BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27650_g1_i1 len=1570 path=[1:0-1569]

Length=1570
                                                                      Score     E

ref|NP_001291330.1|  11-beta-hydroxysteroid dehydrogenase-like 5        541   0.0      
ref|XP_009622010.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    538   0.0      
ref|XP_009799020.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    536   0.0      
ref|XP_006356566.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    535   0.0      
ref|XP_010062387.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    533   0.0      
ref|XP_004242256.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    532   0.0      
ref|XP_009797377.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    529   0.0      
ref|XP_008459623.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    529   0.0      
ref|XP_009617211.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    528   0.0      
ref|XP_004299863.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    525   0.0      
ref|XP_008219091.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    525   0.0      
ref|XP_008378718.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    524   0.0      
ref|XP_004141553.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    525   0.0      
ref|XP_008365259.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    524   1e-180   
ref|XP_009357192.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    523   4e-180   
ref|XP_007222177.1|  hypothetical protein PRUPE_ppa007781mg             521   2e-179   
ref|XP_009333966.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    520   3e-179   
gb|KHG01718.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     520   4e-179   
gb|EYU22738.1|  hypothetical protein MIMGU_mgv1a008685mg                519   1e-178   
ref|XP_009335461.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    515   5e-177   
ref|XP_010530110.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    515   6e-177   
gb|AAX49394.1|  STO-1                                                   514   1e-176   Coffea canephora [robusta coffee]
ref|XP_006441634.1|  hypothetical protein CICLE_v10020750mg             513   4e-176   
ref|XP_007019842.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...    514   5e-176   
ref|XP_006478271.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    509   1e-174   
gb|EPS67484.1|  hypothetical protein M569_07290                         508   1e-174   
ref|XP_002279316.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    508   2e-174   Vitis vinifera
ref|XP_010100094.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...    506   2e-173   
ref|XP_010645922.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    505   2e-173   
ref|XP_010683155.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    504   1e-172   
ref|XP_002528042.1|  Corticosteroid 11-beta-dehydrogenase, putative     503   2e-172   Ricinus communis
ref|NP_001241259.1|  uncharacterized protein LOC100780731               503   3e-172   
ref|XP_006376168.1|  short-chain dehydrogenase/reductase family p...    501   6e-172   
gb|ABS28873.1|  steroleosin-B                                           499   4e-171   Arachis hypogaea [goober]
ref|XP_011006178.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    498   6e-171   
ref|XP_006397111.1|  hypothetical protein EUTSA_v10029315mg             500   1e-170   
ref|XP_004511498.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    499   1e-170   
gb|KHN35097.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     499   1e-170   
ref|XP_009134177.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    500   6e-170   
gb|KFK32035.1|  hypothetical protein AALP_AA6G191600                    498   7e-170   
emb|CDX90742.1|  BnaA03g24220D                                          499   1e-169   
gb|KHN25620.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     496   1e-169   
gb|ACG69526.1|  steroleosin SLO2-2                                      500   2e-169   Brassica napus [oilseed rape]
emb|CDY05081.1|  BnaC03g28790D                                          499   3e-169   
ref|XP_010437678.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    495   5e-169   
ref|XP_006289482.1|  hypothetical protein CARUB_v10003016mg             494   1e-168   
gb|ACG69525.1|  steroleosin SLO2-1                                      497   1e-168   Brassica napus [oilseed rape]
ref|XP_003538052.2|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...    495   2e-168   
ref|XP_010455398.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    494   2e-168   
ref|XP_003610951.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...    491   1e-167   
ref|XP_010421918.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    489   8e-167   
ref|XP_002872483.1|  short-chain dehydrogenase/reductase family p...    489   1e-166   
ref|NP_192740.1|  hydroxysteroid dehydrogenase 5                        490   1e-166   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002325513.1|  short-chain dehydrogenase/reductase family p...    488   2e-166   Populus trichocarpa [western balsam poplar]
emb|CAN76088.1|  hypothetical protein VITISV_028806                     482   1e-163   Vitis vinifera
ref|XP_011036367.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    473   1e-160   
ref|XP_008806995.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    470   9e-160   
ref|XP_010910399.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    470   1e-159   
gb|KDP45630.1|  hypothetical protein JCGZ_17237                         466   8e-159   
ref|XP_009387843.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    466   7e-158   
ref|XP_010927839.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    465   9e-158   
ref|XP_009408757.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    441   2e-148   
gb|KDO51722.1|  hypothetical protein CISIN_1g039397mg                   441   5e-148   
gb|ACF75106.1|  Ste-b                                                   445   5e-148   Brassica napus [oilseed rape]
ref|XP_008806996.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    432   4e-145   
ref|XP_006650876.1|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...    428   3e-143   
ref|XP_010910406.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    426   6e-143   
ref|XP_009797378.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    418   8e-140   
ref|NP_001051859.1|  Os03g0842900                                       418   3e-139   Oryza sativa Japonica Group [Japonica rice]
gb|ABX82800.1|  sterolesin-B                                            408   1e-136   Brassica napus [oilseed rape]
ref|XP_007019843.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...    409   2e-136   
ref|XP_004981097.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    409   1e-135   
ref|NP_001145589.1|  uncharacterized protein LOC100279063               405   9e-134   Zea mays [maize]
dbj|BAK05747.1|  predicted protein                                      396   3e-130   
gb|EEE60277.1|  hypothetical protein OsJ_13325                          385   2e-126   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002463543.1|  hypothetical protein SORBIDRAFT_01g001700          384   7e-126   Sorghum bicolor [broomcorn]
ref|XP_010927840.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    360   4e-117   
ref|XP_008347866.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    348   7e-113   
ref|XP_003562566.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    340   3e-108   
gb|EMS48748.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     327   4e-105   
ref|XP_002966954.1|  hypothetical protein SELMODRAFT_87233              328   5e-104   
ref|XP_002994525.1|  hypothetical protein SELMODRAFT_138761             328   5e-104   
ref|XP_006836805.1|  hypothetical protein AMTR_s00099p00028560          317   7e-102   
gb|EMT32988.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     302   6e-95    
ref|XP_008811369.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    302   3e-94    
ref|XP_011015818.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    296   7e-94    
ref|XP_010929561.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    301   2e-93    
ref|XP_010929560.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    301   3e-93    
ref|XP_006844627.1|  hypothetical protein AMTR_s00016p00227990          296   9e-92    
ref|XP_010929562.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    295   2e-91    
ref|XP_010249449.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    293   1e-90    
ref|XP_001767568.1|  predicted protein                                  290   3e-89    
ref|XP_007160005.1|  hypothetical protein PHAVU_002G285000g             274   3e-83    
ref|XP_002973836.1|  hypothetical protein SELMODRAFT_100351             273   5e-83    
ref|XP_010026329.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    273   6e-83    
ref|XP_008239511.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    271   4e-82    
ref|XP_008344913.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    270   1e-81    
ref|XP_009359396.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    269   3e-81    
ref|XP_010250644.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    267   1e-80    
gb|KHN16857.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     267   2e-80    
ref|XP_009359395.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    266   4e-80    
ref|XP_010086991.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...    265   9e-80    
ref|XP_010663769.1|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...    264   2e-79    
ref|XP_004503736.1|  PREDICTED: dehydrogenase/reductase SDR famil...    264   2e-79    
ref|XP_010277349.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    262   3e-79    
ref|XP_004962634.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    263   4e-79    
gb|KEH21006.1|  short-chain dehydrogenase/reductase                     263   4e-79    
ref|XP_006347480.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    263   5e-79    
ref|XP_010250645.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    262   9e-79    
ref|XP_004241449.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    262   1e-78    
ref|NP_001242368.1|  uncharacterized protein LOC100787835               263   1e-78    
ref|XP_010241532.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    260   2e-78    
ref|XP_008353114.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    259   4e-78    
ref|XP_006664013.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    261   4e-78    
tpg|DAA52416.1|  TPA: hypothetical protein ZEAMMB73_783233              257   5e-78    
ref|XP_010243359.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    261   6e-78    
ref|XP_010086987.1|  Dehydrogenase/reductase SDR family protein 7...    261   6e-78    
ref|XP_004235330.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    259   1e-77    
ref|XP_002463266.1|  hypothetical protein SORBIDRAFT_02g040840          259   2e-77    Sorghum bicolor [broomcorn]
ref|XP_009405178.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    259   2e-77    
ref|XP_010695411.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    258   2e-77    
ref|XP_008446259.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    258   3e-77    
ref|XP_002511145.1|  Corticosteroid 11-beta-dehydrogenase, putative     258   3e-77    Ricinus communis
ref|NP_001136546.1|  corticosteroid 11-beta-dehydrogenase isozyme...    258   4e-77    Zea mays [maize]
ref|XP_002266761.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    257   5e-77    Vitis vinifera
gb|ACG24673.1|  corticosteroid 11-beta-dehydrogenase isozyme 1          258   5e-77    Zea mays [maize]
ref|XP_004297522.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    258   5e-77    
ref|XP_008392822.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    257   7e-77    
ref|XP_010536612.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    257   8e-77    
gb|EYU23068.1|  hypothetical protein MIMGU_mgv1a009201mg                257   1e-76    
ref|XP_009760328.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    257   1e-76    
ref|NP_001066740.1|  Os12g0464400                                       258   1e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009629548.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    256   2e-76    
ref|XP_010039131.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    256   3e-76    
ref|XP_004162136.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    255   4e-76    
ref|XP_004145221.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    255   4e-76    
gb|ABS28874.1|  steroleosin-A                                           255   5e-76    Arachis hypogaea [goober]
ref|XP_008239509.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    255   5e-76    
ref|XP_004145220.1|  PREDICTED: dehydrogenase/reductase SDR famil...    255   5e-76    
ref|XP_010913000.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    254   9e-76    
ref|XP_010695677.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    254   2e-75    
dbj|BAK03741.1|  predicted protein                                      254   2e-75    
ref|XP_008446273.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    253   2e-75    
emb|CBI38150.3|  unnamed protein product                                251   3e-75    
gb|ABA98146.2|  oxidoreductase, short chain dehydrogenase/reducta...    253   3e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004153125.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    253   3e-75    
gb|ABI20736.1|  11-beta-hydroxysteroid dehydrogenase-like protein       253   5e-75    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003581150.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    253   6e-75    
gb|ABO71657.1|  short-chain dehydrogenase reductase                     252   7e-75    Brassica napus [oilseed rape]
gb|ACG69523.1|  steroleosin SLO1-2                                      252   8e-75    Brassica napus [oilseed rape]
ref|XP_003576230.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    251   1e-74    
ref|XP_010695678.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    251   1e-74    
dbj|BAJ85563.1|  predicted protein                                      251   2e-74    
ref|XP_004162134.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    253   2e-74    
emb|CDY16353.1|  BnaA02g11570D                                          251   2e-74    
ref|XP_008439964.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    251   3e-74    
ref|XP_009127346.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    251   3e-74    
gb|ACG69522.1|  steroleosin SLO1-1                                      250   3e-74    Brassica napus [oilseed rape]
ref|XP_007211139.1|  hypothetical protein PRUPE_ppa026374mg             249   4e-74    
ref|XP_006347650.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    249   5e-74    
ref|XP_004297523.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    252   5e-74    
emb|CDY34029.1|  BnaC03g27860D                                          249   6e-74    
gb|EEC69238.1|  hypothetical protein OsI_38254                          249   1e-73    Oryza sativa Indica Group [Indian rice]
gb|ABM90633.1|  short-chain dehydrogenase reductase                     249   1e-73    Brassica napus [oilseed rape]
ref|XP_006436879.1|  hypothetical protein CICLE_v10031927mg             249   1e-73    
ref|XP_010482368.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    249   1e-73    
gb|ACG69524.1|  steroleosin SLO1-3                                      248   2e-73    Brassica napus [oilseed rape]
ref|NP_001291322.1|  11-beta-hydroxysteroid dehydrogenase 1B-like       248   2e-73    
ref|NP_568742.1|  hydroxysteroid dehydrogenase 1                        248   2e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004145219.1|  PREDICTED: uncharacterized protein LOC101220214    253   3e-73    
ref|XP_002865819.1|  short-chain dehydrogenase/reductase family p...    248   4e-73    
ref|XP_009134064.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    247   4e-73    
ref|XP_010442253.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    247   5e-73    
ref|XP_004503837.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    247   6e-73    
ref|XP_003579631.2|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    246   9e-73    
ref|XP_008798974.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    246   1e-72    
emb|CDP19890.1|  unnamed protein product                                251   1e-72    
ref|XP_006436878.1|  hypothetical protein CICLE_v10031969mg             246   1e-72    
gb|EEE53178.1|  hypothetical protein OsJ_36031                          246   2e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010442549.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    246   2e-72    
gb|KFK22922.1|  hypothetical protein AALP_AAs48765U000100               245   3e-72    
ref|XP_004977951.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    245   3e-72    
ref|XP_007038038.1|  Hydroxysteroid dehydrogenase 1                     245   4e-72    
ref|XP_004975422.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    245   6e-72    
gb|KDP22587.1|  hypothetical protein JCGZ_26418                         246   7e-72    
gb|KDO64429.1|  hypothetical protein CISIN_1g042560mg                   242   7e-72    
ref|XP_006402075.1|  hypothetical protein EUTSA_v10015475mg             244   1e-71    
ref|XP_006653339.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    244   1e-71    
ref|XP_006366592.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    243   1e-71    
ref|XP_010910414.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    243   2e-71    
ref|XP_006282100.1|  hypothetical protein CARUB_v10028347mg             243   2e-71    
ref|XP_010253812.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    243   2e-71    
emb|CAH66438.1|  OSIGBa0132D06.4                                        244   2e-71    Oryza sativa [red rice]
ref|NP_001052642.1|  Os04g0390700                                       244   2e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010271121.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    243   2e-71    
ref|NP_001239786.1|  uncharacterized protein LOC100808990               241   4e-71    
gb|KGN64430.1|  hypothetical protein Csa_1G051680                       242   5e-71    
gb|EYU23067.1|  hypothetical protein MIMGU_mgv1a009247mg                241   7e-71    
ref|XP_011023955.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    240   8e-71    
gb|EAZ30541.1|  hypothetical protein OsJ_14589                          241   8e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002321718.2|  hypothetical protein POPTR_0015s11200g             239   1e-70    Populus trichocarpa [western balsam poplar]
ref|XP_002321719.2|  short-chain dehydrogenase/reductase family p...    239   1e-70    Populus trichocarpa [western balsam poplar]
gb|KEH21004.1|  hydroxysteroid 11-beta-dehydrogenase-like protein       240   1e-70    
ref|XP_008446283.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    241   1e-70    
ref|XP_002446312.1|  hypothetical protein SORBIDRAFT_06g013990          241   2e-70    Sorghum bicolor [broomcorn]
ref|XP_011044100.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    239   2e-70    
ref|XP_002446311.1|  hypothetical protein SORBIDRAFT_06g013980          242   2e-70    Sorghum bicolor [broomcorn]
ref|XP_010271122.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    240   2e-70    
ref|NP_001152614.1|  steroleosin                                        239   8e-70    Zea mays [maize]
ref|XP_010323832.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    239   1e-69    
ref|XP_011023956.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    236   2e-69    
ref|XP_007038039.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...    239   2e-69    
emb|CDY09733.1|  BnaC07g33280D                                          236   3e-69    
gb|KHG19414.1|  Dehydrogenase/reductase SDR family protein 7-like...    237   4e-69    
ref|XP_009602452.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    237   5e-69    
ref|XP_011073098.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    236   7e-69    
emb|CDP19889.1|  unnamed protein product                                236   8e-69    
emb|CAH66439.1|  OSIGBa0132D06.5                                        236   8e-69    Oryza sativa [red rice]
ref|XP_007038040.1|  Hydroxysteroid dehydrogenase 2, putative           239   8e-69    
ref|XP_009778659.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    235   9e-69    
ref|XP_010271120.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    237   9e-69    
gb|EEC77184.1|  hypothetical protein OsI_15677                          236   9e-69    Oryza sativa Indica Group [Indian rice]
gb|EPS67142.1|  hypothetical protein M569_07637                         234   1e-68    
ref|XP_009597072.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    234   2e-68    
ref|XP_010555563.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    234   2e-68    
ref|XP_010249087.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    236   2e-68    
ref|XP_009136723.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    234   2e-68    
ref|XP_007211157.1|  hypothetical protein PRUPE_ppa027140mg             234   2e-68    
ref|XP_002322680.1|  hypothetical protein POPTR_0016s04930g             234   2e-68    Populus trichocarpa [western balsam poplar]
ref|NP_001052643.2|  Os04g0390800                                       235   3e-68    Oryza sativa Japonica Group [Japonica rice]
emb|CDX90560.1|  BnaA03g42210D                                          233   5e-68    
ref|XP_006404394.1|  hypothetical protein EUTSA_v10011076mg             233   6e-68    
ref|XP_010270763.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    233   7e-68    
ref|XP_006653338.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    232   1e-67    
ref|XP_004153126.1|  PREDICTED: dehydrogenase/reductase SDR famil...    233   1e-67    
ref|XP_002983555.1|  hypothetical protein SELMODRAFT_234271             232   2e-67    
ref|XP_010271842.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    230   2e-67    
ref|XP_010515042.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    231   3e-67    
gb|KDP22588.1|  hypothetical protein JCGZ_26419                         230   5e-67    
ref|XP_010503335.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    230   6e-67    
ref|XP_010271841.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    230   8e-67    
ref|XP_010656935.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    230   1e-66    
