX84215.1|  BnaC04g09770D                                          243   4e-76   
gb|KFK44990.1|  hypothetical protein AALP_AA1G329700                    243   4e-76   
ref|XP_006661956.1|  PREDICTED: glycine cleavage system H protein...    243   5e-76   
emb|CAA85767.1|  H-protein                                              242   7e-76   Flaveria palmeri
ref|XP_009143678.1|  PREDICTED: glycine cleavage system H protein...    242   8e-76   
emb|CDY26897.1|  BnaA05g18150D                                          242   9e-76   
ref|XP_010499795.1|  PREDICTED: glycine cleavage system H protein...    241   2e-75   
emb|CDY01272.1|  BnaC05g24600D                                          241   2e-75   
ref|XP_002893726.1|  hypothetical protein ARALYDRAFT_890824             241   3e-75   
gb|EPS59179.1|  hypothetical protein M569_15633                         241   3e-75   
dbj|BAJ95506.1|  predicted protein                                      241   3e-75   
ref|XP_008788682.1|  PREDICTED: glycine cleavage system H protein...    241   3e-75   
emb|CDX84067.1|  BnaC08g07440D                                          241   4e-75   
ref|XP_009151432.1|  PREDICTED: glycine cleavage system H protein...    240   5e-75   
ref|NP_181080.1|  glycine decarboxylase complex protein H               240   5e-75   Arabidopsis thaliana [mouse-ear cress]
gb|EMT30735.1|  Glycine cleavage system H protein, mitochondrial        240   5e-75   
gb|EMS55121.1|  Glycine cleavage system H protein, mitochondrial        240   6e-75   
ref|XP_006304263.1|  hypothetical protein CARUB_v10010494mg             239   1e-74   
sp|P93255.1|GCSH_MESCR  RecName: Full=Glycine cleavage system H p...    239   2e-74   Mesembryanthemum crystallinum
ref|XP_010934999.1|  PREDICTED: glycine cleavage system H protein...    239   2e-74   
gb|KFK36433.1|  hypothetical protein AALP_AA4G123600                    236   2e-73   
emb|CAA94317.1|  H protein                                              232   5e-72   Flaveria brownii
ref|XP_006410695.1|  hypothetical protein EUTSA_v10017333mg             232   6e-72   
emb|CAA94316.1|  H protein                                              230   2e-71   
ref|XP_003611465.1|  Glycine cleavage system H protein                  229   7e-71   
ref|XP_008662562.1|  PREDICTED: glycine cleavage system H protein...    228   2e-70   
ref|XP_002879548.1|  predicted protein                                  227   6e-70   
ref|XP_002441938.1|  hypothetical protein SORBIDRAFT_08g005210          227   6e-70   Sorghum bicolor [broomcorn]
ref|XP_004977191.1|  PREDICTED: glycine cleavage system H protein...    226   2e-69   
emb|CAA85754.1|  H-protein                                              225   2e-69   Flaveria bidentis
ref|XP_009377059.1|  PREDICTED: glycine cleavage system H protein...    221   5e-68   
gb|AAM92707.1|  putative glycine decarboxylase subunit                  220   1e-66   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004300261.1|  PREDICTED: glycine cleavage system H protein...    218   1e-66   
ref|XP_002278252.1|  PREDICTED: glycine cleavage system H protein...    216   8e-66   Vitis vinifera
ref|NP_001141253.1|  hypothetical protein                               214   6e-65   Zea mays [maize]
ref|XP_003570126.1|  PREDICTED: glycine cleavage system H protein...    214   7e-65   
ref|XP_009761418.1|  PREDICTED: glycine cleavage system H protein...    213   1e-64   
gb|AFK36203.1|  unknown                                                 213   1e-64   
ref|XP_003607890.1|  Glycine cleavage system H protein                  213   2e-64   
ref|XP_009383690.1|  PREDICTED: glycine cleavage system H protein...    213   2e-64   
ref|XP_004951769.1|  PREDICTED: glycine cleavage system H protein...    212   3e-64   
gb|ACR38569.1|  unknown                                                 212   4e-64   Zea mays [maize]
ref|XP_002451618.1|  hypothetical protein SORBIDRAFT_04g004720          212   4e-64   Sorghum bicolor [broomcorn]
ref|NP_001152670.1|  glycine cleavage system H protein 1                212   5e-64   Zea mays [maize]
ref|XP_006853480.1|  hypothetical protein AMTR_s00032p00204040          212   5e-64   
ref|XP_006468487.1|  PREDICTED: glycine cleavage system H protein...    211   5e-64   
ref|XP_004505304.1|  PREDICTED: glycine cleavage system H protein...    211   5e-64   
gb|KHG00043.1|  Glycine cleavage system H, mitochondrial                211   1e-63   
pdb|1HPC|A  Chain A, Refined Structures At 2 Angstroms And 2.2 An...    209   1e-63   
ref|XP_003556280.1|  PREDICTED: glycine cleavage system H protein...    210   1e-63   
ref|XP_011096810.1|  PREDICTED: glycine cleavage system H protein...    210   2e-63   
ref|XP_010927080.1|  PREDICTED: glycine cleavage system H protein...    210   2e-63   
emb|CDY71483.1|  BnaAnng37640D                                          209   2e-63   
ref|XP_008798232.1|  PREDICTED: glycine cleavage system H protein...    210   2e-63   
ref|XP_006448700.1|  hypothetical protein CICLE_v10017047mg             209   3e-63   
ref|XP_010276207.1|  PREDICTED: glycine cleavage system H protein...    209   4e-63   
ref|XP_009402544.1|  PREDICTED: glycine cleavage system H protein...    209   5e-63   
dbj|BAJ93279.1|  predicted protein                                      209   8e-63   
ref|XP_007145369.1|  hypothetical protein PHAVU_007G233300g             209   8e-63   
ref|XP_009773216.1|  PREDICTED: glycine cleavage system H protein...    208   1e-62   
prf||1923203A  H protein                                                207   1e-62
gb|KDP22912.1|  hypothetical protein JCGZ_01773                         208   1e-62   
ref|XP_010058021.1|  PREDICTED: glycine cleavage system H protein...    208   1e-62   
emb|CCC55419.1|  mitochondrial glycine decarboxylase complex H-pr...    208   2e-62   
ref|XP_009593092.1|  PREDICTED: glycine cleavage system H protein...    207   2e-62   
ref|XP_010941651.1|  PREDICTED: glycine cleavage system H protein...    207   2e-62   
ref|XP_009393274.1|  PREDICTED: glycine cleavage system H protein...    206   5e-62   
ref|XP_010052529.1|  PREDICTED: glycine cleavage system H protein...    206   5e-62   
ref|XP_007212189.1|  hypothetical protein PRUPE_ppa012788mg             206   5e-62   
ref|XP_008459025.1|  PREDICTED: glycine cleavage system H protein...    205   1e-61   
gb|ABK21574.1|  unknown                                                 206   1e-61   Picea sitchensis
emb|CDP11250.1|  unnamed protein product                                205   2e-61   
ref|XP_006296123.1|  hypothetical protein CARUB_v10025275mg             204   2e-61   
ref|XP_010509659.1|  PREDICTED: glycine cleavage system H protein...    205   2e-61   
gb|EMS48693.1|  Glycine cleavage system H protein, mitochondrial        205   2e-61   
ref|XP_006656352.1|  PREDICTED: glycine cleavage system H protein...    205   2e-61   
gb|EPS63218.1|  hypothetical protein M569_11570                         204   3e-61   
ref|XP_006436758.1|  hypothetical protein CICLE_v10032942mg             203   4e-61   
ref|XP_009353965.1|  PREDICTED: glycine cleavage system H protein...    204   4e-61   
gb|KHN08050.1|  Glycine cleavage system H protein, mitochondrial        204   6e-61   
ref|XP_010516681.1|  PREDICTED: glycine cleavage system H protein...    203   7e-61   
ref|XP_010505012.1|  PREDICTED: glycine cleavage system H protein...    203   7e-61   
ref|NP_001058315.1|  Os06g0667600                                       204   7e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002321819.1|  glycine cleavage system H family protein           203   7e-61   Populus trichocarpa [western balsam poplar]
ref|NP_181057.1|  glycine cleavage system H protein 2                   203   9e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006295389.1|  hypothetical protein CARUB_v10024485mg             203   1e-60   
ref|XP_002269090.1|  PREDICTED: glycine cleavage system H protein...    202   1e-60   Vitis vinifera
ref|XP_002881376.1|  hypothetical protein ARALYDRAFT_482477             202   2e-60   
gb|KFK36394.1|  hypothetical protein AALP_AA4G118600                    202   2e-60   
ref|XP_006646940.1|  PREDICTED: glycine cleavage system H protein...    202   3e-60   
gb|KHN42986.1|  Glycine cleavage system H protein, mitochondrial        202   3e-60   
ref|XP_011000181.1|  PREDICTED: glycine cleavage system H protein...    202   3e-60   
ref|XP_004145438.1|  PREDICTED: glycine cleavage system H protein...    202   3e-60   
gb|EPS71608.1|  hypothetical protein M569_03153                         201   4e-60   
ref|XP_004293760.1|  PREDICTED: glycine cleavage system H protein...    201   4e-60   
gb|ACN40098.1|  unknown                                                 202   4e-60   Picea sitchensis
ref|XP_011029909.1|  PREDICTED: glycine cleavage system H protein...    201   5e-60   
ref|NP_001242407.1|  uncharacterized protein LOC100792708               201   5e-60   
gb|ABQ41936.1|  glycine cleavage system H protein                       200   5e-60   Sonneratia ovata
ref|XP_009133011.1|  PREDICTED: glycine cleavage system H protein...    201   5e-60   
gb|AAB82134.1|  H protein subunit of glycine decarboxylase              201   6e-60   Oryza sativa Indica Group [Indian rice]
gb|ABQ41934.1|  glycine cleavage system H protein                       200   7e-60   Sonneratia alba
ref|XP_009143702.1|  PREDICTED: glycine cleavage system H protein...    201   8e-60   
emb|CDY31665.1|  BnaA05g08820D                                          201   8e-60   
gb|ABJ98947.1|  mitochondrial glycine decarboxylase complex H-pro...    201   8e-60   Populus tremuloides
ref|NP_001237081.1|  uncharacterized protein LOC100305815               201   9e-60   
gb|ABQ41937.1|  glycine cleavage system H protein                       199   9e-60   Sonneratia apetala
ref|XP_004244545.1|  PREDICTED: glycine cleavage system H protein...    200   1e-59   
ref|XP_011001375.1|  PREDICTED: glycine cleavage system H protein...    200   1e-59   
ref|XP_002318899.1|  glycine cleavage system H family protein           200   1e-59   Populus trichocarpa [western balsam poplar]
gb|AAO63775.1|  glycine decarboxylase complex H-protein                 200   1e-59   Populus tremuloides
gb|ABQ41935.1|  glycine cleavage system H protein                       199   1e-59   Sonneratia caseolaris
emb|CDX79594.1|  BnaC03g19300D                                          200   1e-59   
ref|XP_010518994.1|  PREDICTED: glycine cleavage system H protein...    200   2e-59   
ref|NP_001046026.1|  Os02g0170100                                       200   2e-59   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84650.1|  hypothetical protein OsI_06022                          199   2e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_007041092.1|  Single hybrid motif superfamily protein            198   4e-59   
ref|XP_010538303.1|  PREDICTED: glycine cleavage system H protein...    199   5e-59   
gb|KCW77926.1|  hypothetical protein EUGRSUZ_D02179                     196   3e-58   
gb|KCW77925.1|  hypothetical protein EUGRSUZ_D02179                     195   5e-58   
ref|XP_006410669.1|  hypothetical protein EUTSA_v10017361mg             196   6e-58   
gb|KCW77927.1|  hypothetical protein EUGRSUZ_D02179                     195   7e-58   
ref|XP_007156656.1|  hypothetical protein PHAVU_002G006000g             195   1e-57   
ref|XP_010492917.1|  PREDICTED: glycine cleavage system H protein...    195   1e-57   
ref|XP_010454131.1|  PREDICTED: glycine cleavage system H protein...    195   2e-57   
gb|EYU43673.1|  hypothetical protein MIMGU_mgv1a0155372mg               193   2e-57   
gb|AAL33596.1|  glycine cleavage H-protein                              193   4e-57   Zea mays [maize]
ref|XP_007154472.1|  hypothetical protein PHAVU_003G122000g             194   5e-57   
ref|XP_010097409.1|  Glycine cleavage system H protein                  193   6e-57   
gb|KDO77366.1|  hypothetical protein CISIN_1g044104mg                   192   6e-57   
ref|XP_010420656.1|  PREDICTED: glycine cleavage system H protein...    192   2e-56   
ref|XP_010692940.1|  PREDICTED: glycine cleavage system H protein...    192   2e-56   
gb|AEP95744.1|  glycine decarboxylase complex subunit H                 191   3e-56   
ref|XP_006365040.1|  PREDICTED: glycine cleavage system H protein...    191   3e-56   
ref|XP_006286593.1|  hypothetical protein CARUB_v10002165mg             191   4e-56   
gb|EYU22152.1|  hypothetical protein MIMGU_mgv1a015161mg                190   5e-56   
ref|XP_004233241.1|  PREDICTED: glycine cleavage system H protein...    191   6e-56   
ref|XP_004960244.1|  PREDICTED: glycine cleavage system H protein...    191   8e-56   
ref|XP_008346098.1|  PREDICTED: glycine cleavage system H protein...    189   1e-55   
gb|KCW75489.1|  hypothetical protein EUGRSUZ_E04249                     189   1e-55   
emb|CCC55429.1|  glycine decarboxylase complex H-protein                189   3e-55   
ref|XP_010536582.1|  PREDICTED: glycine cleavage system H protein...    188   9e-55   
ref|XP_002528162.1|  glycine cleavage system h protein, putative        184   2e-53   Ricinus communis
gb|AEP95748.1|  glycine decarboxylase complex subunit H                 183   2e-53   
ref|XP_008372112.1|  PREDICTED: uncharacterized protein LOC103435489    190   6e-53   
ref|XP_003611466.1|  Glycine cleavage system H protein                  182   9e-53   
gb|ABK23939.1|  unknown                                                 179   2e-51   Picea sitchensis
ref|XP_007215079.1|  hypothetical protein PRUPE_ppa012577mg             179   3e-51   
ref|XP_001696637.1|  glycine cleavage system, H-protein                 177   1e-50   Chlamydomonas reinhardtii
gb|KHN08049.1|  Glycine cleavage system H protein, mitochondrial        177   2e-50   
ref|XP_002957951.1|  hypothetical protein VOLCADRAFT_77739              175   5e-50   
gb|ABA01127.1|  mitochondrial glycine decarboxylase complex H           175   9e-50   Chlamydomonas incerta
ref|XP_002500679.1|  glycine cleavage system h-protein                  172   1e-48   Micromonas commoda
ref|XP_008666737.1|  PREDICTED: glycine cleavage system H protein...    172   2e-48   
ref|XP_001769387.1|  predicted protein                                  171   3e-48   
ref|XP_008659953.1|  PREDICTED: glycine cleavage system H protein...    171   5e-48   
ref|XP_003064360.1|  glycine cleavage system h-protein                  166   3e-46   
ref|WP_020676029.1|  hypothetical protein                               164   4e-46   
gb|KFM28245.1|  Glycine cleavage system H protein, mitochondrial        164   1e-45   
ref|XP_009393275.1|  PREDICTED: glycine cleavage system H protein...    163   2e-45   
emb|CEG01882.1|  Glycine cleavage H-protein, subgroup                   160   2e-44   
ref|XP_001780120.1|  predicted protein                                  159   8e-44   
ref|XP_005845372.1|  hypothetical protein CHLNCDRAFT_32297              158   2e-43   
ref|NP_001172819.1|  Os02g0169700                                       157   3e-43   
ref|XP_005646133.1|  glycine cleavage H-protein                         157   3e-43   
ref|XP_005789351.1|  glycine cleavage system protein H                  157   5e-43   
ref|WP_040095092.1|  glycine cleavage system protein H                  156   6e-43   
ref|XP_001421540.1|  predicted protein                                  156   6e-43   Ostreococcus lucimarinus CCE9901
ref|WP_012875438.1|  glycine cleavage system protein H                  154   3e-42   
ref|XP_004356599.1|  glycine cleavage system H protein                  154   8e-42   
ref|WP_012097317.1|  glycine cleavage system protein H                  152   1e-41   
ref|XP_004305894.1|  PREDICTED: glycine cleavage system H protein...    154   1e-41   
ref|WP_014623706.1|  glycine cleavage system protein H                  152   2e-41   
gb|KCW75490.1|  hypothetical protein EUGRSUZ_E04249                     151   2e-41   
ref|XP_002980848.1|  hypothetical protein SELMODRAFT_113331             153   3e-41   
ref|WP_040200934.1|  glycine cleavage system protein H                  151   4e-41   
ref|WP_025748536.1|  hypothetical protein                               151   5e-41   
ref|XP_002989355.1|  hypothetical protein SELMODRAFT_129640             152   5e-41   
ref|XP_003385717.1|  PREDICTED: glycine cleavage system H protein...    152   1e-40   
ref|WP_029918240.1|  glycine cleavage system protein H                  150   1e-40   
ref|WP_013312827.1|  glycine cleavage system protein H                  149   3e-40   
gb|EEC72576.1|  hypothetical protein OsI_06018                          159   3e-40   Oryza sativa Indica Group [Indian rice]
gb|EEE56396.1|  hypothetical protein OsJ_05547                          160   5e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005535759.1|  similar to glycine cleavage system H protein       150   5e-40   
ref|WP_014966293.1|  glycine cleavage system protein H                  148   6e-40   
ref|WP_041081149.1|  glycine cleavage system protein H                  148   7e-40   
ref|WP_013777673.1|  glycine cleavage system protein H                  148   8e-40   
ref|WP_021298060.1|  glycine cleavage system protein H                  147   9e-40   
ref|XP_009349589.1|  PREDICTED: glycine cleavage system H protein...    149   9e-40   
gb|KHF26120.1|  glycine cleavage system H protein                       147   1e-39   
ref|XP_009593758.1|  PREDICTED: glycine cleavage system H protein...    147   1e-39   
ref|WP_031565961.1|  glycine cleavage system protein H                  147   1e-39   
ref|WP_012871768.1|  glycine cleavage system protein H                  147   1e-39   
gb|KHJ91473.1|  glycine cleavage system H protein                       148   2e-39   
ref|WP_038039796.1|  glycine cleavage system potein H                   147   2e-39   
ref|WP_015280596.1|  glycine cleavage system H protein                  147   2e-39   
ref|WP_026975653.1|  glycine cleavage system protein H                  146   3e-39   
ref|WP_008491707.1|  glycine cleavage system H protein                  146   3e-39   
ref|WP_036543395.1|  glycine cleavage system protein H                  146   3e-39   
ref|WP_012642140.1|  glycine cleavage system protein H                  146   4e-39   
ref|WP_018867861.1|  MULTISPECIES: glycine cleavage system protein H    146   4e-39   
ref|WP_008607700.1|  glycine cleavage system protein H                  145   5e-39   
ref|WP_016481821.1|  glycine cleavage system H protein                  145   6e-39   
ref|WP_019627090.1|  glycine cleavage system protein H                  145   7e-39   
ref|WP_008341044.1|  glycine cleavage system protein H                  145   8e-39   
ref|WP_031449493.1|  glycine cleavage system protein H                  145   9e-39   
ref|WP_018140680.1|  MULTISPECIES: glycine cleavage system protein H    145   1e-38   
ref|WP_006487673.1|  MULTISPECIES: glycine cleavage system protein H    144   1e-38   
ref|WP_026965328.1|  glycine cleavage system protein H                  144   1e-38   
ref|WP_018877895.1|  glycine cleavage system protein H                  145   1e-38   
ref|WP_034422093.1|  glycine cleavage system protein H                  144   1e-38   
ref|WP_011420301.1|  glycine cleavage system protein H                  144   1e-38   
ref|WP_017941311.1|  MULTISPECIES: glycine cleavage system protein H    144   2e-38   
ref|WP_028470544.1|  glycine cleavage system protein H                  144   2e-38   
ref|WP_038246696.1|  glycine cleavage system protein H                  144   2e-38   
ref|WP_012526628.1|  MULTISPECIES: glycine cleavage system protein H    144   2e-38   
ref|WP_013158430.1|  glycine cleavage system protein H                  144   3e-38   
ref|XP_007154471.1|  hypothetical protein PHAVU_003G122000g             143   3e-38   
ref|WP_027672370.1|  glycine cleavage system protein H                  143   4e-38   
ref|WP_039646632.1|  glycine cleavage system protein H                  143   4e-38   
gb|AIS53125.1|  glycine cleavage system H protein GcvH                  143   5e-38   
ref|WP_022955089.1|  glycine cleavage system protein H                  143   5e-38   
ref|WP_014187002.1|  glycine cleavage system protein H                  143   5e-38   
ref|WP_037566731.1|  glycine cleavage system protein H                  143   6e-38   
ref|WP_024325881.1|  glycine cleavage system protein H                  143   6e-38   
ref|WP_013756493.1|  glycine cleavage system protein H                  142   6e-38   
ref|WP_008951563.1|  MULTISPECIES: glycine cleavage system protein H    143   6e-38   
ref|XP_005828260.1|  hypothetical protein GUITHDRAFT_88499              144   6e-38   
ref|WP_012811009.1|  glycine cleavage system protein H                  142   7e-38   
ref|WP_014759181.1|  MULTISPECIES: glycine cleavage system protein H    142   7e-38   
ref|XP_004293759.1|  PREDICTED: glycine cleavage system H protein...    144   8e-38   
ref|WP_036187921.1|  glycine cleavage system protein H                  142   8e-38   
ref|WP_013787703.1|  glycine cleavage system protein H                  142   9e-38   
ref|WP_013332283.1|  glycine cleavage system protein H                  142   9e-38   
ref|WP_011399698.1|  glycine cleavage system protein H                  142   1e-37   
ref|WP_019622799.1|  glycine cleavage system protein H                  142   1e-37   
ref|WP_018169373.1|  glycine cleavage system protein H                  142   2e-37   
ref|WP_018872672.1|  glycine cleavage system protein H                  142   2e-37   
ref|WP_024266390.1|  Glycine cleavage system H protein                  141   2e-37   
ref|WP_034401573.1|  glycine cleavage system protein H                  141   2e-37   
ref|WP_036872416.1|  glycine cleavage system protein H                  141   2e-37   
ref|WP_031504049.1|  glycine cleavage system protein H                  141   2e-37   
ref|WP_014464393.1|  glycine cleavage system protein H                  141   2e-37   
ref|WP_040965167.1|  glycine cleavage system protein H                  141   2e-37   
ref|WP_011566093.1|  glycine cleavage system protein H                  141   2e-37   
ref|WP_023058395.1|  MULTISPECIES: glycine cleavage system H protein    141   2e-37   
ref|WP_006833292.1|  glycine cleavage system protein H                  141   3e-37   
ref|WP_028898111.1|  glycine cleavage system protein H                  141   3e-37   
ref|WP_027726250.1|  glycine cleavage system protein H                  141   3e-37   
ref|WP_026961985.1|  glycine cleavage system protein H                  141   3e-37   
ref|WP_012983086.1|  MULTISPECIES: glycine cleavage system protein H    141   3e-37   
ref|WP_013969749.1|  glycine cleavage system protein H                  141   3e-37   
ref|XP_008378364.1|  PREDICTED: LOW QUALITY PROTEIN: glycine clea...    140   3e-37   
ref|WP_020383621.1|  hypothetical protein                               140   4e-37   
ref|WP_008224418.1|  glycine cleavage system protein H                  140   4e-37   
ref|XP_006986403.1|  PREDICTED: glycine cleavage system H protein...    142   4e-37   
ref|WP_013777472.1|  glycine cleavage system protein H                  140   4e-37   
ref|WP_019675478.1|  glycine cleavage system protein H                  140   4e-37   
ref|WP_011414933.1|  glycine cleavage system protein H                  140   4e-37   
ref|WP_018137941.1|  MULTISPECIES: glycine cleavage system protein H    140   5e-37   
ref|WP_007645254.1|  glycine cleavage system protein H                  140   5e-37   
ref|WP_018946270.1|  glycine cleavage system protein H                  140   5e-37   
ref|WP_018714585.1|  hypothetical protein                               140   6e-37   
ref|WP_004357247.1|  glycine cleavage system protein H                  140   6e-37   
ref|WP_013298402.1|  glycine cleavage system protein H                  140   6e-37   
ref|WP_015904358.1|  glycine cleavage system protein H                  140   6e-37   
ref|WP_034141089.1|  glycine cleavage system protein H                  140   6e-37   
gb|AJF59845.1|  glycine cleavage system H protein                       140   7e-37   
ref|WP_018176402.1|  MULTISPECIES: glycine cleavage system protein H    140   7e-37   
ref|WP_017926926.1|  glycine cleavage system protein H                  140   8e-37   
ref|WP_018948694.1|  glycine cleavage system protein H                  140   8e-37   
ref|WP_008437120.1|  glycine cleavage system protein H                  140   8e-37   
ref|WP_029213462.1|  glycine cleavage system protein H                  140   8e-37   
ref|WP_036511898.1|  glycine cleavage system protein H                  140   9e-37   
ref|WP_037572381.1|  glycine cleavage system protein H                  139   9e-37   
ref|WP_016415072.1|  glycine cleavage system protein H                  140   9e-37   
ref|WP_022961701.1|  glycine cleavage system protein H                  139   9e-37   
ref|WP_004363514.1|  glycine cleavage system H protein                  139   1e-36   
ref|WP_015047985.1|  glycine cleavage system protein H                  139   1e-36   
ref|WP_015358673.1|  MULTISPECIES: glycine cleavage system H prot...    139   1e-36   
ref|WP_018146134.1|  glycine cleavage system protein H                  139   1e-36   
ref|WP_028992093.1|  glycine cleavage system protein H                  139   1e-36   
ref|XP_002174779.1|  glycine decarboxylase complex subunit H            141   1e-36   
ref|WP_014828602.1|  glycine cleavage system protein H                  139   1e-36   
ref|WP_006447504.1|  glycine cleavage system protein H                  139   1e-36   
ref|WP_025876282.1|  glycine cleavage system protein H                  139   1e-36   
ref|WP_015312067.1|  glycine cleavage system H protein                  139   1e-36   
ref|WP_007230871.1|  glycine cleavage system protein H                  139   1e-36   
ref|WP_027492812.1|  glycine cleavage system protein H                  139   1e-36   
ref|WP_035420930.1|  MULTISPECIES: glycine cleavage system protein H    139   1e-36   
ref|WP_041078077.1|  glycine cleavage system protein H                  139   1e-36   
ref|WP_018871267.1|  MULTISPECIES: glycine cleavage system protein H    139   1e-36   
ref|XP_005183152.1|  PREDICTED: glycine cleavage system H protein...    140   1e-36   
ref|WP_011802063.1|  glycine cleavage system protein H                  139   2e-36   
ref|WP_028396154.1|  glycine cleavage system protein H                  139   2e-36   
ref|WP_036139993.1|  glycine cleavage system protein H                  139   2e-36   
ref|WP_018275574.1|  glycine cleavage system protein H                  139   2e-36   
ref|WP_040186619.1|  glycine cleavage system protein H                  139   2e-36   
ref|WP_014432033.1|  glycine cleavage system protein H                  139   2e-36   
ref|WP_019603806.1|  glycine cleavage system protein H                  139   2e-36   
ref|WP_015868956.1|  glycine cleavage system protein H                  139   2e-36   
ref|XP_005292376.1|  PREDICTED: glycine cleavage system H protein...    139   2e-36   
ref|WP_004348588.1|  glycine cleavage system protein H                  139   2e-36   
ref|WP_035394572.1|  glycine cleavage system protein H                  139   2e-36   
ref|WP_014099128.1|  glycine cleavage system protein H                  139   2e-36   
ref|WP_006930207.1|  glycine cleavage system protein H                  139   2e-36   
ref|WP_005173499.1|  glycine cleavage system protein H                  139   2e-36   
ref|WP_009202222.1|  glycine cleavage system protein H                  139   2e-36   
ref|WP_006639009.1|  glycine cleavage system protein H                  139   2e-36   
ref|WP_021964785.1|  glycine cleavage system H protein                  139   2e-36   
ref|WP_019569025.1|  glycine cleavage system protein H                  139   2e-36   
ref|WP_019013508.1|  hypothetical protein                               138   2e-36   
ref|WP_022316147.1|  glycine cleavage system H protein                  139   3e-36   
ref|WP_019950322.1|  glycine cleavage system protein H                  139   3e-36   
ref|WP_002683053.1|  glycine cleavage system protein H                  138   3e-36   
ref|WP_011196048.1|  glycine cleavage system protein H                  138   3e-36   
ref|WP_021817433.1|  glycine cleavage system protein H                  138   3e-36   
ref|WP_027853288.1|  glycine cleavage system protein H                  138   3e-36   
ref|WP_007231239.1|  glycine cleavage system protein H                  138   3e-36   
ref|WP_005469554.1|  MULTISPECIES: glycine cleavage system protein H    138   3e-36   
ref|WP_004411309.1|  glycine cleavage system protein H                  138   3e-36   
ref|WP_038482500.1|  glycine cleavage system protein H                  138   3e-36   
ref|WP_008898676.1|  glycine cleavage system protein H                  138   3e-36   
ref|WP_019168945.1|  glycine cleavage system protein H                  138   3e-36   
ref|WP_004738119.1|  glycine cleavage system protein H                  138   3e-36   
ref|WP_006045050.1|  glycine cleavage system protein H                  138   3e-36   
ref|XP_007360469.1|  hypothetical protein DICSQDRAFT_76324              139   3e-36   
gb|KIN12376.1|  glycine cleavage system protein H                       138   3e-36   
ref|WP_022815654.1|  glycine cleavage system protein H                  138   4e-36   
ref|WP_018414576.1|  glycine cleavage system protein H                  138   4e-36   
ref|WP_038429244.1|  glycine cleavage system protein H                  138   4e-36   
ref|WP_005003382.1|  glycine cleavage system protein H                  138   4e-36   
ref|WP_032909121.1|  glycine cleavage system protein H                  138   4e-36   
ref|WP_007506409.1|  glycine cleavage system protein H                  138   4e-36   
gb|ADI21711.1|  glycine cleavage system H protein (lipoate-binding)     138   4e-36   
ref|WP_008079963.1|  glycine cleavage system protein H                  138   4e-36   
ref|WP_014904569.1|  glycine cleavage system protein H                  138   4e-36   
ref|WP_019590638.1|  glycine cleavage system protein H                  138   4e-36   
ref|WP_017185163.1|  glycine cleavage system protein H                  138   4e-36   
ref|WP_038086532.1|  glycine cleavage system protein H                  138   4e-36   
ref|NP_001188156.1|  mitochondrial glycine cleavage system h protein    139   4e-36   
ref|WP_028881627.1|  glycine cleavage system protein H                  138   4e-36   
ref|WP_000290490.1|  glycine cleavage system protein H                  138   4e-36   
ref|XP_004625817.1|  PREDICTED: glycine cleavage system H protein...    139   5e-36   
ref|WP_003330858.1|  glycine cleavage system protein H                  138   5e-36   
ref|WP_037547802.1|  glycine cleavage system protein H                  138   5e-36   
ref|WP_025001612.1|  glycine cleavage system protein H                  137   5e-36   
ref|WP_019078994.1|  glycine cleavage system protein H                  137   5e-36   
emb|CDQ78676.1|  unnamed protein product                                139   5e-36   
ref|WP_007420172.1|  glycine cleavage system protein H                  137   6e-36   
ref|WP_024329914.1|  glycine cleavage system protein H                  137   6e-36   
ref|WP_034776458.1|  glycine cleavage system protein H                  137   6e-36   
ref|WP_022481298.1|  glycine cleavage system H protein                  137   6e-36   
ref|WP_031900496.1|  glycine cleavage system protein H                  137   6e-36   
ref|WP_026907030.1|  glycine cleavage system protein H                  137   6e-36   
ref|WP_000290491.1|  glycine cleavage system protein H                  137   6e-36   
ref|WP_014709948.1|  glycine cleavage system protein H                  137   6e-36   
ref|WP_022437703.1|  glycine cleavage system H protein                  137   6e-36   
ref|WP_008216962.1|  glycine cleavage system protein H                  137   6e-36   
ref|WP_019229991.1|  hypothetical protein                               137   6e-36   
ref|WP_013059655.1|  MULTISPECIES: glycine cleavage system protein H    137   7e-36   
ref|WP_021697338.1|  glycine cleavage system H protein                  137   7e-36   
emb|CBK21270.2|  unnamed protein product                                139   7e-36   
ref|WP_009471955.1|  glycine cleavage system protein H                  137   7e-36   
ref|WP_029524298.1|  glycine cleavage system protein H                  137   7e-36   
ref|WP_023648118.1|  glycine cleavage system protein H                  137   7e-36   
ref|WP_027631405.1|  glycine cleavage system potein H                   137   8e-36   
ref|WP_019715655.1|  glycine cleavage system protein H                  137   8e-36   
ref|WP_039631386.1|  glycine cleavage system potein H                   137   8e-36   
ref|WP_015924056.1|  glycine cleavage system protein H                  137   8e-36   
ref|WP_017064654.1|  glycine cleavage system protein H                  137   8e-36   
ref|WP_020452879.1|  MULTISPECIES: glycine cleavage system protei...    137   8e-36   
ref|WP_010451972.1|  glycine cleavage system protein H                  137   8e-36   
ref|WP_024967100.1|  glycine cleavage system protein H                  137   8e-36   
gb|AAH14745.1|  Gcsh protein                                            139   8e-36   
ref|XP_781990.2|  PREDICTED: glycine cleavage system H protein, m...    139   8e-36   
ref|WP_015818020.1|  glycine cleavage system protein H                  137   8e-36   
ref|WP_028036608.1|  glycine cleavage system protein H                  137   8e-36   
ref|WP_036524709.1|  glycine cleavage system protein H                  137   9e-36   
ref|WP_000290492.1|  glycine cleavage system protein H                  137   9e-36   
gb|EPB91444.1|  glycine cleavage system H protein                       138   9e-36   
ref|WP_013075752.1|  glycine cleavage system protein H                  137   9e-36   
emb|CDH50821.1|  glycine dehydrogenase                                  138   9e-36   
ref|WP_017072176.1|  MULTISPECIES: glycine cleavage system protein H    137   9e-36   
ref|WP_014234303.1|  MULTISPECIES: glycine cleavage system protein H    137   9e-36   
ref|WP_036909767.1|  glycine cleavage system protein H                  137   9e-36   
ref|WP_020414262.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_010649366.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_004390974.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_027966928.1|  glycine cleavage system protein H                  137   1e-35   
emb|CBY36253.1|  unnamed protein product                                138   1e-35   
ref|WP_027987748.1|  hypothetical protein                               137   1e-35   
ref|WP_036771051.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_027350421.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_027328256.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_025322127.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_014614456.1|  MULTISPECIES: glycine cleavage system protein H    137   1e-35   
ref|XP_002620325.1|  glycine cleavage system H protein                  139   1e-35   
ref|WP_027987016.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_019021125.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_022737010.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_018930861.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_026588684.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_007933499.1|  MULTISPECIES: glycine cleavage system protein H    137   1e-35   
ref|WP_009501667.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_004744041.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_005431364.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_022694940.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_024997948.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_014957569.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_009384910.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_017067508.1|  glycine cleavage system protein H                  137   1e-35   
ref|NP_080848.1|  glycine cleavage system H protein, mitochondria...    138   1e-35   
ref|WP_005451648.1|  MULTISPECIES: glycine cleavage system protein H    137   1e-35   
ref|WP_007958390.1|  glycine cleavage system protein H                  137   1e-35   
ref|WP_022385851.1|  glycine cleavage system H protein                  136   1e-35   
ref|WP_012069985.1|  glycine cleavage system protein H                  137   1e-35   