ref|XP_010086989.1|  Dehydrogenase/reductase SDR family protein 7...    229   1e-66    
ref|XP_011033248.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    229   1e-66    
ref|NP_190319.1|  hydroxysteroid dehydrogenase 2                        229   2e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007160006.1|  hypothetical protein PHAVU_002G285100g             229   2e-66    
emb|CBI38151.3|  unnamed protein product                                230   3e-66    
ref|XP_010251331.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    229   3e-66    
ref|XP_010536607.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    228   4e-66    
ref|XP_010270764.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    228   4e-66    
ref|XP_006404393.1|  hypothetical protein EUTSA_v10010570mg             227   9e-66    
ref|XP_010503336.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    226   2e-65    
emb|CDY21787.1|  BnaA06g20560D                                          225   5e-65    
ref|XP_009150234.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    225   5e-65    
ref|XP_010536603.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    224   6e-65    
gb|ABA93830.1|  oxidoreductase, short chain dehydrogenase/reducta...    226   7e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010536604.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    224   7e-65    
ref|XP_004979317.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    226   9e-65    
ref|NP_001067940.1|  Os11g0499600                                       225   1e-64    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ87073.1|  predicted protein                                      225   2e-64    
gb|AGT17053.1|  hypothetical protein SHCRBa_201_F17_F_10                224   2e-64    
ref|NP_001147696.1|  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase     224   3e-64    Zea mays [maize]
ref|XP_006360917.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    224   3e-64    
ref|XP_010426176.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    223   4e-64    
ref|XP_002452151.1|  hypothetical protein SORBIDRAFT_04g020710          224   4e-64    Sorghum bicolor [broomcorn]
ref|XP_010536605.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    222   6e-64    
ref|XP_010426175.1|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...    222   6e-64    
ref|XP_002875833.1|  short-chain dehydrogenase/reductase family p...    222   8e-64    
ref|XP_007210136.1|  hypothetical protein PRUPE_ppa022641mg             222   8e-64    
gb|KGN64427.1|  hypothetical protein Csa_1G051650                       222   9e-64    
ref|NP_001141666.2|  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase     223   1e-63    Zea mays [maize]
emb|CDX83157.1|  BnaA03g23490D                                          221   1e-63    
ref|XP_003575023.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    223   1e-63    
ref|XP_002449530.1|  hypothetical protein SORBIDRAFT_05g017960          223   2e-63    Sorghum bicolor [broomcorn]
ref|XP_010536601.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    222   2e-63    
ref|XP_010037388.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    221   2e-63    
ref|XP_006662954.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    222   2e-63    
ref|XP_009778660.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    219   2e-63    
ref|XP_002318146.2|  hypothetical protein POPTR_0012s10360g             221   2e-63    Populus trichocarpa [western balsam poplar]
ref|XP_008669501.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    221   4e-63    
ref|XP_009597074.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    218   4e-63    
ref|XP_008239510.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    220   4e-63    
ref|XP_008670737.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    221   5e-63    
ref|XP_009765827.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    221   5e-63    
ref|XP_010442316.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    220   6e-63    
ref|XP_009150624.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    219   8e-63    
ref|NP_190320.1|  hydroxysteroid dehydrogenase 3                        219   8e-63    
ref|NP_199890.1|  hydroxysteroid dehydrogenase 6                        220   9e-63    
ref|XP_010482376.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    220   1e-62    
ref|XP_003577550.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    220   1e-62    
gb|KFK34034.1|  hypothetical protein AALP_AA5G093400                    224   2e-62    
tpg|DAA63854.1|  TPA: hypothetical protein ZEAMMB73_332488              218   2e-62    
ref|XP_006282170.1|  hypothetical protein CARUB_v10028440mg             218   5e-62    
ref|XP_009359394.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    217   6e-62    
gb|KDO64428.1|  hypothetical protein CISIN_1g044010mg                   214   9e-62    
emb|CDX71662.1|  BnaC09g27030D                                          216   1e-61    
gb|EMT06462.1|  hypothetical protein F775_52091                         219   2e-61    
gb|KFK26701.1|  hypothetical protein AALP_AA8G282300                    216   2e-61    
ref|XP_010249088.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    214   5e-61    
ref|XP_006291536.1|  hypothetical protein CARUB_v10017691mg             214   6e-61    
gb|KFK22923.1|  hypothetical protein AALP_AAs48765U000200               213   8e-61    
ref|XP_006648666.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    216   9e-61    
ref|XP_006436880.1|  hypothetical protein CICLE_v10031927mg             213   9e-61    
ref|XP_010086988.1|  Dehydrogenase/reductase SDR family protein 7...    213   1e-60    
ref|NP_001046935.1|  Os02g0511400                                       215   2e-60    
ref|XP_010536608.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    212   4e-60    
dbj|BAA96982.1|  11-beta-hydroxysteroid dehydrogenase-like              212   4e-60    
ref|XP_006579445.1|  PREDICTED: uncharacterized protein LOC100808...    210   4e-60    
gb|EAY86013.1|  hypothetical protein OsI_07374                          214   5e-60    
ref|NP_001154667.1|  hydroxysteroid dehydrogenase 2                     212   6e-60    
ref|XP_006402076.1|  hypothetical protein EUTSA_v10014225mg             211   7e-60    
ref|XP_009127343.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    211   9e-60    
ref|NP_199871.1|  hydroxysteroid dehydrogenase 4                        210   1e-59    
ref|XP_009124895.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    210   1e-59    
ref|XP_002318707.2|  hypothetical protein POPTR_0012s10370g             211   1e-59    
ref|XP_010442546.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    210   2e-59    
ref|XP_010442547.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    209   2e-59    
gb|EMS50702.1|  Dehydrogenase/reductase SDR family protein 7-like...    211   3e-59    
ref|XP_002322681.2|  hypothetical protein POPTR_0016s04940g             210   4e-59    
ref|XP_008666705.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    210   4e-59    
ref|XP_009127342.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    207   2e-58    
ref|XP_010525337.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    207   2e-58    
ref|XP_002511144.1|  Corticosteroid 11-beta-dehydrogenase, putative     206   6e-58    
ref|XP_010442243.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    204   2e-57    
ref|XP_002466880.1|  hypothetical protein SORBIDRAFT_01g015790          206   3e-57    
ref|XP_010536606.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    202   9e-57    
ref|XP_010270765.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    202   1e-56    
emb|CBI15698.3|  unnamed protein product                                203   1e-56    
emb|CDY16351.1|  BnaA02g11550D                                          202   1e-56    
ref|XP_006402065.1|  hypothetical protein EUTSA_v10015936mg             202   2e-56    
ref|XP_003524470.1|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...    201   4e-56    
tpg|DAA38136.1|  TPA: hypothetical protein ZEAMMB73_559137              200   5e-56    
ref|XP_011033350.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    206   1e-55    
dbj|BAD23082.1|  putative steroleosin                                   201   1e-55    
ref|XP_008668191.1|  PREDICTED: steroleosin isoform X2                  201   2e-55    
ref|XP_002864070.1|  short-chain dehydrogenase/reductase family p...    199   3e-55    
ref|XP_010086990.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...    203   8e-55    
ref|XP_008668190.1|  PREDICTED: steroleosin isoform X1                  199   2e-54    
gb|EAY92531.1|  hypothetical protein OsI_14269                          196   3e-54    
ref|XP_010482377.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    195   4e-54    
tpg|DAA41997.1|  TPA: hypothetical protein ZEAMMB73_718382              198   6e-54    
ref|XP_006291535.1|  hypothetical protein CARUB_v10017691mg             193   2e-53    
ref|XP_006580902.1|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...    192   2e-52    
gb|ABI20735.1|  11-beta-hydroxysteroid dehydrogenase-like protein       192   2e-52    
gb|EAZ23188.1|  hypothetical protein OsJ_06873                          189   2e-51    
ref|XP_006844630.1|  hypothetical protein AMTR_s00016p00228910          187   2e-51    
gb|ABM90634.1|  11-beta short-chain dehydrogenase reductase             186   3e-51    
gb|ABM30178.1|  steroleosin                                             183   5e-50    
emb|CAN60641.1|  hypothetical protein VITISV_039526                     189   1e-49    
ref|XP_007038041.1|  Glucose 1-dehydrogenase, putative                  184   1e-49    
gb|EMT26675.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     184   2e-49    
gb|AFW71547.1|  hypothetical protein ZEAMMB73_313921                    177   5e-48    
ref|XP_001756706.1|  predicted protein                                  177   1e-47    
ref|XP_002985446.1|  hypothetical protein SELMODRAFT_424474             179   1e-47    
ref|XP_008788738.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    174   1e-47    
ref|XP_010656930.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    177   3e-47    
tpg|DAA38134.1|  TPA: hypothetical protein ZEAMMB73_559137              176   3e-47    
ref|XP_002979783.1|  hypothetical protein SELMODRAFT_153443             176   6e-47    
emb|CDX91557.1|  BnaC02g16030D                                          175   1e-46    
gb|EMS53803.1|  Dehydrogenase/reductase SDR family protein 7-like...    175   3e-46    
gb|EMS47145.1|  Dehydrogenase/reductase SDR family protein 7-like...    170   5e-44    
ref|XP_010431074.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    166   7e-44    
ref|XP_002511142.1|  Glucose 1-dehydrogenase, putative                  169   8e-44    
ref|XP_009784251.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    160   2e-42    
ref|XP_004298550.1|  PREDICTED: uncharacterized oxidoreductase Yq...    159   8e-42    
gb|EMT26674.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     163   4e-41    
gb|EMT12098.1|  Pentatricopeptide repeat-containing protein             161   1e-38    
ref|WP_010528274.1|  short-chain dehydrogenase                          152   2e-38    
ref|XP_004173851.1|  PREDICTED: retinol dehydrogenase 2-like            148   1e-37    
ref|WP_019245336.1|  short-chain dehydrogenase                          149   3e-37    
gb|KFK39003.1|  hypothetical protein AALP_AA3G187700                    146   2e-36    
ref|XP_008798975.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    144   7e-36    
ref|WP_027471744.1|  short-chain dehydrogenase                          142   4e-35    
ref|XP_010039129.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    140   1e-34    
ref|XP_004335949.1|  oxidoreductase, short chain dehydrogenase/re...    141   2e-34    
ref|WP_016778448.1|  short-chain dehydrogenase                          140   2e-34    
ref|WP_036476988.1|  short-chain dehydrogenase                          137   3e-33    
ref|WP_025604145.1|  short-chain dehydrogenase                          137   4e-33    
emb|CDJ60147.1|  hypothetical protein, conserved                        138   4e-33    
ref|WP_015895400.1|  short-chain dehydrogenase                          137   4e-33    
gb|KDP22589.1|  hypothetical protein JCGZ_26420                         134   5e-33    
ref|WP_015202720.1|  3-oxoacyl-(acyl-carrier-protein) reductase         136   6e-33    
ref|XP_001427169.1|  hypothetical protein                               136   6e-33    
ref|WP_019560422.1|  hypothetical protein                               135   1e-32    
ref|XP_007160008.1|  hypothetical protein PHAVU_002G2852001g            132   1e-32    
ref|XP_004357175.1|  11beta-hydroxysteroid dehydrogenase-like, pu...    136   1e-32    
ref|XP_002184690.1|  predicted protein                                  134   2e-32    
ref|WP_018336362.1|  short-chain dehydrogenase                          135   2e-32    
ref|WP_035040078.1|  short-chain dehydrogenase                          134   2e-32    
ref|WP_002619156.1|  short-chain dehydrogenase                          134   4e-32    
ref|WP_022308701.1|  hypothetical protein                               134   4e-32    
ref|XP_001017504.1|  oxidoreductase, short chain dehydrogenase/re...    134   5e-32    
ref|WP_027202447.1|  short-chain dehydrogenase                          134   5e-32    
gb|EXX68115.1|  oxidoreductase                                          134   1e-31    
ref|WP_010663586.1|  short-chain dehydrogenase                          133   1e-31    
ref|XP_001430409.1|  hypothetical protein                               133   1e-31    
ref|WP_026899360.1|  short-chain dehydrogenase                          132   1e-31    
ref|WP_013632465.1|  short-chain dehydrogenase                          132   2e-31    
ref|WP_026848214.1|  short-chain dehydrogenase                          131   4e-31    
ref|WP_022063622.1|  MULTISPECIES: oxidoreductase short chain deh...    131   4e-31    
ref|WP_015346442.1|  short chain dehydrogenase                          130   5e-31    
ref|WP_027865286.1|  short-chain dehydrogenase                          130   6e-31    
ref|XP_002594099.1|  hypothetical protein BRAFLDRAFT_68459              130   1e-30    
ref|WP_017258573.1|  short-chain dehydrogenase                          129   1e-30    
emb|CBA33247.1|  hypothetical protein Csp_B18100                        129   2e-30    
ref|WP_010602203.1|  short-chain dehydrogenase                          129   2e-30    
ref|WP_021839280.1|  3-oxoacyl-(Acyl-carrier-protein) reductase         129   2e-30    
ref|WP_020985669.1|  KR domain protein                                  129   2e-30    
gb|KFA88847.1|  short-chain dehydrogenase                               129   3e-30    
ref|WP_036217355.1|  short-chain dehydrogenase                          129   3e-30    
ref|WP_025865437.1|  short-chain dehydrogenase                          129   3e-30    
ref|NP_001090784.1|  hydroxysteroid 11-beta-dehydrogenase 1-like ...    129   4e-30    
ref|WP_028111549.1|  short-chain dehydrogenase                          128   4e-30    
ref|WP_014679581.1|  short-chain dehydrogenase                          128   5e-30    
ref|WP_009596236.1|  MULTISPECIES: short-chain dehydrogenase            128   6e-30    
ref|WP_039481552.1|  short-chain dehydrogenase                          127   8e-30    
ref|WP_008444711.1|  11-beta-hydroxysteroid dehydrogenase               127   9e-30    
ref|WP_022323927.1|  3-oxoacyl-(Acyl-carrier-protein) reductase         127   9e-30    
ref|XP_002611300.1|  hydroxysteroid dehydrogenase 1P                    128   1e-29    
ref|WP_022460989.1|  oxidoreductase short chain dehydrogenase/red...    127   1e-29    
ref|WP_022285081.1|  hypothetical protein                               127   1e-29    
ref|WP_016863819.1|  short-chain dehydrogenase                          127   1e-29    
ref|WP_019150748.1|  short-chain dehydrogenase                          127   2e-29    
ref|WP_025145316.1|  short-chain dehydrogenase                          126   2e-29    
ref|WP_022061900.1|  hypothetical protein                               127   2e-29    
gb|AHG92246.1|  short-chain dehydrogenase/reductase SDR                 126   2e-29    
ref|WP_015545784.1|  Short-chain alcohol dehydrogenase of unknown...    126   2e-29    
ref|WP_008503785.1|  short-chain dehydrogenase                          126   2e-29    
emb|CDX83014.1|  BnaA01g20140D                                          124   2e-29    
gb|KFE58907.1|  Short-chain dehydrogenase/reductase SDR                 126   3e-29    
ref|WP_004328997.1|  short-chain dehydrogenase                          126   3e-29    
ref|WP_011550940.1|  short-chain dehydrogenase                          125   3e-29    
ref|XP_002321720.1|  hypothetical protein POPTR_0015s11220g             124   3e-29    
gb|EJY77783.1|  Short-chain dehydrogenase/reductase family protein      125   4e-29    
ref|WP_013666361.1|  short-chain dehydrogenase                          125   4e-29    
ref|WP_038554076.1|  short-chain dehydrogenase                          125   4e-29    
ref|WP_012153695.1|  short-chain dehydrogenase                          125   5e-29    
ref|WP_029289082.1|  short-chain dehydrogenase                          125   5e-29    
gb|AAI06473.1|  LOC733357 protein                                       126   5e-29    
ref|WP_013611031.1|  MULTISPECIES: short-chain dehydrogenase            125   5e-29    
ref|WP_006299197.1|  short-chain dehydrogenase                          125   6e-29    
ref|WP_018696948.1|  MULTISPECIES: short-chain dehydrogenase            125   6e-29    
ref|WP_039713743.1|  short-chain dehydrogenase                          125   6e-29    
ref|WP_022545539.1|  hypothetical protein                               124   8e-29    
ref|WP_040299684.1|  short-chain dehydrogenase                          124   1e-28    
ref|WP_039451443.1|  short-chain dehydrogenase                          124   1e-28    
ref|WP_002695851.1|  short-chain dehydrogenase                          124   1e-28    
ref|WP_029278012.1|  short-chain dehydrogenase                          124   1e-28    
ref|WP_011484077.1|  short-chain dehydrogenase                          124   1e-28    
ref|WP_026236431.1|  short-chain dehydrogenase                          124   2e-28    
ref|WP_028117086.1|  short-chain dehydrogenase                          124   2e-28    
ref|WP_022333774.1|  short-chain alcohol dehydrogenase                  124   2e-28    
ref|WP_009135050.1|  short-chain dehydrogenase                          124   2e-28    
ref|WP_027477137.1|  short-chain dehydrogenase                          123   2e-28    
ref|WP_019574304.1|  short-chain dehydrogenase                          123   2e-28    
ref|XP_002611393.1|  hypothetical protein BRAFLDRAFT_73210              122   3e-28    
ref|WP_021988716.1|  3-oxoacyl-(Acyl-carrier-protein) reductase         123   3e-28    
gb|ETZ23526.1|  short-chain dehydrogenase                               122   4e-28    
gb|EKD89006.1|  hypothetical protein ACD_34C00237G0002                  122   4e-28    
ref|WP_011758510.1|  short-chain dehydrogenase                          122   4e-28    
ref|WP_022147341.1|  short-chain dehydrogenase/reductase SDR            122   4e-28    
ref|WP_019504439.1|  hypothetical protein                               122   5e-28    
ref|WP_015182593.1|  short-chain dehydrogenase                          122   6e-28    
ref|WP_027291861.1|  short-chain dehydrogenase                          122   6e-28    
ref|WP_026995368.1|  short-chain dehydrogenase                          122   6e-28    
dbj|GAM19154.1|  hypothetical protein SAMD00019534_023290               122   8e-28    
ref|WP_026155659.1|  hypothetical protein                               121   1e-27    
ref|WP_027102823.1|  short-chain dehydrogenase                          121   1e-27    
ref|WP_026904729.1|  short-chain dehydrogenase                          121   1e-27    
ref|XP_007440169.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    122   1e-27    
ref|WP_017290334.1|  hypothetical protein                               121   2e-27    
ref|WP_005667697.1|  hypothetical protein                               121   2e-27    
ref|WP_026462694.1|  short-chain dehydrogenase                          120   2e-27    
ref|WP_012792270.1|  short-chain dehydrogenase                          120   2e-27    
ref|WP_012627354.1|  short-chain dehydrogenase                          120   2e-27    
ref|WP_010995590.1|  short-chain dehydrogenase                          120   2e-27    
ref|WP_026020656.1|  short-chain dehydrogenase                          120   2e-27    
ref|WP_012837387.1|  short-chain dehydrogenase                          120   2e-27    
ref|XP_002611392.1|  hypothetical protein BRAFLDRAFT_210965             120   2e-27    
ref|WP_011320660.1|  short-chain dehydrogenase                          120   3e-27    
ref|XP_002611301.1|  hydroxysteroid dehydrogenase 1O                    121   3e-27    
ref|WP_009136068.1|  MULTISPECIES: short-chain dehydrogenase            120   3e-27    
ref|WP_015030997.1|  short-chain dehydrogenase                          120   3e-27    
gb|ETR74219.1|  Short chain dehydrogenase                               120   3e-27    
ref|WP_028101485.1|  short-chain dehydrogenase                          120   3e-27    
ref|WP_034359984.1|  short-chain dehydrogenase                          120   4e-27    
ref|WP_039049894.1|  MULTISPECIES: short-chain dehydrogenase            119   5e-27    
ref|WP_003064583.1|  short-chain dehydrogenase                          119   5e-27    
ref|WP_034392074.1|  short-chain dehydrogenase                          119   6e-27    
ref|XP_002611304.1|  hydroxysteroid dehydrogenase 1M                    120   6e-27    
ref|WP_015808834.1|  short-chain dehydrogenase                          119   7e-27    
ref|WP_011621243.1|  short-chain dehydrogenase                          119   7e-27    
ref|WP_028110082.1|  short-chain dehydrogenase                          119   8e-27    
ref|XP_004350644.1|  short-chain dehydrogenase/reductase family p...    119   8e-27    
ref|XP_004032030.1|  short chain dehydrogenase, putative                123   8e-27    
dbj|GAM20096.1|  hypothetical protein SAMD00019534_032710               119   9e-27    
ref|XP_005428584.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    119   9e-27    
ref|WP_013901898.1|  short-chain dehydrogenase                          119   1e-26    
ref|WP_007650722.1|  short-chain dehydrogenase                          119   1e-26    
ref|WP_015332580.1|  short-chain dehydrogenase/reductase SDR            119   1e-26    