>ref|XP_009377058.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial-like 
isoform X1 [Pyrus x bretschneideri]
Length=165

 Score =   274 bits (701),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 146/162 (90%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANALR+STA+ S+  P  SLSRCFS+VL+GLKYA SHEWVK EGSVATIG
Sbjct  1    MALRLWASSTANALRISTASKSQLSPAFSLSRCFSTVLDGLKYASSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFVELPE G +V QG  FGAVESVKATSDVNSPISGEVVEVN+KLTE 
Sbjct  61   ITDHAQDHLGEVVFVELPESGRSVSQGGSFGAVESVKATSDVNSPISGEVVEVNSKLTES  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYEDGWMIK+KPS+ SEL SL+ PKEYTKFCEEED
Sbjct  121  PGLINSSPYEDGWMIKIKPSSPSELESLLGPKEYTKFCEEED  162



>ref|XP_009378975.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial 
[Pyrus x bretschneideri]
Length=165

 Score =   273 bits (698),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 145/162 (90%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANALR+STA+ S   P  SLSRCFS+VL+GLKYA SHEWVK EGSVATIG
Sbjct  1    MALRLWASSTANALRISTASKSHLSPAFSLSRCFSTVLDGLKYASSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFVELPE G +V QG  FGAVESVKATSDVNSPISGEVVEVN+KLTE 
Sbjct  61   ITDHAQDHLGEVVFVELPESGRSVSQGGSFGAVESVKATSDVNSPISGEVVEVNSKLTES  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYEDGWMIK+KPS+ SEL SL+ PKEYTKFCEEED
Sbjct  121  PGLINSSPYEDGWMIKIKPSSPSELESLLGPKEYTKFCEEED  162



>ref|XP_008341065.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial-like 
[Malus domestica]
Length=165

 Score =   272 bits (696),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 145/162 (90%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANALR+STA+ S   P  SLSRCFS+VL+GLKYA SHEWVK EGSVATIG
Sbjct  1    MALRLWASSTANALRISTASKSHLSPAFSLSRCFSTVLDGLKYASSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFVELPE G +V QG  FGAVESVKATSDVNSPISG+VVEVN+KLTE 
Sbjct  61   ITDHAQDHLGEVVFVELPESGRSVSQGGSFGAVESVKATSDVNSPISGQVVEVNSKLTES  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYEDGWMIK+KPS+ SEL SL+ PKEYTKFCEEED
Sbjct  121  PGLINSSPYEDGWMIKIKPSSPSELESLLGPKEYTKFCEEED  162



>ref|XP_011071934.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial-like 
[Sesamum indicum]
Length=163

 Score =   272 bits (695),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR+WASSTANAL+LSTAAS  P  SLSRCFS+VLEG KYA SHEWVK +G VAT+GIT
Sbjct  1    MALRMWASSTANALKLSTAASKSPAFSLSRCFSTVLEGFKYANSHEWVKHDGPVATVGIT  60

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
             HAQDHLGEVVFVELPE G  V QG  FG+VESVKATSDVNSPISGE+VE+NAKL E PG
Sbjct  61   HHAQDHLGEVVFVELPEAGKPVTQGDSFGSVESVKATSDVNSPISGEIVEINAKLKETPG  120

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            +IN+SPYEDGWMIKVKPSN SEL SLM PKEYTKFCEEED
Sbjct  121  LINTSPYEDGWMIKVKPSNPSELESLMGPKEYTKFCEEED  160



>ref|XP_002280707.1| PREDICTED: glycine cleavage system H protein, mitochondrial [Vitis 
vinifera]
 emb|CBI33899.3| unnamed protein product [Vitis vinifera]
Length=165

 Score =   271 bits (694),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 146/162 (90%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANALR+S A+ +   P  SLSRCFSSVL+GLKYA SHEWVK EGSVATIG
Sbjct  1    MALRMWASSTANALRVSCASKAHVSPAFSLSRCFSSVLDGLKYATSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFVE+PE G +V +G+GFGAVESVKATSDVNSPISGEVVEVN+KL+E 
Sbjct  61   ITDHAQDHLGEVVFVEIPEPGGSVSKGNGFGAVESVKATSDVNSPISGEVVEVNSKLSEA  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYEDGWMIKVKPSN SEL SLM PKEYTKFCEEED
Sbjct  121  PGLINSSPYEDGWMIKVKPSNPSELESLMGPKEYTKFCEEED  162



>ref|XP_002519845.1| glycine cleavage system h protein, putative [Ricinus communis]
 gb|EEF42449.1| glycine cleavage system h protein, putative [Ricinus communis]
Length=165

 Score =   271 bits (694),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 144/162 (89%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTAN L++S A  ++  P+ SLSRCFSSVL+GLKYA SHEWVK EGSVATIG
Sbjct  1    MALRMWASSTANTLKISVACKAQLSPSYSLSRCFSSVLDGLKYATSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFV+LPE GT+V QG  FGAVESVKATSDVNSPISGEVVEVN KLTEG
Sbjct  61   ITDHAQDHLGEVVFVDLPEAGTSVTQGKSFGAVESVKATSDVNSPISGEVVEVNTKLTEG  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG INSSPYE+GWMIKVKP+N SEL SLM PKEYTKFCEEED
Sbjct  121  PGSINSSPYEEGWMIKVKPNNPSELESLMGPKEYTKFCEEED  162



>ref|XP_008374430.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial 
[Malus domestica]
Length=165

 Score =   271 bits (692),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 145/162 (90%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANALR+STA+ S   P  S+SRCFS+VL+GLKYA SHEWVK EGSVATIG
Sbjct  1    MALRMWASSTANALRISTASKSHLXPAFSISRCFSTVLDGLKYASSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFVELPE G +V QG  FGAVESVKATSDVNSPISGEVVEVN+KLTE 
Sbjct  61   ITDHAQDHLGEVVFVELPEAGRSVSQGGSFGAVESVKATSDVNSPISGEVVEVNSKLTES  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYEDGWMIK+KPS+ SEL SL+ PKEYTKFCEEE+
Sbjct  121  PGLINSSPYEDGWMIKIKPSSPSELESLLGPKEYTKFCEEEN  162



>ref|XP_009373439.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial-like 
[Pyrus x bretschneideri]
Length=165

 Score =   271 bits (692),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 144/162 (89%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANALR+STA+ S   P  SLSRCFS+VL+GLKYA SHEWVK EGSVATIG
Sbjct  1    MALRLWASSTANALRISTASKSHLSPAFSLSRCFSTVLDGLKYASSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFVELPE G +V QG  FGAVESVKATSDVNSPISGEVVEVN+KLTE 
Sbjct  61   ITDHAQDHLGEVVFVELPEAGRSVSQGGSFGAVESVKATSDVNSPISGEVVEVNSKLTES  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYE GWMIK+KPS+ SEL SL+ PKEYTKFCEEED
Sbjct  121  PGLINSSPYEGGWMIKIKPSSPSELESLLGPKEYTKFCEEED  162



>ref|XP_008346738.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial 
[Malus domestica]
Length=165

 Score =   271 bits (692),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 145/162 (90%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANALR+STA+ S   P  S+SRCFS+VL+GLKYA SHEWVK EGSVATIG
Sbjct  1    MALRMWASSTANALRISTASKSHLAPAFSISRCFSTVLDGLKYASSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFVELPE G +V QG  FGAVESVKATSDVNSPISGEVVEVN+KLTE 
Sbjct  61   ITDHAQDHLGEVVFVELPEAGRSVSQGGSFGAVESVKATSDVNSPISGEVVEVNSKLTES  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYEDGWMIK+KPS+ SEL SL+ PKEYTKFCEEE+
Sbjct  121  PGLINSSPYEDGWMIKIKPSSPSELESLLGPKEYTKFCEEEN  162



>ref|XP_009762877.1| PREDICTED: glycine cleavage system H protein, mitochondrial [Nicotiana 
sylvestris]
Length=164

 Score =   270 bits (691),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 143/162 (88%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTA--ASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANALR+STA  A+  P  SLSRCFS+VL+GLKYA SHEWVK EGSVAT+G
Sbjct  1    MALRMWASSTANALRVSTASRANLSPAYSLSRCFSTVLDGLKYASSHEWVKHEGSVATVG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFV+LPE G AV QGS FGAVESVKATSD+N PISGE+VEVN KLTE 
Sbjct  61   ITDHAQDHLGEVVFVDLPETGAAVSQGSSFGAVESVKATSDINCPISGEIVEVNTKLTET  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG++NSSPYEDGWMIKVKPSN SEL SLM  KEYTKFCEEED
Sbjct  121  PGLVNSSPYEDGWMIKVKPSNPSELESLMGSKEYTKFCEEED  162



>emb|CAN76620.1| hypothetical protein VITISV_038357 [Vitis vinifera]
Length=165

 Score =   270 bits (690),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 145/162 (90%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANALR+S A+ +   P  SLSRCFSSVL+GLKYA SHEWVK EGSVATIG
Sbjct  1    MALRMWASSTANALRVSCASKAHVSPAFSLSRCFSSVLDGLKYATSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFVELPE G +V +G+GFGAVESVKATSD+NSPISGEVVEVN+KL+E 
Sbjct  61   ITDHAQDHLGEVVFVELPEPGGSVSKGNGFGAVESVKATSDINSPISGEVVEVNSKLSES  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYEDGWMIKVKP N SEL SLM PKEYTKFCEEED
Sbjct  121  PGLINSSPYEDGWMIKVKPGNPSELESLMGPKEYTKFCEEED  162



>ref|XP_010053589.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW77923.1| hypothetical protein EUGRSUZ_D02179 [Eucalyptus grandis]
Length=163

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR+WASSTANALRLS+ AS  P  SL RCFSSVL+GLKYA SHEWVK EG VA++GIT
Sbjct  1    MALRMWASSTANALRLSSKASLSPAFSLHRCFSSVLDGLKYAPSHEWVKHEGPVASVGIT  60

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLGEVVFV+LPE G +V +G  FGAVESVKATSD+NSPISGE+VEVN KLTE PG
Sbjct  61   DHAQDHLGEVVFVDLPEPGGSVSKGGSFGAVESVKATSDINSPISGEIVEVNTKLTETPG  120

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            ++NSSPYEDGWMIKVKPS+ SELGSLM PKEYTKFCEEED
Sbjct  121  LVNSSPYEDGWMIKVKPSDPSELGSLMGPKEYTKFCEEED  160



>ref|XP_008238294.1| PREDICTED: glycine cleavage system H protein, mitochondrial [Prunus 
mume]
Length=165

 Score =   269 bits (687),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 143/162 (88%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANALR+S+A+ +   P  S SRCFSSVLEGLKYA SHEWVK EGSVATIG
Sbjct  1    MALRMWASSTANALRISSASKAHLSPAFSFSRCFSSVLEGLKYASSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFVELPE G +V  G GFGAVESVKATSDVNSPISG+VVEVN+KLTE 
Sbjct  61   ITDHAQDHLGEVVFVELPEAGRSVSAGVGFGAVESVKATSDVNSPISGDVVEVNSKLTES  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYEDGWMIK+KPSN SEL SL+  KEYTKFCEEED
Sbjct  121  PGLINSSPYEDGWMIKIKPSNPSELESLLGAKEYTKFCEEED  162



>ref|XP_007209716.1| hypothetical protein PRUPE_ppa012546mg [Prunus persica]
 gb|EMJ10915.1| hypothetical protein PRUPE_ppa012546mg [Prunus persica]
Length=165

 Score =   268 bits (686),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 143/162 (88%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANALR+S+A+ +   P  S SRCFSSVLEGLKYA SHEWVK EGSVATIG
Sbjct  1    MALRMWASSTANALRISSASKAHLSPAFSFSRCFSSVLEGLKYASSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFVELPE G +V  G GFGAVESVKATSD+NSPISG+VVEVN+KLTE 
Sbjct  61   ITDHAQDHLGEVVFVELPEAGRSVSAGVGFGAVESVKATSDINSPISGDVVEVNSKLTES  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYEDGWMIK+KPSN SEL SL+  KEYTKFCEEED
Sbjct  121  PGLINSSPYEDGWMIKIKPSNPSELESLLGAKEYTKFCEEED  162



>ref|XP_007039553.1| Single hybrid motif superfamily protein [Theobroma cacao]
 gb|EOY24054.1| Single hybrid motif superfamily protein [Theobroma cacao]
Length=165

 Score =   268 bits (686),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 145/162 (90%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANAL++S A+ +   P  SLSRCFS+VL+GLKYA SHEWVK EGSVATIG
Sbjct  1    MALRMWASSTANALKISCASKAHLSPAFSLSRCFSTVLDGLKYANSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFV+LPE G +V QG GFGAVESVKATSDVNSPISGEVVEVN+KLTE 
Sbjct  61   ITDHAQDHLGEVVFVDLPEPGGSVSQGKGFGAVESVKATSDVNSPISGEVVEVNSKLTEA  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYEDGW+IKVKPS+ SEL SLM PKEYTKFCEEED
Sbjct  121  PGLINSSPYEDGWIIKVKPSSPSELESLMGPKEYTKFCEEED  162



>sp|P49359.1|GCSH_FLAPR RecName: Full=Glycine cleavage system H protein, mitochondrial; 
Flags: Precursor [Flaveria pringlei]
 emb|CAA81075.1| H-protein [Flaveria pringlei]
 emb|CAB16913.1| H-protein [Flaveria pringlei]
Length=162

 Score =   268 bits (686),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 146/161 (91%), Gaps = 3/161 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLS-LSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MALRIWASSTANALRLS+A  ++P+ S LSRCFSSVL+GLKYA SHEWVK EGSVATIGI
Sbjct  1    MALRIWASSTANALRLSSA--TRPHFSPLSRCFSSVLDGLKYANSHEWVKHEGSVATIGI  58

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLGEVVFV+LPE G +V + +GFGAVESVKATSDVNSPISGE+VEVN+KL+E P
Sbjct  59   TDHAQDHLGEVVFVDLPEAGGSVTKATGFGAVESVKATSDVNSPISGEIVEVNSKLSETP  118

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G+INSSPYEDGWMIKVKPSN SEL SLM  KEYTKFCEEED
Sbjct  119  GLINSSPYEDGWMIKVKPSNPSELDSLMGAKEYTKFCEEED  159



>gb|KDP39513.1| hypothetical protein JCGZ_05079 [Jatropha curcas]
Length=164

 Score =   268 bits (685),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 144/163 (88%), Gaps = 5/163 (3%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLS---LSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL++S A  SKP LS   LSRCFSSVL+GLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALKISVA--SKPQLSPYCLSRCFSSVLDGLKYATSHEWVKHEGSVATI  58

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFV+LPE G AV QG  FGAVESVKATSDVNSPISGE+VEVN+KL+E
Sbjct  59   GITDHAQDHLGEVVFVDLPEPGVAVTQGKSFGAVESVKATSDVNSPISGEIVEVNSKLSE  118

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG INSSPYE+GWMIKVKPSN SELGSL+D K YTKFCEEED
Sbjct  119  APGAINSSPYEEGWMIKVKPSNPSELGSLLDAKAYTKFCEEED  161



>emb|CAB16710.1| H protein [Flaveria anomala]
Length=162

 Score =   268 bits (685),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 146/161 (91%), Gaps = 3/161 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLS-LSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MALRIWASSTANALRLS+A  ++P+ S LSRCFSSVL+GLKYA SHEWVK EGSVATIGI
Sbjct  1    MALRIWASSTANALRLSSA--TRPHFSPLSRCFSSVLDGLKYANSHEWVKHEGSVATIGI  58

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLGEVVFV+LPE G +V + +GFGAVESVKATSDVNSPISGE+VEVN+KL+E P
Sbjct  59   TDHAQDHLGEVVFVDLPEAGGSVTKATGFGAVESVKATSDVNSPISGEIVEVNSKLSETP  118

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G+INSSPYEDGWMIKVKPSN SEL SLM  KEYTKFCEEED
Sbjct  119  GLINSSPYEDGWMIKVKPSNPSELDSLMGAKEYTKFCEEED  159



>ref|XP_009624149.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=164

 Score =   268 bits (684),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 143/162 (88%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTA--ASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANALR+STA  A+  P  S+SRCFS+VL+GLKYA SHEWVK EGSVAT+G
Sbjct  1    MALRMWASSTANALRVSTASRANLSPAFSISRCFSTVLDGLKYASSHEWVKHEGSVATVG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFV+LPE G AV QGS FGAVESVKATSD+N PISGE+VEVN KLTE 
Sbjct  61   ITDHAQDHLGEVVFVDLPETGAAVSQGSSFGAVESVKATSDINCPISGEIVEVNTKLTET  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG++NSSPYEDGWMIKVKPS+ SEL SLM  KEYTKFCEEED
Sbjct  121  PGLVNSSPYEDGWMIKVKPSSPSELESLMGSKEYTKFCEEED  162



>gb|KHG14887.1| Glycine cleavage system H, mitochondrial [Gossypium arboreum]
Length=165

 Score =   268 bits (684),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 145/164 (88%), Gaps = 6/164 (4%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPN----LSLSRCFSSVLEGLKYAKSHEWVKSEGSVAT  382
            MALR+WASSTANAL++S   SSKPN     SLSRCFS+VL+GLKYA SHEWVK EG VAT
Sbjct  1    MALRMWASSTANALKIS--CSSKPNVSLAFSLSRCFSTVLDGLKYANSHEWVKHEGPVAT  58

Query  383  IGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLT  562
            IGITDHAQDHLGEVVFVELPE G +V QG GFGAVESVKATSDVNSPISGEVVEVN+KL+
Sbjct  59   IGITDHAQDHLGEVVFVELPEPGGSVSQGKGFGAVESVKATSDVNSPISGEVVEVNSKLS  118

Query  563  EGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            E PG+INSSPYEDGWMIKVKPS+ SEL SLM PKEYTKFCEEED
Sbjct  119  ETPGLINSSPYEDGWMIKVKPSSPSELESLMGPKEYTKFCEEED  162



>sp|Q39732.1|GCSH_FLAAN RecName: Full=Glycine cleavage system H protein, mitochondrial; 
Flags: Precursor [Flaveria anomala]
 emb|CAA85761.1| H-protein [Flaveria anomala]
Length=162

 Score =   267 bits (683),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 146/161 (91%), Gaps = 3/161 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLS-LSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MALR+WASSTANALRLS+A  ++P+ S LSRCFSSVL+GLKYA SHEWVK EGSVATIGI
Sbjct  1    MALRMWASSTANALRLSSA--TRPHFSPLSRCFSSVLDGLKYANSHEWVKHEGSVATIGI  58

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLGEVVFV+LPE G +V + +GFGAVESVKATSDVNSPISGE+VEVN+KL+E P
Sbjct  59   TDHAQDHLGEVVFVDLPEAGGSVTKATGFGAVESVKATSDVNSPISGEIVEVNSKLSETP  118

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G+INSSPYEDGWMIKVKPSN SEL SLM  KEYTKFCEEED
Sbjct  119  GLINSSPYEDGWMIKVKPSNPSELDSLMGAKEYTKFCEEED  159



>emb|CAA81073.1| H-protein [Flaveria cronquistii]
 emb|CAA81074.1| H-protein [Flaveria pringlei]
 emb|CAB16912.1| H-protein [Flaveria pringlei]
Length=162

 Score =   267 bits (682),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 146/161 (91%), Gaps = 3/161 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLS-LSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MALR+WASSTANALRLS+A  ++P+ S LSRCFSSVL+GLKYA SHEWVK EGSVATIGI
Sbjct  1    MALRMWASSTANALRLSSA--TRPHFSPLSRCFSSVLDGLKYANSHEWVKHEGSVATIGI  58

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLGEVVFV+LPE G +V + +GFGAVESVKATSDVNSPISGE+VEVN+KL+E P
Sbjct  59   TDHAQDHLGEVVFVDLPETGGSVTKATGFGAVESVKATSDVNSPISGEIVEVNSKLSETP  118

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G+INSSPYEDGWMIKVKPSN SEL SLM  KEYTKFCEEED
Sbjct  119  GLINSSPYEDGWMIKVKPSNPSELDSLMGAKEYTKFCEEED  159



>ref|XP_006436757.1| hypothetical protein CICLE_v10032942mg [Citrus clementina]
 ref|XP_006485430.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
[Citrus sinensis]
 gb|ESR49997.1| hypothetical protein CICLE_v10032942mg [Citrus clementina]
 gb|KDO42215.1| hypothetical protein CISIN_1g031294mg [Citrus sinensis]
Length=162

 Score =   267 bits (682),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 143/160 (89%), Gaps = 1/160 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR+WASSTANALR+S  AS  P  +LSRCFSSVL+GLKYA SHEWVK EGSVAT+GIT
Sbjct  1    MALRMWASSTANALRIS-CASKTPAFALSRCFSSVLDGLKYASSHEWVKHEGSVATVGIT  59

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLGEVVFVELPE G +VKQG GFG VESVKATSDVNSPISGEV+EVN KLTE PG
Sbjct  60   DHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEVNTKLTETPG  119

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            ++NSSPYE+GW+IKVKPS+ S+L SLMDP+ YTKFCEEE+
Sbjct  120  LVNSSPYEEGWLIKVKPSSPSDLESLMDPQAYTKFCEEEN  159



>emb|CAB16914.1| H-Protein precursor [Flaveria pringlei]
Length=162

 Score =   266 bits (681),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 145/161 (90%), Gaps = 3/161 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLS-LSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MALRIWASSTANALRLS+A  ++P+ S LSRCFSSVL+GLKYA SHEWVK EGSVATIGI
Sbjct  1    MALRIWASSTANALRLSSA--TRPHFSPLSRCFSSVLDGLKYASSHEWVKHEGSVATIGI  58

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLGEVVFV+LP+ G +V + +GFGAVESVKATSDVNSPISGE+VEVN KL+E P
Sbjct  59   TDHAQDHLGEVVFVDLPDTGGSVTKATGFGAVESVKATSDVNSPISGEIVEVNTKLSETP  118

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G+INSSPYEDGWMIKVKPSN SEL SLM  KEYTKFCEEED
Sbjct  119  GLINSSPYEDGWMIKVKPSNPSELESLMGAKEYTKFCEEED  159



>ref|XP_010275285.1| PREDICTED: glycine cleavage system H protein, mitochondrial [Nelumbo 
nucifera]
Length=165

 Score =   266 bits (681),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 143/162 (88%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAA--SSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANALR+S  A  S  P  SLSRCFS+VL+GLKYA SHEWVK EGSVATIG
Sbjct  1    MALRMWASSTANALRISCTAKASLSPAFSLSRCFSTVLDGLKYASSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFVELPE G +V +G  FGAVESVKATSDVNSPISGE+VEVN+KL+E 
Sbjct  61   ITDHAQDHLGEVVFVELPEPGGSVSKGGSFGAVESVKATSDVNSPISGEIVEVNSKLSET  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYEDGWMIKVKPS+ SEL SLM PKEYTKFCEEED
Sbjct  121  PGLINSSPYEDGWMIKVKPSSPSELESLMGPKEYTKFCEEED  162



>emb|CAA88734.1| H-protein precursor of glycine cleavage system [Flaveria trinervia]
Length=163

 Score =   266 bits (680),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 144/160 (90%), Gaps = 3/160 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLS-LSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MALRIWASSTA ALRLS+A  S+P+ S L RCFSSVL+GLKYA SHEWVK EGSVATIGI
Sbjct  1    MALRIWASSTAKALRLSSA--SRPHFSPLFRCFSSVLDGLKYANSHEWVKHEGSVATIGI  58

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLGEVVFVELPEVG +V + +GFGAVESVKATSDVNSPISGE+VEVN+KLT+ P
Sbjct  59   TDHAQDHLGEVVFVELPEVGGSVTKATGFGAVESVKATSDVNSPISGEIVEVNSKLTKTP  118

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEE  691
            G+IN SPYEDGWMIKVKPSN SEL SLM PKEYTKFCEEE
Sbjct  119  GLINKSPYEDGWMIKVKPSNPSELDSLMGPKEYTKFCEEE  158



>gb|KHG09409.1| Glycine cleavage system H, mitochondrial [Gossypium arboreum]
Length=163

 Score =   265 bits (678),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR+WAS+TANAL++S A +  P  SLSRCFS+VL+GLKYA+SHEWVK EG VATIGIT
Sbjct  1    MALRMWASTTANALKISCATTKAPVFSLSRCFSTVLDGLKYAESHEWVKHEGPVATIGIT  60

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLGEVVFVELPE G +V +G GFGAVESVKATSDVNSPISGE+VEVN+KLTE PG
Sbjct  61   DHAQDHLGEVVFVELPEPGGSVSKGKGFGAVESVKATSDVNSPISGEIVEVNSKLTETPG  120

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            +INSSPYE GWMIKVKP + SEL SLM PKEYTKFCEEED
Sbjct  121  LINSSPYEGGWMIKVKPGSPSELESLMGPKEYTKFCEEED  160



>ref|XP_004300260.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
isoform 1 [Fragaria vesca subsp. vesca]
Length=166

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASS---KPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANALR+S  AS     P  SLSRCFS+VLEGLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALRISGGASKAQLSPAFSLSRCFSTVLEGLKYASSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFVELPE GT V Q S FG VESVKATSDVNSPISGEVVEVN KL+E
Sbjct  61   GITDHAQDHLGEVVFVELPEPGTVVSQSSSFGNVESVKATSDVNSPISGEVVEVNPKLSE  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+IN+SPYEDGWMIKVKPSN SEL SL+  KEYTKFCEEED
Sbjct  121  TPGLINTSPYEDGWMIKVKPSNPSELESLLGAKEYTKFCEEED  163



>gb|AFK42846.1| unknown [Lotus japonicus]
Length=166

 Score =   265 bits (676),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 143/163 (88%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASS---KPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS++AS     P  SLSRCFSSVL+GLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALKLSSSASRLHLSPPFSLSRCFSSVLDGLKYASSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGE VFVELPE G  V +G GFGAVESVKATSD+NSPISGE++EVN KL+E
Sbjct  61   GITDHAQDHLGEAVFVELPESGKPVTKGDGFGAVESVKATSDINSPISGEIIEVNTKLSE  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+IN+SPYEDGWMIKVKPS+ SEL SL+ P+EYTKFCEEED
Sbjct  121  QPGLINTSPYEDGWMIKVKPSSPSELDSLLGPQEYTKFCEEED  163



>gb|KCW77924.1| hypothetical protein EUGRSUZ_D02179 [Eucalyptus grandis]
Length=164

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSS-VLEGLKYAKSHEWVKSEGSVATIGI  391
            MALR+WASSTANALRLS+ AS  P  SL RCFSS +L+GLKYA SHEWVK EG VA++GI
Sbjct  1    MALRMWASSTANALRLSSKASLSPAFSLHRCFSSGILDGLKYAPSHEWVKHEGPVASVGI  60

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLGEVVFV+LPE G +V +G  FGAVESVKATSD+NSPISGE+VEVN KLTE P
Sbjct  61   TDHAQDHLGEVVFVDLPEPGGSVSKGGSFGAVESVKATSDINSPISGEIVEVNTKLTETP  120

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++NSSPYEDGWMIKVKPS+ SELGSLM PKEYTKFCEEED
Sbjct  121  GLVNSSPYEDGWMIKVKPSDPSELGSLMGPKEYTKFCEEED  161



>ref|XP_004244544.1| PREDICTED: glycine cleavage system H protein, mitochondrial isoform 
X1 [Solanum lycopersicum]
Length=161

 Score =   264 bits (675),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR+WASSTANALR+S+  S + N SLSRCFS+VLEGLKYA SHEWVK EGSVATIGIT
Sbjct  1    MALRMWASSTANALRVSSTVS-RTNFSLSRCFSTVLEGLKYASSHEWVKHEGSVATIGIT  59

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLGEVVFV+LP+ GT+V  GS FGAVESVKATSD+NSPISGE+VEVN KL+E PG
Sbjct  60   DHAQDHLGEVVFVDLPDSGTSVSHGSSFGAVESVKATSDINSPISGEIVEVNTKLSETPG  119

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            +INSSPYEDGWMIKVKPSN SEL SLM  KEYTK C+EE+
Sbjct  120  LINSSPYEDGWMIKVKPSNPSELESLMGAKEYTKLCDEEE  159



>ref|XP_007156655.1| hypothetical protein PHAVU_002G006000g [Phaseolus vulgaris]
 gb|ESW28649.1| hypothetical protein PHAVU_002G006000g [Phaseolus vulgaris]
Length=165

 Score =   264 bits (674),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 143/162 (88%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANAL+LS+A+     P  S SRC S+VL+GLKYA+SHEWVK EGSVATIG
Sbjct  1    MALRMWASSTANALKLSSASRPHLLPPFSFSRCLSTVLDGLKYAESHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFVELPE G AV + SGFGAVESVKATSD+NSPISGE+VEVN KLTE 
Sbjct  61   ITDHAQDHLGEVVFVELPEPGGAVSKNSGFGAVESVKATSDINSPISGEIVEVNTKLTET  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG++NSSPYEDGWMIKVKPS+ SEL SL+ PKEYTKFCEEED
Sbjct  121  PGLVNSSPYEDGWMIKVKPSDPSELESLLGPKEYTKFCEEED  162



>ref|XP_010269973.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
[Nelumbo nucifera]
Length=165

 Score =   264 bits (674),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 142/162 (88%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANALR+S AA S   P   LSRCFS+VL+GLKYA SHEWVK EG+VATIG
Sbjct  1    MALRMWASSTANALRVSCAAKSSLSPAFCLSRCFSTVLDGLKYASSHEWVKHEGAVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFVELPE G +V +G  FGAVESVKATSDVNSPISGE+VEVN KL+E 
Sbjct  61   ITDHAQDHLGEVVFVELPEPGGSVSKGGSFGAVESVKATSDVNSPISGEIVEVNTKLSEA  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYE+GWMIKVKPS+ SEL SLM PKEYTKFCEEED
Sbjct  121  PGLINSSPYENGWMIKVKPSSPSELESLMGPKEYTKFCEEED  162



>ref|XP_009803354.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009803355.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
isoform X2 [Nicotiana sylvestris]
Length=162

 Score =   263 bits (673),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR+WASSTANALR+S      P+ SLSRCFS+VL+GLKYA SHEWVK +GSVAT+GIT
Sbjct  1    MALRMWASSTANALRVSRTNLVAPSFSLSRCFSTVLDGLKYASSHEWVKHDGSVATVGIT  60

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLGEVVFV+LPE G +V QGS FGAVESVKATSD+N PISGE+VEVN KLTE PG
Sbjct  61   DHAQDHLGEVVFVDLPETGGSVSQGSSFGAVESVKATSDINCPISGEIVEVNTKLTETPG  120

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            ++NSSPYEDGWMIKVKPS+ SEL SLM  KEYTKFCEEED
Sbjct  121  LVNSSPYEDGWMIKVKPSSPSELESLMGSKEYTKFCEEED  160



>emb|CAA85759.1| H-protein, partial [Flaveria pringlei]
Length=161

 Score =   263 bits (673),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 144/160 (90%), Gaps = 3/160 (2%)
 Frame = +2

Query  218  ALRIWASSTANALRLSTAASSKPNLS-LSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            ALRIWASSTANALRLS+A  ++P+ S LSRCFSSVL+GLKYA SHEWVK EGSVATIGIT
Sbjct  1    ALRIWASSTANALRLSSA--TRPHFSPLSRCFSSVLDGLKYASSHEWVKHEGSVATIGIT  58

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLGEVVFV+LP+ G +V + +GFGAVESVKATSDVNSPISGE+VEVN KL+E PG
Sbjct  59   DHAQDHLGEVVFVDLPDTGGSVTKATGFGAVESVKATSDVNSPISGEIVEVNTKLSETPG  118

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            +INSSPYEDGWMIKVKPSN SEL SLM  KEYTKFCEEED
Sbjct  119  LINSSPYEDGWMIKVKPSNPSELESLMGAKEYTKFCEEED  158



>gb|KHN42617.1| Glycine cleavage system H protein, mitochondrial [Glycine soja]
Length=165

 Score =   263 bits (672),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 144/164 (88%), Gaps = 6/164 (4%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNL----SLSRCFSSVLEGLKYAKSHEWVKSEGSVAT  382
            MALR+WASSTANAL++S+A  S+P+L    S SRC SSVL+GLKYA SHEWVK EGSVAT
Sbjct  1    MALRMWASSTANALKVSSA--SRPHLLHPFSFSRCLSSVLDGLKYADSHEWVKHEGSVAT  58

Query  383  IGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLT  562
            IGITDHAQDHLGEVV+VELPE G  V Q SGFGAVESVKATSD+NSPISGE+VEVN KLT
Sbjct  59   IGITDHAQDHLGEVVYVELPESGGTVTQKSGFGAVESVKATSDINSPISGEIVEVNKKLT  118

Query  563  EGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            E PG++NSSPYEDGWMIKVKPS+ SEL SLM PKEYTKFCEEED
Sbjct  119  ETPGLVNSSPYEDGWMIKVKPSDPSELDSLMGPKEYTKFCEEED  162



>ref|XP_010104352.1| Glycine cleavage system H protein [Morus notabilis]
 gb|EXB99772.1| Glycine cleavage system H protein [Morus notabilis]
Length=174

 Score =   263 bits (673),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 145/171 (85%), Gaps = 11/171 (6%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANALR+S A+ +   P  SLSRCFS+VL+GLKYA SHEWVK EGSVATIG
Sbjct  1    MALRMWASSTANALRISCASKAHLSPAFSLSRCFSTVLDGLKYATSHEWVKHEGSVATIG  60