>ref|NP_001291330.1| 11-beta-hydroxysteroid dehydrogenase-like 5 [Sesamum indicum]
 gb|AAM46847.1|AF498264_1 steroleosin-B [Sesamum indicum]
Length=362

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/363 (77%), Positives = 303/363 (83%), Gaps = 8/363 (2%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+NS+LN VVPPASL+MLA  WPTL FI+ CEWLYN Y   E ME+KVV+ITGASSGI
Sbjct  1     MDLINSLLNFVVPPASLLMLAFTWPTLFFITTCEWLYNTYLNSENMENKVVLITGASSGI  60

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAY+YAKR ANLVLVARRE+RLR ISENAR LGA NVLI AADVVKEEECRRFI ET
Sbjct  61    GEQIAYQYAKRGANLVLVARREHRLRGISENARRLGAPNVLIMAADVVKEEECRRFINET  120

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             IN+YGRVDHLVNT SLGHTFYFEEASD++VFPILMDINFWGNVYPTYVALPYLR+S GR+
Sbjct  121   INYYGRVDHLVNTVSLGHTFYFEEASDSSVFPILMDINFWGNVYPTYVALPYLRESNGRI  180

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IVNASVE+WLPLPRMSLYSAAK+ L+N YETLRFEV N +GITVATHGWIGTEM RGK M
Sbjct  181   IVNASVENWLPLPRMSLYSAAKSALINFYETLRFEVKNEVGITVATHGWIGTEMTRGKFM  240

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             VEEGAEMQWKEEREVH T GPVEEFAK IVSGACRGD YVKYPSWYD F LYRVF+P VL
Sbjct  241   VEEGAEMQWKEEREVHVTGGPVEEFAKQIVSGACRGDPYVKYPSWYDIFFLYRVFAPKVL  300

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSPAGRPVTVL------QQH  1314
             +WTFR L  N  AR TSFIGTGRP+ +E+SS      +E  SP   P   L      QQ 
Sbjct  301   DWTFRFLLTNGGARRTSFIGTGRPL-LETSSPRRSAVMEGSSPRRLPPGPLTFSPAFQQQ  359

Query  1315  KME  1323
             K E
Sbjct  360   KSE  362



>ref|XP_009622010.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Nicotiana 
tomentosiformis]
Length=367

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/348 (78%), Positives = 302/348 (87%), Gaps = 3/348 (1%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDLVNSVLN VVPPASLVMLA AWP L FI+ CEWLYN ++GE+ MEDKVV+ITGASSGI
Sbjct  1     MDLVNSVLNFVVPPASLVMLAFAWPALTFINTCEWLYNSFFGED-MEDKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYAKR+A+LVLVARRENRL  ISENAR LGAK+VL TAADVVKE +CRRFI ET
Sbjct  60    GEQIAYEYAKRKAHLVLVARRENRLWGISENARGLGAKSVLTTAADVVKEADCRRFITET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             +N YGRVDHLVNTASLGHTFY EEA+DT VFPILMDINFWGNVYPTYVALPYLRQ++GRV
Sbjct  120   VNLYGRVDHLVNTASLGHTFYLEEATDTNVFPILMDINFWGNVYPTYVALPYLRQNKGRV  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IVNASVESWLPLPRMSLYSAAKA LVN YETLRFEV   +G+T+ATHGWIGTEM  G+ M
Sbjct  180   IVNASVESWLPLPRMSLYSAAKAALVNFYETLRFEVNGDVGVTIATHGWIGTEMTGGRFM  239

Query  976   VEEGAEMQWKEEREVHATG-PVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +EEGAEMQWKEEREVHA+G  VE+FAKLIVSGACRGD YVKYPSW+D FLLYRVF+PNVL
Sbjct  240   LEEGAEMQWKEEREVHASGSSVEDFAKLIVSGACRGDPYVKYPSWHDIFLLYRVFTPNVL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSPAGRPV  1296
              WTFR+L  +  AR TSFIGTGRP+   +S    PL  E+ SP  +P+
Sbjct  300   QWTFRMLLADQGARRTSFIGTGRPLAESTSPRRQPL-AESTSPRRQPL  346



>ref|XP_009799020.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Nicotiana 
sylvestris]
Length=378

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/348 (78%), Positives = 301/348 (86%), Gaps = 3/348 (1%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDLVNSVLN VVPPASLVMLA AWP L FI+ CEW YN ++GE  MEDKVV+ITGASSGI
Sbjct  1     MDLVNSVLNFVVPPASLVMLAFAWPALTFINTCEWFYNSFFGEN-MEDKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYAKR+A+LVLVARRENRL  ISENAR LGAK+VLITAADVVKE +CRRFI ET
Sbjct  60    GEQIAYEYAKRKAHLVLVARRENRLWGISENARGLGAKSVLITAADVVKEADCRRFITET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             +N YGRVDHLVNTASLGHTFY EEA+DT VFPILMDINFWGNVYPTYVALPYLRQ++GRV
Sbjct  120   VNLYGRVDHLVNTASLGHTFYLEEATDTNVFPILMDINFWGNVYPTYVALPYLRQNKGRV  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IVNASVESWLPLPRMSLYSAAKA LVN YETLRFEV   +G+T+ATHGWIGTEM  G+ M
Sbjct  180   IVNASVESWLPLPRMSLYSAAKAALVNFYETLRFEVNGDVGVTIATHGWIGTEMTGGRFM  239

Query  976   VEEGAEMQWKEEREVHATG-PVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +EEGAEMQWKEEREVHA+G  VE+FAKLIVSGACRGD YVKYPSW+D FLLYRVF+PNVL
Sbjct  240   LEEGAEMQWKEEREVHASGSSVEDFAKLIVSGACRGDPYVKYPSWHDIFLLYRVFTPNVL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSPAGRPV  1296
              WTFR+L  +  AR TSFIGTGRP+   +S    PL  E+ SP  +P+
Sbjct  300   QWTFRMLLADQGARRTSFIGTGRPLLESTSPRRQPLP-ESTSPRRQPL  346



>ref|XP_006356566.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5-like [Solanum 
tuberosum]
Length=384

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/326 (82%), Positives = 291/326 (89%), Gaps = 2/326 (1%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             MMDLVNSVLN VVPPASLVMLA +WP L FI+ CE +YN ++GE+ MEDK+V+ITGASSG
Sbjct  1     MMDLVNSVLNFVVPPASLVMLAFSWPALYFINTCERMYNSFFGED-MEDKIVIITGASSG  59

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGEQIAYEYAK++A+LVLVARRE RL  ISENAR LGAK+VLITAADVVKE +CRRFI E
Sbjct  60    IGEQIAYEYAKKKAHLVLVARRETRLWGISENARALGAKSVLITAADVVKEADCRRFITE  119

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
             T+N YGRVDHLVNTASLGHTFY EEA+DT VFPILMDINFWGNVYPTYVALPYLRQSRGR
Sbjct  120   TVNLYGRVDHLVNTASLGHTFYLEEATDTNVFPILMDINFWGNVYPTYVALPYLRQSRGR  179

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             VIVNASVESWLPLPRMSLY+AAKA LVN YETLRFEV   +G+T+ATHGWIGTEM  G+ 
Sbjct  180   VIVNASVESWLPLPRMSLYAAAKAALVNFYETLRFEVNGDVGVTIATHGWIGTEMTGGRF  239

Query  973   MVEEGAEMQWKEEREVHATG-PVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNV  1149
             M+EEGAEMQWKEEREVHA+G  VE+FAKLIVSGACRGD YVKYPSWYD FLLYRVF+PNV
Sbjct  240   MLEEGAEMQWKEEREVHASGSSVEDFAKLIVSGACRGDPYVKYPSWYDIFLLYRVFTPNV  299

Query  1150  LNWTFRLLFDNLSARTTSFIGTGRPI  1227
             L WTFRLL  N SAR TS IGTGRP+
Sbjct  300   LQWTFRLLLSNQSARKTSLIGTGRPL  325



>ref|XP_010062387.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Eucalyptus 
grandis]
 gb|KCW69528.1| hypothetical protein EUGRSUZ_F02966 [Eucalyptus grandis]
Length=360

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/365 (75%), Positives = 303/365 (83%), Gaps = 14/365 (4%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDLVNS +N VVPPAS+VMLA AWP L F+ ACEWLYN YY E+ MEDKVV+ITGASSGI
Sbjct  1     MDLVNSFMNWVVPPASMVMLAFAWPALSFLHACEWLYNTYYSED-MEDKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYAKRRANLVLVARRE RL  ISENAR +GAK+VLI AADVVKEE+CRRF+ ET
Sbjct  60    GEQIAYEYAKRRANLVLVARREFRLIGISENARRMGAKHVLIIAADVVKEEDCRRFVNET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             I+ YGR+DHLVNTASLGHTFYFEE +DT+VFP  MDINFWGNVYPTYVALPYL QS G++
Sbjct  120   ISLYGRLDHLVNTASLGHTFYFEEVTDTSVFPHFMDINFWGNVYPTYVALPYLHQSNGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +VNASVE+WLPLPRMSLYSAAKA LVN YETLRFEV + +GIT+ATHGWIG+EM RGK M
Sbjct  180   VVNASVENWLPLPRMSLYSAAKAALVNFYETLRFEVRDEVGITIATHGWIGSEMTRGKFM  239

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +EEGAEMQWKEEREVH + GPVEEFAKLIVSGACRGD YVKYPSWYDTFLL+RVF+PNVL
Sbjct  240   LEEGAEMQWKEEREVHVSGGPVEEFAKLIVSGACRGDPYVKYPSWYDTFLLFRVFAPNVL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSP---AGRPVTVLQ-----  1308
              WTFRLL     AR TS +GTGRP+      +  PL LE PSP      PVT  Q     
Sbjct  300   RWTFRLLLATHGARRTSLVGTGRPV---WEGAGRPL-LEGPSPRKLIASPVTSSQLSPQY  355

Query  1309  QHKME  1323
             Q KME
Sbjct  356   QQKME  360



>ref|XP_004242256.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Solanum 
lycopersicum]
Length=384

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/326 (81%), Positives = 290/326 (89%), Gaps = 2/326 (1%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             MMDLVNSVLN VVPPASLVMLA +WP L FI+ CE +YN ++GE+ MEDK+V+ITGASSG
Sbjct  1     MMDLVNSVLNFVVPPASLVMLAFSWPALYFINTCERMYNSFFGED-MEDKIVIITGASSG  59

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGEQIAYEYAK++A+LVLVARRE RL  ISENAR LGAK+V+ITAADVVKE +CRRFI E
Sbjct  60    IGEQIAYEYAKKKAHLVLVARRETRLWGISENARALGAKSVVITAADVVKEADCRRFITE  119

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
             T+N YGRVDHLVNTASLGHTFY EEA+DT VFPILMDINFWGNVYPTYVALPYLRQSRGR
Sbjct  120   TVNLYGRVDHLVNTASLGHTFYLEEATDTNVFPILMDINFWGNVYPTYVALPYLRQSRGR  179

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             VIVNASVESWLPLPRMSLY+AAKA LVN YETLRFEV   +G+T+ATHGWIGTEM  G+ 
Sbjct  180   VIVNASVESWLPLPRMSLYAAAKAALVNFYETLRFEVDGDVGVTIATHGWIGTEMTGGRF  239

Query  973   MVEEGAEMQWKEEREVHATG-PVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNV  1149
             M+EEGAEMQWKEEREVHA+G  VE+FAKLIVSGACRGD YVKYPSWYD FLLYRVF+PNV
Sbjct  240   MLEEGAEMQWKEEREVHASGSSVEDFAKLIVSGACRGDPYVKYPSWYDIFLLYRVFTPNV  299

Query  1150  LNWTFRLLFDNLSARTTSFIGTGRPI  1227
             L WTFRLL  N S R TS IGTGRP+
Sbjct  300   LQWTFRLLLSNQSVRKTSLIGTGRPL  325



>ref|XP_009797377.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 isoform 
X1 [Nicotiana sylvestris]
Length=356

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/313 (80%), Positives = 279/313 (89%), Gaps = 2/313 (1%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PPASLVMLA AWP L FI+ CEWLYN ++G++ MEDKVV+ITGASSGIGEQIAYEYAKRR
Sbjct  13    PPASLVMLACAWPALTFINTCEWLYNTFFGDD-MEDKVVIITGASSGIGEQIAYEYAKRR  71

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
              NLVLVARRENRL  I E AR LGAKNVLITAADVVKE++CRRFI ET+NFYGRVDHLVN
Sbjct  72    TNLVLVARRENRLWGIREKARQLGAKNVLITAADVVKEDDCRRFITETVNFYGRVDHLVN  131

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
             T SLGHTFY EEA+DT VFPILMDINFWGNVYPTYVALPYLRQ+RGRVIVNASVE+WLPL
Sbjct  132   TVSLGHTFYLEEATDTNVFPILMDINFWGNVYPTYVALPYLRQTRGRVIVNASVENWLPL  191

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
             PRMSLYSAAKA ++N YETL+ EV + +GIT+ATHGWIGTE+ RGK+M++EGA+MQWKEE
Sbjct  192   PRMSLYSAAKAAVINFYETLKLEVKDDVGITIATHGWIGTEITRGKLMMDEGADMQWKEE  251

Query  1012  REVHATG-PVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLS  1188
             REV A+G  VEEFAKLIV+GACRGD YVKYP WYD FLLYRVF+PNVL WTFR+LF +  
Sbjct  252   REVRASGSSVEEFAKLIVAGACRGDPYVKYPGWYDIFLLYRVFAPNVLQWTFRMLFAHQG  311

Query  1189  ARTTSFIGTGRPI  1227
             AR TSFIGT RP+
Sbjct  312   ARRTSFIGTARPL  324



>ref|XP_008459623.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Cucumis 
melo]
Length=360

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/351 (75%), Positives = 293/351 (83%), Gaps = 10/351 (3%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PPASLVMLA +WP L FISACEW+YN +  E+ MEDKVV+ITGASSGIGEQIAYEYAKR+
Sbjct  13    PPASLVMLAFSWPALSFISACEWIYNSFNTED-MEDKVVIITGASSGIGEQIAYEYAKRK  71

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             ANL+LVARRENRLR ISENAR +GAK V+I AADVVKE++CRRF+ ET+ F+GRVDHLVN
Sbjct  72    ANLMLVARRENRLRMISENARFMGAKRVMIMAADVVKEDDCRRFVSETVQFFGRVDHLVN  131

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
             TASLGHTFYFEE +DT++FP LMDINFWGNVYPT VALPYLRQS GRVIVNASVE+WLPL
Sbjct  132   TASLGHTFYFEEVTDTSIFPHLMDINFWGNVYPTLVALPYLRQSNGRVIVNASVETWLPL  191

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
             PRMSLYSAAKA LVN YETLRFEV + +GIT+ATHGWIG+EM RGK MVEEGAEMQ KEE
Sbjct  192   PRMSLYSAAKAALVNFYETLRFEVKDDVGITIATHGWIGSEMTRGKFMVEEGAEMQRKEE  251

Query  1012  REVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLS  1188
             REVH T GPVEEFAKLIVSGACRG+ YVKYPSWYD FLLYR+F+PNVLNWTFRLL     
Sbjct  252   REVHVTGGPVEEFAKLIVSGACRGNIYVKYPSWYDVFLLYRMFAPNVLNWTFRLLLSANG  311

Query  1189  ARTTSFIGTGRPITMEssssssPLRLEAPS------PAGRPVTVLQQHKME  1323
             +R TS +GTG P+  E S S  PL LE  S      PA  P +  Q  K+E
Sbjct  312   SRRTSLVGTGMPV-YEGSVSGKPL-LEGASPRRLLLPANSPQSSPQAQKLE  360



>ref|XP_009617211.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Nicotiana 
tomentosiformis]
Length=349

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/357 (76%), Positives = 304/357 (85%), Gaps = 9/357 (3%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDLVNSVLN VVPPASLVMLA AWP   FI+ CE LYN ++GE+ MEDKVV+ITGASSGI
Sbjct  1     MDLVNSVLNFVVPPASLVMLACAWPAFTFINICERLYNTFFGED-MEDKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYAKRR NLVLVARRENRL  I E AR LGAKNVLI AADVVKE++CRRFI ET
Sbjct  60    GEQIAYEYAKRRTNLVLVARRENRLWGIREKARQLGAKNVLIMAADVVKEDDCRRFITET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             +NFYGRVDHLVNT SLGHTFY EEA+DT VFPILMDINFWGNVYPTYVALP+LRQ+RGRV
Sbjct  120   VNFYGRVDHLVNTVSLGHTFYLEEATDTNVFPILMDINFWGNVYPTYVALPHLRQTRGRV  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IVNASVE+WLPLPRMSLYSAAKA ++N YETL+ EV + +GIT+ATHGWIGTE+ RGK M
Sbjct  180   IVNASVENWLPLPRMSLYSAAKAAVINFYETLKLEVKDDVGITIATHGWIGTEITRGKFM  239

Query  976   VEEGAEMQWKEEREVHATG-PVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             ++EGA+MQWKEEREV A+G  VEEFAKLIV+GACRGD YVKYP WYD FLLYRVF+PN+L
Sbjct  240   MDEGADMQWKEEREVGASGSSVEEFAKLIVAGACRGDPYVKYPGWYDIFLLYRVFAPNIL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSPAGRPVTVLQQHKME  1323
              WTFR+LF +  AR TSFIGTGRP+ +E+S SSSP RL      G P+ +    KME
Sbjct  300   QWTFRMLFAHQGARKTSFIGTGRPL-LETSPSSSPQRL------GAPIVMQDLQKME  349



>ref|XP_004299863.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Fragaria vesca subsp. vesca]
Length=360

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/362 (74%), Positives = 302/362 (83%), Gaps = 8/362 (2%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL NSVLN VVPPASLVMLA +WP LCFIS  EWLYN + GE IMEDKVV+ITGASSGI
Sbjct  1     MDLFNSVLNFVVPPASLVMLAFSWPALCFISGLEWLYNQFNGE-IMEDKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYAKRRA LVLVARR+ RLR I+ENAR LGAK+VLI AADVVKEE+CRRFI ET
Sbjct  60    GEQIAYEYAKRRAQLVLVARRDTRLRGIAENARFLGAKHVLIIAADVVKEEDCRRFINET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             IN YGRVDHLVNT SLGHTF FEE +DT+VFP L+DINFWGNVYPTYVALPYLRQ+ G+V
Sbjct  120   INIYGRVDHLVNTVSLGHTFSFEEVTDTSVFPQLLDINFWGNVYPTYVALPYLRQTHGKV  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IVNASVESWLPLPRMSLY+AAKA LVN YETLR EV + +GIT+ATHGWI +EM+RGK M
Sbjct  180   IVNASVESWLPLPRMSLYAAAKAALVNFYETLRLEVRDEVGITIATHGWIVSEMSRGKFM  239

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             V+EGAEMQWKEEREV A+ GPVE+FA+LIV+GACRGD YVKYPSWYD FLLYRVF+PN+L
Sbjct  240   VDEGAEMQWKEEREVQASGGPVEDFARLIVAGACRGDPYVKYPSWYDIFLLYRVFAPNIL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSP---AGRP--VTVLQQHK  1317
             NWTFR++      R TS +GTGRPI+ E  ++   L LE  SP    G P    +  QHK
Sbjct  300   NWTFRMILPTHGTRRTSLVGTGRPISSEGRNNGR-LLLEGTSPRRHLGSPTFTPLGHQHK  358

Query  1318  ME  1323
             +E
Sbjct  359   LE  360



>ref|XP_008219091.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Prunus 
mume]
Length=356

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/361 (75%), Positives = 298/361 (83%), Gaps = 10/361 (3%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+NSVLN VVPPASLVM+A AWP L FIS CEWL+N +   E MEDKVV+ITGASSGI
Sbjct  1     MDLLNSVLNWVVPPASLVMMAFAWPALTFISGCEWLFNTF-NSEPMEDKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYAKRRA LVLVARRENRLR ISENAR +GAK+V+I AADVVKEEECRRF+ ET
Sbjct  60    GEQIAYEYAKRRAKLVLVARRENRLRLISENARYMGAKHVMIVAADVVKEEECRRFVNET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             INFYGRVDHLVNT SLGHTFYFEE +DTTVFP L+DINFWGNVYPTYVALP+LRQ+ G++
Sbjct  120   INFYGRVDHLVNTVSLGHTFYFEEVTDTTVFPHLLDINFWGNVYPTYVALPHLRQTNGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IVNASVESWLPLPRMSLY+AAKA LVN YETLR EV + +GIT+ATHGWIG+E+ RGK M
Sbjct  180   IVNASVESWLPLPRMSLYAAAKAALVNFYETLRLEVDHEVGITIATHGWIGSELTRGKFM  239

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             VEEGAEMQWKEEREVH T GPV++FA+LIV+GACRGD YVKYPSWYD FLLYRVF+P VL
Sbjct  240   VEEGAEMQWKEEREVHVTGGPVDDFARLIVAGACRGDAYVKYPSWYDIFLLYRVFAPKVL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSPAGRPVTVL----QQHKM  1320
             NWTFRL+      R TS +GTGRPI+        PL  E   P   P T      QQ KM
Sbjct  300   NWTFRLILPTHGGRRTSLVGTGRPIS---EGYGRPL-FEGSPPRKLPNTFAPQSPQQLKM  355

Query  1321  E  1323
             E
Sbjct  356   E  356



>ref|XP_008378718.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Malus 
domestica]
Length=359

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/326 (79%), Positives = 289/326 (89%), Gaps = 2/326 (1%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL NSVLN VVPPASLVMLA AWP L FIS CEWLYNL+   EI+EDKVV+ITGASSGI
Sbjct  1     MDLFNSVLNWVVPPASLVMLAFAWPALTFISGCEWLYNLF-NSEIVEDKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYAKRRANLVLVARRENRLR ISENARL+GAK+V+I AADVVKEEECRRFI ET
Sbjct  60    GEQIAYEYAKRRANLVLVARRENRLRVISENARLIGAKHVMIIAADVVKEEECRRFISET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             I+F+GRVDHLVNT SLGHTFYFEE +DT+VFP+L+DINFWGNVYPTYVALPYLR++ G++
Sbjct  120   ISFHGRVDHLVNTVSLGHTFYFEEVTDTSVFPLLLDINFWGNVYPTYVALPYLRRTNGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IVNASVESWLPLPRMSLY+AAKA LVN YETLR EV + +GIT+ATHGWIG+EM RGK M
Sbjct  180   IVNASVESWLPLPRMSLYAAAKAALVNFYETLRLEVNHEVGITIATHGWIGSEMTRGKFM  239

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +EEGAEMQWKEEREVH   GPVE+FA+LIV+GAC+GD YVKYPSWYD FLLYRVF PN+L
Sbjct  240   LEEGAEMQWKEEREVHVIGGPVEDFARLIVAGACQGDSYVKYPSWYDIFLLYRVFVPNIL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPIT  1230
             +WTFRL+      R TS +GTG PI+
Sbjct  300   HWTFRLILPTHGGRRTSLVGTGGPIS  325



>ref|XP_004141553.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cucumis sativus]
 ref|XP_004162860.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cucumis sativus]
 gb|KGN52682.1| hypothetical protein Csa_5G650470 [Cucumis sativus]
Length=360

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/351 (74%), Positives = 292/351 (83%), Gaps = 10/351 (3%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PPASL MLA +WP L FISACEW+YN +  E+ MEDKVV+ITGASSGIGEQIAYEYAKR+
Sbjct  13    PPASLFMLAFSWPALSFISACEWIYNSFNTED-MEDKVVIITGASSGIGEQIAYEYAKRK  71

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             ANL+LVARRENRLR ISENAR +GAK VLI AADVVKE++CRRF+ ETI ++GRVDHLVN
Sbjct  72    ANLMLVARRENRLRMISENARFIGAKRVLIMAADVVKEDDCRRFVSETIQYFGRVDHLVN  131

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
             TASLGHTFYFEE +DT++FP LMDINFWGNVYPT VALPYLRQS GRVIVNASVE+WLPL
Sbjct  132   TASLGHTFYFEEVTDTSIFPHLMDINFWGNVYPTLVALPYLRQSNGRVIVNASVETWLPL  191

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
             PRMSLYSAAKA LVN YETLRFEV + +GIT+ATHGWIG+EM RGK MVEEGAEMQ KEE
Sbjct  192   PRMSLYSAAKAALVNFYETLRFEVKDDVGITIATHGWIGSEMTRGKFMVEEGAEMQRKEE  251

Query  1012  REVH-ATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLS  1188
             REVH A GPVEEFAKLIVSGACRG+ YVKYPSWYD FLLYR+F+PNVLNWTFR L     
Sbjct  252   REVHVAGGPVEEFAKLIVSGACRGNTYVKYPSWYDVFLLYRMFAPNVLNWTFRFLLSANG  311

Query  1189  ARTTSFIGTGRPITMEssssssPLRLEAPS------PAGRPVTVLQQHKME  1323
             +R TS +GTG P+  E S+S  P+ LE  S      PA  P +  Q  K+E
Sbjct  312   SRRTSLVGTGMPV-YEGSASGRPV-LEGASPRRLLLPANSPQSSPQAQKLE  360



>ref|XP_008365259.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Malus 
domestica]
Length=359

 Score =   524 bits (1349),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 258/326 (79%), Positives = 289/326 (89%), Gaps = 2/326 (1%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL NSVLN VVPPASLVMLA AWP L FIS CEWLYNL+   EI+EDKVV+ITGASSGI
Sbjct  1     MDLFNSVLNWVVPPASLVMLAXAWPALTFISGCEWLYNLF-NSEIVEDKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYAKRRANLVLVARRENRLR ISENARL+GAK+V+I AADVVKEEECRRFI ET
Sbjct  60    GEQIAYEYAKRRANLVLVARRENRLRVISENARLIGAKHVMIIAADVVKEEECRRFISET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             I+F+GRVDHLVNT SLGHTFYFEE +DT+VFP+L+DINFWGNVYPTYVALPYLR++ G++
Sbjct  120   ISFHGRVDHLVNTVSLGHTFYFEEVTDTSVFPLLLDINFWGNVYPTYVALPYLRRTNGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IVNASVESWLPLPRMSLY+AAKA LVN YETLR EV + +GIT+ATHGWIG+EM RGK M
Sbjct  180   IVNASVESWLPLPRMSLYAAAKAALVNFYETLRLEVNHEVGITIATHGWIGSEMTRGKFM  239

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +EEGAEMQWKEEREVH   GPVE+FA+LIV+GAC+GD YVKYPSWYD FLLYRVF PN+L
Sbjct  240   LEEGAEMQWKEEREVHVIGGPVEDFARLIVAGACQGDSYVKYPSWYDIFLLYRVFVPNIL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPIT  1230
             +WTFRL+      R TS +GTG PI+
Sbjct  300   HWTFRLILPTHGGRRTSLVGTGGPIS  325



>ref|XP_009357192.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Pyrus 
x bretschneideri]
Length=359

 Score =   523 bits (1346),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 257/326 (79%), Positives = 287/326 (88%), Gaps = 2/326 (1%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL NSVLN VVPPASL+MLA AWP L F++ CEWLYNL+   EI+EDKVV+ITGASSGI
Sbjct  1     MDLFNSVLNWVVPPASLLMLAFAWPALTFVTGCEWLYNLF-NSEIVEDKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYAKRRANLVLVARR+NRLR ISENAR +GAK V+I AADVVKEEECRRFI ET
Sbjct  60    GEQIAYEYAKRRANLVLVARRQNRLRVISENARRMGAKYVMIIAADVVKEEECRRFISET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             ++FYGRVDHLVNT SLGHTFYFEE +DT+VFP L+DINFWGNVYPTYVALPYLRQ+ G++
Sbjct  120   MSFYGRVDHLVNTVSLGHTFYFEEVTDTSVFPQLLDINFWGNVYPTYVALPYLRQTNGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IVNASVESWLPLPRMSLY+AAKA LVN YETLR EV + +GIT+ATHGWIG+EM RGK M
Sbjct  180   IVNASVESWLPLPRMSLYAAAKAALVNFYETLRLEVNHEVGITIATHGWIGSEMTRGKFM  239

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +EEGAEMQWKEEREVH T GPVE+FA+LIV+GACRGD YVKYPSWYD  LLYRVF+P VL
Sbjct  240   LEEGAEMQWKEEREVHVTGGPVEDFARLIVAGACRGDSYVKYPSWYDRILLYRVFAPKVL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPIT  1230
             NWTFRL+      R TS +GTGRPI+
Sbjct  300   NWTFRLVLPTHGGRRTSLVGTGRPIS  325



>ref|XP_007222177.1| hypothetical protein PRUPE_ppa007781mg [Prunus persica]
 gb|EMJ23376.1| hypothetical protein PRUPE_ppa007781mg [Prunus persica]
Length=356

 Score =   521 bits (1342),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 267/361 (74%), Positives = 297/361 (82%), Gaps = 10/361 (3%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+NSVLN VVPPASLVM+A AWP L FI+ CEWLYN +   E MEDKVV+ITGASSGI
Sbjct  1     MDLLNSVLNWVVPPASLVMMAFAWPALTFITGCEWLYNTF-NSEPMEDKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYAKR A LVLVARR+NRLR ISENAR +GAK+V+I AADVVKEEECRRF+ ET
Sbjct  60    GEQIAYEYAKRGAKLVLVARRDNRLRLISENARHMGAKHVMIVAADVVKEEECRRFVNET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             INFYGRVDHLVNT SLGHTFYFEE +DTTVFP L+DINFWGNVYPTYVALP+LRQ+ G++
Sbjct  120   INFYGRVDHLVNTVSLGHTFYFEEVTDTTVFPHLLDINFWGNVYPTYVALPHLRQTNGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IVNASVESWLPLPRMSLY+AAKA LVN YETLR EV + +GIT+ATHGWIG+E+ RGK M
Sbjct  180   IVNASVESWLPLPRMSLYAAAKAALVNFYETLRLEVDHEVGITIATHGWIGSELTRGKFM  239

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             VEEGAEMQWKEEREVH T GPV++FA+LIV+GACRGD YVKYPSWYD FLLYRVF+P VL
Sbjct  240   VEEGAEMQWKEEREVHVTGGPVDDFARLIVAGACRGDAYVKYPSWYDIFLLYRVFAPKVL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSPAGRPVTVL----QQHKM  1320
             NWTFRL+      R TS +GTGRPI+        PL  E   P   P T      QQ KM
Sbjct  300   NWTFRLILPTHGGRRTSLVGTGRPIS---EGYGRPL-FEGTPPRKLPSTFAPQSPQQLKM  355