Query  389  ITDHAQ---------DHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVV  541
            ITDHAQ         DHLGEVVFVELPE   +V QGSGFGAVESVKATSDVNSPISGEVV
Sbjct  61   ITDHAQVITRLQYTADHLGEVVFVELPERKASVSQGSGFGAVESVKATSDVNSPISGEVV  120

Query  542  EVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            EVN+KL+E PG+IN+SPYEDGWMIKVKPSN +EL SL+ PKEYTKFCEEED
Sbjct  121  EVNSKLSESPGLINTSPYEDGWMIKVKPSNPAELESLLGPKEYTKFCEEED  171



>gb|ABO61731.1| mitochondrial glycine decarboxylase complex H-protein [Populus 
tremuloides]
Length=163

 Score =   262 bits (670),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 143/163 (88%), Gaps = 2/163 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANALR+S A+++   P+ SLSRCFS+VL+GLKYA SHEWVK EGSVATIG
Sbjct  1    MALRLWASSTANALRISVASTAHVSPSYSLSRCFSTVLDGLKYATSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFV+LPE   +V QG  FGAVESVKATSD+NSPISGE+VEVN +L+E 
Sbjct  61   ITDHAQDHLGEVVFVDLPEADDSVSQGKSFGAVESVKATSDINSPISGEIVEVNTQLSET  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEEDH  697
            PG+IN SPYE+GWMIKVKPSN SE+ SL+ PKEYTK CEEEDH
Sbjct  121  PGLINKSPYEEGWMIKVKPSNPSEIESLLGPKEYTKLCEEEDH  163



>ref|NP_001238231.1| uncharacterized protein LOC100306654 [Glycine max]
 gb|ACU14940.1| unknown [Glycine max]
Length=199

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 144/164 (88%), Gaps = 6/164 (4%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNL----SLSRCFSSVLEGLKYAKSHEWVKSEGSVAT  382
            MALR+WASSTANAL++S  ++S+P+L    S SRC SSVL+GLKYA SHEWVK EGSVAT
Sbjct  35   MALRMWASSTANALKVS--STSRPHLLHPFSFSRCLSSVLDGLKYADSHEWVKHEGSVAT  92

Query  383  IGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLT  562
            IGITDHAQDHLGEVV+VELPE G  V Q SGFGAVESVKATSD+NSPISGE+VEVN KLT
Sbjct  93   IGITDHAQDHLGEVVYVELPESGGTVTQKSGFGAVESVKATSDINSPISGEIVEVNKKLT  152

Query  563  EGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            E PG++NSSPYEDGWMIKVKPS+ SEL SLM PKEYTKFCEEED
Sbjct  153  ETPGLVNSSPYEDGWMIKVKPSDPSELDSLMGPKEYTKFCEEED  196



>ref|XP_006362496.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
[Solanum tuberosum]
Length=161

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR+WASSTANALR+S+  S + N SLSRCFS+VLEGLKYA SHEWVK EGSVATIGIT
Sbjct  1    MALRMWASSTANALRVSSTVS-RTNFSLSRCFSTVLEGLKYASSHEWVKHEGSVATIGIT  59

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLGEVVFV+LP+ GT+V  GS FGAVESVKATSD+NSPISGE++EVN KL+E PG
Sbjct  60   DHAQDHLGEVVFVDLPDTGTSVSHGSSFGAVESVKATSDINSPISGEIIEVNTKLSETPG  119

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            +INSSPYEDGWMIKVKPS+ SEL SLM  KEYTK C+EE+
Sbjct  120  LINSSPYEDGWMIKVKPSSPSELESLMGAKEYTKLCDEEE  159



>ref|XP_009615541.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=162

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR+WASSTANALR+S      P  SLSRCFS+VL+GLKYA SHEWVK +GSVATIGIT
Sbjct  1    MALRMWASSTANALRISRTNLIAPAFSLSRCFSTVLDGLKYASSHEWVKHDGSVATIGIT  60

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLGEVVFV+LPE G +  QGS FGAVESVKATSD+N PISGE+VEVN KLTE PG
Sbjct  61   DHAQDHLGEVVFVDLPETGGSASQGSSFGAVESVKATSDINCPISGEIVEVNTKLTETPG  120

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            ++NSSPYEDGWMIKVKPS+ SEL SLM  KEYTKFCEEED
Sbjct  121  LVNSSPYEDGWMIKVKPSSPSELESLMGSKEYTKFCEEED  160



>gb|EYU22153.1| hypothetical protein MIMGU_mgv1a015161mg [Erythranthe guttata]
Length=166

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 144/163 (88%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANALRLS+++SS    P  SLSR FS+VLEG KYA SHEWVK +GS+ATI
Sbjct  1    MALRMWASSTANALRLSSSSSSSRFAPAFSLSRTFSTVLEGFKYATSHEWVKHDGSIATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFVELP+ G AV+Q S FGAVESVKATSD+NSPISGEVVEVN KLTE
Sbjct  61   GITDHAQDHLGEVVFVELPDGGKAVEQASSFGAVESVKATSDINSPISGEVVEVNTKLTE  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYEDGWMIKVKPSN SEL SLM PKEYTKFCE+ED
Sbjct  121  SPGLINSSPYEDGWMIKVKPSNPSELESLMGPKEYTKFCEDED  163



>ref|XP_006361175.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
[Solanum tuberosum]
Length=163

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASS-KPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MALR+WASSTANALR+ST  +   P+ S+SRCFS+V++GLKYA SHEWVK EGSVAT+GI
Sbjct  1    MALRMWASSTANALRISTTNNIIAPSFSISRCFSTVIDGLKYASSHEWVKHEGSVATVGI  60

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLGEVVFV+LP+VG +V QGS FGAVESVKATSD+N PISGE+VEVN KL+E P
Sbjct  61   TDHAQDHLGEVVFVDLPDVGGSVSQGSSFGAVESVKATSDINCPISGEIVEVNTKLSETP  120

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G+INSSPYEDGWMIKVKPS+ SEL SLM  KEYTKFCEEED
Sbjct  121  GLINSSPYEDGWMIKVKPSSPSELESLMGSKEYTKFCEEED  161



>ref|XP_004148493.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
[Cucumis sativus]
 ref|XP_004164375.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
[Cucumis sativus]
 gb|KGN60412.1| Glycine cleavage system h protein [Cucumis sativus]
Length=165

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 143/162 (88%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANAL+LS+++ +   P+ SLSRCFS+VL+GLKYA SHEWVK EGSVAT+G
Sbjct  1    MALRMWASSTANALKLSSSSKTHLSPSFSLSRCFSTVLDGLKYASSHEWVKHEGSVATVG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFV+LPE G++V QG  FGAVESVKATSD+NSPISGE+VEVN +L E 
Sbjct  61   ITDHAQDHLGEVVFVDLPESGSSVSQGKSFGAVESVKATSDINSPISGEIVEVNPQLKES  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYE GWMIKVKPSN  EL SL+ PKEYTKFCEEED
Sbjct  121  PGLINSSPYEGGWMIKVKPSNPGELDSLLGPKEYTKFCEEED  162



>sp|P46485.1|GCSH_FLATR RecName: Full=Glycine cleavage system H protein, mitochondrial; 
AltName: Full=Lipoyl-bearing H protein; Flags: Precursor 
[Flaveria trinervia]
 emb|CAA85760.1| H-protein [Flaveria trinervia]
Length=165

 Score =   261 bits (668),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 144/162 (89%), Gaps = 5/162 (3%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLS-LSRCFSS--VLEGLKYAKSHEWVKSEGSVATI  385
            MALRIWASSTA ALRLS+A  S+P+ S L RCFSS  VL+GLKYA SHEWVK EGSVATI
Sbjct  1    MALRIWASSTAKALRLSSA--SRPHFSPLFRCFSSAAVLDGLKYANSHEWVKHEGSVATI  58

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFVELPEVG +V + +GFGAVESVKATSDVNSPISGE+VEVN+KLT+
Sbjct  59   GITDHAQDHLGEVVFVELPEVGGSVTKATGFGAVESVKATSDVNSPISGEIVEVNSKLTK  118

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEE  691
             PG+IN SPYEDGWMIKVKPSN SEL SLM PKEYTKFCEEE
Sbjct  119  TPGLINKSPYEDGWMIKVKPSNPSELDSLMGPKEYTKFCEEE  160



>ref|XP_004241973.1| PREDICTED: glycine cleavage system H protein, mitochondrial [Solanum 
lycopersicum]
Length=163

 Score =   261 bits (667),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASS-KPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MALR+WASSTANALR+ST  +   P+ S+SRCFS+V++GLKYA SHEWVK EGSVAT+GI
Sbjct  1    MALRMWASSTANALRISTTNNIIAPSFSISRCFSTVIDGLKYASSHEWVKHEGSVATVGI  60

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLGEVVFV+LP++G +V QGS FGAVESVKATSD+N PISGE+VEVN KL+E P
Sbjct  61   TDHAQDHLGEVVFVDLPDIGGSVSQGSSFGAVESVKATSDINCPISGEIVEVNTKLSETP  120

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G+INSSPYEDGWMIKVKPS+ SEL SLM  KEYTKFCEEED
Sbjct  121  GLINSSPYEDGWMIKVKPSSPSELESLMGSKEYTKFCEEED  161



>ref|XP_003539169.1| PREDICTED: glycine cleavage system H protein, mitochondrial [Glycine 
max]
 gb|KHN34856.1| Glycine cleavage system H protein, mitochondrial [Glycine soja]
Length=165

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 140/162 (86%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANAL+LS+ +     P  S SRC SSVL+GLKYA SHEWVK EGSVATIG
Sbjct  1    MALRMWASSTANALKLSSVSRPHLLPPFSFSRCLSSVLDGLKYADSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVV+VELPE G  V + SGFGAVESVKATSD+NSPISGE+VEVN KLTE 
Sbjct  61   ITDHAQDHLGEVVYVELPEPGGTVSKKSGFGAVESVKATSDINSPISGEIVEVNKKLTET  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG++NSSPYEDGWMIKVKPS+ SEL SLM PKEYTKFCEEED
Sbjct  121  PGLVNSSPYEDGWMIKVKPSDPSELDSLMGPKEYTKFCEEED  162



>ref|XP_008465945.1| PREDICTED: glycine cleavage system H protein, mitochondrial [Cucumis 
melo]
Length=165

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 143/162 (88%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANAL+LS+++ +   P+ SLSRCFS+VL+GLKYA SHEWVK EGSVAT+G
Sbjct  1    MALRMWASSTANALKLSSSSKTHLSPSFSLSRCFSTVLDGLKYASSHEWVKHEGSVATVG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFV+LPE G++V QG  FGAVESVKATSD+NSPISGE+VEVN +L E 
Sbjct  61   ITDHAQDHLGEVVFVDLPESGSSVSQGKSFGAVESVKATSDINSPISGEIVEVNPQLKET  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYE GWMIKVKPSN  EL SL+ PKEYTKFCEEED
Sbjct  121  PGLINSSPYEGGWMIKVKPSNPGELDSLLGPKEYTKFCEEED  162



>ref|XP_011028218.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
[Populus euphratica]
Length=164

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 142/162 (88%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANALR+S A+++   P+ SLSRCFS+V++GLKYA SHEWVK EG VATIG
Sbjct  1    MALRLWASSTANALRISVASTAHLSPSYSLSRCFSTVVDGLKYASSHEWVKHEGPVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFV+LPE   +V QG  FGAVESVKATSD+NSPISGE+VEVN KL+E 
Sbjct  61   ITDHAQDHLGEVVFVDLPEPEGSVSQGKSFGAVESVKATSDINSPISGEIVEVNTKLSET  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+IN SPYE+GWMIKVKPSN SEL SL+ PKEYTKFCEEED
Sbjct  121  PGLINKSPYEEGWMIKVKPSNPSELQSLLGPKEYTKFCEEED  162



>ref|XP_006385625.1| glycine cleavage system protein H precursor [Populus trichocarpa]
 gb|ABK95310.1| unknown [Populus trichocarpa]
 gb|ERP63422.1| glycine cleavage system protein H precursor [Populus trichocarpa]
Length=165

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 142/163 (87%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASS---KPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANALR+S A+S+    P+ SLSRCFS+V++GLKYA SHEWVK EG VATI
Sbjct  1    MALRLWASSTANALRISVASSTAHLSPSYSLSRCFSTVVDGLKYASSHEWVKHEGPVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFV+LPE   AV QG  FGAVESVKATSD+NSPISGE+VEVN KL+E
Sbjct  61   GITDHAQDHLGEVVFVDLPEPEGAVSQGKSFGAVESVKATSDINSPISGEIVEVNTKLSE  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+IN SPYE+GWMIKVKPSN SEL SL+ PKEYTKFCEEE+
Sbjct  121  TPGLINKSPYEEGWMIKVKPSNPSELQSLLGPKEYTKFCEEEE  163



>ref|XP_011018608.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
[Populus euphratica]
Length=163

 Score =   259 bits (661),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 142/163 (87%), Gaps = 2/163 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASS--KPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANALR+S A+++   P+ SLSRCFS+VL+GLKYA SHEWVK EGSVATIG
Sbjct  1    MALRLWASSTANALRISVASTAPVSPSCSLSRCFSTVLDGLKYATSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFV+LPE   +V QG  FGAVESVKATSD+NSPISGE+VEVN +L E 
Sbjct  61   ITDHAQDHLGEVVFVDLPEPDGSVSQGKSFGAVESVKATSDINSPISGEIVEVNTQLGET  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEEDH  697
            PG+IN SPYE+GWMIKVKPSN SE+ SL+ PKEYTK CEEEDH
Sbjct  121  PGLINKSPYEEGWMIKVKPSNPSEIESLLGPKEYTKLCEEEDH  163



>emb|CDP12988.1| unnamed protein product [Coffea canephora]
Length=164

 Score =   258 bits (660),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MA+R+WASSTANAL+LSTA   +  P  SLSRCFS+VLEG KYA SHEWVK EG VA +G
Sbjct  1    MAMRMWASSTANALKLSTAIRPQFSPAFSLSRCFSTVLEGFKYANSHEWVKHEGPVAAVG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFVELP+ G+ V QG  FG VESVKATSDVNSPISGEVVEVN+KL+E 
Sbjct  61   ITDHAQDHLGEVVFVELPDAGSVVSQGKSFGNVESVKATSDVNSPISGEVVEVNSKLSET  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEE  691
            PG+INSSPYEDGWMIKVKPSN SEL SLM  KEYTKFCEEE
Sbjct  121  PGLINSSPYEDGWMIKVKPSNPSELESLMGSKEYTKFCEEE  161



>gb|ACJ85876.1| unknown [Medicago truncatula]
Length=166

 Score =   258 bits (658),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 143/163 (88%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASS---KPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+L +++S     P  S+SRCFS+VL+GLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALKLPSSSSRLHLSPPFSISRCFSTVLDGLKYASSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFVELPE G +V +G+GFGAVESVKATSDVNSPISGE+VEVN KLT 
Sbjct  61   GITDHAQDHLGEVVFVELPEPGGSVTKGNGFGAVESVKATSDVNSPISGEIVEVNDKLTG  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYEDGWMIK+KPS+ SEL SL+  KEYTKFCEEED
Sbjct  121  KPGLINSSPYEDGWMIKIKPSDPSELESLLGAKEYTKFCEEED  163



>gb|ABK96453.1| unknown [Populus trichocarpa x Populus deltoides]
Length=165

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 141/163 (87%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASS---KPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANALR+S A+S+    P+ SLSRCFS+V++GLKYA SHEWVK EG VATI
Sbjct  1    MALRLWASSTANALRISVASSTAHLSPSYSLSRCFSTVVDGLKYASSHEWVKHEGPVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFV+LPE    V QG  FGAVESVKATSD+NSPISGE+VEVN KL+E
Sbjct  61   GITDHAQDHLGEVVFVDLPEPEGPVSQGKSFGAVESVKATSDINSPISGEIVEVNTKLSE  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+IN SPYE+GWMIKVKPSN SEL SL+ PKEYTKFCEEE+
Sbjct  121  TPGLINKSPYEEGWMIKVKPSNPSELQSLLGPKEYTKFCEEEE  163



>ref|XP_008799361.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial-like 
[Phoenix dactylifera]
Length=166

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 142/163 (87%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNL---SLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MAL++WASSTANAL++S + +  P L   S+SRCFSSVL+GLKY  SHEWVK+EGSVATI
Sbjct  1    MALKLWASSTANALKISCSGAKTPPLLPFSISRCFSSVLDGLKYTSSHEWVKNEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQ HLGEVVFVELPE  ++V +G  FGAVESVKATSDVNSP++GEVVEVN KLTE
Sbjct  61   GITDHAQGHLGEVVFVELPEAASSVSKGGSFGAVESVKATSDVNSPVAGEVVEVNTKLTE  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYEDGWMIKV+PS+ SEL SLM PKEYTKFCEEED
Sbjct  121  TPGLINSSPYEDGWMIKVRPSSPSELDSLMGPKEYTKFCEEED  163



>ref|XP_006368429.1| glycine cleavage system protein H precursor [Populus trichocarpa]
 gb|ABK96504.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP64998.1| glycine cleavage system protein H precursor [Populus trichocarpa]
Length=163

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 142/163 (87%), Gaps = 2/163 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANALR+S A+++   P+ SLSRCFS+VL+GLKYA SHEWVK EGS+ATIG
Sbjct  1    MALRLWASSTANALRISVASTAHVSPSYSLSRCFSTVLDGLKYATSHEWVKHEGSLATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFV+LPE   +V QG  FGAVESVKATSD+NSPISGE+VEVN +L+E 
Sbjct  61   ITDHAQDHLGEVVFVDLPEPDGSVSQGKSFGAVESVKATSDINSPISGEIVEVNTQLSET  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEEDH  697
            PG+IN SPYE+GWMIKVKPSN SEL SL+  KEYTK CEEEDH
Sbjct  121  PGLINKSPYEEGWMIKVKPSNPSELESLLGAKEYTKLCEEEDH  163



>ref|XP_009114880.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial 
[Brassica rapa]
 emb|CDX93831.1| BnaA09g24310D [Brassica napus]
Length=166

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 141/163 (87%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS++AS     P  S+SRCFSSVLEGLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALKLSSSASRSHLLPAFSISRCFSSVLEGLKYANSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GI+DHAQDHLGEVVFVELPE  ++V +   FGAVESVKATS++ SPISGEV+EVN KL +
Sbjct  61   GISDHAQDHLGEVVFVELPEEKSSVTKEKNFGAVESVKATSEIISPISGEVIEVNTKLAD  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYEDGWMIKVKPSN +EL SLM PKEYTKFCEEED
Sbjct  121  SPGLINSSPYEDGWMIKVKPSNPAELESLMGPKEYTKFCEEED  163



>gb|AAQ67414.2| mitochondrial glycine decarboxylase complex H-protein [Populus 
tremuloides]
Length=165

 Score =   256 bits (653),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 142/163 (87%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASS---KPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANALR+S A+S+    P+ SLSRCFS+V++GLKYA SHEWVK EG VATI
Sbjct  1    MALRLWASSTANALRISVASSAAHLSPSYSLSRCFSTVVDGLKYASSHEWVKHEGPVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFV+LPE   +V QG  FGAVESVKATSD+NSPISGE+VEVN KL+E
Sbjct  61   GITDHAQDHLGEVVFVDLPEPEGSVSQGKSFGAVESVKATSDINSPISGEIVEVNTKLSE  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+IN SPYE+GWMIKVKPS+ SEL SL+ PKEYTKFCEEE+
Sbjct  121  TPGLINKSPYEEGWMIKVKPSDPSELQSLLGPKEYTKFCEEEE  163



>ref|XP_009395148.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=164

 Score =   253 bits (645),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 138/162 (85%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLST--AASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MAL++WASS ANALR+S   A +  P  S+SRCFSSV++GLKY  SHEWVK EGSVATIG
Sbjct  1    MALKLWASSAANALRISCSGARTPFPAFSISRCFSSVIDGLKYTSSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQ HLGEVVFVELPE G AV +G  FGAVESVKATSDVNSP+SGEV+EVNAKLTE 
Sbjct  61   ITDHAQGHLGEVVFVELPESGVAVAKGGSFGAVESVKATSDVNSPVSGEVIEVNAKLTET  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+IN+SPYEDGWMIKVKPS+ SEL SLM  KEYTK CEEED
Sbjct  121  PGLINTSPYEDGWMIKVKPSDPSELNSLMGSKEYTKCCEEED  162



>ref|XP_010531734.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial 
[Tarenaya hassleriana]
Length=165

 Score =   252 bits (644),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 140/162 (86%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANAL+LS A+ S   P  S+SRCFS+VLEGLKYA SHEWVK EGSVATIG
Sbjct  1    MALRMWASSTANALKLSCASKSSLSPAFSVSRCFSTVLEGLKYANSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFVELP+  ++V +   FGAVESVKATS++ SPISGEV+E+N KL + 
Sbjct  61   ITDHAQDHLGEVVFVELPDEKSSVNKDKPFGAVESVKATSEIISPISGEVIEINTKLGDS  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYEDGWMIKVKPS+ SEL SLM PKEYTKFCEEED
Sbjct  121  PGLINSSPYEDGWMIKVKPSSPSELESLMGPKEYTKFCEEED  162



>ref|XP_010461070.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial 
[Camelina sativa]
Length=166

 Score =   252 bits (644),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 139/163 (85%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS+  S     P  S+SRCFSSVLEGLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALKLSSTVSKSHLSPGFSISRCFSSVLEGLKYANSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQ HLGEVVF ELPE+ ++V +   FGAVESVKATS++ SPISGEVVEVN KLTE
Sbjct  61   GITDHAQGHLGEVVFAELPELNSSVSKEKNFGAVESVKATSEILSPISGEVVEVNTKLTE  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+IN+SPYE+GWMIKVKPSN +EL +LM PKEYTKFCE+ED
Sbjct  121  SPGLINTSPYEEGWMIKVKPSNPAELETLMGPKEYTKFCEDED  163



>ref|XP_010941216.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial-like 
[Elaeis guineensis]
Length=215

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 142/165 (86%), Gaps = 3/165 (2%)
 Frame = +2

Query  209  KTMALRIWASSTANALRLSTAASSKPNL---SLSRCFSSVLEGLKYAKSHEWVKSEGSVA  379
            ++MAL++WASSTANAL++S   +  P     S+SRCFSSVL+GLKY+ SHEWVK EGSVA
Sbjct  48   ESMALKLWASSTANALKISCGGAKTPPFLPFSISRCFSSVLDGLKYSSSHEWVKHEGSVA  107

Query  380  TIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKL  559
            T+GITDHAQ HLGEVVFVELPE G+++ +G  FGAVESVKATSDVNSP+SGEVVEVN KL
Sbjct  108  TVGITDHAQGHLGEVVFVELPEAGSSISKGGSFGAVESVKATSDVNSPVSGEVVEVNTKL  167

Query  560  TEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            TE PG+INSSPY+DGWMIKV+P + SEL SLM PKEYTKFCE+ED
Sbjct  168  TEVPGLINSSPYDDGWMIKVRPGSPSELDSLMGPKEYTKFCEDED  212



>ref|XP_010538375.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial-like 
[Tarenaya hassleriana]
Length=165

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 138/162 (85%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTA--ASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANAL+LS A  A+  P  S+SRCFS+VLEGLKYA SHEWVK EGSVA IG
Sbjct  1    MALRMWASSTANALKLSRASKANLSPAFSISRCFSTVLEGLKYASSHEWVKHEGSVAIIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            I+DHAQDHLGEVVFVELPE   +V +   FGAVESVKATS++ SPISGEV+E+N KL + 
Sbjct  61   ISDHAQDHLGEVVFVELPEENASVNKDKAFGAVESVKATSEIISPISGEVIEINTKLADS  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYEDGWMIKVKPS+ SEL SLM PKEYTKFCEEED
Sbjct  121  PGLINSSPYEDGWMIKVKPSSPSELESLMGPKEYTKFCEEED  162



>ref|XP_010478667.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial-like 
[Camelina sativa]
Length=166

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 139/163 (85%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS+  S     P  S+SRCFSSVLEGLKYA SHEWVK EGSVAT+
Sbjct  1    MALRMWASSTANALKLSSTVSKSHLSPAFSISRCFSSVLEGLKYANSHEWVKHEGSVATV  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQ HLGEVVF ELPE+ ++V +   FGAVESVKATS++ SPISGEV+EVN KLTE
Sbjct  61   GITDHAQGHLGEVVFAELPELNSSVSKEKNFGAVESVKATSEILSPISGEVIEVNTKLTE  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+IN+SPYE+GWMIKVKPSN +EL +LM PKEYTKFCE+ED
Sbjct  121  SPGLINTSPYEEGWMIKVKPSNPAELETLMGPKEYTKFCEDED  163



>ref|XP_009387258.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=164

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 139/162 (86%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MAL++WASSTANALR+S ++S    P  S+ R FSSV+EGLKY  SHEWVK EGSVAT+G
Sbjct  1    MALKLWASSTANALRISCSSSRPAFPAFSIFRSFSSVIEGLKYTGSHEWVKQEGSVATVG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQ HLGEVVFVELPE G AV +GS FGAVESVKATSDVNSP+SGEV+E+N +LTE 
Sbjct  61   ITDHAQGHLGEVVFVELPESGAAVAKGSSFGAVESVKATSDVNSPVSGEVIEINTRLTET  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYEDGWMIKV+PS+ SE+ SLM  KEYTKFCEEED
Sbjct  121  PGLINSSPYEDGWMIKVRPSDPSEVKSLMGSKEYTKFCEEED  162



>emb|CAA85757.1| H-protein [Flaveria chlorifolia]
 emb|CAA85758.1| H-protein [Flaveria linearis]
 emb|CAA85766.1| H-protein [Flaveria floridana]
Length=152

 Score =   250 bits (638),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 139/154 (90%), Gaps = 3/154 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLS-LSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MALR+WASSTANALRLS+A  ++P+ S LSRCFSSVL+GLKYA SHEWVK EGSVAT+GI
Sbjct  1    MALRMWASSTANALRLSSA--TRPHFSPLSRCFSSVLDGLKYANSHEWVKHEGSVATVGI  58

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLGEVVFV+LPE G +V + +GFGAVESVKATSDVNSPISGE+VEVN+KL+E P
Sbjct  59   TDHAQDHLGEVVFVDLPEAGGSVTKATGFGAVESVKATSDVNSPISGEIVEVNSKLSETP  118

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYT  673
            G+INSSPYEDGWMIKVKPSN SEL SLM  KEYT
Sbjct  119  GLINSSPYEDGWMIKVKPSNPSELDSLMGAKEYT  152



>ref|XP_006847689.1| hypothetical protein AMTR_s00149p00054540 [Amborella trichopoda]
 gb|ERN09270.1| hypothetical protein AMTR_s00149p00054540 [Amborella trichopoda]
Length=162

 Score =   250 bits (638),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 138/160 (86%), Gaps = 1/160 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR+WASSTANALR+S   +S     LSR FSSVL+GLKY++SHEWVK EG VATIGIT
Sbjct  1    MALRLWASSTANALRISCGTNSTA-FYLSRSFSSVLDGLKYSESHEWVKHEGPVATIGIT  59

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLGEVVFV+LPE G +V +G GFGAVESVKATSDVNSPISGEVVEVN KL+  PG
Sbjct  60   DHAQDHLGEVVFVDLPETGVSVSKGGGFGAVESVKATSDVNSPISGEVVEVNTKLSGAPG  119

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            +INSSPYE+GWMIKVKPSN SEL SLM  KEYTKFCE+E+
Sbjct  120  LINSSPYEEGWMIKVKPSNPSELESLMGSKEYTKFCEDEN  159



>sp|P49360.1|GCSH_FLAPU RecName: Full=Glycine cleavage system H protein, mitochondrial; 
Flags: Precursor, partial [Flaveria pubescens]
 emb|CAA85768.1| H-protein [Flaveria pubescens]
Length=152

 Score =   249 bits (637),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 139/154 (90%), Gaps = 3/154 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLS-LSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MALR+WASSTANALRLS+A  ++P+ S LSRCFSSVL+GLKYA SHEWVK EGSVAT+GI
Sbjct  1    MALRMWASSTANALRLSSA--TRPHYSPLSRCFSSVLDGLKYANSHEWVKHEGSVATVGI  58

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLGEVVFV+LPE G +V + +GFGAVESVKATSDVNSPISGE+VEVN+KL+E P
Sbjct  59   TDHAQDHLGEVVFVDLPEAGGSVTKATGFGAVESVKATSDVNSPISGEIVEVNSKLSETP  118

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYT  673
            G+INSSPYEDGWMIKVKPSN SEL SLM  KEYT
Sbjct  119  GLINSSPYEDGWMIKVKPSNPSELDSLMGAKEYT  152



>emb|CAA85756.1| H-protein, partial [Flaveria cronquistii]
Length=152

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 139/154 (90%), Gaps = 3/154 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLS-LSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MALR+WASSTANALRLS+A  ++P+ S LSRCFSSVL+GLK+A SHEWVK EGSVATIGI
Sbjct  1    MALRMWASSTANALRLSSA--TRPHFSPLSRCFSSVLDGLKHANSHEWVKHEGSVATIGI  58

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLGEVVFV+LPE G +V + +GFGAVESVKATSDVNSPISGE+VEVN+KL+E P
Sbjct  59   TDHAQDHLGEVVFVDLPETGGSVTKATGFGAVESVKATSDVNSPISGEIVEVNSKLSETP  118

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYT  673
            G+INSSPYEDGWMIKVKPSN SEL SLM  KEYT
Sbjct  119  GLINSSPYEDGWMIKVKPSNPSELDSLMGAKEYT  152



>emb|CAA85755.1| H-protein, partial [Flaveria cronquistii]
Length=152

 Score =   249 bits (635),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 138/154 (90%), Gaps = 3/154 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLS-LSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MALR+WASSTANALRLS+A  ++P+ S LSRCFSSVL+GLKYA SHEWVK EGSVATIGI
Sbjct  1    MALRMWASSTANALRLSSA--TRPHFSPLSRCFSSVLDGLKYATSHEWVKHEGSVATIGI  58

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLGEVVFV+LP+ G +V + +GFGAVESVKATSDVNSPISGE+VEVN KL+E P
Sbjct  59   TDHAQDHLGEVVFVDLPDTGGSVTKATGFGAVESVKATSDVNSPISGEIVEVNTKLSETP  118

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYT  673
            G+INSSPYEDGWMIKVKPSN SEL SLM  KEYT
Sbjct  119  GLINSSPYEDGWMIKVKPSNPSELESLMGAKEYT  152



>ref|XP_003611464.1| Glycine cleavage system H protein [Medicago truncatula]
 gb|AES94422.1| glycine cleavage system H protein [Medicago truncatula]
 gb|AFK47219.1| unknown [Medicago truncatula]
Length=166

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 144/163 (88%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS+++S     P  S+SRCFS+VL+GLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALKLSSSSSRLHLSPPFSISRCFSTVLDGLKYASSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFVELPE G +V +G+GFGAVESVKATSDVNSPISGE+VEVN KLT 
Sbjct  61   GITDHAQDHLGEVVFVELPEPGGSVTKGNGFGAVESVKATSDVNSPISGEIVEVNDKLTG  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYEDGWMIK+KPS+ SEL SL+  KEYTKFCEEED
Sbjct  121  KPGLINSSPYEDGWMIKIKPSDPSELESLLGAKEYTKFCEEED  163



>ref|NP_001065060.1| Os10g0516100 [Oryza sativa Japonica Group]
 sp|A2Z9B8.1|GCSH_ORYSI RecName: Full=Glycine cleavage system H protein, mitochondrial; 
Flags: Precursor [Oryza sativa Indica Group]
 sp|A3C6G9.1|GCSH_ORYSJ RecName: Full=Glycine cleavage system H protein, mitochondrial; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAK39594.1|AC025296_29 putative glycine decarboxylase subunit [Oryza sativa Japonica 
Group]
 gb|AAP54618.1| Glycine cleavage system H protein, mitochondrial precursor, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF26974.1| Os10g0516100 [Oryza sativa Japonica Group]
 gb|EAY79202.1| hypothetical protein OsI_34315 [Oryza sativa Indica Group]
 gb|EAZ16682.1| hypothetical protein OsJ_32157 [Oryza sativa Japonica Group]
 dbj|BAG88468.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96987.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00033.1| unnamed protein product [Oryza sativa Japonica Group]
Length=164

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 139/162 (86%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASS ANAL++S + +++  P  S+SR FS+VL+GLKY+ SHEWVK++GSVATIG
Sbjct  1    MALRLWASSAANALKISCSGATRAAPAYSISRYFSTVLDGLKYSSSHEWVKNDGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQ HLGEVVFVELPE G  V QG  FG VESVKATSD+NSPISGEVVEVN KL+E 
Sbjct  61   ITDHAQGHLGEVVFVELPEAGAKVSQGGAFGNVESVKATSDINSPISGEVVEVNDKLSET  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYEDGWMIKVKPS+ SEL +L+DP +YTK CEEED
Sbjct  121  PGLINSSPYEDGWMIKVKPSSPSELDALLDPAKYTKHCEEED  162



>ref|XP_010677275.1| PREDICTED: glycine cleavage system H protein, mitochondrial [Beta 
vulgaris subsp. vulgaris]
Length=164

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 136/162 (84%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKP--NLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTAN+L +S A+ + P    SLSRCFS+VL+ LKYA SHEWVK EGSVATIG
Sbjct  1    MALRMWASSTANSLGISCASKALPFPAFSLSRCFSTVLDNLKYASSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            +TDHAQ HLG+VVF ELP+ G  V  G  F +VESVKATSDVNSPISGE+VEVN KL+E 
Sbjct  61   VTDHAQHHLGDVVFAELPDGGVGVTAGKAFASVESVKATSDVNSPISGEIVEVNTKLSET  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG++NSSPYEDGWMIKVKPSN +EL SLM PKEYTKFCEEED
Sbjct  121  PGLLNSSPYEDGWMIKVKPSNPAELESLMGPKEYTKFCEEED  162



>ref|NP_174525.1| probable glycine cleavage system H protein 2 [Arabidopsis thaliana]
 sp|Q9LQL0.1|GCSH3_ARATH RecName: Full=Glycine cleavage system H protein 3, mitochondrial; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF81345.1|AC007767_25 Identical to a glycine cleavage system H-protein precursor from 
Arabidopsis thaliana gb|P25855. It contains a glycine cleavage 
H-protein domain PF|01597. ESTs gb|R90208, gb|AI994794, 
gb|AA605324, gb|N38240, gb|AV533336, gb|AV534187, gb|AA597419 
and gb|AA597515 come from this gene [Arabidopsis thaliana]
 gb|AAG48828.1|AF332465_1 putative glycine cleavage system H protein precursor [Arabidopsis 
thaliana]
 gb|AAK60330.1|AF385740_1 At1g32470/F5D14_10 [Arabidopsis thaliana]
 gb|AAL77729.1| At1g32470/F5D14_10 [Arabidopsis thaliana]
 gb|AEE31490.1| probable glycine cleavage system H protein 2 [Arabidopsis thaliana]
Length=166

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 142/163 (87%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS++AS     P  S+SRCFSSVLEGLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALKLSSSASKSHLLPAFSISRCFSSVLEGLKYANSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFVELPE  ++V +   FGAVESVKATS++ SPISGEV+EVN KLTE
Sbjct  61   GITDHAQDHLGEVVFVELPEANSSVSKEKSFGAVESVKATSEILSPISGEVIEVNTKLTE  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYEDGWMIKVKPS+ +EL +LM PKEYTKFCEEED
Sbjct  121  SPGLINSSPYEDGWMIKVKPSSPAELEALMGPKEYTKFCEEED  163



>emb|CDY32279.1| BnaC05g28570D [Brassica napus]
Length=166

 Score =   245 bits (626),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 141/163 (87%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS++ S     P  S+SRCFSSVLEGLKYA SHEWVK +GSVATI
Sbjct  1    MALRMWASSTANALKLSSSTSKSHLLPAFSISRCFSSVLEGLKYANSHEWVKHDGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFVELPE  ++V +   FGAVESVKATS++ SPISGEV+EVN KLT+
Sbjct  61   GITDHAQDHLGEVVFVELPEEKSSVSKEKNFGAVESVKATSEILSPISGEVIEVNTKLTD  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYEDGWMIKVKPSN +EL +LM PKEYTKFCEEED
Sbjct  121  SPGLINSSPYEDGWMIKVKPSNPAELETLMGPKEYTKFCEEED  163



>sp|P16048.1|GCSH_PEA RecName: Full=Glycine cleavage system H protein, mitochondrial; 
Flags: Precursor [Pisum sativum]
 emb|CAA45978.1| H protein [Pisum sativum]
 gb|AAA33668.1| H-protein of glycine decarboxylase precursor (EC 2.1.2.10) [Pisum 
sativum]
 emb|CAA37704.1| H-protein [Pisum sativum]
 emb|CAI79404.1| H-protein [Pisum fulvum]
 emb|CAJ13415.1| H subunit of glycine decarboxylase multi-enzyme complex [Pisum 
fulvum]
 emb|CAJ13721.1| H-protein of the glycine decarboxylase multi-enzyme complex [Pisum 
sativum var. pumilio]
 emb|CAJ13722.1| H-protein of the glycine decarboxylase multi-enzyme complex [Pisum 
sativum var. pumilio]
 emb|CAJ13724.1| H-protein of the glycine decarboxylase multi-enzyme complex [Pisum 
sativum]
 emb|CAJ13725.1| H-protein of the glycine decarboxylase multi-enzyme complex [Pisum 
sativum]
 emb|CAJ13726.1| H-protein of the glycine decarboxylase multi-enzyme complex [Pisum 
sativum]
 emb|CAJ13727.1| H protein of the glycine decarboxylase multi-enzyme complex [Pisum 
fulvum]
 emb|CAJ13728.1| H protein of the glycine decarboxylase multi-enzyme complex [Pisum 
fulvum]
 emb|CAJ13729.1| H-protein, glycine decarboxylase multi-enzyme complex [Pisum 
sativum subsp. elatius]
 emb|CAJ13730.1| H-protein, glycine decarboxylase multi-enzyme complex [Pisum 
sativum subsp. elatius]
 emb|CAJ13731.1| H-protein, glycine decarboxylase multi-enzyme complex [Pisum 
sativum subsp. elatius]
 emb|CAJ13732.1| H-protein, glycine decarboxylase multi-enzyme complex [Pisum 
sativum subsp. elatius]
 emb|CAJ13733.1| H-protein from the glycine decarboxylase multi-enzyme complex 
[Pisum abyssinicum]
 emb|CAJ13734.1| H-protein from the glycine decarboxylase multi-enzyme complex 
[Pisum abyssinicum]
 emb|CAJ13735.1| H-protein from the glycine decarboxylase multi-enzyme complex 
[Pisum abyssinicum]
 emb|CAJ13736.1| H-protein from the glycine decarboxylase multi-enzyme complex 
[Pisum abyssinicum]
 emb|CAJ13828.1| glycine decarboxylase multi-enzyme complex, H subunit [Pisum 
sativum]
 emb|CAJ13829.1| glycine decarboxylase multi-enzyme complex, H subunit [Pisum 
sativum]
 emb|CAJ13830.1| glycine decarboxylase multi-enzyme complex, H subunit [Pisum 
sativum]
 emb|CAJ13831.1| glycine decarboxylase multi-enzyme complex, H subunit [Pisum 
sativum]
 emb|CAJ13832.1| glycine decarboxylase multi-enzyme complex, H subunit [Pisum 
sativum]
 emb|CAJ13833.1| glycine decarboxylase multi-enzyme complex, H subunit [Pisum 
sativum subsp. asiaticum]
 emb|CAJ13834.1| glycine decarboxylase multi-enzyme complex, H subunit [Pisum 
sativum]
 emb|CAJ13835.1| glycine decarboxylase multi-enzyme complex, H subunit [Pisum 
sativum]
 emb|CAJ13836.1| glycine decarboxylase multi-enzyme complex, H subunit [Pisum 
sativum var. tibetanicum]
 emb|CAJ13837.1| glycine decarboxylase multi-enzyme complex, H subunit [Pisum 
sativum subsp. transcaucasicum]
 emb|CAJ13838.1| glycine decarboxylase multi-enzyme complex, H subunit [Pisum 
sativum subsp. transcaucasicum]
 emb|CAJ13839.1| glycine decarboxylase multi-enzyme complex, H subunit [Pisum 
sativum]
 emb|CAJ13840.1| glycine decarboxylase multi-enzyme complex, H subunit [Pisum 
sativum]
Length=165

 Score =   245 bits (625),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 140/162 (86%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANAL+LS+++     P  S+SRCFS+VL+GLKYA SHEWVK EGSVATIG
Sbjct  1    MALRMWASSTANALKLSSSSRLHLSPTFSISRCFSNVLDGLKYAPSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFVELPE G +V +G GFGAVESVKATSDVNSPISGEV+EVN  LT  
Sbjct  61   ITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKATSDVNSPISGEVIEVNTGLTGK  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYEDGWMIK+KP++  EL SL+  KEYTKFCEEED
Sbjct  121  PGLINSSPYEDGWMIKIKPTSPDELESLLGAKEYTKFCEEED  162



>ref|XP_003574175.1| PREDICTED: glycine cleavage system H protein, mitochondrial [Brachypodium 
distachyon]
Length=164

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 139/162 (86%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLST--AASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASS ANAL++S+  A ++ P  S+SR FS+VL+GLKY+ SHEWVK+EG+VATIG
Sbjct  1    MALRLWASSAANALKISSSGARAAAPAYSISRYFSTVLDGLKYSSSHEWVKNEGTVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            I+DHAQ HLGEVVFVELPE GT V QG  FG VESVKATSDVNSPISGEVVEVN KL+  
Sbjct  61   ISDHAQGHLGEVVFVELPEAGTKVTQGGAFGNVESVKATSDVNSPISGEVVEVNEKLSGT  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+IN+SPYEDGWMIKVKPS+ SEL +L+DP +YTK CEEED
Sbjct  121  PGLINTSPYEDGWMIKVKPSSPSELDALLDPAKYTKHCEEED  162



>ref|XP_010505041.1| PREDICTED: glycine cleavage system H protein 1, mitochondrial 
[Camelina sativa]
 ref|XP_010509623.1| PREDICTED: glycine cleavage system H protein 1, mitochondrial 
[Camelina sativa]
 ref|XP_010516715.1| PREDICTED: glycine cleavage system H protein 1, mitochondrial 
[Camelina sativa]
Length=166

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 136/163 (83%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LST+ S     P  S+SRCFS+VLEGLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALKLSTSVSKSHLSPAFSISRCFSTVLEGLKYANSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GIT HAQDHLGEVVFVELPE  + V +   FGAVESVKATS++ SPISGEV+EVN  LT 
Sbjct  61   GITAHAQDHLGEVVFVELPEENSTVSKEKSFGAVESVKATSEILSPISGEVIEVNKNLTG  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+IN+SPYEDGWMIKVKPS+ +EL SLM  KEYTKFCE+ED
Sbjct  121  SPGLINTSPYEDGWMIKVKPSSPAELESLMGAKEYTKFCEDED  163



>ref|XP_004511777.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
[Cicer arietinum]
Length=164

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK-PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MALR+WASSTANAL+LS+++SSK P  SLSR FSSVL+GLKY+ SHEWVK EGS+ATIGI
Sbjct  1    MALRMWASSTANALKLSSSSSSKLPPFSLSRSFSSVLDGLKYSSSHEWVKHEGSIATIGI  60

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQ+HLGEVVFVELPE G +V +G+GFGAVESVKATSDVNSPISGE+VEVN KLT  P
Sbjct  61   TDHAQEHLGEVVFVELPEAGGSVSKGNGFGAVESVKATSDVNSPISGEIVEVNDKLTGKP  120

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G+INSSPYEDGWMIK+KPS+ +EL SL+  KEYTKFCEEED
Sbjct  121  GLINSSPYEDGWMIKIKPSSPTELDSLLGAKEYTKFCEEED  161



>emb|CDY65367.1| BnaA05g34950D [Brassica napus]
Length=166

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 139/163 (85%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS++ S     P  S+SRCFSSVLEGLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALKLSSSVSKSQLSPAFSISRCFSSVLEGLKYANSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFVELPE   +V +   FGAVESVKATS++ SPISGEV+EVN KL+E
Sbjct  61   GITDHAQDHLGEVVFVELPEENGSVSKEKSFGAVESVKATSEILSPISGEVIEVNKKLSE  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYEDGWMIKVKPSN SEL SLM  KEYTKFCEEED
Sbjct  121  APGLINSSPYEDGWMIKVKPSNPSELESLMGSKEYTKFCEEED  163



>ref|XP_006415191.1| hypothetical protein EUTSA_v10008944mg [Eutrema salsugineum]
 gb|ESQ33544.1| hypothetical protein EUTSA_v10008944mg [Eutrema salsugineum]
Length=166

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 141/163 (87%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS++AS     P  S+SRCFSSVLEGLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALKLSSSASKSHLLPAFSISRCFSSVLEGLKYANSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQ HLGEVVFVELPE  +AV +   FGAVESVKATS++ SPISGEV+EVN KLT+
Sbjct  61   GITDHAQGHLGEVVFVELPEEKSAVSKEKNFGAVESVKATSEILSPISGEVIEVNTKLTD  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYEDGWMIKVKPSN +EL SLM PKEYTKFCEEED
Sbjct  121  SPGLINSSPYEDGWMIKVKPSNPAELESLMGPKEYTKFCEEED  163



>ref|XP_009107967.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial-like 
[Brassica rapa]
Length=166

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 142/163 (87%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS++AS     P  S+SRCFSSVLEGLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALKLSSSASKSHLLPAFSISRCFSSVLEGLKYANSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GI+DHAQDHLGEVVFVELPE  ++V +G  FGAVESVKATS++ SPISGEV+EVN KL +
Sbjct  61   GISDHAQDHLGEVVFVELPEEKSSVSKGKNFGAVESVKATSEIISPISGEVIEVNTKLAD  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYE+GWMIKVKPSN +EL SLM PKEYTKFCEEED
Sbjct  121  SPGLINSSPYEEGWMIKVKPSNPAELESLMGPKEYTKFCEEED  163



>emb|CAJ13723.1| H-protein of the glycine decarboxylase multi-enzyme complex [Pisum 
sativum var. pumilio]
Length=165

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 139/162 (86%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANAL+LS+++     P  S+SRCFS+VL+GLKYA SHEWVK EGSVATIG
Sbjct  1    MALRMWASSTANALKLSSSSRLHLSPTFSISRCFSNVLDGLKYAPSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFVELPE G +V +G GFGAVESVKATSDVNSPISGEV+EVN  LT  
Sbjct  61   ITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKATSDVNSPISGEVIEVNTGLTGK  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYEDGWMIK+KP+   EL SL+  KEYTKFCEEED
Sbjct  121  PGLINSSPYEDGWMIKIKPTIPDELESLLGAKEYTKFCEEED  162



>emb|CDX84215.1| BnaC04g09770D [Brassica napus]
Length=166

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 139/163 (85%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS++ S     P  S+SRCFSSVLEGLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALKLSSSVSKSQLSPAFSISRCFSSVLEGLKYANSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFVELPE   +V++   FGAVESVKATS++ SPISGEV+EVN  L+E
Sbjct  61   GITDHAQDHLGEVVFVELPEENGSVRKEKSFGAVESVKATSEILSPISGEVIEVNKTLSE  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYEDGWMIKVKPSN SEL SLM  KEYTKFCEEED
Sbjct  121  APGLINSSPYEDGWMIKVKPSNPSELESLMGSKEYTKFCEEED  163



>gb|KFK44990.1| hypothetical protein AALP_AA1G329700 [Arabis alpina]
Length=166

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS++ S     P  S+SRCFSSVLEGLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALKLSSSVSKSHLSPPFSISRCFSSVLEGLKYANSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GI+DHAQ HLGEVVFVELPE  ++V +   FGAVESVKATS++ SPISGEV+EVN KLT+
Sbjct  61   GISDHAQGHLGEVVFVELPEANSSVSKEKSFGAVESVKATSEIISPISGEVIEVNTKLTD  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYEDGWMIKVKPS+ +EL SLMDPK YTKFCEEED
Sbjct  121  SPGLINSSPYEDGWMIKVKPSSPAELESLMDPKAYTKFCEEED  163



>ref|XP_006661956.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
[Oryza brachyantha]
Length=164

 Score =   243 bits (619),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 137/162 (85%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASS ANAL++S + +S+  P  S+SR FS+VL+GLKY+ SHEWVK +GSVATIG
Sbjct  1    MALRLWASSAANALKISCSGASRAAPAYSISRYFSTVLDGLKYSSSHEWVKHDGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQ HLGEVVFVELPE G  V QG  FG VESVKATSDVNSPISGEVVEVN KL+E 
Sbjct  61   ITDHAQGHLGEVVFVELPEGGAKVSQGGAFGNVESVKATSDVNSPISGEVVEVNGKLSET  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPY+DGWMIKVKPS+ +EL +LMD  +YTK CEEED
Sbjct  121  PGLINSSPYDDGWMIKVKPSSPAELDALMDAAKYTKHCEEED  162



>emb|CAA85767.1| H-protein [Flaveria palmeri]
Length=154

 Score =   242 bits (617),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 136/156 (87%), Gaps = 5/156 (3%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLS-LSRCFSS--VLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTA ALRLS+A  ++P+ S LSRCFSS  VL+GLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTAKALRLSSA--TRPHFSPLSRCFSSAAVLDGLKYANSHEWVKHEGSVATI  58

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFVELPE G +V + + FGAVESVKATSDVNSPISGE+VEVN+KLTE
Sbjct  59   GITDHAQDHLGEVVFVELPEAGGSVTKTTSFGAVESVKATSDVNSPISGEIVEVNSKLTE  118

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYT  673
             PG+IN SPYEDGWMIKVKPSN SEL SLM  KEYT
Sbjct  119  TPGLINKSPYEDGWMIKVKPSNPSELDSLMGAKEYT  154



>ref|XP_009143678.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial 
[Brassica rapa]
Length=166

 Score =   242 bits (618),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 139/163 (85%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTA+AL+LS++ S     P  S+SRCFSSVLEGLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTASALKLSSSVSKSQLTPAFSISRCFSSVLEGLKYANSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFVELPE   +V +   FGAVESVKATS++ SPISGEV+EVN KL+E
Sbjct  61   GITDHAQDHLGEVVFVELPEENGSVSKEKSFGAVESVKATSEILSPISGEVIEVNKKLSE  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYEDGWMIKVKPSN SEL SLM  KEYTKFCEEED
Sbjct  121  APGLINSSPYEDGWMIKVKPSNPSELESLMGSKEYTKFCEEED  163



>emb|CDY26897.1| BnaA05g18150D [Brassica napus]
Length=166

 Score =   242 bits (618),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS++ S     P  S+SRCFSSVLEGLKYA SHEWVK +GSVATI
Sbjct  1    MALRMWASSTANALKLSSSTSKSHLLPAFSISRCFSSVLEGLKYATSHEWVKHDGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFVELPE  ++V +   FGAVESVKATS++ SPISGEV+EVN KLT+
Sbjct  61   GITDHAQDHLGEVVFVELPEEKSSVSKEKNFGAVESVKATSEILSPISGEVIEVNTKLTD  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYEDGWMIKVKPSN +EL +LM  KEYTKFCEEED
Sbjct  121  SPGLINSSPYEDGWMIKVKPSNPAELETLMGSKEYTKFCEEED  163



>ref|XP_010499795.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial 
[Camelina sativa]
Length=166

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS++ S     P  S+SRCFSSVLEGLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALKLSSSVSKSHLSPAFSISRCFSSVLEGLKYANSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQ HLGEVVF ELPE+ ++V +   FGAVESVKATS++ SPISGEV+EVN KLTE
Sbjct  61   GITDHAQGHLGEVVFAELPELNSSVSKEKNFGAVESVKATSEILSPISGEVIEVNTKLTE  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+IN+SPYE+GWMIKVKPSN +EL +LM PKEYTKFCE+ED
Sbjct  121  SPGLINTSPYEEGWMIKVKPSNPAELDTLMGPKEYTKFCEDED  163



>emb|CDY01272.1| BnaC05g24600D [Brassica napus]
Length=166

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 141/163 (87%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS++AS     P  S+SRCFSSVLEGLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALKLSSSASKSHLLPAFSISRCFSSVLEGLKYANSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GI+DHAQDHLGEVVFVELPE  ++V +   FGAVESVKATS++ SPISGEV+EVN KL +
Sbjct  61   GISDHAQDHLGEVVFVELPEEKSSVTKEKNFGAVESVKATSEIISPISGEVIEVNTKLAD  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYEDGWM+KVKPSN +EL SLM PKEYTKFCEEED
Sbjct  121  SPGLINSSPYEDGWMMKVKPSNPAELESLMGPKEYTKFCEEED  163



>ref|XP_002893726.1| hypothetical protein ARALYDRAFT_890824 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69985.1| hypothetical protein ARALYDRAFT_890824 [Arabidopsis lyrata subsp. 
lyrata]
Length=166

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 142/163 (87%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS++AS     P  S+SRCFSSVLEGLKYA SHEWVK +GSVATI
Sbjct  1    MALRMWASSTANALKLSSSASKSHLLPAFSISRCFSSVLEGLKYANSHEWVKHDGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFVELPE  ++V +   FGAVESVKATS++ SPISGEV+EVN KLTE
Sbjct  61   GITDHAQDHLGEVVFVELPEANSSVSKEKSFGAVESVKATSEILSPISGEVIEVNTKLTE  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYE+GWMIKVKPS+ +EL +LM PKEYTKFCE+ED
Sbjct  121  SPGLINSSPYEEGWMIKVKPSSPAELEALMGPKEYTKFCEDED  163



>gb|EPS59179.1| hypothetical protein M569_15633, partial [Genlisea aurea]
Length=161

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 132/160 (83%), Gaps = 4/160 (3%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR+WASSTANAL++S +ASS P      CFS+VLEGLKY+ SHEWVK +G ++TIGIT
Sbjct  3    MALRMWASSTANALKISISASSNPR----SCFSTVLEGLKYSNSHEWVKHDGPISTIGIT  58

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQ HLG+VVFVELPE G  V  G GFGAVESVKATSD+NSPISGE+VEVN KL E PG
Sbjct  59   DHAQGHLGDVVFVELPEAGKEVTAGKGFGAVESVKATSDINSPISGEIVEVNDKLAETPG  118

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            +IN SPY DGWMIKVK S++ EL SL+DPK YTK CEEED
Sbjct  119  LINQSPYGDGWMIKVKASDSRELDSLLDPKAYTKLCEEED  158



>dbj|BAJ95506.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03631.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88062.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=164

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 138/162 (85%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLST--AASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASS ANAL++S+  A ++ P  S+SR FS+V++GLKY  SHEWVK++GSVATIG
Sbjct  1    MALRLWASSAANALKISSSGARAAAPAYSISRYFSTVIDGLKYTSSHEWVKNDGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            I+DHAQ HLGEVVFVELPE GT V QG  FG VESVKATSDVNSPISGEVVEVN+KL+E 
Sbjct  61   ISDHAQGHLGEVVFVELPEAGTKVSQGGAFGNVESVKATSDVNSPISGEVVEVNSKLSEA  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYE+GWMIKVKPS+ +EL  L+D  +YTK CEEED
Sbjct  121  PGLINSSPYEEGWMIKVKPSSPAELEGLLDSAKYTKHCEEED  162



>ref|XP_008788682.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial 
[Phoenix dactylifera]
Length=166

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 145/163 (89%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLS-TAASSKPNL--SLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MAL++WASSTANAL++S + A + P L  S+SRCFSSVL+GLKY+ SHEWVK EGSVATI
Sbjct  1    MALKLWASSTANALKISCSGAKTSPFLPFSISRCFSSVLDGLKYSSSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQ HLGEVVFVELPE G++V +G GFGAVESVKATSDVNSP+SGEVVEVN KLTE
Sbjct  61   GITDHAQGHLGEVVFVELPESGSSVSKGGGFGAVESVKATSDVNSPVSGEVVEVNTKLTE  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYEDGWMIKV+PS+ +EL SLM PKEYTKFCEEED
Sbjct  121  TPGLINSSPYEDGWMIKVRPSSPTELDSLMGPKEYTKFCEEED  163



>emb|CDX84067.1| BnaC08g07440D [Brassica napus]
Length=166

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 141/163 (87%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS++AS     P  S+SRCFSSVLEGLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALKLSSSASKSHLLPAFSISRCFSSVLEGLKYANSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GI+DHAQDHLGEVVFVELPE  ++V +   FGAVESVKATS++ SPISGEV+EVN KL +
Sbjct  61   GISDHAQDHLGEVVFVELPEEKSSVSKEKNFGAVESVKATSEILSPISGEVIEVNTKLAD  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYE+GWMIKVKPSN +EL SLM PKEYTKFCEEED
Sbjct  121  SPGLINSSPYEEGWMIKVKPSNPAELESLMGPKEYTKFCEEED  163



>ref|XP_009151432.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial-like 
[Brassica rapa]
Length=166

 Score =   240 bits (613),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 141/163 (87%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS++AS     P  S+SRCFSSVLEGLKYA SHEWVK +GSVATI
Sbjct  1    MALRMWASSTANALKLSSSASKSHLLPAFSISRCFSSVLEGLKYATSHEWVKHDGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFVELPE  ++V +   FGAVESVKATS++ SPISGEV+EVN KLT+
Sbjct  61   GITDHAQDHLGEVVFVELPEEKSSVSKEKNFGAVESVKATSEILSPISGEVIEVNTKLTD  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYEDGWMIKVKPSN +EL +LM  KEYTKFCEEED
Sbjct  121  SPGLINSSPYEDGWMIKVKPSNPAELETLMGSKEYTKFCEEED  163



>ref|NP_181080.1| glycine decarboxylase complex protein H [Arabidopsis thaliana]
 sp|P25855.1|GCSH1_ARATH RecName: Full=Glycine cleavage system H protein 1, mitochondrial; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAA32802.1| H-Protein precursor [Arabidopsis thaliana]
 gb|AAA87942.1| glycine decarboxylase complex H-protein precursor [Arabidopsis 
thaliana]
 gb|AAC36184.1| glycine decarboxylase complex H-protein [Arabidopsis thaliana]
 gb|AAK91461.1| At2g35370/T32F12.25 [Arabidopsis thaliana]
 gb|AAL24242.1| At2g35370/T32F12.25 [Arabidopsis thaliana]
 gb|AAM19865.1| At2g35370/T32F12.25 [Arabidopsis thaliana]
 gb|AAM64413.1| glycine decarboxylase complex H-protein [Arabidopsis thaliana]
 dbj|BAF00389.1| glycine decarboxylase complex H-protein [Arabidopsis thaliana]
 gb|AEC09100.1| glycine decarboxylase complex protein H [Arabidopsis thaliana]
 prf||1908425A Gly decarboxylase:SUBUNIT=H protein
Length=165

 Score =   240 bits (613),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 138/162 (85%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPN--LSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANAL+LS++ S       S SRCFS+VLEGLKYA SHEWVK EGSVATIG
Sbjct  1    MALRMWASSTANALKLSSSVSKSHLSPFSFSRCFSTVLEGLKYANSHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            IT HAQDHLGEVVFVELPE  T+V +   FGAVESVKATS++ SPISGE++EVN KLTE 
Sbjct  61   ITAHAQDHLGEVVFVELPEDNTSVSKEKSFGAVESVKATSEILSPISGEIIEVNKKLTES  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYEDGWMIKVKPS+ +EL SLM PKEYTKFCEEED
Sbjct  121  PGLINSSPYEDGWMIKVKPSSPAELESLMGPKEYTKFCEEED  162



>gb|EMT30735.1| Glycine cleavage system H protein, mitochondrial [Aegilops tauschii]
Length=164

 Score =   240 bits (612),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 138/162 (85%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLST--AASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASS ANAL++S+  A ++ P  S+SR FS+V++GLKY  SHEWVK++GSVATIG
Sbjct  1    MALRLWASSAANALKISSSGARAAAPAYSISRYFSTVIDGLKYTSSHEWVKNDGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            I+DHAQ HLGEVVFVELPE GT V QG  FG VESVKATSDVNSPISGEVVEVN+KL+E 
Sbjct  61   ISDHAQGHLGEVVFVELPETGTKVSQGGAFGNVESVKATSDVNSPISGEVVEVNSKLSET  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYE+GWMIKVKPS+ +EL  L+D  +YTK CEEED
Sbjct  121  PGLINSSPYEEGWMIKVKPSSPAELEGLLDSAKYTKHCEEED  162



>gb|EMS55121.1| Glycine cleavage system H protein, mitochondrial [Triticum urartu]
Length=164

 Score =   240 bits (612),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 138/162 (85%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLST--AASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASS ANAL++S+  A ++ P  S+SR FS+V++GLKY  SHEWVK++GSVATIG
Sbjct  1    MALRLWASSAANALKISSSGARAAAPAYSISRYFSTVIDGLKYTSSHEWVKNDGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            I+DHAQ HLGEVVFVELPE GT V QG  FG VESVKATSDVNSPISGEVVEVN+KL+E 
Sbjct  61   ISDHAQGHLGEVVFVELPEAGTKVSQGGAFGNVESVKATSDVNSPISGEVVEVNSKLSET  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+INSSPYE+GWMIKVKPS+ +EL  L+D  +YTK CEEED
Sbjct  121  PGLINSSPYEEGWMIKVKPSSPAELEGLLDSAKYTKHCEEED  162



>ref|XP_006304263.1| hypothetical protein CARUB_v10010494mg [Capsella rubella]
 gb|EOA37161.1| hypothetical protein CARUB_v10010494mg [Capsella rubella]
Length=166

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS++ S     P  S+SRCFSSVLEGLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALKLSSSVSKSHLSPAFSISRCFSSVLEGLKYANSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQ HLGEVVFVELPE  ++V +   FGAVESVKATS++ SPISGEV+E+N KLTE
Sbjct  61   GITDHAQGHLGEVVFVELPEPNSSVTKEKNFGAVESVKATSEILSPISGEVIEINTKLTE  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYE+GWMIKVKPS+ +EL +LM PKEYTKFCE+ED
Sbjct  121  SPGLINSSPYEEGWMIKVKPSSPAELEALMGPKEYTKFCEDED  163



>sp|P93255.1|GCSH_MESCR RecName: Full=Glycine cleavage system H protein, mitochondrial; 
Flags: Precursor [Mesembryanthemum crystallinum]
 gb|AAB38501.1| glycine cleavage system protein H precursor [Mesembryanthemum 
crystallinum]
Length=163

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 135/162 (83%), Gaps = 3/162 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASS ANAL +S A  S   P LSLSRCFS+VL+GLKYA SHEWVK  GSVATIG
Sbjct  1    MALRMWASSAANALGVSCAPKSHLLPALSLSRCFSTVLDGLKYASSHEWVKHGGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQ HLG+VVF ELPE G AV  G  F +VESVKATSDVNSPISGE+VEVN KL++ 
Sbjct  61   ITDHAQGHLGDVVFAELPE-GGAVSAGKPFASVESVKATSDVNSPISGEIVEVNTKLSDS  119

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG++NSSPYE+GWM+KVKPSN +EL SLM  KEYTKFCEEED
Sbjct  120  PGLLNSSPYEEGWMVKVKPSNPAELESLMGSKEYTKFCEEED  161



>ref|XP_010934999.1| PREDICTED: glycine cleavage system H protein 3, mitochondrial 
[Elaeis guineensis]
Length=166

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKP---NLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MAL++WASSTANAL++S + +        S+SRCFSSVL+GLKY+ SHEWVK EGSVAT+
Sbjct  1    MALKLWASSTANALKISCSGAKTSLFLPFSISRCFSSVLDGLKYSSSHEWVKHEGSVATV  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQ HLGEVVFVELPE G +V +G  FGAVESVKATSDVNSP+SGEVVEVN KLTE
Sbjct  61   GITDHAQGHLGEVVFVELPESGGSVSKGGSFGAVESVKATSDVNSPVSGEVVEVNTKLTE  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYEDGWMIKV+PS+ SEL SLM PKEYTKFCEEED
Sbjct  121  TPGLINSSPYEDGWMIKVRPSSPSELDSLMGPKEYTKFCEEED  163



>gb|KFK36433.1| hypothetical protein AALP_AA4G123600 [Arabis alpina]
Length=166

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 137/163 (84%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS++ S     P  S+SRCFSSVLEGLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALKLSSSVSKSHLSPAFSISRCFSSVLEGLKYANSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQ HLGEVVFVELPE   +V +   FGAVESVKATS++ SPISGEV+EVN KL +
Sbjct  61   GITDHAQGHLGEVVFVELPEENGSVSKEKSFGAVESVKATSEILSPISGEVIEVNKKLID  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYEDGWMIKV PS+ +EL SLM PKEYTKFCEEED
Sbjct  121  SPGLINSSPYEDGWMIKVNPSSPAELESLMGPKEYTKFCEEED  163



>emb|CAA94317.1| H protein [Flaveria brownii]
Length=141

 Score =   232 bits (591),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 130/143 (91%), Gaps = 3/143 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLS-LSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MALR+WASSTANALRLS+A  ++P+ S LSRCFSSVL+GLKYA SHEWVK EGSVAT+GI
Sbjct  1    MALRMWASSTANALRLSSA--TRPHFSPLSRCFSSVLDGLKYANSHEWVKHEGSVATVGI  58

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLGEVVFV+LPE G +V + +GFGAVESVKATSDVNSPISGE+VEVN+KL+E P
Sbjct  59   TDHAQDHLGEVVFVDLPEAGGSVTKATGFGAVESVKATSDVNSPISGEIVEVNSKLSETP  118

Query  572  GVINSSPYEDGWMIKVKPSNASE  640
            G+INSSPYEDGWMIKVK SN SE
Sbjct  119  GLINSSPYEDGWMIKVKLSNPSE  141



>ref|XP_006410695.1| hypothetical protein EUTSA_v10017333mg [Eutrema salsugineum]
 gb|ESQ52148.1| hypothetical protein EUTSA_v10017333mg [Eutrema salsugineum]
Length=166

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 130/163 (80%), Gaps = 3/163 (2%)
 Frame = +2

Query  215  MALRIWASSTAN---ALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTAN        + +   P  S+ RC SSVLEGLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANILKLSSSVSKSHLSPAFSICRCLSSVLEGLKYANSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQ HLGEVVFVELPE   +V +   FGAVESVKATS++ SPISGEV+EVN KLTE
Sbjct  61   GITDHAQGHLGEVVFVELPEENGSVSKEKSFGAVESVKATSEILSPISGEVIEVNKKLTE  120

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PG+INSSPYEDGWMIKV+PS+ +EL SLM PKEYTKFC EED
Sbjct  121  SPGLINSSPYEDGWMIKVRPSSPAELESLMGPKEYTKFCVEED  163



>emb|CAA94316.1| H protein [Flaveria trinervia]
Length=143

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 129/145 (89%), Gaps = 5/145 (3%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLS-LSRCFSS--VLEGLKYAKSHEWVKSEGSVATI  385
            MALRIWASSTA ALRLS+A  S+P+ S L RCFSS  VL+GLKYA SHEWVK EGSVATI
Sbjct  1    MALRIWASSTAKALRLSSA--SRPHFSPLFRCFSSAAVLDGLKYANSHEWVKHEGSVATI  58

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFVELPEVG +V + +GFGAVESVKATSDVNSPISGE+VEVN+KLT+
Sbjct  59   GITDHAQDHLGEVVFVELPEVGGSVTKATGFGAVESVKATSDVNSPISGEIVEVNSKLTK  118

Query  566  GPGVINSSPYEDGWMIKVKPSNASE  640
             PG+IN SPYEDGWMIKVKPSN SE
Sbjct  119  TPGLINKSPYEDGWMIKVKPSNPSE  143



>ref|XP_003611465.1| Glycine cleavage system H protein [Medicago truncatula]
Length=156

 Score =   229 bits (584),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 130/160 (81%), Gaps = 7/160 (4%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR+WASSTAN            N+ +     +VL+GLKYA SHEWVK EGSVATIGIT
Sbjct  1    MALRMWASSTANLNECG-------NIYVFISIFAVLDGLKYASSHEWVKHEGSVATIGIT  53

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLGEVVFVELPE G +V +G+GFGAVESVKATSDVNSPISGE+VEVN KLT  PG
Sbjct  54   DHAQDHLGEVVFVELPEPGGSVTKGNGFGAVESVKATSDVNSPISGEIVEVNDKLTGKPG  113

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            +INSSPYEDGWMIK+KPS+ SEL SL+  KEYTKFCEEED
Sbjct  114  LINSSPYEDGWMIKIKPSDPSELESLLGAKEYTKFCEEED  153