Query  1321  E  1323
             E
Sbjct  356   E  356



>ref|XP_009333966.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Pyrus 
x bretschneideri]
Length=359

 Score =   520 bits (1340),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 257/326 (79%), Positives = 287/326 (88%), Gaps = 2/326 (1%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL NSVLN VVPPASLVMLA AWP L FIS CEWLYNL+   EI+EDKVV+ITGASSGI
Sbjct  1     MDLFNSVLNWVVPPASLVMLAFAWPALTFISGCEWLYNLF-NSEIVEDKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYAKRRAN+VLVARRENRLR ISENARL+GAK+V+I AADVVKEEECRRFI ET
Sbjct  60    GEQIAYEYAKRRANIVLVARRENRLRVISENARLIGAKHVMIIAADVVKEEECRRFISET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             I+F+GRVDHLVNT SLGHTFYFEE +DT+VFP L+DINFWGNVYPTYVALPYLR++ G++
Sbjct  120   ISFHGRVDHLVNTVSLGHTFYFEEVTDTSVFPHLLDINFWGNVYPTYVALPYLRRTNGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IVNASVESWLPLPRMSLY+AAKA LVN YETLR EV + +GIT+ATHGWI +EM RGK M
Sbjct  180   IVNASVESWLPLPRMSLYAAAKAALVNFYETLRLEVNHEVGITIATHGWIESEMTRGKFM  239

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +EEGAEMQWKEEREVH   GPVE+FA+LIV+GACRGD YVKYPSWYD FLLYR+F PN L
Sbjct  240   LEEGAEMQWKEEREVHVIGGPVEDFARLIVAGACRGDSYVKYPSWYDIFLLYRLFVPNTL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPIT  1230
             +WTFRL+      R TS +GTGRPI+
Sbjct  300   HWTFRLILPTHGGRRTSLVGTGRPIS  325



>gb|KHG01718.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Gossypium 
arboreum]
 gb|KHG29574.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Gossypium 
arboreum]
Length=355

 Score =   520 bits (1339),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 249/327 (76%), Positives = 286/327 (87%), Gaps = 1/327 (0%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             MMDL+ S LNLVVPPA+++MLA +WP LCFI+ACEW+YN  Y  E M+ KVV+ITGASSG
Sbjct  1     MMDLMTSFLNLVVPPATMMMLAFSWPALCFINACEWVYNTLYTIEDMDGKVVIITGASSG  60

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGEQIAYEYAKRRANLVLVARRE RLRAISE AR LGA + ++ AADVVKE++CRRF+ E
Sbjct  61    IGEQIAYEYAKRRANLVLVARREQRLRAISEKARYLGANSAIVIAADVVKEDDCRRFVNE  120

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
             T+NFYGRVDHLVN ASLGHTFYF+E +D++VFPIL+DINFWGNVYPT+VALPYL QS GR
Sbjct  121   TVNFYGRVDHLVNAASLGHTFYFDEVTDSSVFPILLDINFWGNVYPTFVALPYLHQSNGR  180

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             VIVNASVE+WLPLPRMSLY+AAKA LVN YETLR EV N +GIT+ATHGWIG EM RGK 
Sbjct  181   VIVNASVENWLPLPRMSLYAAAKAALVNFYETLRLEVNNDVGITIATHGWIGGEMTRGKF  240

Query  973   MVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNV  1149
             M+EEGAEMQWKEEREV A+ GPVEEFA+LIVSGACRGD YVKYPSW+DTFLL+RVF+PNV
Sbjct  241   MLEEGAEMQWKEEREVQASGGPVEEFARLIVSGACRGDAYVKYPSWHDTFLLFRVFAPNV  300

Query  1150  LNWTFRLLFDNLSARTTSFIGTGRPIT  1230
             LNW+FRLL      R TS +G G+P++
Sbjct  301   LNWSFRLLLSAHGTRRTSMVGVGKPMS  327



>gb|EYU22738.1| hypothetical protein MIMGU_mgv1a008685mg [Erythranthe guttata]
Length=365

 Score =   519 bits (1337),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 266/377 (71%), Positives = 301/377 (80%), Gaps = 23/377 (6%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+N+VLN VVPPASLVMLA AWPTL FIS CEW Y+ Y+  + MEDKVVVITGASSGI
Sbjct  1     MDLMNAVLNFVVPPASLVMLAFAWPTLFFISTCEWFYSTYFKRDTMEDKVVVITGASSGI  60

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAY+YAK+ ANLVLVARRE RLR ISENAR +GA++VLI AADVVKE++CRRFI ET
Sbjct  61    GEQIAYQYAKKGANLVLVARREQRLRGISENARRMGAQHVLIMAADVVKEDDCRRFINET  120

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             IN++GRVDHLVNT SLGHTFYF+EA+DT+VFPILMDINFWGNVYPTYVALPYLR+S GR+
Sbjct  121   INYFGRVDHLVNTVSLGHTFYFDEATDTSVFPILMDINFWGNVYPTYVALPYLRESNGRI  180

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +VNASVE+WLPLPRMS+Y+AAK+ L+N YETLRFEV + IGITVATHGWIGTE+  GK M
Sbjct  181   VVNASVENWLPLPRMSVYAAAKSALMNFYETLRFEVKDEIGITVATHGWIGTEITGGKFM  240

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             VEEGA+MQWKEEREVH + GPVEEFA+LIV GACRGD YVKYPSWYD F LYRVF+P VL
Sbjct  241   VEEGADMQWKEEREVHVSGGPVEEFARLIVEGACRGDPYVKYPSWYDVFFLYRVFAPKVL  300

Query  1153  NWTFRLLFDNLS-ARTTSFIGTGRPITMEssssssPLRLEAPSPAGRPVTVLQQHKME*M  1329
              WTFR L  N+   RTTSFIGTGR +            LEA SP  R   V +       
Sbjct  301   YWTFRFLSTNVGEGRTTSFIGTGRKL------------LEASSPPRRLTLVAE-------  341

Query  1330  N*SKPQHACNASHSTIS  1380
                 P    + S ST S
Sbjct  342   --GSPGRLTSGSTSTFS  356



>ref|XP_009335461.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Pyrus 
x bretschneideri]
Length=371

 Score =   515 bits (1327),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 259/338 (77%), Positives = 287/338 (85%), Gaps = 14/338 (4%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL NSVLN VVPPASLVMLA AWP L FIS CEWLYNL+   EI+EDKVV+ITGASSGI
Sbjct  1     MDLFNSVLNWVVPPASLVMLAFAWPALTFISGCEWLYNLF-NSEIVEDKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYAKRRAN+VLVARRENRLR ISENARLLGAK+V+I AADVVKEEECRRFI ET
Sbjct  60    GEQIAYEYAKRRANIVLVARRENRLRVISENARLLGAKHVMIIAADVVKEEECRRFISET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             I+F+GRVDHLVNT SLGHTFYFEE +DT+VFP L+DINFWGNVYPTYVALPYLRQ+ G++
Sbjct  120   ISFHGRVDHLVNTVSLGHTFYFEEVTDTSVFPHLLDINFWGNVYPTYVALPYLRQTNGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IVNASVESWLPLPRMSLY+AAKA LVN YETLR EV + +GIT+ATHGWI +EM RGK M
Sbjct  180   IVNASVESWLPLPRMSLYAAAKAALVNFYETLRLEVNHEVGITIATHGWIESEMTRGKFM  239

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTF-----------  1119
             +EEGAEMQWKEEREVH   GPVE+FA+LIV+GACRGD YVKYPSWYD F           
Sbjct  240   LEEGAEMQWKEEREVHVIGGPVEDFARLIVAGACRGDSYVKYPSWYDIFLLXXXXXXXXX  299

Query  1120  -LLYRVFSPNVLNWTFRLLFDNLSARTTSFIGTGRPIT  1230
              LLYR+F PN L+WTFRL+      R TS +GTGRPI+
Sbjct  300   XLLYRLFVPNTLHWTFRLILPTHGGRRTSLVGTGRPIS  337



>ref|XP_010530110.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Tarenaya 
hassleriana]
Length=360

 Score =   515 bits (1326),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 251/360 (70%), Positives = 297/360 (83%), Gaps = 3/360 (1%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             M+DL+N+V+NL+ PPA++V++A AWP+LCFISACEWLYN ++G E MEDKVVV+TGASS 
Sbjct  1     MVDLLNTVMNLMAPPATMVVMAFAWPSLCFISACEWLYNSFFGTEDMEDKVVVVTGASSA  60

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             +GEQIAYEYAKR+ANLVLVARRE RLR IS  AR +GAK+V+I AADVVKE++CRRFI +
Sbjct  61    VGEQIAYEYAKRKANLVLVARREQRLRGISSKAREMGAKHVMIIAADVVKEDQCRRFITD  120

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
               N+YGRVDHLVNT SLGHTFYFE+ +DTTVFP L+DINFWGNVYPTYVALPYL +S GR
Sbjct  121   AFNYYGRVDHLVNTVSLGHTFYFEDVTDTTVFPHLLDINFWGNVYPTYVALPYLHKSNGR  180

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             ++VNASVE+WLPLPRMSLYSAAKA LVN YETLRFE+   IGIT+ATHGWIG++M RGK 
Sbjct  181   IVVNASVENWLPLPRMSLYSAAKAALVNFYETLRFELNGEIGITIATHGWIGSDMTRGKF  240

Query  973   MVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNV  1149
             M+EEGAEMQWKEEREV A+ GP+E+FAK+IVSGACRGD YVK+PSWYD FLLYRVF+PNV
Sbjct  241   MLEEGAEMQWKEEREVPASGGPLEDFAKMIVSGACRGDAYVKFPSWYDVFLLYRVFTPNV  300

Query  1150  LNWTFRLLFDNLSARTTSFIGTGRPI--TMEssssssPLRLEAPSPAGRPVTVLQQHKME  1323
             L WT RLL     +R +S IGTG P+     S   SSP +  A  P      V + H+ E
Sbjct  301   LRWTLRLLISTEGSRRSSLIGTGTPVIEAKPSLEGSSPRKFPASPPRFAQFNVQEIHRSE  360



>gb|AAX49394.1| STO-1 [Coffea canephora]
 emb|CDP00863.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   514 bits (1323),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 261/358 (73%), Positives = 303/358 (85%), Gaps = 4/358 (1%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+NSVLNLVVPPASL+MLA AWPTL FI+ACEWLYN Y+ EE M++KVVVITGASSGI
Sbjct  1     MDLINSVLNLVVPPASLLMLAFAWPTLSFINACEWLYNTYFSEE-MDNKVVVITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYAKR ANLVLVARR+NRL  I++NA+ LG+++VLI AADVVKEE+CRRFI ET
Sbjct  60    GEQIAYEYAKRGANLVLVARRDNRLHGIADNAQRLGSRHVLIMAADVVKEEDCRRFINET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             IN++G VDHLVNTASLGHTF+FEEA+D +VFPIL+DINFWGNVYPTYVALPYLRQ+ GR+
Sbjct  120   INYFGCVDHLVNTASLGHTFFFEEATDASVFPILLDINFWGNVYPTYVALPYLRQTNGRI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +VNAS+E+WLPLPRMSLYSAAKA L+N YETLRFEV + +GIT+ATHGWIGTEM RG+ M
Sbjct  180   VVNASIENWLPLPRMSLYSAAKAALINFYETLRFEVKDEVGITIATHGWIGTEMTRGRFM  239

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             VEEGAEMQWKEEREV  T GP E+FAKLIV+GACR   YVKYPSWYD F ++RVFSPNVL
Sbjct  240   VEEGAEMQWKEEREVQVTGGPAEDFAKLIVAGACRQAAYVKYPSWYDIFFVFRVFSPNVL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSPAGRP-VTVLQQHKME  1323
              WTF LL  +  +R TSFIGTGRP+ +E S     L   +P  + +    V QQ K+E
Sbjct  300   YWTFHLLSTSHVSRRTSFIGTGRPL-LEGSPPRKLLTGASPGTSSQSQAPVYQQQKVE  356



>ref|XP_006441634.1| hypothetical protein CICLE_v10020750mg [Citrus clementina]
 gb|ESR54874.1| hypothetical protein CICLE_v10020750mg [Citrus clementina]
Length=364

 Score =   513 bits (1320),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 246/325 (76%), Positives = 288/325 (89%), Gaps = 2/325 (1%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+NS LNLVVPPASLVM+A AWP LCF++ CEWLYN +Y E  MEDKVV+ITGASS I
Sbjct  1     MDLLNSFLNLVVPPASLVMMAFAWPALCFVNGCEWLYNNFYSEN-MEDKVVIITGASSDI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYAKR+ANLVLVARRENRLR IS+NAR +GA +++  AADVVKEE+CRRF+ ET
Sbjct  60    GEQIAYEYAKRKANLVLVARRENRLRGISQNARFMGAGHIITIAADVVKEEDCRRFVSET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             IN +GRVDHLVNTASLGHTF+FEE +DT++FP L+DINFWGNVYPT+VALPYL +S GRV
Sbjct  120   INVFGRVDHLVNTASLGHTFFFEEVTDTSIFPRLLDINFWGNVYPTFVALPYLHESNGRV  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +VNASVE+WLPLPRMSLY++AKA LV  YE+LRFE+ + +GIT+ATHGWIG+EM +GK M
Sbjct  180   VVNASVENWLPLPRMSLYASAKAALVTFYESLRFELNDEVGITIATHGWIGSEMTKGKFM  239

Query  976   VEEGAEMQWKEEREVH-ATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +E+GAEMQWKEEREVH A GPVE+FA+LIVSGACRGD YVK+PSWYD FLLYRVF+P+VL
Sbjct  240   LEDGAEMQWKEEREVHVAGGPVEDFARLIVSGACRGDTYVKFPSWYDVFLLYRVFAPHVL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPI  1227
             NWTFRLL  +  AR TS IGTGRP+
Sbjct  300   NWTFRLLISSEGARRTSLIGTGRPL  324



>ref|XP_007019842.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein isoform 1 
[Theobroma cacao]
 gb|EOY17067.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein isoform 1 
[Theobroma cacao]
Length=412

 Score =   514 bits (1325),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 255/366 (70%), Positives = 301/366 (82%), Gaps = 11/366 (3%)
 Frame = +1

Query  244   LIKMMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGA  423
             ++ MMDL++S LN +VPPAS+V+L  AWP LCF+ ACEWLYN  Y E  ++DKVV+ITGA
Sbjct  52    VVNMMDLIDSFLNFLVPPASMVILFFAWPALCFVRACEWLYNTLYTENSIQDKVVIITGA  111

Query  424   SSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRF  603
             SSGIGEQIAYEYA+RRANLVLVARRE+RLR ISE AR +GAKNV+I AADVVKE++CRRF
Sbjct  112   SSGIGEQIAYEYARRRANLVLVARREHRLRGISEKARHIGAKNVIIIAADVVKEDDCRRF  171

Query  604   ILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQS  783
             + ETINFYGRVDHLVN  SLGHTFYFEE +DT+VFP L+DINFWGNVYPT+VALP+L QS
Sbjct  172   VTETINFYGRVDHLVNAVSLGHTFYFEEVTDTSVFPHLLDINFWGNVYPTFVALPHLHQS  231

Query  784   RGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMAR  963
              GR+I+NASVE+WLPLPRMSLY+AAKA LVN YETLRFEV N +GIT+ATHGWIG EM R
Sbjct  232   NGRIIMNASVENWLPLPRMSLYAAAKAALVNFYETLRFEVNNEVGITIATHGWIGGEMTR  291

Query  964   GKIMVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFS  1140
             GK M+EEGAEMQWKE+RE+  + G VEEFA+LIVSGACRGD YVKYPSW+DTFLLYR  +
Sbjct  292   GKFMLEEGAEMQWKEKREIAVSAGAVEEFARLIVSGACRGDAYVKYPSWHDTFLLYRAIA  351

Query  1141  PNVLNWTFRLLFDNLSARTTSFIGTGRPITMEsss----sssPLRLEAPSPAGRPVTVLQ  1308
             PNVLNW  RLL      R TS +G GR + ++++     S+SP++L    P G P+T  Q
Sbjct  352   PNVLNWMLRLLLSVHGTRRTSMMGVGRQLPVDAARYVSESTSPMKL----PTG-PITFSQ  406

Query  1309  -QHKME  1323
              Q KME
Sbjct  407   PQQKME  412



>ref|XP_006478271.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5-like [Citrus 
sinensis]
 ref|XP_006491603.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5-like [Citrus 
sinensis]
Length=364

 Score =   509 bits (1311),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 246/325 (76%), Positives = 286/325 (88%), Gaps = 2/325 (1%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+NS LNLVVPPASLVMLA AWP LCF++ CEWLYN +Y E  MEDKVV+ITGASS I
Sbjct  1     MDLLNSFLNLVVPPASLVMLAFAWPALCFVNGCEWLYNNFYSEN-MEDKVVIITGASSDI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYAKR+ANLVLVARRENRL  IS+NAR +GA +++  AADVVKEE+CRRF+ ET
Sbjct  60    GEQIAYEYAKRKANLVLVARRENRLPGISQNARFMGAGHIITIAADVVKEEDCRRFVSET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             IN +GRVDHLVNTASLGHTF+FEE +DT++FP L+DINFWGNVYPT+VALPYL +S GRV
Sbjct  120   INVFGRVDHLVNTASLGHTFFFEEVTDTSIFPRLLDINFWGNVYPTFVALPYLHESNGRV  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +VNASVE+WLPLPRMSLY++AKA LV  YE+LRFE+ + +GIT+ATHGWIG EM +GK M
Sbjct  180   VVNASVENWLPLPRMSLYASAKAALVTFYESLRFELNDEVGITIATHGWIGIEMTKGKFM  239