>ref|XP_008662562.1| PREDICTED: glycine cleavage system H protein, mitochondrial [Zea 
mays]
 gb|AFW56359.1| glycine cleavage H-protein [Zea mays]
Length=164

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 130/162 (80%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPN--LSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASS ANAL+LS   +       S+SR FS+V +GLKY +SHEWVK+ G VAT+G
Sbjct  1    MALRMWASSAANALKLSAGGAGARAAAFSISRFFSTVHDGLKYTQSHEWVKTTGDVATVG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQ HLGEVVFVELPE GT V  G  FG VESVKATSDVNSPISGEVVEVNAKL+E 
Sbjct  61   ITDHAQGHLGEVVFVELPEPGTKVAAGGPFGNVESVKATSDVNSPISGEVVEVNAKLSET  120

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG+IN+SPYEDGWMIKVKPS+  E  +L+D  +YTK CEEED
Sbjct  121  PGLINTSPYEDGWMIKVKPSSPGEADALLDAAKYTKHCEEED  162



>ref|XP_002879548.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55807.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=161

 Score =   227 bits (578),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 133/158 (84%), Gaps = 2/158 (1%)
 Frame = +2

Query  227  IWASSTANALRLSTAASSKPN--LSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDH  400
            +WASSTANAL+LS++ S       S+SRCFS+ LEGLKYA SHEWVK EGSVATIGIT H
Sbjct  1    MWASSTANALKLSSSVSKSHLSPFSISRCFSTGLEGLKYANSHEWVKHEGSVATIGITAH  60

Query  401  AQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVI  580
            AQDHLGEVVFVELPE  T+  +   FGAVESVKATS++ SPISGE++EVN KLTE PG+I
Sbjct  61   AQDHLGEVVFVELPEENTSATKEKSFGAVESVKATSEILSPISGEIIEVNKKLTESPGLI  120

Query  581  NSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            NSSPYEDGWMIKVKPS+ +EL SLM PKEYTKFCEEED
Sbjct  121  NSSPYEDGWMIKVKPSSPAELESLMGPKEYTKFCEEED  158



>ref|XP_002441938.1| hypothetical protein SORBIDRAFT_08g005210 [Sorghum bicolor]
 gb|EES15776.1| hypothetical protein SORBIDRAFT_08g005210 [Sorghum bicolor]
Length=170

 Score =   227 bits (579),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 132/168 (79%), Gaps = 8/168 (5%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPN--------LSLSRCFSSVLEGLKYAKSHEWVKSEG  370
            MALR+WASS ANAL+LS  A +           LS+SR FS+V +GLKY +SHEWVK+  
Sbjct  1    MALRLWASSAANALKLSGTAGACGASAAAPAFALSISRFFSTVHDGLKYTQSHEWVKTAD  60

Query  371  SVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVN  550
             VAT+GITDHAQDHLGEVVFVELPE GT V  G+ FG VESVKATSDVNSPISGEVVEVN
Sbjct  61   GVATVGITDHAQDHLGEVVFVELPEPGTTVSAGASFGNVESVKATSDVNSPISGEVVEVN  120

Query  551  AKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            +KL+E PG+IN+SPYEDGWMIKVKPS+  E   L+D  +YTK CEEED
Sbjct  121  SKLSETPGLINTSPYEDGWMIKVKPSSPGEADVLLDAAKYTKHCEEED  168



>ref|XP_004977191.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
[Setaria italica]
Length=163

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 126/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKS-EGSVATIGI  391
            MALR+WASS A AL+LS A +  P  S+SR FS+V +GLKY  SHEWVK  E  V T+GI
Sbjct  1    MALRLWASSAAKALKLSGARAVAPAFSISRFFSTVHDGLKYTHSHEWVKHHEDGVVTVGI  60

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQ HLGEVVFVELPE G  V  G  FG VESVKATSDVNSPISGEVVEVN+KL+E P
Sbjct  61   TDHAQSHLGEVVFVELPEAGAQVSAGGSFGNVESVKATSDVNSPISGEVVEVNSKLSETP  120

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G+INSSPYEDGWMIKVKPS+  E   L+D  +YTK CEEED
Sbjct  121  GLINSSPYEDGWMIKVKPSSPGEADGLLDAAKYTKHCEEED  161



>emb|CAA85754.1| H-protein [Flaveria bidentis]
Length=143

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 127/145 (88%), Gaps = 5/145 (3%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLS-LSRCFSS--VLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTA ALRLS+A  ++P+ S L RCFSS  VL+GLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTAKALRLSSA--TRPHFSPLFRCFSSAAVLDGLKYANSHEWVKHEGSVATI  58

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFV+LPE G +V + + FGAVESVKATSDVNSPISGE+VEVN+KLTE
Sbjct  59   GITDHAQDHLGEVVFVDLPEAGGSVTKATSFGAVESVKATSDVNSPISGEIVEVNSKLTE  118

Query  566  GPGVINSSPYEDGWMIKVKPSNASE  640
             PG+IN SPYEDGWMIKVKPSN SE
Sbjct  119  TPGLINKSPYEDGWMIKVKPSNPSE  143



>ref|XP_009377059.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
isoform X2 [Pyrus x bretschneideri]
Length=137

 Score =   221 bits (563),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  317  VLEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESV  496
            VL+GLKYA SHEWVK EGSVATIGITDHAQDHLGEVVFVELPE G +V QG  FGAVESV
Sbjct  9    VLDGLKYASSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPESGRSVSQGGSFGAVESV  68

Query  497  KATSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTK  676
            KATSDVNSPISGEVVEVN+KLTE PG+INSSPYEDGWMIK+KPS+ SEL SL+ PKEYTK
Sbjct  69   KATSDVNSPISGEVVEVNSKLTESPGLINSSPYEDGWMIKIKPSSPSELESLLGPKEYTK  128

Query  677  FCEEED  694
            FCEEED
Sbjct  129  FCEEED  134



>gb|AAM92707.1| putative glycine decarboxylase subunit [Triticum aestivum]
Length=201

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 138/199 (69%), Gaps = 39/199 (20%)
 Frame = +2

Query  215  MALRIWASSTANALRLST--AASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASS ANAL++S+  A ++ P  S+SR FS+V++GLKY  SHEWVK++GSVATIG
Sbjct  1    MALRLWASSAANALKISSSGARAAAPAYSISRYFSTVIDGLKYTSSHEWVKNDGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            I+DHAQ HLGEVVFVELPE GT V QG  FG VESVKATSDVNSPISGEVVEVN+KL+E 
Sbjct  61   ISDHAQGHLGEVVFVELPEAGTKVSQGGAFGNVESVKATSDVNSPISGEVVEVNSKLSET  120

Query  569  PGV-------------------------------------INSSPYEDGWMIKVKPSNAS  637
            PG+                                     INSSPYE+GWMIKVKPS+ +
Sbjct  121  PGLVRTANTSPPSISNPFSLSRPCSDPNELCCCDCAVAWQINSSPYEEGWMIKVKPSSPA  180

Query  638  ELGSLMDPKEYTKFCEEED  694
            EL  L+D  +YTK CEEED
Sbjct  181  ELEGLLDSAKYTKHCEEED  199



>ref|XP_004300261.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
isoform 2 [Fragaria vesca subsp. vesca]
Length=144

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 120/163 (74%), Gaps = 25/163 (15%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASS---KPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANALR+S  AS     P  SLSRCFS+VLEGLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALRISGGASKAQLSPAFSLSRCFSTVLEGLKYASSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFVELPE GT V Q S FG VESVKATSD                  
Sbjct  61   GITDHAQDHLGEVVFVELPEPGTVVSQSSSFGNVESVKATSD------------------  102

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
                IN+SPYEDGWMIKVKPSN SEL SL+  KEYTKFCEEED
Sbjct  103  ----INTSPYEDGWMIKVKPSNPSELESLLGAKEYTKFCEEED  141



>ref|XP_002278252.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
[Vitis vinifera]
 emb|CBI27155.3| unnamed protein product [Vitis vinifera]
Length=154

 Score =   216 bits (550),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 126/160 (79%), Gaps = 9/160 (6%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MA R+WAS  A+ LRLS            R FSSV++ LKYA SHEWVK +G+ A +GIT
Sbjct  1    MASRLWASRAASYLRLSV---------FHRGFSSVVKDLKYADSHEWVKIDGNSAIVGIT  51

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLG+VV+VELPE G AV QGSGFGAVESVKATSD+NSP+SG+VVEVN +L   PG
Sbjct  52   DHAQDHLGDVVYVELPEAGAAVNQGSGFGAVESVKATSDINSPVSGKVVEVNEELNSSPG  111

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            ++N+SPYE+GW+IKV+ S+  EL SLMD ++YTKFCEEED
Sbjct  112  LVNASPYENGWIIKVEMSDTGELNSLMDSEQYTKFCEEED  151



>ref|NP_001141253.1| hypothetical protein [Zea mays]
 gb|ACF85859.1| unknown [Zea mays]
 gb|AFW70288.1| hypothetical protein ZEAMMB73_241255 [Zea mays]
Length=159

 Score =   214 bits (545),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 123/157 (78%), Gaps = 9/157 (6%)
 Frame = +2

Query  227  IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQ  406
             WAS  A  LR+ST           R F++VL+ LKYA +HEWVK EG  AT+GITDHAQ
Sbjct  11   FWASRAAAYLRIST---------FPRAFATVLKDLKYADTHEWVKVEGDSATVGITDHAQ  61

Query  407  DHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINS  586
            DHLG+VVFVELPEVG +V QG  FGAVESVKATSD+NSP+SGEVVEVN KL+E PG++N+
Sbjct  62   DHLGDVVFVELPEVGISVSQGKNFGAVESVKATSDINSPVSGEVVEVNEKLSEEPGLVNA  121

Query  587  SPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEEDH  697
            SPYE GW+IKVK SN+ +L SLMD  +Y+KFCEEED+
Sbjct  122  SPYEKGWIIKVKLSNSGDLNSLMDDDKYSKFCEEEDN  158



>ref|XP_003570126.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
[Brachypodium distachyon]
Length=158

 Score =   214 bits (544),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 126/156 (81%), Gaps = 9/156 (6%)
 Frame = +2

Query  227  IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQ  406
            +WAS  A+ LR+ST           R FS+VL+ LKYA++HEWVK EG +AT+GITDHAQ
Sbjct  9    LWASRAASYLRIST---------FPRAFSTVLKDLKYAETHEWVKVEGDLATVGITDHAQ  59

Query  407  DHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINS  586
            DHLG+VV+VELPEVGT V QG+ FGAVESVKATSD+NSPISGEV+ VN +LTE PG++N+
Sbjct  60   DHLGDVVYVELPEVGTCVSQGNNFGAVESVKATSDINSPISGEVIAVNDELTEKPGLVNA  119

Query  587  SPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            +PYE GW+IKVK  +A EL SLMD ++Y+KFCEEED
Sbjct  120  NPYEGGWIIKVKVKDAGELNSLMDDEKYSKFCEEED  155



>ref|XP_009761418.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Nicotiana sylvestris]
Length=154

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 125/160 (78%), Gaps = 9/160 (6%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MA ++WAS  A+ LR+ST           R F++V++ LKYA SHEWVK +GS ATIGIT
Sbjct  1    MATKLWASRAASYLRVST---------FHRAFATVVKDLKYADSHEWVKVDGSSATIGIT  51

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLG+VV+VELPEVG +V Q   FGAVESVKATSD+NSP+SG+VVEVN KL + PG
Sbjct  52   DHAQDHLGDVVYVELPEVGASVTQSGSFGAVESVKATSDINSPVSGKVVEVNEKLNDTPG  111

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            ++N SPY+DGW+IKV+ +N  EL SLMD  +Y+KFCEEED
Sbjct  112  LVNESPYQDGWIIKVEINNNDELKSLMDHDQYSKFCEEED  151



>gb|AFK36203.1| unknown [Lotus japonicus]
Length=155

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 128/161 (80%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALR-IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R +WAS  A+ LR+S           +R FSSV++ LKYA SHEWVK +G+ AT+GI
Sbjct  1    MACRQLWASRAASYLRISV---------FNRAFSSVVKDLKYADSHEWVKVDGNSATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVGT V QG GFGAVESVKATSD+NSP+SG+VVEVN +L   P
Sbjct  52   TDHAQDHLGDVVYVELPEVGTEVTQGGGFGAVESVKATSDINSPVSGKVVEVNEELNSSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
              +NSSPYEDGW+IKV+ S++SEL +LMD ++Y+KFCEEED
Sbjct  112  AKVNSSPYEDGWIIKVELSDSSELSNLMDSEQYSKFCEEED  152



>ref|XP_003607890.1| Glycine cleavage system H protein [Medicago truncatula]
 gb|ABC75361.1| 2-oxo acid dehydrogenase, lipoyl-binding site [Medicago truncatula]
 gb|AES90087.1| glycine cleavage system H protein [Medicago truncatula]
 gb|AFK37310.1| unknown [Medicago truncatula]
Length=155

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 126/161 (78%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALR-IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R +WAS  A+ LR+S            R FS+VL  LKYA SHEWVK +G  ATIGI
Sbjct  1    MACRQLWASRAASYLRISL---------FHRSFSNVLNNLKYADSHEWVKVDGKSATIGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVGTAV QG GFGAVESVKATSD+NSP+SG+V+EVN +L+  P
Sbjct  52   TDHAQDHLGDVVYVELPEVGTAVTQGDGFGAVESVKATSDINSPVSGKVIEVNEELSNSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             ++NSSPYE+GW+IKV+ S++ EL  LMD ++YTKFCEEED
Sbjct  112  ALVNSSPYENGWIIKVEMSDSGELDKLMDSEKYTKFCEEED  152



>ref|XP_009383690.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=155

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 127/161 (79%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WAS  A+ LR+S            R FS+V++ LKY+ +HEW+K +GS ATIGI
Sbjct  1    MAYRVLWASRVASYLRISV---------FHRGFSTVIKDLKYSDTHEWIKVDGSSATIGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVGT V QG GFGAVESVKATSDVNSP+SGEVVEVN++LT  P
Sbjct  52   TDHAQDHLGDVVYVELPEVGTTVAQGKGFGAVESVKATSDVNSPVSGEVVEVNSELTGSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++N+SPYE+GW++KV   +  EL SLMD ++Y+KFCEEED
Sbjct  112  GLVNASPYENGWIVKVNMGDTGELNSLMDSEQYSKFCEEED  152



>ref|XP_004951769.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Setaria italica]
Length=158

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 125/157 (80%), Gaps = 9/157 (6%)
 Frame = +2

Query  227  IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQ  406
            +WAS  A  LR+ST           R FS+V++ LKYA +HEWVK EG  AT+GITDHAQ
Sbjct  10   MWASRAAAYLRIST---------FPRAFSTVMKDLKYADTHEWVKVEGDSATVGITDHAQ  60

Query  407  DHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINS  586
            DHLG+VV+VELPEVG +V QG  FGAVESVKATSD+NSP+SGEVVEVN KL+E PG++N+
Sbjct  61   DHLGDVVYVELPEVGISVSQGKNFGAVESVKATSDINSPVSGEVVEVNEKLSEEPGLVNA  120

Query  587  SPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEEDH  697
            SPY+ GW+IKVK S++ EL SLMD ++Y+KFCEEED+
Sbjct  121  SPYDKGWIIKVKLSDSGELNSLMDDEKYSKFCEEEDN  157



>gb|ACR38569.1| unknown [Zea mays]
 gb|AFW66375.1| glycine cleavage system H protein 1 [Zea mays]
Length=160

 Score =   212 bits (539),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 123/156 (79%), Gaps = 9/156 (6%)
 Frame = +2

Query  227  IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQ  406
            +WAS  A  LR+ST           R FS+VL+ LKYA +HEWVK EG  AT+GITDHAQ
Sbjct  12   LWASRAAAYLRIST---------FPRAFSTVLKDLKYADTHEWVKVEGDSATVGITDHAQ  62

Query  407  DHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINS  586
            DHLG+VV+VELPEVG +V QG  FGAVESVKATSD+NSP+SGEVVEVN KL+E PG++N+
Sbjct  63   DHLGDVVYVELPEVGVSVSQGKNFGAVESVKATSDINSPVSGEVVEVNRKLSEEPGLVNA  122

Query  587  SPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            SPYE GW+IKVK S++ EL SLMD  +Y+KFCEEED
Sbjct  123  SPYEKGWIIKVKLSDSGELSSLMDGDKYSKFCEEED  158



>ref|XP_002451618.1| hypothetical protein SORBIDRAFT_04g004720 [Sorghum bicolor]
 gb|EES04594.1| hypothetical protein SORBIDRAFT_04g004720 [Sorghum bicolor]
Length=158

 Score =   212 bits (539),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 125/157 (80%), Gaps = 9/157 (6%)
 Frame = +2

Query  227  IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQ  406
            +WAS  A  LR+ST           R FS+VL+ LKYA +HEWVK EG  AT+GITDHAQ
Sbjct  10   LWASRAAAYLRIST---------FPRAFSTVLKDLKYADTHEWVKVEGDSATVGITDHAQ  60

Query  407  DHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINS  586
            DHLG+VV+VELPEVG +V QG  FGAVESVKATSD+NSP+SGEVVEVN KL+E PG++N+
Sbjct  61   DHLGDVVYVELPEVGISVSQGKNFGAVESVKATSDINSPVSGEVVEVNNKLSEEPGLVNA  120

Query  587  SPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEEDH  697
            SPYE GW+IKVK S++ EL SLM+ ++Y+KFCEEED+
Sbjct  121  SPYEKGWIIKVKLSDSGELNSLMNDEKYSKFCEEEDN  157



>ref|NP_001152670.1| glycine cleavage system H protein 1 [Zea mays]
 gb|ACG48830.1| glycine cleavage system H protein 1 [Zea mays]
Length=160

 Score =   212 bits (539),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 123/156 (79%), Gaps = 9/156 (6%)
 Frame = +2

Query  227  IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQ  406
            +WAS  A  LR+ST           R FS+VL+ LKYA +HEWVK EG  AT+GITDHAQ
Sbjct  12   LWASRAAAYLRIST---------FPRAFSTVLKDLKYADTHEWVKVEGDSATVGITDHAQ  62

Query  407  DHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINS  586
            DHLG+VV+VELPEVG +V QG  FGAVESVKATSD+NSP+SGEVVEVN KL+E PG++N+
Sbjct  63   DHLGDVVYVELPEVGVSVSQGKNFGAVESVKATSDINSPVSGEVVEVNGKLSEEPGLVNA  122

Query  587  SPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            SPYE GW+IKVK S++ EL SLMD  +Y+KFCEEED
Sbjct  123  SPYEKGWIIKVKLSDSGELSSLMDGDKYSKFCEEED  158



>ref|XP_006853480.1| hypothetical protein AMTR_s00032p00204040 [Amborella trichopoda]
 gb|ERN14947.1| hypothetical protein AMTR_s00032p00204040 [Amborella trichopoda]
Length=159

 Score =   212 bits (539),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 128/161 (80%), Gaps = 4/161 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MA R+W S  A+ LR+S     KP+ +  R FSSVL+ LKYA +HEWVK +GS AT+GIT
Sbjct  1    MASRLWGSRAASYLRISI----KPSFNFYRPFSSVLKDLKYADTHEWVKVDGSSATVGIT  56

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLG+VV+VELPEVG  V +G  FGAVESVKATSDVNSP+SG+VVEVN +L+  PG
Sbjct  57   DHAQDHLGDVVYVELPEVGATVTKGDSFGAVESVKATSDVNSPVSGKVVEVNGELSSSPG  116

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEEDH  697
            ++N+SPYE+GW+IKV+ S+  E+ SLM   +YT+FCEEED+
Sbjct  117  LVNASPYEEGWIIKVEMSDPGEVSSLMGADQYTQFCEEEDN  157



>ref|XP_006468487.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Citrus sinensis]
Length=155

 Score =   211 bits (538),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 124/161 (77%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WAS  A+ LR+S            R FSSV++ LKYA SHEWVK +G+ ATIGI
Sbjct  1    MASRLLWASRAASYLRISV---------FHRGFSSVIKDLKYADSHEWVKVDGNSATIGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG  VKQ + FGAVESVKATSDVNSP+SG+VVEVN +L+  P
Sbjct  52   TDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVKATSDVNSPVSGKVVEVNEELSSSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             ++NSSPYEDGW+IKV+  NA EL  LMD  +YTKFCEEED
Sbjct  112  ALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTKFCEEED  152



>ref|XP_004505304.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
[Cicer arietinum]
Length=155

 Score =   211 bits (538),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 125/161 (78%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALR-IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R +WAS  A+ LR+S            R FS+VL+ LKYA SHEWVK +G+ AT+GI
Sbjct  1    MACRQLWASRAASYLRISL---------FHRSFSNVLKDLKYADSHEWVKIDGNSATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG AV QG GFGAVESVKATSD+NSP+SG VVEVN +L   P
Sbjct  52   TDHAQDHLGDVVYVELPEVGAAVTQGGGFGAVESVKATSDINSPVSGTVVEVNEELNSSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             ++NSSPYE+GW+IKVK S++ EL  LMD ++YTKFCEEED
Sbjct  112  ALVNSSPYENGWIIKVKLSDSGELNKLMDSEQYTKFCEEED  152



>gb|KHG00043.1| Glycine cleavage system H, mitochondrial [Gossypium arboreum]
Length=155

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 123/156 (79%), Gaps = 9/156 (6%)
 Frame = +2

Query  227  IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQ  406
            +WAS  A+ LR+S            R FS+VL+ LKYA SHEWVK EG+ ATIGITDHAQ
Sbjct  6    LWASRAASYLRISV---------FHRGFSTVLKDLKYADSHEWVKVEGNSATIGITDHAQ  56

Query  407  DHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINS  586
            DHLG+VV+VELPEVG AVKQG  FGAVESVKATSDVNSP+SG+VVEVN +L+  P  +NS
Sbjct  57   DHLGDVVYVELPEVGAAVKQGESFGAVESVKATSDVNSPVSGKVVEVNEELSGSPAKVNS  116

Query  587  SPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            SPYEDGW+IKV+  +A EL +LMD +EY+KFCEEED
Sbjct  117  SPYEDGWIIKVEMKDAGELRNLMDSEEYSKFCEEED  152



>pdb|1HPC|A Chain A, Refined Structures At 2 Angstroms And 2.2 Angstroms 
Of The Two Forms Of The H-protein, A Lipoamide-containing Protein 
Of The Glycine Decarboxylase
 pdb|1HPC|B Chain B, Refined Structures At 2 Angstroms And 2.2 Angstroms 
Of The Two Forms Of The H-protein, A Lipoamide-containing Protein 
Of The Glycine Decarboxylase
 pdb|1DXM|A Chain A, Reduced Form Of The H Protein From Glycine Decarboxylase 
Complex
 pdb|1DXM|B Chain B, Reduced Form Of The H Protein From Glycine Decarboxylase 
Complex
 pdb|1HTP|A Chain A, Refined Structures At 2 Angstroms And 2.2 Angstroms 
Of The Two Forms Of The H-Protein, A Lipoamide-Containing Protein 
Of The Glycine Decarboxylase Complex
Length=131

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +2

Query  311  SSVLEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVE  490
            S+VL+GLKYA SHEWVK EGSVATIGITDHAQDHLGEVVFVELPE G +V +G GFGAVE
Sbjct  1    SNVLDGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVE  60

Query  491  SVKATSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEY  670
            SVKATSDVNSPISGEV+EVN  LT  PG+INSSPYEDGWMIK+KP++  EL SL+  KEY
Sbjct  61   SVKATSDVNSPISGEVIEVNTGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEY  120

Query  671  TKFCEEED  694
            TKFCEEED
Sbjct  121  TKFCEEED  128



>ref|XP_003556280.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
isoform 1 [Glycine max]
Length=155

 Score =   210 bits (535),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 125/161 (78%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALR-IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R +WAS  A+ LR+S            R FS+VL  LKYA SHEWVK +G+ AT+GI
Sbjct  1    MACRQLWASRAASYLRISV---------FHRSFSNVLNDLKYADSHEWVKVDGNSATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLGEVV+VELPEVG  V QG GFGA ESVKATSD+NSP+SG+VVEVN KLT  P
Sbjct  52   TDHAQDHLGEVVYVELPEVGATVTQGEGFGAAESVKATSDINSPVSGKVVEVNEKLTSSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             ++N+SPY+DGW+IKV+ S++ EL +LMD ++Y+KFCEEED
Sbjct  112  ALVNTSPYKDGWIIKVEMSDSGELNNLMDSEKYSKFCEEED  152



>ref|XP_011096810.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
[Sesamum indicum]
Length=155

 Score =   210 bits (535),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 126/161 (78%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WA+  A+ LR+S            R F++V++ LKYA SHEWVK EG+ ATIGI
Sbjct  1    MASRLLWATRAASFLRISVP---------YRGFATVIKDLKYADSHEWVKVEGNSATIGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPE G  V QG+GFGAVESVKATSD+NSP+SG+VVEVN KL + P
Sbjct  52   TDHAQDHLGDVVYVELPEEGAEVTQGAGFGAVESVKATSDINSPVSGKVVEVNTKLNDSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++N+SPYE+GW+IKV+  NA EL  LMDP +Y+KFCEEED
Sbjct  112  GLVNASPYENGWIIKVEMQNADELNCLMDPDQYSKFCEEED  152



>ref|XP_010927080.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Elaeis guineensis]
Length=155

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 126/161 (78%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WAS  A+ LR+ST           R F+SV++ LKYA +HEW+K +G+ A +GI
Sbjct  1    MAARLLWASRAASYLRIST---------FPRGFASVVKDLKYADTHEWIKVDGTSAMVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG+ V QG  FGAVESVKATSD+NSP+SGEVVEVN++L   P
Sbjct  52   TDHAQDHLGDVVYVELPEVGSNVTQGKNFGAVESVKATSDINSPVSGEVVEVNSELNNSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++N+SPY+DGW+IKVK S+  EL SLMD  +YTKFCEEED
Sbjct  112  GLVNASPYKDGWIIKVKMSDEGELNSLMDSDQYTKFCEEED  152



>emb|CDY71483.1| BnaAnng37640D, partial [Brassica napus]
Length=141

 Score =   209 bits (533),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 116/135 (86%), Gaps = 1/135 (1%)
 Frame = +2

Query  293  SLSRCFS-SVLEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQG  469
            +LS CF   VLEGLKYA SHEWVK EGSVATIGI+DHAQDHLGEVVFVELPE  ++V + 
Sbjct  4    TLSGCFGLKVLEGLKYANSHEWVKHEGSVATIGISDHAQDHLGEVVFVELPEEKSSVSKE  63

Query  470  SGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGS  649
              FGAVESVKATS++ SPISGEV+EVN KL + PG+INSSPYE+GWMIKVKPSN +EL S
Sbjct  64   KNFGAVESVKATSEIISPISGEVIEVNTKLADSPGLINSSPYEEGWMIKVKPSNPAELES  123

Query  650  LMDPKEYTKFCEEED  694
            LM PKEYTKFCEEED
Sbjct  124  LMGPKEYTKFCEEED  138



>ref|XP_008798232.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
[Phoenix dactylifera]
Length=155

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 124/161 (77%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WAS  A+ LR+ST           R F+SV++ LKYA +HEWVK +G+ AT+GI
Sbjct  1    MAARLLWASRVASYLRIST---------FPRGFASVMKDLKYADTHEWVKVDGTSATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVGT V QG  FGAVESVKATSD+NSP+SGEVVEVN +L   P
Sbjct  52   TDHAQDHLGDVVYVELPEVGTNVTQGKNFGAVESVKATSDINSPVSGEVVEVNTELNSSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++N+S Y+DGW+IKVK S+A EL SLMD   Y KFCEEED
Sbjct  112  GLVNASAYDDGWIIKVKMSDAGELDSLMDSDLYAKFCEEED  152



>ref|XP_006448700.1| hypothetical protein CICLE_v10017047mg [Citrus clementina]
 gb|ESR61940.1| hypothetical protein CICLE_v10017047mg [Citrus clementina]
Length=155

 Score =   209 bits (533),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 125/161 (78%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WAS  A+ LR+S            R FSSV++ LKYA SHEWVK +G+ ATIGI
Sbjct  1    MASRLLWASRAASYLRISV---------FHRGFSSVIKDLKYADSHEWVKVDGNSATIGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG  VKQG+ FGAVESVKATSDVNSP+SG+VVEVN +L+  P
Sbjct  52   TDHAQDHLGDVVYVELPEVGVTVKQGASFGAVESVKATSDVNSPVSGKVVEVNEELSSSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             ++NSSPY+DGW+IKV+  +A EL  LMD  +YTKFCEEED
Sbjct  112  ALVNSSPYKDGWIIKVEMDSAGELKKLMDADQYTKFCEEED  152



>ref|XP_010276207.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
[Nelumbo nucifera]
Length=154

 Score =   209 bits (532),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 127/160 (79%), Gaps = 9/160 (6%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MA R+WAS  A+ LR+S            R F+SV++ LKY+ +HEWVK +G+ AT+GIT
Sbjct  1    MASRLWASRAASYLRVSVR---------HRGFASVVKDLKYSDTHEWVKVDGTSATVGIT  51

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLG+VV+VELPEVG +V QG+GFGAVESVKATSDVNSP+SG+V+EVN +L   PG
Sbjct  52   DHAQDHLGDVVYVELPEVGASVTQGNGFGAVESVKATSDVNSPVSGKVIEVNEELNSSPG  111

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            ++N+SPYE+GW+IKV+  +A E+ +LMD + YTKFCEEED
Sbjct  112  LVNASPYENGWIIKVEIQDAGEVNTLMDSERYTKFCEEED  151



>ref|XP_009402544.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=155

 Score =   209 bits (531),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 123/161 (76%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WAS  A+ LR+S         +  R FS+V++ LKYA +HEWVK +GS ATIGI
Sbjct  1    MASRLLWASRAASYLRIS---------AFHRGFSTVIKDLKYADTHEWVKVDGSSATIGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG  V QG  FGAVESVKATSDVNSP+SGEVVEVN +L   P
Sbjct  52   TDHAQDHLGDVVYVELPEVGATVAQGKNFGAVESVKATSDVNSPVSGEVVEVNRELVGSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++N SPYE+GW+IKVK S+  EL SLMD   Y+KFCEEED
Sbjct  112  GLVNGSPYENGWIIKVKMSDTGELNSLMDSNRYSKFCEEED  152



>dbj|BAJ93279.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04847.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=158

 Score =   209 bits (531),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 121/156 (78%), Gaps = 9/156 (6%)
 Frame = +2

Query  227  IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQ  406
            +WAS  A+ LR+ST           R FS+VL+ LKYA +HEWVK EG  AT+GITDHAQ
Sbjct  9    LWASRAASFLRIST---------FPRAFSTVLKDLKYADTHEWVKVEGDSATVGITDHAQ  59

Query  407  DHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINS  586
            DHLG+VV+VELPEVG +V QG+ FGAVESVKATSD+NSP+SGEV+ VN +L E P ++N 
Sbjct  60   DHLGDVVYVELPEVGASVTQGTNFGAVESVKATSDINSPVSGEVIAVNDELLEKPALVNG  119

Query  587  SPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PYE GW+IKVK SNA EL SLMD ++Y+KFCEEED
Sbjct  120  DPYEGGWIIKVKVSNAGELNSLMDDEKYSKFCEEED  155



>ref|XP_007145369.1| hypothetical protein PHAVU_007G233300g [Phaseolus vulgaris]
 gb|ESW17363.1| hypothetical protein PHAVU_007G233300g [Phaseolus vulgaris]
Length=179

 Score =   209 bits (532),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 126/163 (77%), Gaps = 10/163 (6%)
 Frame = +2

Query  209  KTMALR-IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            + MA R  WAS  A+ LR+S           +R FS+V++ LKYA SHEWVK +G+ AT+
Sbjct  24   REMACRQFWASRAASYLRISV---------FNRAFSNVVKDLKYADSHEWVKVDGNSATV  74

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLG+VV+VELPEVGT V QG  FGAVESVKATSD+NSPISG+V EVN +L  
Sbjct  75   GITDHAQDHLGDVVYVELPEVGTTVTQGDSFGAVESVKATSDINSPISGKVTEVNEELNS  134

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             P ++NSSPY+DGW+IKV+ S++ E+ +LMD ++YTKFCEEED
Sbjct  135  SPALVNSSPYKDGWIIKVELSDSGEVNNLMDSEKYTKFCEEED  177



>ref|XP_009773216.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Nicotiana sylvestris]
Length=154

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 124/160 (78%), Gaps = 9/160 (6%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MA ++WAS  A+ LR+ST         + R F++V + LKYA+SHEWVK +GS ATIGIT
Sbjct  1    MATKLWASRAASYLRIST---------IHRAFATVAKDLKYAESHEWVKVDGSSATIGIT  51

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLG+VV+VELPEVG +V Q   FGAVESVKATSD+NSP+SG+VVEVN KL   P 
Sbjct  52   DHAQDHLGDVVYVELPEVGASVNQFDSFGAVESVKATSDINSPVSGKVVEVNEKLDSSPA  111

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            +IN SPY++GW+IKV+ +N  EL SLMDP +Y+ FC+EED
Sbjct  112  LINGSPYQEGWIIKVEMNNPDELKSLMDPDKYSSFCDEED  151



>prf||1923203A H protein
Length=131

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +2

Query  311  SSVLEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVE  490
            S+VL+GLKYA SHEWVK EGSVATIGITDHAQDHLGEVVFVELPE G +V +G GFGAVE
Sbjct  1    SNVLDGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVE  60

Query  491  SVKATSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEY  670
            SV ATSDVNSPISGEV+EVN  LT  PG+INSSPYEDGWMIK+KP++  EL SL+  KEY
Sbjct  61   SVXATSDVNSPISGEVIEVNTGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEY  120

Query  671  TKFCEEED  694
            TKFCEEED
Sbjct  121  TKFCEEED  128



>gb|KDP22912.1| hypothetical protein JCGZ_01773 [Jatropha curcas]
Length=154

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 123/161 (76%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WAS  A+ LR+S            R FSSV++ LKYA SHEWVK +G+ AT+GI
Sbjct  1    MATRLLWASRAASYLRISV---------FHRGFSSVIKDLKYADSHEWVKVDGNSATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG +VKQG  FGAVESVKATSDVNSPISG+VVEVN +L   P
Sbjct  52   TDHAQDHLGDVVYVELPEVGASVKQGDSFGAVESVKATSDVNSPISGKVVEVNEELNSSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++NSSPYE GW+IKV  S+  EL +L D  EY+KFCEEED
Sbjct  112  GLVNSSPYEKGWIIKVNISDVDELKNLKDADEYSKFCEEED  152