Query  976   VEEGAEMQWKEEREVH-ATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +E+GAEMQWKEEREVH A GPVE+FA+LIVSGACRGD YVK+PSWYD FLLYRVF+P+VL
Sbjct  240   LEDGAEMQWKEEREVHVAGGPVEDFARLIVSGACRGDTYVKFPSWYDVFLLYRVFAPHVL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPI  1227
             NWTFRLL  +  AR TS IGTGRP+
Sbjct  300   NWTFRLLISSEGARRTSLIGTGRPL  324



>gb|EPS67484.1| hypothetical protein M569_07290, partial [Genlisea aurea]
Length=345

 Score =   508 bits (1309),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 256/348 (74%), Positives = 292/348 (84%), Gaps = 6/348 (2%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             MMDL+NSVLN  VPPASL+MLA +WPTL FI++CEW YN Y+  E ME KVVVITGASSG
Sbjct  1     MMDLINSVLNFFVPPASLLMLAFSWPTLFFINSCEWFYNTYFSGENMESKVVVITGASSG  60

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGEQIAY+YAKR ANLVLVARRE+RLR ISENAR LGA  VL+ AADVVKE++CRRFI E
Sbjct  61    IGEQIAYQYAKRGANLVLVARREHRLRGISENARRLGAPFVLVMAADVVKEDDCRRFINE  120

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
             TIN++GR+DHLVNT SLGHTF+FEEA+DT VFP+LMDINFWGNVYPTYVALPYLR+S GR
Sbjct  121   TINYFGRLDHLVNTVSLGHTFHFEEATDTNVFPLLMDINFWGNVYPTYVALPYLRESNGR  180

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             +IVNASVE+WLPLPRMSLY+AAK+ L+N YETLRFE+   +GITVATHGW+GTE+ARGK 
Sbjct  181   IIVNASVENWLPLPRMSLYAAAKSALINFYETLRFEMKGEVGITVATHGWMGTELARGKF  240

Query  973   MVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNV  1149
             MVEEGAEMQWKEEREVH + GPVEE+AKLIV+GACRGD YVKYP WYD F LYRVF+P +
Sbjct  241   MVEEGAEMQWKEEREVHVSGGPVEEYAKLIVAGACRGDPYVKYPKWYDIFFLYRVFAPKI  300

Query  1150  LNWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSPAGRP  1293
             L WT      +  AR TS IGTGRP+       SSP+R  + SP G P
Sbjct  301   LFWTLSFFLTDGIARRTSLIGTGRPL----LEGSSPMRYLS-SPEGSP  343



>ref|XP_002279316.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 isoform 
X1 [Vitis vinifera]
 emb|CBI31355.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   508 bits (1309),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 254/326 (78%), Positives = 286/326 (88%), Gaps = 4/326 (1%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+NS+LNLVVPPASLVMLA AWP L FI+ACEW+YN  Y E  MEDKVV+ITGASSGI
Sbjct  1     MDLINSLLNLVVPPASLVMLAFAWPALSFINACEWVYNTLYSEN-MEDKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQ+AYEYAK+ A LVLVARRENRL  I ENAR LGAK+V+I AADVVK ++CRRF+ ET
Sbjct  60    GEQVAYEYAKKGAKLVLVARRENRLLGIGENARQLGAKHVMIMAADVVKLDDCRRFVTET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             +N+YGRVDHLVNTASLGHTFYFEEA DT+VFP LMDINFWGNVYPTYVALP+LRQS GRV
Sbjct  120   VNYYGRVDHLVNTASLGHTFYFEEAIDTSVFPPLMDINFWGNVYPTYVALPFLRQSNGRV  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IVNASVE+WLPLPRMSLY+AAKA L+N YETLRFE    +GIT+ATHGWIG++M RGK M
Sbjct  180   IVNASVENWLPLPRMSLYAAAKAALINFYETLRFE-AKEVGITIATHGWIGSDMTRGKFM  238

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +E+GAEMQWKEEREV  T GPVEEFA+L+V+GACRGD YVKYPSWYD FLLYRVF+PNVL
Sbjct  239   LEDGAEMQWKEEREVQVTGGPVEEFARLMVAGACRGDAYVKYPSWYDIFLLYRVFAPNVL  298

Query  1153  NWTFRLLFD-NLSARTTSFIGTGRPI  1227
              WTFRLL   N + R+TS IGTGRP+
Sbjct  299   GWTFRLLLSTNGARRSTSLIGTGRPL  324



>ref|XP_010100094.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Morus notabilis]
 gb|EXB81477.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Morus notabilis]
Length=359

 Score =   506 bits (1302),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 258/356 (72%), Positives = 295/356 (83%), Gaps = 12/356 (3%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MD VN+ LN VVPPAS+VMLA AWP LCFISACEWLY+ +Y EE MEDKVV+ITGASSGI
Sbjct  1     MDFVNTFLNWVVPPASMVMLACAWPALCFISACEWLYSTFY-EENMEDKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYA+R ANLVLVARRE RL  ISENAR +GA++V+I AADVVKE++CRRF+ ET
Sbjct  60    GEQIAYEYARRGANLVLVARRETRLLGISENARRIGARHVMIIAADVVKEDDCRRFLNET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             INF+GRVDHLVNT SLGHTFY EE SDT+VFP L+DINFWGNVYPT+VALPYL QS GRV
Sbjct  120   INFHGRVDHLVNTVSLGHTFYLEEVSDTSVFPHLLDINFWGNVYPTFVALPYLYQSNGRV  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +VNASVE+WLPLPRMSLY+AAK+ L+N YETLRFEV + +GIT+ATHGWIG E++ GK M
Sbjct  180   VVNASVENWLPLPRMSLYAAAKSALINFYETLRFEVRDEVGITIATHGWIGGEISGGKFM  239

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +EEGAEMQWKEEREVH + GPVE+FA+LIVSGACRG+ YVKYPSWYD FL+YRVF+P +L
Sbjct  240   LEEGAEMQWKEEREVHVSGGPVEKFARLIVSGACRGEPYVKYPSWYDIFLVYRVFAPKIL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSP----AGRPVTVLQ  1308
             NWTFRLL      R TS +GTGRP   E      PL LE  SP     G P+T  Q
Sbjct  300   NWTFRLLLSPNGTRRTSLVGTGRPYYAE-----RPL-LEGSSPRKFLTGGPMTFPQ  349



>ref|XP_010645922.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 isoform 
X2 [Vitis vinifera]
Length=352

 Score =   505 bits (1301),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 253/325 (78%), Positives = 285/325 (88%), Gaps = 4/325 (1%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+NS+LNLVVPPASLVMLA AWP L FI+ACEW+YN  Y E  MEDKVV+ITGASSGI
Sbjct  1     MDLINSLLNLVVPPASLVMLAFAWPALSFINACEWVYNTLYSEN-MEDKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQ+AYEYAK+ A LVLVARRENRL  I ENAR LGAK+V+I AADVVK ++CRRF+ ET
Sbjct  60    GEQVAYEYAKKGAKLVLVARRENRLLGIGENARQLGAKHVMIMAADVVKLDDCRRFVTET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             +N+YGRVDHLVNTASLGHTFYFEEA DT+VFP LMDINFWGNVYPTYVALP+LRQS GRV
Sbjct  120   VNYYGRVDHLVNTASLGHTFYFEEAIDTSVFPPLMDINFWGNVYPTYVALPFLRQSNGRV  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IVNASVE+WLPLPRMSLY+AAKA L+N YETLRFE    +GIT+ATHGWIG++M RGK M
Sbjct  180   IVNASVENWLPLPRMSLYAAAKAALINFYETLRFE-AKEVGITIATHGWIGSDMTRGKFM  238

Query  976   VEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLN  1155
             +E+GAEMQWKEEREV   GPVEEFA+L+V+GACRGD YVKYPSWYD FLLYRVF+PNVL 
Sbjct  239   LEDGAEMQWKEEREVTG-GPVEEFARLMVAGACRGDAYVKYPSWYDIFLLYRVFAPNVLG  297

Query  1156  WTFRLLFD-NLSARTTSFIGTGRPI  1227
             WTFRLL   N + R+TS IGTGRP+
Sbjct  298   WTFRLLLSTNGARRSTSLIGTGRPL  322



>ref|XP_010683155.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Beta 
vulgaris subsp. vulgaris]
Length=352

 Score =   504 bits (1297),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 250/357 (70%), Positives = 295/357 (83%), Gaps = 6/357 (2%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MD++NS++N VVPPASLVMLA+AWPTL FI+ACEW+Y L+  E  MEDKVV+ITGASSG+
Sbjct  1     MDVLNSLMNFVVPPASLVMLAMAWPTLSFINACEWVYGLFSYEN-MEDKVVIITGASSGL  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYAKR A LVLVARR+ RLR ISENAR +GAK+V+I AADVVKE+ECRRFI ET
Sbjct  60    GEQIAYEYAKRGAILVLVARRDTRLRGISENARQMGAKHVMIVAADVVKEDECRRFINET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             + FYGRVDHLVN  SLGHTFYFEEA+DT+VFP LMDINFWGNVYPTYVALPYLRQ+RGR+
Sbjct  120   MTFYGRVDHLVNATSLGHTFYFEEANDTSVFPHLMDINFWGNVYPTYVALPYLRQTRGRI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IVNASVE+W PLPRMSLYSAAK+ LVN YETLR EV   +GIT+ATHGWIGT++ RGK+M
Sbjct  180   IVNASVENWFPLPRMSLYSAAKSALVNFYETLRLEVKEDVGITIATHGWIGTDVTRGKLM  239

Query  976   VEEGAEMQWKEEREVHATG-PVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             V+ GA+MQW+EEREV ++   V++FAKLIV+GACRGD YVK+PSWYD FLLY+ F+P VL
Sbjct  240   VDNGADMQWREEREVQSSSEAVDDFAKLIVAGACRGDPYVKHPSWYDAFLLYKAFAPKVL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSPAGRPVTVLQQHKME  1323
              WTFRLL    S+R TS +G GRP+      S+SP +  +P    R     QQ K+E
Sbjct  300   GWTFRLLLGADSSRKTSLVGVGRPL----LESASPKKPSSPMTGSRLAYAPQQMKVE  352



>ref|XP_002528042.1| Corticosteroid 11-beta-dehydrogenase, putative [Ricinus communis]
 gb|EEF34360.1| Corticosteroid 11-beta-dehydrogenase, putative [Ricinus communis]
Length=352

 Score =   503 bits (1295),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 247/325 (76%), Positives = 281/325 (86%), Gaps = 2/325 (1%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+NSV+N VVPPASLVMLA +WP L FI+ CEWLY  YY E+ MEDKVV+ITGASSGI
Sbjct  1     MDLINSVMNWVVPPASLVMLACSWPALFFINTCEWLYRSYYSED-MEDKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYAKR+ANLVL+ARRE RLR ISE ARL GAK+V+I AADVVKE++CRRF+ ET
Sbjct  60    GEQIAYEYAKRKANLVLIARREQRLRGISEKARLFGAKHVMIMAADVVKEDDCRRFVEET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             INFYGRVDHLVNTASLGHTFY EE  DT+VFP L+DINFWGNVYPT VALPYL Q+ GR+
Sbjct  120   INFYGRVDHLVNTASLGHTFYVEEVLDTSVFPHLLDINFWGNVYPTVVALPYLHQTNGRI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IVNA+V++WLPLPRMSLY+AAKA LVN YE+LRFE+   IGIT+ATHGWIG+EM+RG+  
Sbjct  180   IVNAAVQNWLPLPRMSLYAAAKAALVNFYESLRFELNGDIGITIATHGWIGSEMSRGRFR  239

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +EEGAEMQW EEREV A+ GPVEE+AKLIVSGACRGD YVK+PSWYD FLLYR F+PNVL
Sbjct  240   LEEGAEMQWIEEREVQASGGPVEEYAKLIVSGACRGDRYVKFPSWYDVFLLYREFAPNVL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPI  1227
             NWT  LL     AR TS +GTGRP+
Sbjct  300   NWTLHLLLAGHGARRTSLVGTGRPL  324



>ref|NP_001241259.1| uncharacterized protein LOC100780731 [Glycine max]
 gb|ACU18023.1| unknown [Glycine max]
Length=355

 Score =   503 bits (1294),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 247/359 (69%), Positives = 297/359 (83%), Gaps = 7/359 (2%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MD +N +LNL+VPP S++ LA +WP LCF++ CEWLYN  YGE+I ++KVV+ITGASSGI
Sbjct  1     MDFLNFMLNLLVPPGSMLTLAFSWPALCFLNVCEWLYNSIYGEDI-DNKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYA RRANL LVARRE+RLR I+ENA+ LGA++V+I AADVVKEE+CRRF+ ET
Sbjct  60    GEQIAYEYALRRANLTLVARREHRLRGIAENAKRLGARHVMIMAADVVKEEDCRRFVNET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             IN +GRVDHLVNT SLGHTF FEE +DT+VFP+L+DINFWGNVYPT+VALPYL QS GR+
Sbjct  120   INVFGRVDHLVNTVSLGHTFCFEEVTDTSVFPVLLDINFWGNVYPTFVALPYLHQSNGRI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             I+NASVESWLP+PRMSLY+AAKA LVN YETLRFE+ + +GIT+ATHGWIG+EM RGK M
Sbjct  180   IINASVESWLPMPRMSLYAAAKAALVNFYETLRFELKDEVGITIATHGWIGSEMTRGKFM  239

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +EEGAEMQWKEEREVH   GPVEEFA+LIVSGACRGD YVK+PSWYD FLLYRVF+P VL
Sbjct  240   LEEGAEMQWKEEREVHVMGGPVEEFARLIVSGACRGDAYVKFPSWYDVFLLYRVFAPRVL  299

Query  1153  NWTFRLLFD-NLSARTTSFIGTGRPITMEssssssPL-RLEAPSPAGRPVTVLQQHKME  1323
             NW FR L     + R +S++GTG+ I  E+     P+  LE  SP      ++ QHK++
Sbjct  300   NWAFRFLISPQGTRRASSYVGTGKHI--EAVGMVRPMAMLEGTSPT-HTGQLISQHKLD  355



>ref|XP_006376168.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
 gb|ERP53965.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
Length=326

 Score =   501 bits (1289),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 233/312 (75%), Positives = 273/312 (88%), Gaps = 2/312 (1%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PPASLVMLA +WP LCFI+ CEWLY  ++ E+ MEDKVV+ITGASSGIGEQIAYEYAKR+
Sbjct  13    PPASLVMLACSWPALCFINTCEWLYRSFFSED-MEDKVVIITGASSGIGEQIAYEYAKRK  71

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A LVL+ARRE+RLR +SE AR +GAK VLI AADVVKE++CRRF+ ETIN++GRVDHLVN
Sbjct  72    AILVLIARREHRLRGVSEKARYIGAKRVLIMAADVVKEDDCRRFVNETINYFGRVDHLVN  131

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
             TASLGHTFYFEE  DT+VFP  +DINFWGNVYPTYVALPYLRQS GRV+VNA+VESWLPL
Sbjct  132   TASLGHTFYFEEVGDTSVFPHFLDINFWGNVYPTYVALPYLRQSNGRVVVNAAVESWLPL  191

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
             PRMSLY+AAKA LV+ YE+LRFEV   +GIT+A+HGWIG+EM+RGK M+E+GAEMQWKEE
Sbjct  192   PRMSLYAAAKAALVSFYESLRFEVNGEVGITIASHGWIGSEMSRGKFMLEDGAEMQWKEE  251

Query  1012  REVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLS  1188
             REV+ T GPVE++AK+IVSGACRG +YVKYPSWYD FLLYR+F+P +LNW  R+L     
Sbjct  252   REVNGTGGPVEDYAKMIVSGACRGHQYVKYPSWYDIFLLYRMFAPGILNWALRMLLAPNG  311

Query  1189  ARTTSFIGTGRP  1224
             +R TS IGTGRP
Sbjct  312   SRRTSMIGTGRP  323



>gb|ABS28873.1| steroleosin-B [Arachis hypogaea]
Length=353

 Score =   499 bits (1286),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 250/344 (73%), Positives = 292/344 (85%), Gaps = 10/344 (3%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+NSVLNL VPPASL+ LA +WP LCF  ACEWLYN  YG+  M+ KVV+ITGASSGI
Sbjct  1     MDLINSVLNLFVPPASLITLAFSWPALCFPHACEWLYNTVYGDN-MDGKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYA RRA LVLVARRE+RLR I+ENAR +GA++V+I AADVVKE+ECRRF+ ET
Sbjct  60    GEQIAYEYALRRACLVLVARREHRLRGIAENARRMGARHVMIVAADVVKEDECRRFVNET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             INFYGRVDHLVNT SLGHTFYFEE +DT+VFP+L+DINFWGN+YPT VALPYL ++ GRV
Sbjct  120   INFYGRVDHLVNTVSLGHTFYFEEVTDTSVFPVLLDINFWGNIYPTLVALPYLHRTNGRV  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             I+NASVESWLPLPRMSLY+AAKA LVN YETLRFE+ + +G+T+ATHGWIG+EM  GK M
Sbjct  180   IINASVESWLPLPRMSLYAAAKAALVNFYETLRFELRDEVGVTIATHGWIGSEMTSGKFM  239