>ref|XP_010058021.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW75488.1| hypothetical protein EUGRSUZ_E04249 [Eucalyptus grandis]
Length=155

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 126/161 (78%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WAS  A+ LR+S A          R F++VL+ LKY  SHEWVK EG+ AT+GI
Sbjct  1    MASRLLWASRAASYLRISVA---------HRGFATVLKDLKYYDSHEWVKVEGNSATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VVFVELPEVG  V QG GFGAVESVKATSDVNSP++G+VVEVN +L+  P
Sbjct  52   TDHAQDHLGDVVFVELPEVGAPVTQGEGFGAVESVKATSDVNSPVTGKVVEVNEELSNSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++NSSPYE GW+IKV+ S+A +L +LMD  +Y+KFCEEED
Sbjct  112  GLVNSSPYEQGWIIKVEMSDAGQLNNLMDADKYSKFCEEED  152



>emb|CCC55419.1| mitochondrial glycine decarboxylase complex H-protein [Pinus 
pinaster]
Length=167

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 125/164 (76%), Gaps = 4/164 (2%)
 Frame = +2

Query  215  MALRIWASSTANAL----RLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVAT  382
            MALR+WAS  A +L    R    +   P +  SR FS V+EGLKYA SHEWVKS+G + T
Sbjct  1    MALRVWASQAATSLGIGCRRPLRSLGFPAVPFSRGFSDVIEGLKYADSHEWVKSDGKLGT  60

Query  383  IGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLT  562
            +GIT HAQDHLG+VVFV+LPEVG +V +GS FGAVESVKATSD+ SP+SGEVVE N KLT
Sbjct  61   VGITHHAQDHLGDVVFVDLPEVGVSVSKGSSFGAVESVKATSDIMSPVSGEVVETNTKLT  120

Query  563  EGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            E P +IN SPY +GW+IKV+  + SE+ +LM+ ++Y +FCEEED
Sbjct  121  ETPALINGSPYGEGWIIKVRIKDPSEMDTLMNAEQYKRFCEEED  164



>ref|XP_009593092.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
[Nicotiana tomentosiformis]
Length=154

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 125/160 (78%), Gaps = 9/160 (6%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MA ++WAS  A+ LR+ST         + R F++V + LKYA+SHEWV+ +GS ATIGIT
Sbjct  1    MATQLWASRAASYLRIST---------IHRAFATVAKDLKYAESHEWVRVDGSSATIGIT  51

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLG+VV+VELPEVG +V Q   FGAVESVKATSD+NSP+SG+VVEVN KL   P 
Sbjct  52   DHAQDHLGDVVYVELPEVGASVNQFGSFGAVESVKATSDINSPVSGKVVEVNEKLDSSPA  111

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            +IN SPY++GW+IKV+ +N  EL SLMDP++Y+ FC+EED
Sbjct  112  LINGSPYQEGWIIKVEMNNPDELKSLMDPEQYSNFCDEED  151



>ref|XP_010941651.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
[Elaeis guineensis]
Length=155

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 124/161 (77%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WAS  A  L +ST         + R F+SV++ LKYA +HEWVK +G+ A +GI
Sbjct  1    MAARLLWASRAAKYLTVST---------IPRGFASVVKDLKYADTHEWVKVDGTSAAVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG  V QG  FGAVESVKATSD+NSP+SGEVVEVN +L   P
Sbjct  52   TDHAQDHLGDVVYVELPEVGANVTQGKNFGAVESVKATSDINSPVSGEVVEVNTELNSSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++N+SPY DGW+IKVK S+A EL SLMD ++YTKFCEEED
Sbjct  112  GLVNASPYGDGWIIKVKMSDAGELNSLMDSEQYTKFCEEED  152



>ref|XP_009393274.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=155

 Score =   206 bits (525),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 125/161 (78%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WA   A+ LR+ST           R FS+V++ LKYA +HEWVK +GS AT+GI
Sbjct  1    MASRLLWARGAASYLRIST---------FHRGFSTVIKDLKYADTHEWVKVDGSSATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG +V QG  FGAVESVKATSDVNSP+SGEVVEVN +L+  P
Sbjct  52   TDHAQDHLGDVVYVELPEVGASVVQGKNFGAVESVKATSDVNSPVSGEVVEVNTELSGSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++N+ PYE+GW+IKVK S+  EL SLMD + Y+KFCEEED
Sbjct  112  GLVNARPYENGWIIKVKMSDTGELNSLMDSEGYSKFCEEED  152



>ref|XP_010052529.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
[Eucalyptus grandis]
 gb|KCW76600.1| hypothetical protein EUGRSUZ_D00982 [Eucalyptus grandis]
Length=156

 Score =   206 bits (525),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 123/156 (79%), Gaps = 9/156 (6%)
 Frame = +2

Query  227  IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQ  406
            +WAS  A+ LR+S            R FS+VL+ LKYA SHEWVK EG+ AT+GITDHAQ
Sbjct  7    LWASRAASYLRISV---------FHRGFSTVLKDLKYADSHEWVKIEGASATVGITDHAQ  57

Query  407  DHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINS  586
            DHLG+VV++ELPEVG AV QGS FGAVESVKATSD+ SPISG+VVEVN +L + PG++NS
Sbjct  58   DHLGDVVYIELPEVGAAVAQGSSFGAVESVKATSDIYSPISGKVVEVNEELNKSPGLVNS  117

Query  587  SPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            SPYEDGW+IKV+  +A+E+ +LM   +Y+KFCEEED
Sbjct  118  SPYEDGWIIKVEAKDANEVNNLMGADDYSKFCEEED  153



>ref|XP_007212189.1| hypothetical protein PRUPE_ppa012788mg [Prunus persica]
 ref|XP_008225830.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
[Prunus mume]
 gb|EMJ13388.1| hypothetical protein PRUPE_ppa012788mg [Prunus persica]
Length=154

 Score =   206 bits (525),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 126/161 (78%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WAS  A+ LR+             R F+SV++ LKYA SHEWVK +G+ AT+GI
Sbjct  1    MASRLLWASRAASYLRIQVT---------HRGFASVVKDLKYADSHEWVKVDGNSATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG AVKQG GFGAVESVKATSDV SP+SG+V+EVN +L   P
Sbjct  52   TDHAQDHLGDVVYVELPEVGAAVKQGEGFGAVESVKATSDVYSPVSGKVIEVNEELGNSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++NSSPYEDGW+IKV+ S++ E+  LMD ++YTKFCEEED
Sbjct  112  GLVNSSPYEDGWIIKVEISDSGEVKKLMDSEKYTKFCEEED  152



>ref|XP_008459025.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
[Cucumis melo]
Length=155

 Score =   205 bits (522),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 128/161 (80%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALR-IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R +WAS  A+ LR+S            R F+SV++ LKYA SHEWVK EG  AT+GI
Sbjct  1    MASRLVWASRAASYLRISIPF---------RGFASVVKDLKYATSHEWVKVEGDKATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVGT+VKQ   FGAVESVKATSD+NSP+SG+++EVN +L+  P
Sbjct  52   TDHAQDHLGDVVYVELPEVGTSVKQDGSFGAVESVKATSDINSPVSGKIIEVNEELSSSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++NSSPYE+GW+IKV+ S++ EL +LMD ++Y+KFCEEED
Sbjct  112  GLVNSSPYENGWIIKVEVSDSGELKNLMDSEQYSKFCEEED  152



>gb|ABK21574.1| unknown [Picea sitchensis]
 gb|ABK22277.1| unknown [Picea sitchensis]
 gb|ABR17354.1| unknown [Picea sitchensis]
 gb|ACN40085.1| unknown [Picea sitchensis]
Length=164

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 125/164 (76%), Gaps = 7/164 (4%)
 Frame = +2

Query  215  MALRIWASSTANAL----RLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVAT  382
            MALR+WAS TA +L    R    +   P +  SR FS V+EGLKYA SHEWVKS+G   T
Sbjct  1    MALRVWASQTATSLGIGCRRPLRSLGFPAVPFSRGFSEVIEGLKYADSHEWVKSDG---T  57

Query  383  IGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLT  562
            +GIT HAQDHLG+VVFV+LPEVG AV +GS FGAVESVKATSD+ +P+SGEVVE N KLT
Sbjct  58   VGITHHAQDHLGDVVFVDLPEVGAAVSKGSSFGAVESVKATSDIIAPVSGEVVETNTKLT  117

Query  563  EGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            E P +IN SPYE+GW+IKV+  + SE+ +LM+ ++Y  FCEEED
Sbjct  118  ETPALINGSPYEEGWLIKVRIQDPSEMDTLMNAEKYKHFCEEED  161



>emb|CDP11250.1| unnamed protein product [Coffea canephora]
Length=154

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 123/160 (77%), Gaps = 9/160 (6%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MA ++WAS  A+ LR+S            R F++V++ LKYA SHEWVK +G+ AT+GIT
Sbjct  1    MATKLWASKAASYLRISV---------FHRGFATVVKDLKYADSHEWVKVDGNSATVGIT  51

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLG+VV+VELPEVG  VKQG  FGAVESVKATSDV SP+SG+VV+VN KL + PG
Sbjct  52   DHAQDHLGDVVYVELPEVGKEVKQGDSFGAVESVKATSDVYSPVSGKVVDVNEKLGDSPG  111

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            ++N SPYEDGW++KV+ SN  EL SL+D ++YTK CE ED
Sbjct  112  LVNGSPYEDGWIMKVEISNKDELNSLLDSEQYTKHCEAED  151



>ref|XP_006296123.1| hypothetical protein CARUB_v10025275mg, partial [Capsella rubella]
 gb|EOA29021.1| hypothetical protein CARUB_v10025275mg, partial [Capsella rubella]
Length=128

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  320  LEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVK  499
            LEGLKYA SHEWVK EGSVATIGIT HAQ+HLGEVVFVELPE  T+V +   FGAVESVK
Sbjct  1    LEGLKYANSHEWVKHEGSVATIGITAHAQEHLGEVVFVELPEENTSVSKEKNFGAVESVK  60

Query  500  ATSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKF  679
            ATS++ SPISGEV+EVN KLTE PG+INSSPYEDGWMIKVKPS+ +EL SLM PKEYTKF
Sbjct  61   ATSEILSPISGEVIEVNKKLTESPGLINSSPYEDGWMIKVKPSSPAELESLMGPKEYTKF  120

Query  680  CEEED  694
            CE+ED
Sbjct  121  CEDED  125



>ref|XP_010509659.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
[Camelina sativa]
Length=156

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 125/162 (77%), Gaps = 11/162 (7%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSS-VLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+ WAS  A+ LR+S A          R F+S VL+ LKYA SHEWVK EG+ AT G
Sbjct  1    MALRLLWASRVASHLRISVA---------QRGFASAVLKDLKYADSHEWVKIEGNKATFG  51

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLG+VV+VELPE+G +V QG  FGAVESVKATSD+NSP+SG VVEVN +LTE 
Sbjct  52   ITDHAQDHLGDVVYVELPELGHSVSQGKSFGAVESVKATSDINSPVSGTVVEVNKELTES  111

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG++NSSPYE GW++KV+ S+A E   LMD  +Y+KFCEEED
Sbjct  112  PGLVNSSPYEQGWIVKVELSDAGEAEKLMDSDKYSKFCEEED  153



>gb|EMS48693.1| Glycine cleavage system H protein, mitochondrial [Triticum urartu]
Length=156

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 122/156 (78%), Gaps = 9/156 (6%)
 Frame = +2

Query  227  IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQ  406
            +WAS  A+ L++S         +  R FS+VL+ LKYA++HEWVK +G  AT+GITDHAQ
Sbjct  7    LWASRAASYLKIS---------AFPRAFSTVLKDLKYAETHEWVKVDGDSATVGITDHAQ  57

Query  407  DHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINS  586
            DHLG+VV+VELPEVG +V QG+ FGAVESVKATSD+NSP+SGEV+ VN +L E P ++N 
Sbjct  58   DHLGDVVYVELPEVGASVSQGTNFGAVESVKATSDINSPVSGEVIAVNDELLEKPALVNG  117

Query  587  SPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             PYE GW+IKVK S+A EL SLMD K+Y+KFCEEED
Sbjct  118  DPYEGGWIIKVKVSDAGELNSLMDDKKYSKFCEEED  153



>ref|XP_006656352.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Oryza brachyantha]
Length=158

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 119/155 (77%), Gaps = 9/155 (6%)
 Frame = +2

Query  227  IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQ  406
            +WA   A+ LR+S         S  R FS+VL+ LKYA +HEWVK EG  ATIGITDHAQ
Sbjct  10   LWACRAASYLRIS---------SFPRAFSTVLKDLKYADTHEWVKVEGDSATIGITDHAQ  60

Query  407  DHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINS  586
            DHLG+VV+VELPEVG  V QG  FGAVESVKATSD+N+P+SGE+++VN +L+E PG +N 
Sbjct  61   DHLGDVVYVELPEVGATVSQGKNFGAVESVKATSDINAPVSGEILQVNDELSEKPGFVNG  120

Query  587  SPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEE  691
            SPYE GW+IKVK S+ SEL SLMD ++Y KFCEEE
Sbjct  121  SPYEKGWIIKVKISDPSELNSLMDDEKYKKFCEEE  155



>gb|EPS63218.1| hypothetical protein M569_11570 [Genlisea aurea]
Length=154

 Score =   204 bits (519),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 121/160 (76%), Gaps = 9/160 (6%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MA R+WA+  A+ LRLS            R F++VL+ LKY+ SHEWVK EG+ ATIG+T
Sbjct  1    MAARLWATRVASFLRLSVPF---------RGFATVLKDLKYSDSHEWVKIEGNSATIGVT  51

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQ+HLG+VV+VELP+VG  V+ G  FGAVESVKATSDVNSPISG V+EVN KLTE PG
Sbjct  52   DHAQNHLGDVVYVELPDVGAEVENGESFGAVESVKATSDVNSPISGRVIEVNTKLTESPG  111

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            ++N+SP+ DGWMIKV+  +  EL SLMD   Y+ FC+EED
Sbjct  112  LVNASPFGDGWMIKVELKDGDELNSLMDADRYSNFCDEED  151



>ref|XP_006436758.1| hypothetical protein CICLE_v10032942mg [Citrus clementina]
 gb|ESR49998.1| hypothetical protein CICLE_v10032942mg [Citrus clementina]
 gb|KDO42216.1| hypothetical protein CISIN_1g031294mg [Citrus sinensis]
Length=130

 Score =   203 bits (517),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 108/122 (89%), Gaps = 1/122 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR+WASSTANALR+S  AS  P  +LSRCFSSVL+GLKYA SHEWVK EGSVAT+GIT
Sbjct  1    MALRMWASSTANALRIS-CASKTPAFALSRCFSSVLDGLKYASSHEWVKHEGSVATVGIT  59

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLGEVVFVELPE G +VKQG GFG VESVKATSDVNSPISGEV+EVN KLTE PG
Sbjct  60   DHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEVNTKLTETPG  119

Query  575  VI  580
            ++
Sbjct  120  LV  121



>ref|XP_009353965.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
[Pyrus x bretschneideri]
Length=154

 Score =   204 bits (518),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 127/161 (79%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WAS  A+ LR+ T           R F+SV++  KYA SHEWVK +G+ AT+GI
Sbjct  1    MASRLMWASRAASYLRIQTT---------HRGFASVVKDFKYADSHEWVKVDGNSATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG +VKQG GFGAVESVKATSDV SP+SG+VVEVN +L+  P
Sbjct  52   TDHAQDHLGDVVYVELPEVGASVKQGEGFGAVESVKATSDVYSPVSGKVVEVNEELSNSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++N+SPYE+GW++KV+ S++ EL  L+D ++YTKFCEEED
Sbjct  112  GLVNASPYEEGWIMKVEISDSGELNKLLDSEKYTKFCEEED  152



>gb|KHN08050.1| Glycine cleavage system H protein, mitochondrial [Glycine soja]
Length=155

 Score =   204 bits (518),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 123/161 (76%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALR-IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R +WAS  A+ LR+S            R FS+V++  KY  SHEWVK +G+ ATIGI
Sbjct  1    MACRQLWASRAASYLRISV---------FHRGFSNVIKDFKYVDSHEWVKVDGNYATIGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG AV QG  FGAVESVKATSD+NSPISG+VVEVN  L   P
Sbjct  52   TDHAQDHLGDVVYVELPEVGAAVTQGGSFGAVESVKATSDINSPISGKVVEVNEALNSSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             ++NSSPY+DGW+IKV+ +++ EL +LMD ++Y+KFCEEED
Sbjct  112  ALVNSSPYKDGWIIKVEINDSGELNNLMDSEQYSKFCEEED  152



>ref|XP_010516681.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Camelina sativa]
Length=156

 Score =   203 bits (517),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 123/162 (76%), Gaps = 11/162 (7%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSS-VLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+ WAS  A+ LR+S A          R F+S VL+ LKYA SHEWVK EG+ AT G
Sbjct  1    MALRLLWASRVASHLRISVA---------QRGFASAVLKDLKYADSHEWVKIEGTKATFG  51

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLG+VV+VELP+VG  V QG  FGAVESVKATSD+NSP+SG VVEVN +LTE 
Sbjct  52   ITDHAQDHLGDVVYVELPDVGLTVSQGKSFGAVESVKATSDINSPVSGTVVEVNKELTES  111

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG++NSSPY+ GW++KV+ S+A E   LMD   Y+KFCEEED
Sbjct  112  PGLVNSSPYDQGWIVKVELSDAGEAEKLMDSDNYSKFCEEED  153



>ref|XP_010505012.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Camelina sativa]
Length=156

 Score =   203 bits (517),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 125/162 (77%), Gaps = 11/162 (7%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSS-VLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+ WAS  A+ LR+S A          R F+S VL+ LKYA SHEWVK EG+ AT G
Sbjct  1    MALRLLWASRVASHLRISVA---------QRGFASAVLKDLKYADSHEWVKIEGNKATFG  51

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLG+VV+VELP+VG +V QG  FGAVESVKATSD+NSP+SG VVEVN +L+E 
Sbjct  52   ITDHAQDHLGDVVYVELPDVGLSVSQGKSFGAVESVKATSDINSPVSGTVVEVNKELSES  111

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG++NSSPYE GW++KV+ S+A E   LMD  +Y+KFCEEED
Sbjct  112  PGLVNSSPYEQGWIVKVELSDAGEAEKLMDSDKYSKFCEEED  153



>ref|NP_001058315.1| Os06g0667600 [Oryza sativa Japonica Group]
 dbj|BAD45431.1| putative glycine decarboxylase complex H-protein [Oryza sativa 
Japonica Group]
 dbj|BAD45416.1| putative glycine decarboxylase complex H-protein [Oryza sativa 
Japonica Group]
 dbj|BAF20229.1| Os06g0667600 [Oryza sativa Japonica Group]
 dbj|BAG92586.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86751.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81143.1| hypothetical protein OsI_24045 [Oryza sativa Indica Group]
 gb|EEE66185.1| hypothetical protein OsJ_22296 [Oryza sativa Japonica Group]
Length=160

 Score =   204 bits (518),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 120/151 (79%), Gaps = 9/151 (6%)
 Frame = +2

Query  242  TANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGE  421
            TA+ LR+S         S  R FS+VL+ LKYA +HEWVK EG  ATIG+TDHAQDHLG+
Sbjct  16   TASYLRIS---------SFPRAFSTVLKDLKYADTHEWVKVEGDSATIGVTDHAQDHLGD  66

Query  422  VVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINSSPYED  601
            VV+VELPEVG+ V QG+ FGAVESVKATSD+N+P+SGE+++VN +L+E PG IN SPYE 
Sbjct  67   VVYVELPEVGSTVSQGTNFGAVESVKATSDINAPVSGEIIQVNDELSEKPGFINGSPYEK  126

Query  602  GWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            GW+IKVK S+ SEL SLMD ++Y KFCEEED
Sbjct  127  GWIIKVKISDPSELNSLMDDEKYKKFCEEED  157



>ref|XP_002321819.1| glycine cleavage system H family protein [Populus trichocarpa]
 gb|EEF05946.1| glycine cleavage system H family protein [Populus trichocarpa]
Length=155

 Score =   203 bits (517),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 126/161 (78%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WAS  A+ LR+S +          R F+SV++ LKYA+SHEWVK +G+ AT+GI
Sbjct  1    MASRLLWASRAASYLRISVS---------HRGFASVIKDLKYAESHEWVKVDGNTATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG AV QGSGFGAVESVKATSDV SP+SG VVEVN +L+  P
Sbjct  52   TDHAQDHLGDVVYVELPEVGAAVNQGSGFGAVESVKATSDVYSPVSGNVVEVNEELSSSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++NSSPYE GW++KV+  +ASEL +L +  +Y KFCEEED
Sbjct  112  GLVNSSPYEKGWIMKVEIKDASELETLKNSDDYAKFCEEED  152



>ref|NP_181057.1| glycine cleavage system H protein 2 [Arabidopsis thaliana]
 sp|O82179.1|GCSH2_ARATH RecName: Full=Glycine cleavage system H protein 2, mitochondrial; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC61829.1| glycine decarboxylase complex H-protein [Arabidopsis thaliana]
 gb|AAL06993.1| At2g35120/T4C15.21 [Arabidopsis thaliana]
 gb|AAL31106.1| At2g35120/T4C15.21 [Arabidopsis thaliana]
 dbj|BAE99735.1| glycine decarboxylase complex H-protein [Arabidopsis thaliana]
 gb|AEC09067.1| glycine decarboxylase complex protein H2 [Arabidopsis thaliana]
Length=156

 Score =   203 bits (517),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 125/162 (77%), Gaps = 11/162 (7%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSV-LEGLKYAKSHEWVKSEGSVATIG  388
            MA R+ WAS  A+ LR+S A          R FSSV L+ LKYA SHEWVK +G+ AT G
Sbjct  1    MACRLFWASRVASHLRISVA---------QRGFSSVVLKDLKYADSHEWVKIDGNKATFG  51

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLG+VV+VELP+VG +V QG  FGAVESVKATSD+NSP+SG+VVEVN +LTE 
Sbjct  52   ITDHAQDHLGDVVYVELPDVGHSVSQGKSFGAVESVKATSDINSPVSGKVVEVNEELTES  111

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG++NSSPYE GW+IKV+ S+A E   LMD  +Y+KFCEEED
Sbjct  112  PGLVNSSPYEQGWIIKVELSDAGEAEKLMDSDKYSKFCEEED  153



>ref|XP_006295389.1| hypothetical protein CARUB_v10024485mg [Capsella rubella]
 gb|EOA28287.1| hypothetical protein CARUB_v10024485mg [Capsella rubella]
Length=156

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 123/162 (76%), Gaps = 11/162 (7%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSS-VLEGLKYAKSHEWVKSEGSVATIG  388
            MA R+ WAS  A+ LR+S A          R F+S VL+ LKYA SHEWVK EG+ AT G
Sbjct  1    MASRLLWASRVASHLRISVA---------QRGFASAVLKDLKYADSHEWVKIEGNKATFG  51

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLG+VV+VELPEVG +V QG  FGAVESVKATSD+NSP+SG V EVN KLTE 
Sbjct  52   ITDHAQDHLGDVVYVELPEVGHSVSQGKSFGAVESVKATSDINSPVSGTVFEVNEKLTES  111

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG++NSSPYE GW++KV+ S+A E   LMD  +Y+KFCEEED
Sbjct  112  PGLVNSSPYEQGWIVKVELSDAGEAEKLMDSDKYSKFCEEED  153



>ref|XP_002269090.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
[Vitis vinifera]
 emb|CBI34101.3| unnamed protein product [Vitis vinifera]
Length=155

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 121/156 (78%), Gaps = 9/156 (6%)
 Frame = +2

Query  227  IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQ  406
            +WA+  A+ LR+S            R FSSV++ LKY  SHEW K +G++ATIGITDHAQ
Sbjct  6    LWATRAASYLRISVPF---------RAFSSVVKDLKYVDSHEWAKVDGNLATIGITDHAQ  56

Query  407  DHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINS  586
            DHLG+VV+VELPEVG  V QG  FGAVESVKATSD+NSP+SG+VVEVN +L+  PG++N 
Sbjct  57   DHLGDVVYVELPEVGANVSQGGSFGAVESVKATSDINSPVSGKVVEVNEELSSSPGLVNG  116

Query  587  SPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            SPYE GW+IKV+ SN SEL SLMD ++Y+KFCEEED
Sbjct  117  SPYEKGWIIKVEISNPSELNSLMDSEQYSKFCEEED  152



>ref|XP_002881376.1| hypothetical protein ARALYDRAFT_482477 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57635.1| hypothetical protein ARALYDRAFT_482477 [Arabidopsis lyrata subsp. 
lyrata]
Length=156

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 124/162 (77%), Gaps = 11/162 (7%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSV-LEGLKYAKSHEWVKSEGSVATIG  388
            MA R+ WAS  A+ LR+S A          R FSSV L+ LKYA SHEWVK +G+ AT G
Sbjct  1    MACRLLWASRVASHLRISVA---------QRGFSSVVLKDLKYADSHEWVKIDGNKATFG  51

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLG+VV+VELP+VG +V QG  FGAVESVKATSD+NSP+SG VVEVN +LTE 
Sbjct  52   ITDHAQDHLGDVVYVELPDVGHSVSQGKSFGAVESVKATSDINSPVSGTVVEVNEELTES  111

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG++NSSPYE GW+IKV+ S+A E   LMD  +Y+KFCEEED
Sbjct  112  PGLVNSSPYEQGWIIKVELSDAGEAEKLMDSDKYSKFCEEED  153



>gb|KFK36394.1| hypothetical protein AALP_AA4G118600 [Arabis alpina]
Length=156

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 122/157 (78%), Gaps = 10/157 (6%)
 Frame = +2

Query  227  IWASSTANALRLSTAASSKPNLSLSRCFSSV-LEGLKYAKSHEWVKSEGSVATIGITDHA  403
            +WAS  A+ LR+S A          R FSSV L+ LKYA SHEWVK +G+ AT GITDHA
Sbjct  6    LWASRVASRLRISVA---------QRGFSSVVLKDLKYADSHEWVKIDGNKATFGITDHA  56

Query  404  QDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVIN  583
            QDHLG+VV+VELP++G +V QG  FGAVESVKATSD+NSP+SG VVEVN KLTE PG++N
Sbjct  57   QDHLGDVVYVELPDLGRSVTQGESFGAVESVKATSDINSPVSGTVVEVNEKLTESPGLVN  116

Query  584  SSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            +SPYE+GW+IKV  S+A E  +LMD  +Y+KFCEEED
Sbjct  117  TSPYEEGWIIKVDLSDAGEAKNLMDSDKYSKFCEEED  153



>ref|XP_006646940.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Oryza brachyantha]
Length=158

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 122/156 (78%), Gaps = 9/156 (6%)
 Frame = +2

Query  227  IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQ  406
            +WAS  A+ L++S         +  R FS+VL+ LKYA +HEWVK EG  AT+GITDHAQ
Sbjct  9    LWASRAASYLKIS---------AFPRAFSTVLKDLKYADTHEWVKVEGDSATVGITDHAQ  59

Query  407  DHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINS  586
             HLG+VV+VELPEVG++V QG  FGAVESVKATSD+NSP+SGEVV VN  L++ PG++N+
Sbjct  60   HHLGDVVYVELPEVGSSVSQGKNFGAVESVKATSDINSPVSGEVVAVNDVLSDEPGLVNT  119

Query  587  SPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            SPYE GW+IKVK S++ EL SLMD  +Y+KFCEEED
Sbjct  120  SPYESGWIIKVKVSDSGELNSLMDDGKYSKFCEEED  155



>gb|KHN42986.1| Glycine cleavage system H protein, mitochondrial [Glycine soja]
Length=155

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 122/161 (76%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALR-IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R +WAS  A+ LR+S            R FS+V++ LKYA SHEWVK + + AT+GI
Sbjct  1    MACRQLWASRAASYLRISV---------FHRGFSNVVKDLKYADSHEWVKVDENSATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG AV QG  FGAVESVKATSD+NSP+SG+VVEVN  L   P
Sbjct  52   TDHAQDHLGDVVYVELPEVGAAVTQGGSFGAVESVKATSDINSPVSGKVVEVNEALNSSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             +INSSPY+DGW+IKV+ S+  EL +LMD  +Y+KFCEEED
Sbjct  112  ALINSSPYKDGWIIKVEISDNGELNNLMDSDQYSKFCEEED  152



>ref|XP_011000181.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
[Populus euphratica]
Length=155

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 125/161 (78%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WAS  A+ LR+S +          R F+SV++ LKYA+SHEWVK +G+ AT+GI
Sbjct  1    MASRLLWASRAASYLRISVS---------HRGFASVIKDLKYAESHEWVKVDGNTATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG  V QGSGFGAVESVKATSDV SP+SG VVEVN +L+  P
Sbjct  52   TDHAQDHLGDVVYVELPEVGATVNQGSGFGAVESVKATSDVYSPVSGNVVEVNEELSNSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++NSSPYE GW++KV+  +ASEL +L +  +Y KFCEEED
Sbjct  112  GLVNSSPYEKGWIMKVEIKDASELETLKNSDDYAKFCEEED  152



>ref|XP_004145438.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
[Cucumis sativus]
 gb|KGN66866.1| hypothetical protein Csa_1G701910 [Cucumis sativus]
Length=155

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 126/161 (78%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALR-IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R +WAS  A+ LR+S            R F+SV++ LKYA SHEWVK EG  AT+GI
Sbjct  1    MASRLVWASRAASYLRISIPF---------RGFASVVKDLKYATSHEWVKVEGDKATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQ HLG+VV+VELPEVGT+VKQ   FGAVESVKATSD+NSP+SG+++EVN +L+  P
Sbjct  52   TDHAQGHLGDVVYVELPEVGTSVKQDGSFGAVESVKATSDINSPVSGKIIEVNEELSSSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++NSSPYE+GW+IKV+ S++ EL  LMD ++Y+KFCEEED
Sbjct  112  GLVNSSPYENGWIIKVEVSDSGELKKLMDSEQYSKFCEEED  152



>gb|EPS71608.1| hypothetical protein M569_03153 [Genlisea aurea]
Length=154

 Score =   201 bits (512),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 124/161 (77%), Gaps = 9/161 (6%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MA  +WA+  A+ LR+S            R F++VL+ LKYA +HEWVK EG+ ATIGIT
Sbjct  1    MASSLWATRAASFLRISVPF---------RGFATVLKDLKYADTHEWVKVEGNSATIGIT  51

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLG+VV+VELP+ G+ VKQG  FGAVESVKATSD+NSP+SG V+EVN KL++ PG
Sbjct  52   DHAQDHLGDVVYVELPDEGSKVKQGQSFGAVESVKATSDINSPVSGTVLEVNTKLSDSPG  111

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEEDH  697
            ++N+SP+E+GW+IKV+  +  EL SLMD   Y+KFCEEED+
Sbjct  112  LVNASPFEEGWIIKVELKDGDELKSLMDADHYSKFCEEEDN  152



>ref|XP_004293760.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like 
isoform 2 [Fragaria vesca subsp. vesca]
Length=152

 Score =   201 bits (512),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 122/149 (82%), Gaps = 1/149 (1%)
 Frame = +2

Query  251  ALRLSTAASSKPNLSLS-RCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVV  427
            A RL++ A+S   + ++ R F+SV++ L YA SHEWVK +G  ATIGITDHAQDHLG+VV
Sbjct  2    ASRLASRAASYLRIQVTHRGFASVVKDLNYANSHEWVKVDGKSATIGITDHAQDHLGDVV  61

Query  428  FVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGW  607
            +VELPEVG AVKQG GFGAVESVKATSDV SP+SG+VVEVN +L   PG++NSSPYE GW
Sbjct  62   YVELPEVGVAVKQGEGFGAVESVKATSDVYSPVSGKVVEVNEELNSSPGLVNSSPYEKGW  121

Query  608  MIKVKPSNASELGSLMDPKEYTKFCEEED  694
            +IKV+ +++ EL +LMD  +YTKFCEEED
Sbjct  122  IIKVEINDSGELKNLMDSDKYTKFCEEED  150



>gb|ACN40098.1| unknown [Picea sitchensis]
Length=164

 Score =   202 bits (513),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 124/164 (76%), Gaps = 7/164 (4%)
 Frame = +2

Query  215  MALRIWASSTANAL----RLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVAT  382
            MALR+ AS TA +L    R    +   P +  SR FS V+EGLKYA SHEWVKS+G   T
Sbjct  1    MALRVLASQTATSLGIGCRRPLRSLGFPAVPFSRGFSEVIEGLKYADSHEWVKSDG---T  57

Query  383  IGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLT  562
            +GIT HAQDHLG+VVFV+LPEVG AV +GS FGAVESVKATSD+ +P+SGEVVE N KLT
Sbjct  58   VGITHHAQDHLGDVVFVDLPEVGAAVSKGSSFGAVESVKATSDIIAPVSGEVVETNTKLT  117

Query  563  EGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            E P +IN SPYE+GW+IKV+  + SE+ +LM+ ++Y  FCEEED
Sbjct  118  ETPALINGSPYEEGWLIKVRIQDPSEMDTLMNAEKYKHFCEEED  161



>ref|XP_011029909.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Populus euphratica]
Length=155

 Score =   201 bits (512),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 124/161 (77%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WAS  A+ LR+S +          R F+SV++ LKYA SHEWVK +G  AT+GI
Sbjct  1    MASRLLWASRAASYLRISVS---------HRGFASVVKDLKYADSHEWVKVDGKTATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG +V QGSGFGAVESVKATSDV SP+SG+VVEVN +L   P
Sbjct  52   TDHAQDHLGDVVYVELPEVGASVNQGSGFGAVESVKATSDVYSPVSGDVVEVNEELNSSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++NSSPYE GW++KV+  +ASEL +L +  +Y KFCEEED
Sbjct  112  GLVNSSPYEKGWIMKVEIKDASELETLKNSDDYAKFCEEED  152



>ref|NP_001242407.1| uncharacterized protein LOC100792708 [Glycine max]
 gb|ACU18497.1| unknown [Glycine max]
Length=155

 Score =   201 bits (512),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 123/161 (76%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALR-IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R +WAS  A+ LR+S            R FS+V++  KY  SHEWVK +G+ ATIGI
Sbjct  1    MACRQLWASRAASYLRISV---------FHRGFSNVIKDFKYVDSHEWVKVDGNYATIGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG AV QG  FGA+ESVKAT+D+NSPISGEVVEVN  L   P
Sbjct  52   TDHAQDHLGDVVYVELPEVGAAVTQGGSFGALESVKATTDINSPISGEVVEVNEALNSSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             ++NSSPY++GW+IKV+ +++ EL +LMD ++Y+KFCEEED
Sbjct  112  ALVNSSPYKNGWIIKVEINDSGELNNLMDSEQYSKFCEEED  152