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +EEGAEMQWKEERE++   GPVEEFA+L+V+GACRGD YVKYPSWYD FLLYRVF+PNVL
Sbjct  240   LEEGAEMQWKEEREMNVIGGPVEEFARLMVAGACRGDAYVKYPSWYDVFLLYRVFAPNVL  299

Query  1153  NWTFRLLF-DNLSARTTSFIGTGRPITMEssssssPLRLEAPSP  1281
             NW FRLL     + RT+S++GTGR +         P+ LEAPSP
Sbjct  300   NWAFRLLIAPQGTKRTSSYVGTGRSLE------GRPM-LEAPSP  336



>ref|XP_011006178.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Populus 
euphratica]
Length=336

 Score =   498 bits (1283),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 230/312 (74%), Positives = 272/312 (87%), Gaps = 2/312 (1%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PPASLVMLA +WP LCFI+ CEWLY  ++ E+ MEDKVV+ITGASSGIGEQIAYEYAKR+
Sbjct  23    PPASLVMLACSWPALCFINTCEWLYKSFFSED-MEDKVVIITGASSGIGEQIAYEYAKRK  81

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A LVL+AR+E+RLR +SE AR +GAK+VLI AADVVKE++CRRF+ ETIN++GRVDHLVN
Sbjct  82    AILVLIARKEHRLRGVSEKARYIGAKHVLIMAADVVKEDDCRRFVNETINYFGRVDHLVN  141

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
             TASLGHTFYFEE  DT+VFP  +DINFWGNVYPTYVALPYLRQS GRV+VNA+VESWLPL
Sbjct  142   TASLGHTFYFEEVGDTSVFPHFLDINFWGNVYPTYVALPYLRQSNGRVVVNAAVESWLPL  201

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
             PRMSLY+AAKA LV+ YE+LRFEV   +GIT+A+HGWIG EM+RGK M+E+GA MQWKEE
Sbjct  202   PRMSLYAAAKAALVSFYESLRFEVNGEVGITIASHGWIGNEMSRGKFMLEDGAAMQWKEE  261

Query  1012  REVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLS  1188
             REV+ T GPVE++AK+IVSGACRG +YVKYPSWYD FLLYR+F+P +LNW  R+L     
Sbjct  262   REVNGTGGPVEDYAKMIVSGACRGHQYVKYPSWYDIFLLYRMFAPGILNWALRMLLAPNG  321

Query  1189  ARTTSFIGTGRP  1224
             +R TS +GTGRP
Sbjct  322   SRRTSLVGTGRP  333



>ref|XP_006397111.1| hypothetical protein EUTSA_v10029315mg [Eutrema salsugineum]
 gb|ESQ38564.1| hypothetical protein EUTSA_v10029315mg [Eutrema salsugineum]
Length=401

 Score =   500 bits (1288),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 250/377 (66%), Positives = 302/377 (80%), Gaps = 8/377 (2%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             M+DL+NSV+NLV PPA++V++A +WP LCFIS  E LYN Y+  E MEDKVVVITGASS 
Sbjct  1     MVDLLNSVMNLVAPPATMVVMAFSWPLLCFISFSERLYNSYFATEDMEDKVVVITGASSA  60

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGEQIAYEYAKR ANLVLVARRE RLR +S  AR++GA +V+I AADV+KE++CRRFI +
Sbjct  61    IGEQIAYEYAKRGANLVLVARREQRLRVVSNKARIIGANHVIIIAADVIKEDDCRRFITQ  120

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
              +N+YGRVDHLVNT SLGHTFYF+E SDTTVFP L+DINFWGNVYPTYVALPYL+++ GR
Sbjct  121   AVNYYGRVDHLVNTVSLGHTFYFDEVSDTTVFPHLLDINFWGNVYPTYVALPYLQKTNGR  180

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             ++VNASVE+WLPLPRMSLYSAAKA LVN YETLRFE+   +GIT+ATHGWIG+EM+RGK 
Sbjct  181   IVVNASVENWLPLPRMSLYSAAKAALVNFYETLRFELNEEVGITIATHGWIGSEMSRGKF  240

Query  973   MVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNV  1149
             M+EEGAEMQWKEEREV A  GP+EEFAK+IV+GACRGD YVK+P+WYD FLLYRVF+PNV
Sbjct  241   MLEEGAEMQWKEEREVSANGGPIEEFAKMIVAGACRGDAYVKFPNWYDVFLLYRVFTPNV  300

Query  1150  LNWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSPAGRPVTVLQQHKME*M  1329
             L WTF+LL  +  +R +S +G G  + ++ SSS   L LE  +P    VT    H     
Sbjct  301   LRWTFKLLLSSEGSRRSSLVGVGPAMPVDESSSEMKLMLEGGTPR---VTGSPPHYTA--  355

Query  1330  N*SKPQHACNASHSTIS  1380
               S P++  +  H T S
Sbjct  356   --SPPRYTASPPHYTAS  370



>ref|XP_004511498.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cicer arietinum]
Length=373

 Score =   499 bits (1285),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 242/350 (69%), Positives = 290/350 (83%), Gaps = 8/350 (2%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MD  N +LNL VPP SL+ LA +WP LCF++ACEWLYN  Y E+IM+ KVV+ITGASSGI
Sbjct  1     MDFFNFLLNLFVPPLSLIALAFSWPALCFLNACEWLYNYIYAEDIMDSKVVIITGASSGI  60

Query  436   GE-----QIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRR  600
             GE     QIAYEYA RRANL+LVARRE+RLR I+ENAR +GAK+V+I AADVVKE++C+R
Sbjct  61    GEASLYQQIAYEYAIRRANLMLVARREHRLRGIAENARRMGAKHVMIMAADVVKEDDCKR  120

Query  601   FILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQ  780
             F+ ETIN +GRVDHLVNT SLGHTFYFEE +DT+VFP+L+DINFWGNVYPT VALP+L Q
Sbjct  121   FVNETINVFGRVDHLVNTVSLGHTFYFEEVTDTSVFPVLLDINFWGNVYPTLVALPHLHQ  180

Query  781   SRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMA  960
             S GRVI+NASVESWLPLPRMSL+ AAKA L+N YETLRFE+   +G+T+ATHGWIG+EM 
Sbjct  181   SNGRVIINASVESWLPLPRMSLFGAAKAALINFYETLRFELKEEVGVTIATHGWIGSEMT  240

Query  961   RGKIMVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVF  1137
             RGK M+EEGA+MQWKEERE+H + G VEEFA+LIVSGACRGD YVK+PSWYD FLLYRVF
Sbjct  241   RGKFMLEEGADMQWKEEREIHVSGGAVEEFARLIVSGACRGDSYVKFPSWYDVFLLYRVF  300

Query  1138  SPNVLNWTFRLLFD-NLSARTTSFIGTGRPITMEssssssPLRLEAPSPA  1284
             +PNVLNW F+LL     + RT+S++GTGR +   +     P+ LE  SP+
Sbjct  301   APNVLNWAFQLLISPQGTRRTSSYLGTGRSLDNVTGGMGKPM-LEGNSPS  349



>gb|KHN35097.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Glycine 
soja]
Length=371

 Score =   499 bits (1284),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 252/374 (67%), Positives = 304/374 (81%), Gaps = 21/374 (6%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MD +N +LNL+VPP S++ LA +WP LCF++ CEWLYN  YGE+ M++KVV+ITGASSGI
Sbjct  1     MDFLNFLLNLLVPPGSMITLAFSWPALCFLNFCEWLYNSIYGED-MDNKVVIITGASSGI  59

Query  436   GE--------QIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEE  591
             GE        QIAYEYA RRANL LVARRE+RLR I+ENA+ LGA++V+I AADVVKE++
Sbjct  60    GEASSLCIMHQIAYEYALRRANLTLVARREHRLRGIAENAKRLGARHVMIMAADVVKEDD  119

Query  592   CRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPY  771
             CRRF+ ETIN +GRVDHLVNT SLGHTF FEEA+DT+VFP+L+DINFWGNVYPT+VALPY
Sbjct  120   CRRFVNETINVFGRVDHLVNTVSLGHTFCFEEATDTSVFPVLLDINFWGNVYPTFVALPY  179

Query  772   LRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGT  951
             L QS GR+I+NASVESWLP+PRMSLY+AAKA LVN YETLRFE+ + +GIT+ATHGWIG+
Sbjct  180   LHQSNGRIIINASVESWLPMPRMSLYAAAKAALVNFYETLRFELKDEVGITIATHGWIGS  239

Query  952   EMARGKIMVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLY  1128
             EM RGK M+EEGAEMQWKEEREVH T GPVEEFA+LIVSGACRGD YVK+PSWYD FLLY
Sbjct  240   EMTRGKFMLEEGAEMQWKEEREVHVTGGPVEEFARLIVSGACRGDAYVKFPSWYDVFLLY  299

Query  1129  RVFSPNVLNWTFRLLFD-NLSARTTSFIGTGRPITMEssssssPL-RLEAPSP---AGRP  1293
             RVF+P VLNW FRLL     + R +S++GTG+ I  E+     P+  LE  SP   A  P
Sbjct  300   RVFAPRVLNWAFRLLISPQGTRRASSYVGTGKHI--EAVGMVRPMAMLEGTSPTHNAIGP  357

Query  1294  VT----VLQQHKME  1323
             +T    ++ QHK++
Sbjct  358   LTFSGQLISQHKLD  371



>ref|XP_009134177.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Brassica 
rapa]
Length=447

 Score =   500 bits (1288),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 245/344 (71%), Positives = 293/344 (85%), Gaps = 1/344 (0%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             M+DL+NSV+NLV PPA++V++A +WP LCFIS  E LYN Y+  E MEDKVVVITGASS 
Sbjct  1     MVDLLNSVMNLVAPPATMVVMAFSWPLLCFISFSERLYNSYFVTEDMEDKVVVITGASSA  60

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGEQIAYEYAKR ANLVLVARRE RLR +S NAR +GA +V+I AADVVKE++CRRFI +
Sbjct  61    IGEQIAYEYAKRGANLVLVARREQRLRVVSNNARQIGANHVIIIAADVVKEDDCRRFITQ  120

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
              +N+YGRVDHLVN+ASLGHTFYF+E SDTTVFP L+DINFWGNVYPTYVALP+L+++ GR
Sbjct  121   AVNYYGRVDHLVNSASLGHTFYFDEVSDTTVFPHLLDINFWGNVYPTYVALPHLQKTNGR  180

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             ++VNASVE+WLPLPRMSLYSAAKA LVN YETLRFE+   +GIT+ATHGWIG+EM+RGK 
Sbjct  181   IVVNASVENWLPLPRMSLYSAAKAALVNFYETLRFELNGDVGITIATHGWIGSEMSRGKF  240

Query  973   MVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNV  1149
             M+EEGAEMQWKEEREV A  GP+EEFAK+IV+GACRGD YVK+P+WYD FLLYRVF+PNV
Sbjct  241   MLEEGAEMQWKEEREVPANGGPLEEFAKMIVAGACRGDAYVKFPNWYDVFLLYRVFTPNV  300

Query  1150  LNWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSP  1281
             L WTF+LL  +  +R +S +G G+ + +E SSS   L LE  SP
Sbjct  301   LRWTFKLLLSSEGSRQSSLVGVGQGMPVEESSSQMKLMLEGGSP  344



>gb|KFK32035.1| hypothetical protein AALP_AA6G191600 [Arabis alpina]
Length=380

 Score =   498 bits (1281),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 243/344 (71%), Positives = 289/344 (84%), Gaps = 1/344 (0%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             M+DL+NSV+NLVVPPA++V++A +WP L FIS  E LYN YY  E MEDKVVVITGASS 
Sbjct  1     MVDLLNSVMNLVVPPATMVVMAFSWPLLSFISFSERLYNSYYATENMEDKVVVITGASSA  60

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGEQIAYEYAKRRANLVLVARRE RLR +S  A+ +GA +V+I AADV+KE++CRRFI +
Sbjct  61    IGEQIAYEYAKRRANLVLVARREQRLRVVSSKAKTIGANHVIIIAADVIKEDDCRRFITQ  120

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
              +++YGRVDHLVNTASLGHTFYFEE SDTTVFP L+DINFWGNVYPTYVALPYL+++ GR
Sbjct  121   AVDYYGRVDHLVNTASLGHTFYFEEVSDTTVFPHLLDINFWGNVYPTYVALPYLKKTNGR  180

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             ++VNASVE+WLPLPRMSLYSAAKA LVN YETLRFE+   +GIT+ATHGWIG+EM+RGK 
Sbjct  181   IVVNASVENWLPLPRMSLYSAAKAALVNFYETLRFELNGDVGITIATHGWIGSEMSRGKF  240

Query  973   MVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNV  1149
             M+EEGAEMQWKEEREV A  GP+EEFAK+IV+GACRGD YVK+P+WYD FLLYRVF+PNV
Sbjct  241   MLEEGAEMQWKEEREVPANGGPLEEFAKMIVAGACRGDAYVKFPNWYDVFLLYRVFTPNV  300

Query  1150  LNWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSP  1281
             L WTF+LL     +R +S +G G  +  + S+S   L LE   P
Sbjct  301   LRWTFKLLLSTEGSRKSSLVGVGSGMPADESTSQMKLMLEGGPP  344



>emb|CDX90742.1| BnaA03g24220D [Brassica napus]
Length=451

 Score =   499 bits (1286),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 244/344 (71%), Positives = 293/344 (85%), Gaps = 1/344 (0%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             M+DL+NSV+NLV PPA++V++A +WP LCFIS  E LYN Y+  E MEDKVVVITGASS 
Sbjct  1     MVDLLNSVMNLVAPPATMVVMAFSWPLLCFISFSERLYNSYFVTEDMEDKVVVITGASSA  60

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGEQIAYEYAKR ANLVLVARRE RLR +S NAR +GA +V+I AADVVKE++CRRFI +
Sbjct  61    IGEQIAYEYAKRGANLVLVARREQRLRVVSNNARQIGANHVIIIAADVVKEDDCRRFITQ  120

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
              +N+YGRVDHLVN+ASLGHTFYF+E SDTTVFP L+DINFWGNVYPTYVALP+L+++ GR
Sbjct  121   AVNYYGRVDHLVNSASLGHTFYFDEVSDTTVFPHLLDINFWGNVYPTYVALPHLQKTNGR  180

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             ++VNASVE+WLPLPRMSLYSAAKA LVN YETLRFE+   +GIT+ATHGWIG+EM+RGK 
Sbjct  181   IVVNASVENWLPLPRMSLYSAAKAALVNFYETLRFELNGDVGITIATHGWIGSEMSRGKF  240

Query  973   MVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNV  1149
             M+EEGAEMQWKEEREV A  GP+E+FAK+IV+GACRGD YVK+P+WYD FLLYRVF+PNV
Sbjct  241   MLEEGAEMQWKEEREVSANGGPLEDFAKMIVAGACRGDAYVKFPNWYDVFLLYRVFTPNV  300

Query  1150  LNWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSP  1281
             L WTF+LL  +  +R +S +G G+ + +E SSS   L LE  SP
Sbjct  301   LRWTFKLLLSSEGSRQSSLVGVGQGMPVEESSSQMKLMLEGGSP  344



>gb|KHN25620.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Glycine 
soja]
Length=363

 Score =   496 bits (1277),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 247/367 (67%), Positives = 297/367 (81%), Gaps = 15/367 (4%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MD +N +LNL+VPP S++ LA +WP LCF++ CEWLYN  YGE+I ++KVV+ITGASSGI
Sbjct  1     MDFLNFMLNLLVPPGSMLTLAFSWPALCFLNVCEWLYNSIYGEDI-DNKVVIITGASSGI  59

Query  436   GE--------QIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEE  591
             GE        QIAYEYA RRANL LVARRE+RLR I+ENA+ LGA++V+I AADVVKEE+
Sbjct  60    GEASSLYIMHQIAYEYALRRANLTLVARREHRLRGIAENAKRLGARHVMIMAADVVKEED  119

Query  592   CRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPY  771
             CRRF+ ETIN +GRVDHLVNT SLGHTF FEE +DT+VFP+L+DINFWGNVYPT+VALPY
Sbjct  120   CRRFVNETINVFGRVDHLVNTVSLGHTFCFEEVTDTSVFPVLLDINFWGNVYPTFVALPY  179

Query  772   LRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGT  951
             L QS GR+I+NASVESWLP+PRMSLY+AAKA LVN YETLRFE+ + +GIT+ATHGWIG+
Sbjct  180   LHQSNGRIIINASVESWLPMPRMSLYAAAKAALVNFYETLRFELKDEVGITIATHGWIGS  239

Query  952   EMARGKIMVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLY  1128
             EM RGK M+EEGAEMQWKEEREVH   GPVEEFA+LIVSGACRGD YVK+PSWYD FLLY
Sbjct  240   EMTRGKFMLEEGAEMQWKEEREVHVMGGPVEEFARLIVSGACRGDAYVKFPSWYDVFLLY  299