>gb|ABQ41936.1| glycine cleavage system H protein [Sonneratia ovata]
Length=129

 Score =   200 bits (509),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 114/135 (84%), Gaps = 7/135 (5%)
 Frame = +2

Query  236  SSTANALRLSTAASSKPNL-SLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQDH  412
            SS A+  +LS      P+L SLSRCFSSVLEGLKYA+SHEWVK EG VATIGITDHAQDH
Sbjct  1    SSAASKTQLS------PDLFSLSRCFSSVLEGLKYAESHEWVKHEGGVATIGITDHAQDH  54

Query  413  LGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINSSP  592
            LGEVVFV+LPE G  V QG  FGAVESVKATSDVNSP+SG+++EVN +LTE PG++NSSP
Sbjct  55   LGEVVFVDLPEPGVQVSQGGSFGAVESVKATSDVNSPVSGKIMEVNTQLTEKPGLVNSSP  114

Query  593  YEDGWMIKVKPSNAS  637
            YEDGWMIK+KPSN S
Sbjct  115  YEDGWMIKIKPSNPS  129



>ref|XP_009133011.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Brassica rapa]
 emb|CDX84620.1| BnaA03g16100D [Brassica napus]
Length=156

 Score =   201 bits (511),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 126/162 (78%), Gaps = 11/162 (7%)
 Frame = +2

Query  215  MALR-IWASSTANALRLSTAASSKPNLSLSRCFSSV-LEGLKYAKSHEWVKSEGSVATIG  388
            MA R +WAS  A+ LR+S A          R F+SV L+ LKYA+SHEWVK +G+ AT G
Sbjct  1    MAARFLWASRVASHLRISIA---------QRGFASVVLKDLKYAESHEWVKIDGNKATFG  51

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLG+VV+VELP++G +V QG  FGAVESVKATSD+NSP+SG+VVEVN  L+E 
Sbjct  52   ITDHAQDHLGDVVYVELPDLGRSVSQGESFGAVESVKATSDINSPVSGKVVEVNEVLSES  111

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG++N+SPYEDGW+IKV+ S+A E   LMD  +Y+KFCEEED
Sbjct  112  PGLVNTSPYEDGWIIKVELSDAEEAKKLMDSDKYSKFCEEED  153



>gb|AAB82134.1| H protein subunit of glycine decarboxylase [Oryza sativa Indica 
Group]
Length=162

 Score =   201 bits (511),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 117/140 (84%), Gaps = 2/140 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASS ANAL++S + +++  P  S+SR FS+VL+GLK + SHEWVK++GSVATIG
Sbjct  1    MALRLWASSAANALKISCSGATRAAPAYSISRYFSTVLDGLKCSSSHEWVKNDGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQ HLG VVFVELPE G  V QGS F  VESVK TSD+NSPISGEVVEVN KL+E 
Sbjct  61   ITDHAQGHLGXVVFVELPEAGAKVSQGSAFCNVESVKGTSDINSPISGEVVEVNDKLSET  120

Query  569  PGVINSSPYEDGWMIKVKPS  628
            P +INSSPYEDGWMI+VKP+
Sbjct  121  PRLINSSPYEDGWMIQVKPN  140



>gb|ABQ41934.1| glycine cleavage system H protein [Sonneratia alba]
 gb|ACS68655.1| H-protein of the glycine decarboxylase multi-enzyme complex [Sonneratia 
alba]
 gb|ACS68725.1| H-protein of the glycine decarboxylase multi-enzyme complex [Sonneratia 
alba]
Length=129

 Score =   200 bits (508),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 111/129 (86%), Gaps = 5/129 (4%)
 Frame = +2

Query  266  TAASSKPNLS-----LSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVF  430
            ++A+SK  LS     LSRCFSSVLEGLKYA+SHEWVK EG VATIGITDHAQDHLGEVVF
Sbjct  1    SSAASKTQLSPELFSLSRCFSSVLEGLKYAESHEWVKHEGEVATIGITDHAQDHLGEVVF  60

Query  431  VELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWM  610
            V+LPE G  V QG  FGAVESVKATSDVNSP+SG+++EVN +LTE PG++NSSPYEDGWM
Sbjct  61   VDLPEPGVQVSQGGSFGAVESVKATSDVNSPVSGKIMEVNTQLTEKPGLVNSSPYEDGWM  120

Query  611  IKVKPSNAS  637
            IK+KPSN S
Sbjct  121  IKIKPSNPS  129



>ref|XP_009143702.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
[Brassica rapa]
 emb|CDX84261.1| BnaC04g10230D [Brassica napus]
Length=156

 Score =   201 bits (510),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 126/162 (78%), Gaps = 11/162 (7%)
 Frame = +2

Query  215  MALR-IWASSTANALRLSTAASSKPNLSLSRCFSSV-LEGLKYAKSHEWVKSEGSVATIG  388
            MA R +WAS  A+ LR+S A          R F+SV L+ LKYA SHEWVK +G+ AT G
Sbjct  1    MAARFLWASRAASHLRISVA---------QRGFASVVLKDLKYADSHEWVKIDGNKATFG  51

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLG+VV+VELP++G +V QG  FGAVESVKATSD+NSP+SG+VVEVN  LTE 
Sbjct  52   ITDHAQDHLGDVVYVELPDLGRSVSQGESFGAVESVKATSDINSPVSGKVVEVNEVLTES  111

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG++N+SPYE+GW+IKV+ S+A E+  LMD  +Y+KFCEEED
Sbjct  112  PGLVNTSPYEEGWIIKVELSDAGEVEKLMDSDKYSKFCEEED  153



>emb|CDY31665.1| BnaA05g08820D [Brassica napus]
Length=156

 Score =   201 bits (510),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 126/162 (78%), Gaps = 11/162 (7%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSV-LEGLKYAKSHEWVKSEGSVATIG  388
            MA R+ WAS  A+ LR+S A          R F+SV L+ LKYA SHEWVK +G+ AT G
Sbjct  1    MAARLLWASRVASHLRISVA---------QRGFASVVLKDLKYADSHEWVKIDGNKATFG  51

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLG+VV+VELP++G +V QG  FGAVESVKATSD+NSP+SG+VVEVN  LTE 
Sbjct  52   ITDHAQDHLGDVVYVELPDLGRSVSQGESFGAVESVKATSDINSPVSGKVVEVNEVLTES  111

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG++N+SPYE+GW+IKV+ S+A E+  LMD  +Y+KFCEEED
Sbjct  112  PGLVNTSPYEEGWIIKVELSDAGEVEKLMDSDKYSKFCEEED  153



>gb|ABJ98947.1| mitochondrial glycine decarboxylase complex H-protein [Populus 
tremuloides]
Length=155

 Score =   201 bits (510),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 124/161 (77%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WAS  A+ LR+S +          R F+SV++ LKYA+SHEWVK  G+ AT+GI
Sbjct  1    MASRLLWASRAASYLRISVS---------HRGFASVIKDLKYAESHEWVKVAGNTATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG  V QGSGFGAVESVKATSDV SP+SG VVEVN +L+  P
Sbjct  52   TDHAQDHLGDVVYVELPEVGATVNQGSGFGAVESVKATSDVYSPVSGNVVEVNEELSNSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++NSSPYE GW++KV+  +ASEL +L +  +Y KFCEEED
Sbjct  112  GLVNSSPYEKGWIMKVEIKDASELETLKNSDDYAKFCEEED  152



>ref|NP_001237081.1| uncharacterized protein LOC100305815 [Glycine max]
 gb|ACU13688.1| unknown [Glycine max]
Length=155

 Score =   201 bits (510),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 122/161 (76%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALR-IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R +WAS  A+ LR+S            R FS+V++ LKYA SHEWVK + + AT+GI
Sbjct  1    MACRQLWASRAASYLRISV---------FHRGFSNVVKDLKYADSHEWVKVDENSATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG AV QG  FGA+ESVKATSD+NSP+SG+VVEVN  L   P
Sbjct  52   TDHAQDHLGDVVYVELPEVGAAVTQGGSFGALESVKATSDINSPVSGKVVEVNEALNSSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             +INSSPY+DGW+IKV+ S+  EL +LMD  +Y+KFCEEED
Sbjct  112  ALINSSPYKDGWIIKVEISDNGELNNLMDSDQYSKFCEEED  152



>gb|ABQ41937.1| glycine cleavage system H protein [Sonneratia apetala]
Length=129

 Score =   199 bits (507),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  290  LSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQG  469
             SLSRCFSSVLEGLKYA+SHEWVK EG VATIGITDHAQDHLGEVVFV+LPE G  V QG
Sbjct  14   FSLSRCFSSVLEGLKYAESHEWVKHEGGVATIGITDHAQDHLGEVVFVDLPEPGVQVSQG  73

Query  470  SGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSNAS  637
              FGAVESVKATSDVNSP+SG+++EVN +LTE PG++NSSPYEDGWMIK+KPSN S
Sbjct  74   GSFGAVESVKATSDVNSPVSGKIMEVNTQLTEKPGLVNSSPYEDGWMIKIKPSNPS  129



>ref|XP_004244545.1| PREDICTED: glycine cleavage system H protein, mitochondrial isoform 
X2 [Solanum lycopersicum]
Length=138

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 109/122 (89%), Gaps = 1/122 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR+WASSTANALR+S+  S + N SLSRCFS+VLEGLKYA SHEWVK EGSVATIGIT
Sbjct  1    MALRMWASSTANALRVSSTVS-RTNFSLSRCFSTVLEGLKYASSHEWVKHEGSVATIGIT  59

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLGEVVFV+LP+ GT+V  GS FGAVESVKATSD+NSPISGE+VEVN KL+E PG
Sbjct  60   DHAQDHLGEVVFVDLPDSGTSVSHGSSFGAVESVKATSDINSPISGEIVEVNTKLSETPG  119

Query  575  VI  580
            ++
Sbjct  120  LV  121



>ref|XP_011001375.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Populus euphratica]
Length=155

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 123/161 (76%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WAS  A+ LR+S +          R F+SV++ LKYA SHEWVK +G  AT+GI
Sbjct  1    MASRLLWASRAASYLRISVS---------HRGFASVVKDLKYADSHEWVKVDGKTATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG +V QGSGFGAVESVKATSDV SP+SG+VVEVN +L   P
Sbjct  52   TDHAQDHLGDVVYVELPEVGASVNQGSGFGAVESVKATSDVYSPVSGDVVEVNEELNSSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++NSSPYE GW++KV+  + SEL +L +  EY KFCEEED
Sbjct  112  GLVNSSPYEKGWIMKVEIKDDSELKNLKNSDEYAKFCEEED  152



>ref|XP_002318899.1| glycine cleavage system H family protein [Populus trichocarpa]
 gb|EEE97119.1| glycine cleavage system H family protein [Populus trichocarpa]
Length=155

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 123/161 (76%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WAS  A+ LR+S +          R F+SV++ LKYA+SHEWVK +G  AT+GI
Sbjct  1    MASRLLWASRAASYLRISVS---------HRGFASVVKDLKYAESHEWVKVDGKTATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG  V QGSGFGAVESVKATSDV SP+SG+VVEVN +L   P
Sbjct  52   TDHAQDHLGDVVYVELPEVGVTVNQGSGFGAVESVKATSDVYSPVSGDVVEVNEELNSSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++NSSPYE GW++KV+  + SEL +L +  EY KFCEEED
Sbjct  112  GLVNSSPYEKGWIMKVEIKDDSELKNLKNSDEYAKFCEEED  152



>gb|AAO63775.1| glycine decarboxylase complex H-protein [Populus tremuloides]
Length=155

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 123/161 (76%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WAS  A+ LR+S +          R F+SV++ LKYA+SHEWVK +G  AT+GI
Sbjct  1    MASRLLWASRAASYLRISVS---------HRGFASVVKDLKYAESHEWVKVDGKTATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VV+VELPEVG  V QGSGFGAVESVKATSDV SP+SG+VVEVN +L   P
Sbjct  52   TDHAQDHLGDVVYVELPEVGATVSQGSGFGAVESVKATSDVYSPVSGDVVEVNEELNSSP  111

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++NSSPYE GW++KV+  + SEL +L +  EY KFCEEED
Sbjct  112  GLVNSSPYEKGWIMKVEIKDDSELKNLKNSDEYAKFCEEED  152



>gb|ABQ41935.1| glycine cleavage system H protein [Sonneratia caseolaris]
Length=129

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 111/129 (86%), Gaps = 5/129 (4%)
 Frame = +2

Query  266  TAASSKPNLS-----LSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVF  430
            ++A+SK  LS     LSRCFSSVLEGLKYA+SHEW+K EG VATIGITDHAQDHLGEVVF
Sbjct  1    SSAASKTQLSPELFSLSRCFSSVLEGLKYAESHEWIKHEGGVATIGITDHAQDHLGEVVF  60

Query  431  VELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWM  610
            V+LPE G  V QG  FGAVESVKATSDVNSP+SG+++EVN +LTE PG++NSSPYEDGWM
Sbjct  61   VDLPEPGVQVSQGGSFGAVESVKATSDVNSPVSGKIMEVNTQLTEKPGLVNSSPYEDGWM  120

Query  611  IKVKPSNAS  637
            IK+KPSN S
Sbjct  121  IKIKPSNPS  129



>emb|CDX79594.1| BnaC03g19300D [Brassica napus]
Length=156

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 126/162 (78%), Gaps = 11/162 (7%)
 Frame = +2

Query  215  MALR-IWASSTANALRLSTAASSKPNLSLSRCFSSV-LEGLKYAKSHEWVKSEGSVATIG  388
            MA R +WAS  A+ LR+S          + R F+SV L+ LKYA+SHEWVK +G+ AT G
Sbjct  1    MAARFLWASRVASHLRISI---------VQRGFASVVLKDLKYAESHEWVKIDGNKATFG  51

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLG+VV+VELP++G +V QG  FGAVESVKATSD+NSP+SG+VVEVN  L+E 
Sbjct  52   ITDHAQDHLGDVVYVELPDLGRSVSQGESFGAVESVKATSDINSPVSGKVVEVNEVLSES  111

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG++N+SPYEDGW+IKV+ S+A E   LMD  +Y+KFCEEED
Sbjct  112  PGLVNTSPYEDGWIIKVELSDAEEAKKLMDSDKYSKFCEEED  153



>ref|XP_010518994.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
[Tarenaya hassleriana]
Length=156

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 125/162 (77%), Gaps = 11/162 (7%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSV-LEGLKYAKSHEWVKSEGSVATIG  388
            MA R+ WAS  A+ LR+S            R FSSV L+ LKYA SHEWVK +G  A +G
Sbjct  1    MASRLMWASRVASHLRISV---------FQRGFSSVILKDLKYADSHEWVKVDGKKAVVG  51

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLG+VV+VELPEVG +V +G  FGAVESVKATSD+NSP+SG+V+E+N KL + 
Sbjct  52   ITDHAQDHLGDVVYVELPEVGRSVSKGESFGAVESVKATSDINSPVSGKVLEINEKLNDS  111

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            P ++NSSPYE+GW+IKV+ S++ EL +LMD ++YTKFCEEED
Sbjct  112  PALVNSSPYEEGWIIKVELSDSGELNNLMDSEKYTKFCEEED  153



>ref|NP_001046026.1| Os02g0170100 [Oryza sativa Japonica Group]
 dbj|BAD25486.1| putative glycine decarboxylase complex H-protein [Oryza sativa 
Japonica Group]
 dbj|BAD25184.1| putative glycine decarboxylase complex H-protein [Oryza sativa 
Japonica Group]
 dbj|BAF07940.1| Os02g0170100 [Oryza sativa Japonica Group]
 dbj|BAG94815.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86840.1| unnamed protein product [Oryza sativa Japonica Group]
Length=158

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 120/156 (77%), Gaps = 9/156 (6%)
 Frame = +2

Query  227  IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQ  406
            +WAS  A+ L++ST           R FS+VL+ LKYA +HEWVK EG  AT+GITDHAQ
Sbjct  9    LWASRAASYLKIST---------FPRAFSTVLKDLKYADTHEWVKVEGDSATVGITDHAQ  59

Query  407  DHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINS  586
             HLG+VV+VELPEVG++V QG  FGAVESVKATSD+ SP+SGEVV VN  L + PG++N+
Sbjct  60   HHLGDVVYVELPEVGSSVSQGKNFGAVESVKATSDIYSPVSGEVVAVNDGLGDEPGLVNT  119

Query  587  SPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            SPYE GW+IKVK S++ EL SLMD  +Y+KFCEEED
Sbjct  120  SPYESGWIIKVKVSDSGELNSLMDDAKYSKFCEEED  155



>gb|EAY84650.1| hypothetical protein OsI_06022 [Oryza sativa Indica Group]
 gb|EAZ21898.1| hypothetical protein OsJ_05551 [Oryza sativa Japonica Group]
Length=156

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 120/156 (77%), Gaps = 9/156 (6%)
 Frame = +2

Query  227  IWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQ  406
            +WAS  A+ L++ST           R FS+VL+ LKYA +HEWVK EG  AT+GITDHAQ
Sbjct  7    LWASRAASYLKIST---------FPRAFSTVLKDLKYADTHEWVKVEGDSATVGITDHAQ  57

Query  407  DHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINS  586
             HLG+VV+VELPEVG++V QG  FGAVESVKATSD+ SP+SGEVV VN  L + PG++N+
Sbjct  58   HHLGDVVYVELPEVGSSVSQGKNFGAVESVKATSDIYSPVSGEVVAVNDGLGDEPGLVNT  117

Query  587  SPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            SPYE GW+IKVK S++ EL SLMD  +Y+KFCEEED
Sbjct  118  SPYESGWIIKVKVSDSGELNSLMDDAKYSKFCEEED  153



>ref|XP_007041092.1| Single hybrid motif superfamily protein [Theobroma cacao]
 gb|EOX96923.1| Single hybrid motif superfamily protein [Theobroma cacao]
Length=137

 Score =   198 bits (504),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +2

Query  296  LSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSG  475
              R FS+VL  LKYA SHEWVK  G+ ATIGITDHAQDHLG+VV+VELPEVG  VKQG G
Sbjct  2    FHRGFSTVLNDLKYADSHEWVKVNGNSATIGITDHAQDHLGDVVYVELPEVGATVKQGDG  61

Query  476  FGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLM  655
            FGAVESVKATSDVNSP+SG+VVEVN +L+  P ++NSSPYE+GW+IKV+ ++A EL +LM
Sbjct  62   FGAVESVKATSDVNSPVSGKVVEVNEELSNSPALVNSSPYENGWIIKVEMNDAGELKNLM  121

Query  656  DPKEYTKFCEEED  694
              +EY+KFCEEED
Sbjct  122  GSEEYSKFCEEED  134



>ref|XP_010538303.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
[Tarenaya hassleriana]
Length=156

 Score =   199 bits (505),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 126/162 (78%), Gaps = 11/162 (7%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSV-LEGLKYAKSHEWVKSEGSVATIG  388
            MA R+ WAS  A+ LR+S            R FSSV L+ LKYA SHEWVK +G+ AT+G
Sbjct  1    MASRLLWASRVASHLRVSV---------FQRGFSSVILKDLKYADSHEWVKVDGNKATVG  51

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLG+VV+VELP+VG ++ QG  FGAVESVKATSD+NSPISG+VVEVN KL++ 
Sbjct  52   ITDHAQDHLGDVVYVELPDVGRSLSQGESFGAVESVKATSDINSPISGKVVEVNDKLSDT  111

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            P ++NSSPYEDGW+IKV+ S++ EL +LM  ++Y+ FCEEED
Sbjct  112  PALVNSSPYEDGWIIKVELSDSGELNNLMGSEKYSSFCEEED  153



>gb|KCW77926.1| hypothetical protein EUGRSUZ_D02179 [Eucalyptus grandis]
Length=129

 Score =   196 bits (497),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR+WASSTANALRLS+ AS  P  SL RCFSSVL+GLKYA SHEWVK EG VA++GIT
Sbjct  1    MALRMWASSTANALRLSSKASLSPAFSLHRCFSSVLDGLKYAPSHEWVKHEGPVASVGIT  60

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLGEVVFV+LPE G +V +G  FGAVESVKATSD+NSPISGE+VEVN KLTE PG
Sbjct  61   DHAQDHLGEVVFVDLPEPGGSVSKGGSFGAVESVKATSDINSPISGEIVEVNTKLTETPG  120

Query  575  VINSSPYED  601
            +I    Y +
Sbjct  121  LIIEFRYSN  129



>gb|KCW77925.1| hypothetical protein EUGRSUZ_D02179 [Eucalyptus grandis]
Length=128

 Score =   195 bits (496),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR+WASSTANALRLS+ AS  P  SL RCFSSVL+GLKYA SHEWVK EG VA++GIT
Sbjct  1    MALRMWASSTANALRLSSKASLSPAFSLHRCFSSVLDGLKYAPSHEWVKHEGPVASVGIT  60

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLGEVVFV+LPE G +V +G  FGAVESVKATSD+NSPISGE+VEVN KLTE PG
Sbjct  61   DHAQDHLGEVVFVDLPEPGGSVSKGGSFGAVESVKATSDINSPISGEIVEVNTKLTETPG  120

Query  575  VIN  583
            +++
Sbjct  121  LVS  123



>ref|XP_006410669.1| hypothetical protein EUTSA_v10017361mg [Eutrema salsugineum]
 gb|ESQ52122.1| hypothetical protein EUTSA_v10017361mg [Eutrema salsugineum]
Length=156

 Score =   196 bits (498),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 123/162 (76%), Gaps = 11/162 (7%)
 Frame = +2

Query  215  MALR-IWASSTANALRLSTAASSKPNLSLSRCFSSV-LEGLKYAKSHEWVKSEGSVATIG  388
            MA R + AS  A+ LR+S A          R FSSV L+ LKYA SHEWVK EG  AT G
Sbjct  1    MAARFLLASRVASYLRISVA---------QRGFSSVVLKDLKYADSHEWVKIEGKKATFG  51

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLG+VV+VELP++G +V QG  FGAVESVKATSD+ SPISG+VVEVN +LTE 
Sbjct  52   ITDHAQDHLGDVVYVELPDMGHSVSQGESFGAVESVKATSDIFSPISGKVVEVNEELTES  111

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            PG++NSSPY+ GW+IKV+ S+A E   LMD ++Y+KFCEEED
Sbjct  112  PGLVNSSPYDKGWLIKVEVSDAGEAQKLMDSEKYSKFCEEED  153



>gb|KCW77927.1| hypothetical protein EUGRSUZ_D02179 [Eucalyptus grandis]
Length=140

 Score =   195 bits (496),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR+WASSTANALRLS+ AS  P  SL RCFSSVL+GLKYA SHEWVK EG VA++GIT
Sbjct  1    MALRMWASSTANALRLSSKASLSPAFSLHRCFSSVLDGLKYAPSHEWVKHEGPVASVGIT  60

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQDHLGEVVFV+LPE G +V +G  FGAVESVKATSD+NSPISGE+VEVN KLTE PG
Sbjct  61   DHAQDHLGEVVFVDLPEPGGSVSKGGSFGAVESVKATSDINSPISGEIVEVNTKLTETPG  120

Query  575  VIN  583
            ++ 
Sbjct  121  LVT  123



>ref|XP_007156656.1| hypothetical protein PHAVU_002G006000g [Phaseolus vulgaris]
 gb|ESW28650.1| hypothetical protein PHAVU_002G006000g [Phaseolus vulgaris]
Length=154

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 111/128 (87%), Gaps = 3/128 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK--PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MALR+WASSTANAL+LS+A+     P  S SRC S+VL+GLKYA+SHEWVK EGSVATIG
Sbjct  1    MALRMWASSTANALKLSSASRPHLLPPFSFSRCLSTVLDGLKYAESHEWVKHEGSVATIG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQDHLGEVVFVELPE G AV + SGFGAVESVKATSD+NSPISGE+VEVN KLTE 
Sbjct  61   ITDHAQDHLGEVVFVELPEPGGAVSKNSGFGAVESVKATSDINSPISGEIVEVNTKLTET  120

Query  569  PG-VINSS  589
            PG VINS+
Sbjct  121  PGLVINSN  128



>ref|XP_010492917.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Camelina sativa]
Length=157

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 127/163 (78%), Gaps = 12/163 (7%)
 Frame = +2

Query  215  MALRIWASST--ANALRLSTAASSKPNLSLSRCFSSV-LEGLKYAKSHEWVKSEGSVATI  385
            MALR+  +S+  A+ LR+S +          R FSSV L+ LKYA SHEWVK EG+ AT+
Sbjct  1    MALRLMLASSRIASHLRISVS---------HRAFSSVVLKDLKYADSHEWVKIEGNKATV  51

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQ+HLG+VV+V+LP+VG +V QG  FGAVESVKATSD+NSPISG+V++VN  L+E
Sbjct  52   GITDHAQEHLGDVVYVKLPDVGRSVSQGESFGAVESVKATSDINSPISGKVLQVNKDLSE  111

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             P ++NSSPYE+GW++KV+ S+A E+  LMD  +Y+KFCEEED
Sbjct  112  SPALVNSSPYEEGWIMKVELSDAGEVKKLMDSDKYSKFCEEED  154



>ref|XP_010454131.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Camelina sativa]
Length=157

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 126/163 (77%), Gaps = 12/163 (7%)
 Frame = +2

Query  215  MALRIWASS--TANALRLSTAASSKPNLSLSRCFSSV-LEGLKYAKSHEWVKSEGSVATI  385
            MALR+  +S   A+ LR+S +          R FSSV L+ LKYA SHEWVK EG+ AT+
Sbjct  1    MALRLMLASYRIASHLRISVS---------HRAFSSVVLKDLKYADSHEWVKIEGNKATV  51

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQ+HLG+VV+VELP+VG +V QG  FGAVESVKATSD+NSPISG+V++VN  L+E
Sbjct  52   GITDHAQEHLGDVVYVELPDVGRSVSQGESFGAVESVKATSDINSPISGKVLQVNKDLSE  111

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             P ++NSSPYE+GW+IKV+ S+A E+  LM+  +Y+KFCEEED
Sbjct  112  SPALVNSSPYEEGWIIKVELSDAGEVKKLMESDKYSKFCEEED  154



>gb|EYU43673.1| hypothetical protein MIMGU_mgv1a0155372mg, partial [Erythranthe 
guttata]
Length=128

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  320  LEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVK  499
            L+ LKYA SHEWVK EG+ ATIGITDHAQDHLG+VV+VELPE GT V QG  FGAVESVK
Sbjct  1    LKDLKYADSHEWVKVEGNSATIGITDHAQDHLGDVVYVELPEAGTEVTQGDSFGAVESVK  60

Query  500  ATSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKF  679
            ATSD+NSPISG+VVEVN+KL E PG++N+SPYE+GW+IKV+ + + EL +LMD ++Y+KF
Sbjct  61   ATSDINSPISGKVVEVNSKLNESPGLVNASPYENGWIIKVEIATSDELNNLMDSEKYSKF  120

Query  680  CEEED  694
            CEEED
Sbjct  121  CEEED  125



>gb|AAL33596.1| glycine cleavage H-protein [Zea mays]
Length=134

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 108/134 (81%), Gaps = 2/134 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPN--LSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIG  388
            MA R+WASS ANAL+LS   +       S+SR FS+V +GLKY +SHEWVK+ G VAT+G
Sbjct  1    MAFRMWASSAANALKLSAGGAGARAAAFSISRFFSTVHDGLKYTQSHEWVKTTGDVATVG  60

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            ITDHAQ HLGEVVFVELPE GT V  G  FG VESVKATSDVNSPISGEVVEVNAKL+E 
Sbjct  61   ITDHAQGHLGEVVFVELPEPGTKVAAGGSFGNVESVKATSDVNSPISGEVVEVNAKLSET  120

Query  569  PGVINSSPYEDGWM  610
            PG+IN+SPYEDGWM
Sbjct  121  PGLINTSPYEDGWM  134



>ref|XP_007154472.1| hypothetical protein PHAVU_003G122000g [Phaseolus vulgaris]
 gb|ESW26466.1| hypothetical protein PHAVU_003G122000g [Phaseolus vulgaris]
Length=161

 Score =   194 bits (492),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 122/164 (74%), Gaps = 16/164 (10%)
 Frame = +2

Query  224  RIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHA  403
            ++WAS   + LR+S +          R FS+V++ LKYA SHEWVK +G+ AT+GITDHA
Sbjct  5    QLWASRAVSYLRISVS---------HRPFSNVVKDLKYADSHEWVKVDGNSATVGITDHA  55

Query  404  QDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGV--  577
            QDHLG+VV+VELPEVG  V QG  FGAVESVKATSDVNSP+SG+V+EVN +L   P +  
Sbjct  56   QDHLGDVVYVELPEVGATVTQGDSFGAVESVKATSDVNSPVSGKVIEVNQELNTSPALLS  115

Query  578  -----INSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
                 +NSSPY DGW+IKV+ S++ EL +LMD ++Y+KFCEEED
Sbjct  116  FVANYVNSSPYNDGWIIKVELSDSGELNNLMDSEKYSKFCEEED  159



>ref|XP_010097409.1| Glycine cleavage system H protein [Morus notabilis]
 gb|EXB68026.1| Glycine cleavage system H protein [Morus notabilis]
Length=155

 Score =   193 bits (491),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 120/158 (76%), Gaps = 9/158 (6%)
 Frame = +2

Query  221  LRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDH  400
            + +WAS  A+ LR+S           +R F+SV++ L YA SHEW K EG+ AT+GITDH
Sbjct  4    MLLWASRAASHLRISV---------FTRPFASVVKDLNYADSHEWAKVEGNSATVGITDH  54

Query  401  AQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVI  580
            AQDHLG+VV+VELPEVG ++ +G GFGAVESVKATSDV SP+SG+VVEVN +L   PG+I
Sbjct  55   AQDHLGDVVYVELPEVGKSLTKGEGFGAVESVKATSDVYSPMSGKVVEVNEELNSSPGLI  114

Query  581  NSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            NSSPYE GW++K++ S+  E+  LMD  +Y+KFCEEED
Sbjct  115  NSSPYEKGWIMKLEVSSGGEVNGLMDADQYSKFCEEED  152



>gb|KDO77366.1| hypothetical protein CISIN_1g044104mg, partial [Citrus sinensis]
Length=128

 Score =   192 bits (488),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  320  LEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVK  499
            ++ LKYA SHEWVK +G+ ATIGITDHAQDHLG+VV+VELPEVG  VKQ + FGAVESVK
Sbjct  1    IKDLKYADSHEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVK  60

Query  500  ATSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKF  679
            ATSDVNSP+SG+VVEVN +L+  P ++NSSPYEDGW+IKV+  NA EL  LMD  +YTKF
Sbjct  61   ATSDVNSPVSGKVVEVNEELSSSPALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTKF  120

Query  680  CEEED  694
            CEEED
Sbjct  121  CEEED  125



>ref|XP_010420656.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Camelina sativa]
Length=157

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 123/161 (76%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSV-LEGLKYAKSHEWVKSEGSVATIGI  391
            + L + +S  A+ LR+S +          R FSSV L+ LKYA SHEWVK EG+ AT+GI
Sbjct  3    LTLMLASSRIASHLRISLS---------HRAFSSVVLKDLKYADSHEWVKIEGNKATVGI  53

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQ+HLG+VV+VELP+VG +V QG  FGAVESVKATSD+NSPISG+V++VN  L+E P
Sbjct  54   TDHAQEHLGDVVYVELPDVGRSVSQGESFGAVESVKATSDINSPISGKVLQVNKDLSESP  113

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             ++ SSPYE+GW+IKV+ S+A E+  LMD  +Y+KFCEEED
Sbjct  114  ALVTSSPYEEGWIIKVELSDAGEVKKLMDSDKYSKFCEEED  154



>ref|XP_010692940.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=154

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 123/160 (77%), Gaps = 9/160 (6%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR++AS  A+ L +S          L R +++V+  LKY  SHEWVK EG++AT+GIT
Sbjct  1    MALRLFASKAASRLGISV---------LPRGYATVIGDLKYTDSHEWVKVEGNIATVGIT  51

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQ+HLG+VV+VELPE G  V  G+ FGAVESVKA+SD+NSPI+G+V +VN +L++ P 
Sbjct  52   DHAQEHLGDVVYVELPEEGADVSHGTAFGAVESVKASSDINSPITGKVTQVNNELSDSPA  111

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            ++NSSP+E GW+IKV+ SN+ ++ SLMD  +Y+KFCEEED
Sbjct  112  LVNSSPFEKGWIIKVELSNSGDINSLMDADKYSKFCEEED  151



>gb|AEP95744.1| glycine decarboxylase complex subunit H [Cicer arietinum]
Length=129

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 115/128 (90%), Gaps = 1/128 (1%)
 Frame = +2

Query  227  IWASSTANALRLSTAASSK-PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHA  403
            +WASSTANAL+LS ++SSK P  SLSR FSSVL+GLKY+ SHEWVK EGS+ATIGITDHA
Sbjct  1    VWASSTANALKLSFSSSSKLPPFSLSRSFSSVLDGLKYSSSHEWVKHEGSIATIGITDHA  60

Query  404  QDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVIN  583
            Q+HLGEVVFVELPE G +V +G+GFGAVESVKATSDVNSPISGE+VEVN KLT  PG+IN
Sbjct  61   QEHLGEVVFVELPEAGGSVSKGNGFGAVESVKATSDVNSPISGEIVEVNDKLTGKPGLIN  120

Query  584  SSPYEDGW  607
            SSPYEDGW
Sbjct  121  SSPYEDGW  128



>ref|XP_006365040.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Solanum tuberosum]
Length=154

 Score =   191 bits (486),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 121/160 (76%), Gaps = 9/160 (6%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MA ++WAS  A+ LR+S         +  R F++V + LKY +SHEWVK +G+ ATIGIT
Sbjct  1    MATKLWASRAASYLRIS---------AFHRAFATVPKDLKYTESHEWVKVDGNSATIGIT  51

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQ HLG+VV+VE PEVG++V+Q   FGAVESVKA+SD+NSP+SG+VVE N +L  GP 
Sbjct  52   DHAQKHLGDVVYVEFPEVGSSVEQFDSFGAVESVKASSDINSPVSGKVVEFNEELNNGPA  111

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            +IN++ YE GW++KV+ +   E+ +LMDP +YTKFC+EED
Sbjct  112  LINANCYEQGWILKVEMNKPDEVKALMDPDQYTKFCDEED  151



>ref|XP_006286593.1| hypothetical protein CARUB_v10002165mg [Capsella rubella]
 gb|EOA19491.1| hypothetical protein CARUB_v10002165mg [Capsella rubella]
Length=157

 Score =   191 bits (486),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 124/163 (76%), Gaps = 12/163 (7%)
 Frame = +2

Query  215  MALRIWASST--ANALRLSTAASSKPNLSLSRCFSSV-LEGLKYAKSHEWVKSEGSVATI  385
            MA R+  +S+  A+ LR+S +          R FSSV L+ LKYA SHEWVK EG+ AT+
Sbjct  1    MASRLLCASSMIASHLRISIS---------QRGFSSVVLKDLKYADSHEWVKIEGNKATV  51

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQ+HLG+VV+VELP+VG +V QG  FGAVESVKATSD+NSP+SG+V +VN  L+E
Sbjct  52   GITDHAQEHLGDVVYVELPDVGRSVSQGESFGAVESVKATSDINSPVSGKVFQVNQNLSE  111

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
             P ++NSSPYE GW+IKV+ S+A E+  LMD  +Y+KFCEEED
Sbjct  112  SPALVNSSPYEQGWIIKVELSDAGEVKKLMDSDKYSKFCEEED  154



>gb|EYU22152.1| hypothetical protein MIMGU_mgv1a015161mg [Erythranthe guttata]
Length=134

 Score =   190 bits (483),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 111/130 (85%), Gaps = 3/130 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANALRLS+++SS    P  SLSR FS+VLEG KYA SHEWVK +GS+ATI
Sbjct  1    MALRMWASSTANALRLSSSSSSSRFAPAFSLSRTFSTVLEGFKYATSHEWVKHDGSIATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFVELP+ G AV+Q S FGAVESVKATSD+NSPISGEVVEVN KLTE
Sbjct  61   GITDHAQDHLGEVVFVELPDGGKAVEQASSFGAVESVKATSDINSPISGEVVEVNTKLTE  120

Query  566  GPGVINSSPY  595
             PG++ +  Y
Sbjct  121  SPGLVINYFY  130



>ref|XP_004233241.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial 
[Solanum lycopersicum]
Length=154

 Score =   191 bits (484),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 121/160 (76%), Gaps = 9/160 (6%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MA ++WAS  A+ LR+S         +  R F++V + LKY +SHEWVK +G+ ATIGIT
Sbjct  1    MATKLWASRAASYLRIS---------AFHRAFATVPKDLKYTESHEWVKVDGNSATIGIT  51

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQ HLG+VV+VE PEVG++V+Q   FGAVESVKA+SD+NSP+SG+VVE N +L  GP 
Sbjct  52   DHAQKHLGDVVYVEFPEVGSSVEQFGSFGAVESVKASSDINSPVSGKVVEFNEELNNGPA  111

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            +IN++ YE GW++KV+ +   E+ +LMDP +YTKFC+EED
Sbjct  112  LINANCYEQGWILKVEMNKPDEVKALMDPDQYTKFCDEED  151



>ref|XP_004960244.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Setaria italica]
Length=161

 Score =   191 bits (484),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = +2

Query  290  LSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQG  469
            L L+  F SVL+ LKYA +HEWVK E   ATIGITDHAQDHLG+VV+VELPEVG +V Q 
Sbjct  25   LVLTHFFPSVLKDLKYADTHEWVKVEDGSATIGITDHAQDHLGDVVYVELPEVGNSVYQV  84

Query  470  SGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGS  649
              FGAVE VKATSD+NSP+SGEVVEVN KL+E PG++N+S Y+ GW+IKVK S++ EL S
Sbjct  85   KKFGAVERVKATSDINSPVSGEVVEVNGKLSEEPGLVNASSYDHGWIIKVKLSDSGELSS  144

Query  650  LMDPKEYTKFCEEED  694
            LMD ++Y KFCEEED
Sbjct  145  LMDDEKYLKFCEEED  159



>ref|XP_008346098.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Malus domestica]
Length=143

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  296  LSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSG  475
             +  F++V++ LKYA SHEWVK +G+ AT GITDHAQDHLG+VV+VELPE G AVKQG G
Sbjct  9    FTFLFTTVVKDLKYADSHEWVKVDGNSATXGITDHAQDHLGDVVYVELPEAGAAVKQGEG  68

Query  476  FGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLM  655
            FGAVESVKATSDV SP+SG+V EVN +L+  PG++NSSPY DGW++KV+ S++ EL  L+
Sbjct  69   FGAVESVKATSDVYSPVSGKVTEVNEELSNSPGLVNSSPYGDGWIMKVEISDSGELNKLL  128

Query  656  DPKEYTKFCEEED  694
            D ++YTKFCEEED
Sbjct  129  DAEKYTKFCEEED  141



>gb|KCW75489.1| hypothetical protein EUGRSUZ_E04249 [Eucalyptus grandis]
Length=144

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 118/161 (73%), Gaps = 21/161 (13%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WAS  A+ LR+S A          R F++VL+ LKY  SHEWVK EG+ AT+GI
Sbjct  1    MASRLLWASRAASYLRISVA---------HRGFATVLKDLKYYDSHEWVKVEGNSATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQDHLG+VVFVELPEVG  V QG GFGAVESVKATSDVNSP++G+VVEV        
Sbjct  52   TDHAQDHLGDVVFVELPEVGAPVTQGEGFGAVESVKATSDVNSPVTGKVVEV--------  103

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
               NSSPYE GW+IKV+ S+A +L +LMD  +Y+KFCEEED
Sbjct  104  ---NSSPYEQGWIIKVEMSDAGQLNNLMDADKYSKFCEEED  141



>emb|CCC55429.1| glycine decarboxylase complex H-protein [Pinus pinaster]
Length=171

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 126/168 (75%), Gaps = 8/168 (5%)
 Frame = +2

Query  215  MALRI-WASS--TANALRL-STAASSKPNL----SLSRCFSSVLEGLKYAKSHEWVKSEG  370
            MA R+ W +S   A+ LR+ ST   S+P      S SR F+SV++ LKY  SHEWVK +G
Sbjct  1    MASRVAWRASRTAASLLRMRSTCVDSRPPFRFPFSYSRGFASVVKDLKYTDSHEWVKVDG  60

Query  371  SVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVN  550
             +A IGITDHAQDHLG+VVFVELP+VGT V +G   GAVESVKATSDV SP+SGEV EVN
Sbjct  61   PLAVIGITDHAQDHLGDVVFVELPDVGTTVSKGGTLGAVESVKATSDVFSPVSGEVAEVN  120

Query  551  AKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            ++L+  PG++N SPY+ GW+ KV+ +NA++L SL+D  +YT FCE+ED
Sbjct  121  SELSGSPGLVNGSPYDGGWIAKVRMNNAADLESLLDVDQYTAFCEKED  168



>ref|XP_010536582.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Tarenaya hassleriana]
 ref|XP_010536594.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Tarenaya hassleriana]
 ref|XP_010536602.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Tarenaya hassleriana]
 ref|XP_010536609.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Tarenaya hassleriana]
 ref|XP_010536619.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Tarenaya hassleriana]
Length=158

 Score =   188 bits (477),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 120/161 (75%), Gaps = 10/161 (6%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSV-LEGLKYAKSHEWVKSEGSVATIG  388
            MAL + WAS TA+ LR+S            R F SV L  LKYA +HEWVK +G+ ATIG
Sbjct  1    MALPLFWASRTASRLRISVLRR--------RSFGSVNLRDLKYAGTHEWVKVDGNAATIG  52

Query  389  ITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEG  568
            IT HAQDH+G+V+FVELPE+G  +KQG  F +VES+KATSDVNSP+SG+V++V+ +LT  
Sbjct  53   ITHHAQDHVGDVIFVELPELGRVLKQGCSFASVESMKATSDVNSPVSGKVIKVHEELTSS  112

Query  569  PGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEE  691
            PG++N SPYE GWM+KV+ S+  EL +LMD  +YT+FCEEE
Sbjct  113  PGLVNWSPYERGWMVKVEMSDRGELNNLMDSDQYTRFCEEE  153



>ref|XP_002528162.1| glycine cleavage system h protein, putative [Ricinus communis]
 gb|EEF34213.1| glycine cleavage system h protein, putative [Ricinus communis]
Length=142

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = +2

Query  272  ASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVFVELPEVG  451
            A+ +P +       ++++ LKYA SHEWVK +G+ AT+GITDHAQDHLG+VV+VELPEVG
Sbjct  2    AAIRPQICC--ILLAIVKDLKYADSHEWVKVDGNSATVGITDHAQDHLGDVVYVELPEVG  59

Query  452  TAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSN  631
             AV QG+ FGAVESVKATSD+NSP+SG+VVEVN +L   PG++NSSPY+ GW+IKV  S+
Sbjct  60   AAVTQGNSFGAVESVKATSDINSPVSGKVVEVNEELNGSPGLVNSSPYDKGWIIKVNISD  119

Query  632  ASELGSLMDPKEYTKFCEEED  694
              EL +L D  EY KFCEEED
Sbjct  120  VGELKNLKDSDEYLKFCEEED  140



>gb|AEP95748.1| glycine decarboxylase complex subunit H [Cicer arietinum]
Length=127

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 112/124 (90%), Gaps = 1/124 (1%)
 Frame = +2

Query  239  STANALRLSTAASSK-PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQDHL  415
            STANAL+LS+++SSK P  SLSR FSSVL+GLKY+ SHEWVK EGS+ATIGITDHAQ+HL
Sbjct  4    STANALKLSSSSSSKLPPFSLSRSFSSVLDGLKYSSSHEWVKHEGSIATIGITDHAQEHL  63

Query  416  GEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINSSPY  595
            GEVVFVELPE G +V +G+GFGAVESVKATSDVNSPISGE+VEVN KLT  PG+INSSPY
Sbjct  64   GEVVFVELPEAGGSVSKGNGFGAVESVKATSDVNSPISGEIVEVNDKLTGKPGLINSSPY  123

Query  596  EDGW  607
            EDGW
Sbjct  124  EDGW  127



>ref|XP_008372112.1| PREDICTED: uncharacterized protein LOC103435489 [Malus domestica]
Length=383

 Score =   190 bits (482),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = +2

Query  308  FSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAV  487
            F++V++ LKYA SHEWVK +G+ AT GITDHAQDHLG+VV+VELPE G AVKQG GFGAV
Sbjct  253  FTTVVKDLKYADSHEWVKVDGNSATXGITDHAQDHLGDVVYVELPEAGAAVKQGEGFGAV  312

Query  488  ESVKATSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKE  667
            ESVKATSDV SP+SG+V EVN +L+  PG++NSSPY DGW++KV+ S++ EL  L+D ++
Sbjct  313  ESVKATSDVYSPVSGKVTEVNEELSNSPGLVNSSPYGDGWIMKVEISDSGELNKLLDAEK  372

Query  668  YTKFCEEED  694
            YTKFCEEED
Sbjct  373  YTKFCEEED  381



>ref|XP_003611466.1| Glycine cleavage system H protein [Medicago truncatula]
 gb|AES94424.1| glycine cleavage system H protein [Medicago truncatula]
Length=145

 Score =   182 bits (462),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 110/125 (88%), Gaps = 3/125 (2%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSK---PNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATI  385
            MALR+WASSTANAL+LS+++S     P  S+SRCFS+VL+GLKYA SHEWVK EGSVATI
Sbjct  1    MALRMWASSTANALKLSSSSSRLHLSPPFSISRCFSTVLDGLKYASSHEWVKHEGSVATI  60

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GITDHAQDHLGEVVFVELPE G +V +G+GFGAVESVKATSDVNSPISGE+VEVN KLT 
Sbjct  61   GITDHAQDHLGEVVFVELPEPGGSVTKGNGFGAVESVKATSDVNSPISGEIVEVNDKLTG  120

Query  566  GPGVI  580
             PG++
Sbjct  121  KPGLV  125



>gb|ABK23939.1| unknown [Picea sitchensis]
 gb|ABK26695.1| unknown [Picea sitchensis]
 gb|ACN40259.1| unknown [Picea sitchensis]
Length=171

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 122/168 (73%), Gaps = 8/168 (5%)
 Frame = +2

Query  215  MALRI-WASS--TANALRL-STAASSKPNLSL----SRCFSSVLEGLKYAKSHEWVKSEG  370
            MA R+ W +S   A+ LR+ ST   S+P        SR FSSV++  KY  SHEWVK +G
Sbjct  1    MASRVAWRASRGAASLLRMRSTCVESRPPFRFPFAYSRGFSSVVKNFKYTDSHEWVKVDG  60

Query  371  SVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVN  550
             +A IGITDHAQ+HLG+VVFVELP+VGT V +G   G VESVK+TSDV SP+SGEV EVN
Sbjct  61   PLAVIGITDHAQEHLGDVVFVELPDVGTTVSKGGTVGVVESVKSTSDVFSPVSGEVAEVN  120

Query  551  AKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            ++L   PG++N SPY+ GW+IKV+ ++ +++ SL+D  +YT FCE+E+
Sbjct  121  SELNSSPGLVNGSPYDGGWIIKVRMNDPADVDSLLDADQYTTFCEKEN  168



>ref|XP_007215079.1| hypothetical protein PRUPE_ppa012577mg [Prunus persica]
 gb|EMJ16278.1| hypothetical protein PRUPE_ppa012577mg [Prunus persica]
Length=163

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 124/162 (77%), Gaps = 12/162 (7%)
 Frame = +2

Query  215  MAL-RIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEW--VKSEGSVATI  385
            MAL R+W++S A +LR+S            R FSS +EGLK+AKSHEW  V+ EG +A++
Sbjct  1    MALTRVWSTSAALSLRVSVPC---------RGFSSAVEGLKFAKSHEWAKVEDEGKLASV  51

Query  386  GITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTE  565
            GIT+HAQ+HLG+V++VELP+VG AV QG+  G+VESVKA+SD+NSP+SG +VEVN +L  
Sbjct  52   GITEHAQEHLGDVIYVELPDVGVAVAQGTIVGSVESVKASSDINSPVSGNIVEVNKELLS  111

Query  566  GPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEE  691
             PG++N SPYE GW++KV+ S+  EL +LMDP EY+++ +++
Sbjct  112  SPGLVNGSPYEKGWIMKVEMSSRDELNNLMDPDEYSEYVKKK  153



>ref|XP_001696637.1| glycine cleavage system, H-protein [Chlamydomonas reinhardtii]
 gb|EDP08614.1| glycine cleavage system, H-protein [Chlamydomonas reinhardtii]
 gb|ADF43148.1| GCSHp [Chlamydomonas reinhardtii]
 gb|ADF43186.1| GCSHm [Chlamydomonas reinhardtii]
Length=159

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 110/158 (70%), Gaps = 0/158 (0%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR + S     L L          +  R +++V +G KYA SHEW K +G VAT+GI+
Sbjct  1    MALRAFGSLALGNLGLQAQVMQFAGATAMRAYATVEKGYKYAASHEWAKVDGDVATVGIS  60

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQ  LG+VV+VELP+VG AVK+G  FG VESVKA SDV SPISGEVVEVN+ L + PG
Sbjct  61   DHAQGELGDVVYVELPDVGKAVKKGETFGVVESVKAASDVYSPISGEVVEVNSLLVDKPG  120

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEE  688
             +NSSP+++GW+IKVK SN  EL SL+D   Y K CE+
Sbjct  121  TVNSSPFKEGWIIKVKLSNKGELSSLLDSDAYAKECEK  158



>gb|KHN08049.1| Glycine cleavage system H protein, mitochondrial [Glycine soja]
Length=179

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 124/177 (70%), Gaps = 18/177 (10%)
 Frame = +2

Query  215  MALR-IWASSTANALRLSTAASSKPNLSLSRCFSSVL---EGLKYAK--------SHEWV  358
            MA R +WAS  A+ LR+S    S  N ++S   S  +   +G KY          + +W 
Sbjct  1    MACRQLWASRAASYLRISVFHRSFSN-AVSGDLSGYVATDQGFKYRSWSRLFVDIADKWQ  59

Query  359  KS-----EGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSP  523
             +     +G+ AT+GITDHAQDHLGEVV+VELPEVG  V QG GFGA ESVKATSD+NSP
Sbjct  60   TNAADAVDGNSATVGITDHAQDHLGEVVYVELPEVGATVTQGEGFGAAESVKATSDINSP  119

Query  524  ISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            +SG+VVEVN KLT  P ++N+SPY+DGW+IKV+ S++ EL +LMD ++Y+KFCEEED
Sbjct  120  VSGKVVEVNEKLTSSPALVNTSPYKDGWIIKVEMSDSGELNNLMDSEKYSKFCEEED  176



>ref|XP_002957951.1| hypothetical protein VOLCADRAFT_77739 [Volvox carteri f. nagariensis]
 gb|ADI46890.1| GCSHf [Volvox carteri f. nagariensis]
 gb|ADI46962.1| GCSHm [Volvox carteri f. nagariensis]
 gb|EFJ40977.1| hypothetical protein VOLCADRAFT_77739 [Volvox carteri f. nagariensis]
Length=159

 Score =   175 bits (444),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 107/158 (68%), Gaps = 0/158 (0%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR++ S     L L               FS+V +G KYAKSHEW K++G +AT+GI+
Sbjct  1    MALRVFGSFALGKLGLQAQIMQASGAIAVHAFSTVAQGYKYAKSHEWAKADGDIATVGIS  60

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQ  LG+VV+VELP+VG  VK+G  FG VESVKA SDV SP+SGEVVEVN  L + PG
Sbjct  61   DHAQGQLGDVVYVELPDVGKEVKRGETFGVVESVKAASDVYSPVSGEVVEVNQALVDKPG  120

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEE  688
             +N+SPYE+GW+IKVK S   EL  L++  EY   CE+
Sbjct  121  TVNTSPYEEGWIIKVKMSKKGELVGLLNADEYAAECEK  158



>gb|ABA01127.1| mitochondrial glycine decarboxylase complex H [Chlamydomonas 
incerta]
Length=159

 Score =   175 bits (443),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 109/158 (69%), Gaps = 0/158 (0%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR + S     L L          +  R +++V +G KYA SHEW K +G VAT+GI+
Sbjct  1    MALRAFGSLALGKLGLQAQVMQFAGATAMRTYATVEKGYKYAPSHEWAKVDGDVATVGIS  60

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQ  LG+VV+VELP+VG AVK+G  FG VESVKA SDV SPISGE VEVN+ L + PG
Sbjct  61   DHAQGELGDVVYVELPDVGKAVKKGETFGVVESVKAASDVYSPISGEAVEVNSVLVDKPG  120

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEE  688
             +NSSP+++GW+IKVK SN  EL SL+D   Y K CE+
Sbjct  121  TVNSSPFKEGWIIKVKLSNKGELSSLLDSDAYAKECEK  158



>ref|XP_002500679.1| glycine cleavage system h-protein [Micromonas sp. RCC299]
 gb|ACO61937.1| glycine cleavage system h-protein [Micromonas sp. RCC299]
Length=157

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 107/157 (68%), Gaps = 1/157 (1%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGIT  394
            MALR +A  +A +L L +  S  P L+ +R  S+V+EGLKY  SHEW K +G   T+GIT
Sbjct  1    MALRQFARQSARSLGLRSDVSLAPALA-TRGMSTVIEGLKYMASHEWAKVDGDTVTVGIT  59

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
            DHAQ  LG+VV+VELPEVG+ V   S FG VESVKA SDV SPISGEVV VN  L + PG
Sbjct  60   DHAQAELGDVVYVELPEVGSQVSAKSTFGVVESVKAASDVYSPISGEVVAVNEDLADSPG  119

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCE  685
             +N   Y DGWM+KVK ++  EL +LMD K Y   C+
Sbjct  120  KVNEGAYTDGWMMKVKMTDPKELDALMDAKAYEASCD  156



>ref|XP_008666737.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Zea mays]
 ref|XP_008650115.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Zea mays]
Length=174

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +2

Query  317  VLEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESV  496
            VL+ LKYA SHEWVK EG  AT+GITD+AQ  LGE+V+VELPEVG +V QG  F A+ESV
Sbjct  49   VLKDLKYADSHEWVKVEGDSATVGITDYAQRALGELVYVELPEVGISVSQGKTFAALESV  108

Query  497  KATSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTK  676
            KA SD  SP+S EVVEVN KL++ PG++N+SPYE GW+IKVK SN+ EL SLMD  +Y+K
Sbjct  109  KAASDTYSPVSREVVEVNEKLSDLPGLVNTSPYEKGWLIKVKLSNSGELNSLMDDDKYSK  168

Query  677  FCE  685
            FCE
Sbjct  169  FCE  171



>ref|XP_001769387.1| predicted protein [Physcomitrella patens]
 gb|EDQ65756.1| predicted protein [Physcomitrella patens]
Length=159

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 115/161 (71%), Gaps = 9/161 (6%)
 Frame = +2

Query  221  LRIWASSTANALRLSTAASSKPNLSLSRCFSS--VLEGLKYAKSHEWVKSEGSVATIGIT  394
            LR WA  +A+A R + A          + FS+  V++ L+Y+KSHEW + EG  A +GIT
Sbjct  6    LRPWAVRSASAFRQTMAP-------FFQRFSTATVVDNLRYSKSHEWTRLEGDTAVVGIT  58

Query  395  DHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPG  574
             HAQ+ LG+VVFV+LPEVG A+ QG  FG+VESVKA SDV SP+SGEVVEVN++LTE PG
Sbjct  59   HHAQEALGDVVFVDLPEVGKAISQGDSFGSVESVKAVSDVYSPVSGEVVEVNSELTESPG  118

Query  575  VINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEEDH  697
            ++N  P+E+GWM+K+K  + +E+ SL+  + Y ++ EEE H
Sbjct  119  LVNKGPFEEGWMMKLKLKDPAEVQSLLTAESYKQYIEEEGH  159



>ref|XP_008659953.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
[Zea mays]
Length=179

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  308  FSSVLEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAV  487
            F S+ + LKYA SHEWVK EG  AT+GITD+AQ  LGE+V+VELPEVG +V QG  F A+
Sbjct  51   FFSMPKDLKYADSHEWVKVEGDSATVGITDYAQRALGELVYVELPEVGISVSQGKTFAAL  110

Query  488  ESVKATSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKE  667
            ESVKA SD  SP+SGEVVEVN KL++ PG++N+SPYE GW+IKVK SN+ EL SLMD  +
Sbjct  111  ESVKAASDTYSPVSGEVVEVNEKLSDLPGLVNTSPYEKGWLIKVKLSNSGELNSLMDDDK  170

Query  668  YTKFCE  685
            Y+KFCE
Sbjct  171  YSKFCE  176



>ref|XP_003064360.1| glycine cleavage system h-protein [Micromonas pusilla CCMP1545]
 gb|EEH51265.1| glycine cleavage system h-protein [Micromonas pusilla CCMP1545]
Length=154

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 102/153 (67%), Gaps = 8/153 (5%)
 Frame = +2

Query  251  ALRLSTAASSKPNLSLSRCF--------SSVLEGLKYAKSHEWVKSEGSVATIGITDHAQ  406
            ALR  +   + P L+L            S+V+EGLKY +SHEW K +G VATIGITDHAQ
Sbjct  2    ALRQFSRRVAAPMLNLRAAAPAMNARAMSTVIEGLKYMQSHEWAKVDGDVATIGITDHAQ  61

Query  407  DHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGVINS  586
              LG+VV+VELPEVG+ V     FG VESVKA SDV SP++GEV+ +N  L + PG +N 
Sbjct  62   AELGDVVYVELPEVGSTVTHKETFGVVESVKAASDVYSPVTGEVIAINEDLADAPGKVNE  121

Query  587  SPYEDGWMIKVKPSNASELGSLMDPKEYTKFCE  685
              +EDGWM+KVK SNA EL SLMD   Y K CE
Sbjct  122  GAFEDGWMMKVKMSNAGELDSLMDAAAYEKSCE  154



>ref|WP_020676029.1| hypothetical protein [Geopsychrobacter electrodiphilus]
Length=127

 Score =   164 bits (415),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  323  EGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKA  502
            E LKY + HEWV  EG + +IGITD AQD LG+VVFVELPEVG  V+ G  FG VESVKA
Sbjct  5    EELKYTEEHEWVLLEGDLVSIGITDFAQDQLGDVVFVELPEVGDRVELGKAFGVVESVKA  64

Query  503  TSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFC  682
             SD+ +P++GEVVEVN +L + P +IN+SPYEDGWMI++KP + SEL  LMD  +Y  F 
Sbjct  65   VSDIYAPLAGEVVEVNTELPDAPEMINTSPYEDGWMIRIKPDDPSELEELMDASDYQDFV  124

Query  683  EEE  691
            EEE
Sbjct  125  EEE  127



>gb|KFM28245.1| Glycine cleavage system H protein, mitochondrial [Auxenochlorella 
protothecoides]
Length=170

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 115/173 (66%), Gaps = 15/173 (9%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAASSKPNLSLS------------RCFSSVLEGLKYAKSHEWV  358
            MALR  AS  A+ L L   A   P+L+L+            R +S+V++GLKYA+SHE+ 
Sbjct  1    MALRQLASQAASGLGLRCTA---PSLALTQSPVGLLQAALFRSYSTVIDGLKYAESHEYA  57

Query  359  KSEGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEV  538
            K EG VAT+GITD AQ  LG+VV+VE+PEVG ++ +G+  G VESVKA SD+ SP+SGEV
Sbjct  58   KIEGDVATLGITDFAQSELGDVVYVEVPEVGASLSKGANLGVVESVKAASDIYSPLSGEV  117

Query  539  VEVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEEDH  697
            +EVN+ L + P  IN+ P+E GW+ K+K S+ SE  SL+D   Y K  E + H
Sbjct  118  IEVNSALVDDPAKINAEPFEGGWLAKIKLSDPSEADSLLDANAYKKHVESQAH  170



>ref|XP_009393275.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=135

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 107/161 (66%), Gaps = 30/161 (19%)
 Frame = +2

Query  215  MALRI-WASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGI  391
            MA R+ WA   A+ LR+ST           R FS+V++ LKYA +HEWVK +GS AT+GI
Sbjct  1    MASRLLWARGAASYLRIST---------FHRGFSTVIKDLKYADTHEWVKVDGSSATVGI  51

Query  392  TDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGP  571
            TDHAQ                    G  FGAVESVKATSDVNSP+SGEVVEVN +L+  P
Sbjct  52   TDHAQ--------------------GKNFGAVESVKATSDVNSPVSGEVVEVNTELSGSP  91

Query  572  GVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            G++N+ PYE+GW+IKVK S+  EL SLMD + Y+KFCEEED
Sbjct  92   GLVNARPYENGWIIKVKMSDTGELNSLMDSEGYSKFCEEED  132



>emb|CEG01882.1| Glycine cleavage H-protein, subgroup [Ostreococcus tauri]
Length=157

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 108/161 (67%), Gaps = 5/161 (3%)
 Frame = +2

Query  203  SCKTMALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVAT  382
            S +T  L +  SSTA A     AA     L     +S+V+EGLKY  SHEW K EG VAT
Sbjct  2    SARTALLALSRSSTAMAPMCCGAAFGARAL-----YSTVIEGLKYMPSHEWAKVEGDVAT  56

Query  383  IGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLT  562
            IGITDHAQ  LG++V+VELPEVG+ V+  S FG VESVKA SDV SP+SGEVV VN  L 
Sbjct  57   IGITDHAQAELGDIVYVELPEVGSKVEAKSSFGVVESVKAASDVYSPLSGEVVAVNDALN  116

Query  563  EGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCE  685
            + PG++N S + +GW++KVK SN SE+ ++MD   Y   C+
Sbjct  117  DTPGMVNESSFGEGWLMKVKMSNPSEVDNMMDAAAYEASCQ  157



>ref|XP_001780120.1| predicted protein [Physcomitrella patens]
 gb|EDQ55039.1| predicted protein [Physcomitrella patens]
Length=168

 Score =   159 bits (403),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 12/169 (7%)
 Frame = +2

Query  215  MALRIWASSTANALRLS--TAASSKPNLSLSRCFSS-------VLEGLKYAKSHEWVKSE  367
            MALR  A+  A  LRL    A +    + L+R FS+       V +GL YA++HEWVK +
Sbjct  1    MALRSAATQAATLLRLRGRPALTQSIYVPLARRFSTTQVASDEVRDGLHYAETHEWVKVD  60

Query  368  GSVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEV  547
            G + TIGI+DHAQ  LG++VF+ELPE G+AV   + FG VESVKA S+V SP+SGEVVE 
Sbjct  61   GDIGTIGISDHAQKALGDLVFIELPEGGSAVTAKTRFGLVESVKAVSEVYSPVSGEVVET  120

Query  548  NAKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEEED  694
            N+ L+E P  +NSSPY++GW+IKVK S+ SEL +LM+ +   K+ E +D
Sbjct  121  NSSLSETPETVNSSPYDEGWLIKVKLSDKSELENLMNKE---KYAEHQD  166



>ref|XP_005845372.1| hypothetical protein CHLNCDRAFT_32297 [Chlorella variabilis]
 gb|EFN53270.1| hypothetical protein CHLNCDRAFT_32297 [Chlorella variabilis]
Length=163

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 109/163 (67%), Gaps = 6/163 (4%)
 Frame = +2

Query  215  MALRIWASSTANALRLSTAA-----SSKPNLSLS-RCFSSVLEGLKYAKSHEWVKSEGSV  376
            MAL  +A      L L   A     SS    SL+ R +++VLEGLKY++ HEWVK EG  
Sbjct  1    MALAAFAKKAVGGLGLRCGAPLLADSSSTLRSLAVRGYATVLEGLKYSEDHEWVKLEGDT  60

Query  377  ATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAK  556
            A +GITD AQ+ LG++V+VELPEVG+ V  G  F  VESVKA SDV SP++GEV EVN+ 
Sbjct  61   AVVGITDFAQEELGDLVYVELPEVGSTVTAGERFSVVESVKAASDVISPVTGEVTEVNSA  120

Query  557  LTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCE  685
            L++    +N+ P+ +GWM+KVK ++AS+L  LMD   YT FC+
Sbjct  121  LSDDSSKVNTDPFGEGWMVKVKLADASQLDGLMDSNGYTDFCK  163



>ref|NP_001172819.1| Os02g0169700 [Oryza sativa Japonica Group]
 dbj|BAH91548.1| Os02g0169700, partial [Oryza sativa Japonica Group]
Length=146

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 101/127 (80%), Gaps = 1/127 (1%)
 Frame = +2

Query  314  SVLEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVES  493
            +VL+ LKY+++HEWV  EG  ATIGI+DHAQDHLG V  VELPEVG +V QG+ FG V S
Sbjct  16   NVLKDLKYSETHEWVSVEGDYATIGISDHAQDHLGYVASVELPEVGQSVSQGNKFGVVVS  75

Query  494  VKATSD-VNSPISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEY  670
            VK T+  +NSP+SGEVVEVN +L++ PG++N+ PYE GW+I VK S++ EL SLM+ ++Y
Sbjct  76   VKGTTRGINSPVSGEVVEVNDQLSDLPGLVNARPYETGWIIVVKISDSGELNSLMNDEDY  135

Query  671  TKFCEEE  691
            +KFC+ E
Sbjct  136  SKFCKGE  142



>ref|XP_005646133.1| glycine cleavage H-protein [Coccomyxa subellipsoidea C-169]
 gb|EIE21589.1| glycine cleavage H-protein [Coccomyxa subellipsoidea C-169]
Length=134

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = +2

Query  314  SVLEGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVES  493
            +V EG KYAKSHE+ K +G  ATIGI+D AQ  LG++V+VELPEVG+ V QG  FG VES
Sbjct  7    AVEEGFKYAKSHEYAKIDGDTATIGISDFAQSELGDIVYVELPEVGSEVTQGENFGVVES  66

Query  494  VKATSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYT  673
            VKA SDV SP+SGEVVE N  LTE PG +N++P+ DGWMIKVK ++ S+   L+D   Y 
Sbjct  67   VKAASDVYSPLSGEVVETNQTLTEDPGKVNTAPFSDGWMIKVKLTDPSQADGLLDSAAYG  126

Query  674  KFCEEEDH  697
              CEE  H
Sbjct  127  THCEENAH  134



>ref|XP_005789351.1| glycine cleavage system protein H [Emiliania huxleyi CCMP1516]
 gb|EOD36922.1| glycine cleavage system protein H [Emiliania huxleyi CCMP1516]
Length=151

 Score =   157 bits (397),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 102/157 (65%), Gaps = 10/157 (6%)
 Frame = +2

Query  218  ALRIWASSTANALRLSTAASSKPNLSLSRCFSSVLEGLKYAKSHEWVKSEGSVATIGITD  397
            +LR+ +   A + RL+     +P L   R  ++     K++K HEWVK EG VAT+GITD
Sbjct  5    SLRLTSRVPAASQRLA-----RPALLARRGLAT-----KFSKDHEWVKVEGKVATVGITD  54

Query  398  HAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKATSDVNSPISGEVVEVNAKLTEGPGV  577
            HAQ+ LG+VVFV+LPEVG  VK+    GAVESVKA SDV +P+SGEV +VN  L + P +
Sbjct  55   HAQEQLGDVVFVDLPEVGAVVKKDDTMGAVESVKAASDVYAPVSGEVTDVNGALNDEPAL  114

Query  578  INSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFCEE  688
            INSS   DGWM KVK S   EL  LMD   Y KFC E
Sbjct  115  INSSAESDGWMCKVKLSKPDELDGLMDADAYKKFCNE  151



>ref|WP_040095092.1| glycine cleavage system protein H [Geoalkalibacter ferrihydriticus]
 gb|KIH77274.1| glycine cleavage system protein H [Geoalkalibacter ferrihydriticus 
DSM 17813]
Length=127

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  323  EGLKYAKSHEWVKSEGSVATIGITDHAQDHLGEVVFVELPEVGTAVKQGSGFGAVESVKA  502
            E  KY + HEWV  EG V T+GITD AQD LG+VVFVELPEVG  V+ G  FG VESVKA
Sbjct  5    EEFKYTEEHEWVLVEGEVVTVGITDFAQDSLGDVVFVELPEVGIKVEAGKVFGVVESVKA  64

Query  503  TSDVNSPISGEVVEVNAKLTEGPGVINSSPYEDGWMIKVKPSNASELGSLMDPKEYTKFC  682
             SD+ SP++GEVVEVN +L + P ++N+SPYEDGWMIKV+ S+ +EL  L+D   Y +F 
Sbjct  65   VSDIYSPVTGEVVEVNEELPDTPEILNTSPYEDGWMIKVRLSDPAELEDLLDAASYQEFI  124

Query  683  EEE  691
            EE+
Sbjct  125  EED  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2357131629170