Query  1129  RVFSPNVLNWTFRLLFD-NLSARTTSFIGTGRPITMEssssssPL-RLEAPSPAGRPVTV  1302
             RVF+P VLNW FR L     + R +S++GTG+ I  E+     P+  LE  SP      +
Sbjct  300   RVFAPRVLNWAFRFLISPQGTRRASSYVGTGKHI--EAVGMVRPMAMLEGTSPT-HTGQL  356

Query  1303  LQQHKME  1323
             + QHK++
Sbjct  357   ISQHKLD  363



>gb|ACG69526.1| steroleosin SLO2-2 [Brassica napus]
Length=461

 Score =   500 bits (1287),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 244/344 (71%), Positives = 293/344 (85%), Gaps = 1/344 (0%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             M+DL+NSV+NLV PPA++V++A +WP LCFIS  E LYN Y+  E MEDKVVVITGASS 
Sbjct  1     MVDLLNSVMNLVAPPATMVVMAFSWPLLCFISFSERLYNSYFVTEDMEDKVVVITGASSA  60

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGEQIAYEYAKR ANLVLVARRE RLR +S NAR +GA +V+I AADVVKE++CRRFI +
Sbjct  61    IGEQIAYEYAKRGANLVLVARREQRLRVVSNNARQIGANHVIIIAADVVKEDDCRRFITQ  120

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
              +N+YGRVDHLVN+ASLGHTFYF+E SDTTVFP L+DINFWGNVYPTYVALP+L+++ GR
Sbjct  121   AVNYYGRVDHLVNSASLGHTFYFDEVSDTTVFPHLLDINFWGNVYPTYVALPHLQKTNGR  180

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             ++VNASVE+WLPLPRMSLYSAAKA LVN YETLRFE+   +GIT+ATHGWIG+EM+RGK 
Sbjct  181   IVVNASVENWLPLPRMSLYSAAKAALVNFYETLRFELNGDVGITIATHGWIGSEMSRGKF  240

Query  973   MVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNV  1149
             M+EEGAEMQWKEEREV A  GP+E+FAK+IV+GACRGD YVK+P+WYD FLLYRVF+PNV
Sbjct  241   MLEEGAEMQWKEEREVSAKGGPLEDFAKMIVAGACRGDAYVKFPNWYDVFLLYRVFTPNV  300

Query  1150  LNWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSP  1281
             L WTF+LL  +  +R +S +G G+ + +E SSS   L LE  SP
Sbjct  301   LRWTFKLLLSSEGSRQSSLVGVGQGMPVEESSSQMKLMLEGGSP  344



>emb|CDY05081.1| BnaC03g28790D [Brassica napus]
Length=456

 Score =   499 bits (1285),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 244/344 (71%), Positives = 292/344 (85%), Gaps = 1/344 (0%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             M+DL+NSV+NLV PPA++V++A +WP LCFI+  E LYN Y+  E MEDKVVVITGASS 
Sbjct  1     MVDLLNSVMNLVAPPATMVVMAFSWPLLCFITFSERLYNSYFVTEDMEDKVVVITGASSA  60

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGEQIAYEYAKR ANLVLVARRE RLR +S NAR +GA +V+I AADVVKE++CRRFI +
Sbjct  61    IGEQIAYEYAKRGANLVLVARREQRLRVVSNNARQIGANHVIIIAADVVKEDDCRRFITQ  120

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
              +N+YGRVDHLVN+ASLGHTFYF+E SDTTVFP L+DINFWGNVYPTYVALP+L+++ GR
Sbjct  121   AVNYYGRVDHLVNSASLGHTFYFDEVSDTTVFPHLLDINFWGNVYPTYVALPHLQKTNGR  180

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             ++VNASVE+WLPLPRMSLYSAAKA LVN YETLRFE+   +GIT+ATHGWIG+EM+RGK 
Sbjct  181   IVVNASVENWLPLPRMSLYSAAKAALVNFYETLRFELNGDVGITIATHGWIGSEMSRGKF  240

Query  973   MVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNV  1149
             M+EEGAEMQWKEEREV A  GP+EEFAK+IV+GACRGD YVK+P+WYD FLLYRVF+PNV
Sbjct  241   MLEEGAEMQWKEEREVPANGGPLEEFAKMIVAGACRGDAYVKFPNWYDVFLLYRVFTPNV  300

Query  1150  LNWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSP  1281
             L WTF+LL  +  +R +S +G G+ +  E SSS   L LE  SP
Sbjct  301   LRWTFKLLLSSEGSRQSSLVGVGQGLPPEESSSQMKLMLEGGSP  344



>ref|XP_010437678.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Camelina 
sativa]
Length=382

 Score =   495 bits (1275),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 243/344 (71%), Positives = 287/344 (83%), Gaps = 1/344 (0%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             M+DL+NSV+NLV PPA++V++A AWP L FIS  E +YN Y+  E MEDKVVVITGASS 
Sbjct  1     MVDLLNSVMNLVAPPATMVVMAFAWPLLSFISFSERVYNSYFATENMEDKVVVITGASSA  60

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGEQIAYEYAKR ANLVLVARRE RLR +S  A+ +GA +V+I AADV+KE++CRRFI +
Sbjct  61    IGEQIAYEYAKRGANLVLVARREQRLRVVSNKAKQIGANHVIIIAADVIKEDDCRRFITQ  120

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
              +N+YGRVDHLVNTASLGHTFYFEE SDTTVFP LMDINFWGNVYPTYVALPYL+Q+ GR
Sbjct  121   AVNYYGRVDHLVNTASLGHTFYFEEVSDTTVFPHLMDINFWGNVYPTYVALPYLQQTNGR  180

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             ++VNASVE+WLPLPRMSLYSAAKA LVN YETLRFE+   +GIT+ATHGWIG+EM RGK 
Sbjct  181   IVVNASVENWLPLPRMSLYSAAKAALVNFYETLRFELNEDVGITIATHGWIGSEMTRGKF  240

Query  973   MVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNV  1149
             M+EEGAEMQWKEEREV A  GP+E+FAK+IV+GACRGD YVK+P+WYD FLLYRVF+PNV
Sbjct  241   MLEEGAEMQWKEEREVSANGGPLEDFAKMIVAGACRGDPYVKFPNWYDVFLLYRVFTPNV  300

Query  1150  LNWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSP  1281
             L WTF+LL     +R +S +G G  + ++ SSS   L LE   P
Sbjct  301   LRWTFKLLLSTEGSRRSSLVGVGAGMPLDESSSQMKLMLEGGPP  344



>ref|XP_006289482.1| hypothetical protein CARUB_v10003016mg [Capsella rubella]
 gb|EOA22380.1| hypothetical protein CARUB_v10003016mg [Capsella rubella]
Length=389

 Score =   494 bits (1273),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 244/344 (71%), Positives = 286/344 (83%), Gaps = 1/344 (0%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             M+DL+NSV+NLV PPA++V++A AWP L FIS  E +YN Y+  E MEDKVVVITGASS 
Sbjct  1     MVDLLNSVMNLVAPPATMVVMAFAWPLLSFISFSERVYNSYFATENMEDKVVVITGASSA  60

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGEQIAYEYAKR ANLVLVARRE RLR +S  A+ +GA +V+I AADV+KE++CRRFI +
Sbjct  61    IGEQIAYEYAKRGANLVLVARREQRLRVVSNKAKQIGANHVIIIAADVIKEDDCRRFITQ  120

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
              +N+YGRVDHLVNTASLGHTFYFEE SDTTVFP LMDINFWGNVYPTYVALPYL+Q+ GR
Sbjct  121   AVNYYGRVDHLVNTASLGHTFYFEEVSDTTVFPHLMDINFWGNVYPTYVALPYLQQTNGR  180

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             ++VNASVE+WLPLPRMSLYSAAKA LVN YETLRFE+   +GIT+ATHGWIG+EM RGK 
Sbjct  181   IVVNASVENWLPLPRMSLYSAAKAALVNFYETLRFELNGDVGITIATHGWIGSEMTRGKF  240

Query  973   MVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNV  1149
             M+EEGAEMQWKEEREV A  GP+EEFAK+IV+GACRGD YVK+P+WYD FLLYRVF+PNV
Sbjct  241   MLEEGAEMQWKEEREVPANGGPLEEFAKMIVAGACRGDAYVKFPNWYDVFLLYRVFTPNV  300

Query  1150  LNWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSP  1281
             L WTF+LL     +R +S +G G  +  + SSS   L LE   P
Sbjct  301   LRWTFKLLLSTEGSRRSSLVGVGAGMPADESSSQMKLMLEGGPP  344



>gb|ACG69525.1| steroleosin SLO2-1 [Brassica napus]
Length=456

 Score =   497 bits (1280),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 243/344 (71%), Positives = 291/344 (85%), Gaps = 1/344 (0%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             M+DL+NSV+NLV PPA++V++A +WP LCFI+  E LYN Y+  E MEDKVVVITGAS  
Sbjct  1     MVDLLNSVMNLVAPPATMVVMAFSWPLLCFITFSERLYNSYFVTEDMEDKVVVITGASPA  60

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGEQIAYEYAKR ANLVLVARRE RLR +S NAR +GA +V+I AADVVKE++CRRFI +
Sbjct  61    IGEQIAYEYAKRGANLVLVARREQRLRVVSNNARQIGANHVIIIAADVVKEDDCRRFITQ  120

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
              +N+YGRVDHLVN+ASLGHTFYF+E SDTTVFP L+DINFWGNVYPTYVALP+L+++ GR
Sbjct  121   AVNYYGRVDHLVNSASLGHTFYFDEVSDTTVFPHLLDINFWGNVYPTYVALPHLQKTNGR  180

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             ++VNASVE+WLPLPRMSLYSAAKA LVN YETLRFE+   +GIT+ATHGWIG+EM+RGK 
Sbjct  181   IVVNASVENWLPLPRMSLYSAAKAALVNFYETLRFELNGDVGITIATHGWIGSEMSRGKF  240

Query  973   MVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNV  1149
             M+EEGAEMQWKEEREV A  GP+EEFAK+IV+GACRGD YVK+P+WYD FLLYRVF+PNV
Sbjct  241   MLEEGAEMQWKEEREVPANGGPLEEFAKMIVAGACRGDAYVKFPNWYDVFLLYRVFTPNV  300

Query  1150  LNWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSP  1281
             L WTF+LL  +  +R +S +G G+ +  E SSS   L LE  SP
Sbjct  301   LRWTFKLLLSSEGSRQSSLVGVGQGLPPEESSSQMKLMLEGGSP  344



>ref|XP_003538052.2| PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydroxysteroid dehydrogenase-like 
5-like [Glycine max]
Length=411

 Score =   495 bits (1275),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 248/370 (67%), Positives = 295/370 (80%), Gaps = 23/370 (6%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MD +N +LNL+VPP S++ LA +WP LCF++ CEWL N  YGE+ M++KVV+ITGASSGI
Sbjct  51    MDFLNFLLNLLVPPGSMITLAFSWPALCFLNFCEWLCNSIYGED-MDNKVVIITGASSGI  109

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYA RRANL LVARRE+RLR I+ENA+ LGA++V+I AADVVKE++CRRF+ ET
Sbjct  110   GEQIAYEYALRRANLTLVARREHRLRGIAENAKRLGARHVMIMAADVVKEDDCRRFVNET  169

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             IN +GRVDHLVNT SLGHTF FEEA+DT+VFP+L+DINFWGNVYPT+VALPYL QS GR+
Sbjct  170   INVFGRVDHLVNTVSLGHTFCFEEATDTSVFPVLLDINFWGNVYPTFVALPYLHQSNGRI  229

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             I+NASVESWLP+PRMSLY+AAKA LVN YETLRFE+ + +GIT+ATHGWIG+EM RGK M
Sbjct  230   IINASVESWLPMPRMSLYAAAKAALVNFYETLRFELKDEVGITIATHGWIGSEMTRGKFM  289

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +EEGAEMQWKEEREV  T GPVEEFA+LIVSGACRGD YVK+PSWYD FLLYRVF+P VL
Sbjct  290   LEEGAEMQWKEEREVQVTGGPVEEFARLIVSGACRGDAYVKFPSWYDVFLLYRVFAPRVL  349

Query  1153  NWTFRLLFDNLSARTT------SFIGTGRPITMEssssssPLRLEAPSP---AGRPVT--  1299
             NW FRLL      R          +G  RP+ M        L LE  SP   A  P+T  
Sbjct  350   NWAFRLLISPQGTRGAXSYVHIEAVGMVRPMAM--------LMLEGTSPTHNAIGPLTFS  401

Query  1300  --VLQQHKME  1323
               ++ QHK++
Sbjct  402   GQLISQHKLD  411



>ref|XP_010455398.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Camelina 
sativa]
Length=382

 Score =   494 bits (1272),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 243/344 (71%), Positives = 287/344 (83%), Gaps = 1/344 (0%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             M+DL+NSV+NLV PPA++V++A AWP L FIS  E +YN Y+  E MEDKVVVITGASS 
Sbjct  1     MVDLLNSVMNLVAPPATMVVMAFAWPLLSFISFSERVYNSYFATENMEDKVVVITGASSA  60

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGEQIAYEYAKR ANLVLVARRE RLR +S  A+ +GA +V+I AADV+KE++CRRFI +
Sbjct  61    IGEQIAYEYAKRGANLVLVARREQRLRVVSNKAKQIGANHVIIIAADVIKEDDCRRFITQ  120

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
              +N+YGRVDHLVNTASLGHTFYFEE SDTTVFP LMDINFWGNVYPTYVALPYL+Q+ GR
Sbjct  121   AVNYYGRVDHLVNTASLGHTFYFEEVSDTTVFPHLMDINFWGNVYPTYVALPYLQQTNGR  180

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             ++VNASVE+WLPLPRMSLYSAAKA LVN YETLRFE+   +GIT+ATHGWIG+EM RGK 
Sbjct  181   IVVNASVENWLPLPRMSLYSAAKAALVNFYETLRFELNEDVGITIATHGWIGSEMTRGKF  240

Query  973   MVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNV  1149
             M+EEGAEMQWKEEREV A  GP+EEFAK+IV+GACRGD YVK+P+W+D FLLYRVF+PNV
Sbjct  241   MLEEGAEMQWKEEREVPANGGPLEEFAKMIVAGACRGDPYVKFPNWHDVFLLYRVFTPNV  300

Query  1150  LNWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSP  1281
             L WTF+LL     +R +S +G G  + ++ SSS   L LE   P
Sbjct  301   LRWTFKLLLSTEGSRRSSLVGVGAGLPVDESSSQMKLMLEGGPP  344



>ref|XP_003610951.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Medicago 
truncatula]
 gb|AES93909.1| corticosteroid 11-beta-dehydrogenase [Medicago truncatula]
Length=371

 Score =   491 bits (1265),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 247/369 (67%), Positives = 297/369 (80%), Gaps = 15/369 (4%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MD +N +LNL VPPASL+ LA +WP LCF++ACEWL+N  YGE+ M+ KVV+ITGASS I
Sbjct  1     MDFLNFLLNLFVPPASLITLAFSWPALCFLNACEWLFNYNYGED-MDSKVVIITGASSAI  59

Query  436   GE-----QIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRR  600
             GE     QIAYEYA RRANL+LVARRE+RL  I+ENAR +GA++V+I AADVVKE++CRR
Sbjct  60    GEASCQNQIAYEYAIRRANLMLVARREHRLIGIAENARRMGARHVMIMAADVVKEDDCRR  119

Query  601   FILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQ  780
             F+ ETIN +GRVDHLVNT SLGHTFYFEE +DT+VFP+L+DINFWGNVYPT VALPYL Q
Sbjct  120   FVNETINVFGRVDHLVNTVSLGHTFYFEEVTDTSVFPVLLDINFWGNVYPTLVALPYLHQ  179

Query  781   SRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMA  960
             S GRVI+NASVESWLPLPRMSL+ AAKA LVN YETLRFE+ + +G+T+ATHGWIG+EM 
Sbjct  180   SNGRVIINASVESWLPLPRMSLFGAAKAALVNFYETLRFELKDEVGVTIATHGWIGSEMT  239

Query  961   RGKIMVEEGAEMQWKEEREVHATG-PVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVF  1137
             RGK M+EEGA+MQWKEERE+H +G  VEEFA+LIVSGACRGD YVK+PSWYD FLLYRVF
Sbjct  240   RGKFMLEEGADMQWKEEREMHVSGEAVEEFARLIVSGACRGDAYVKFPSWYDVFLLYRVF  299

Query  1138  SPNVLNWTFRLLFD-NLSARTTSFIGTGRPITMEssssssPLRLEAPSPAGR----PVTV  1302
             +PNVLNW FRLL     + R +S++GTGR +   +     P+ LE  SP       P+T 
Sbjct  300   APNVLNWAFRLLISPQGTRRFSSYLGTGRSLDTVTGGMGRPM-LEGTSPRHHTGMVPLTF  358

Query  1303  LQQ--HKME  1323
               Q  H+M+
Sbjct  359   SGQLSHQMQ  367



>ref|XP_010421918.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Camelina 
sativa]
Length=377

 Score =   489 bits (1260),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 243/349 (70%), Positives = 285/349 (82%), Gaps = 9/349 (3%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             M+DL+NSV+NLV PPA++V++A AWP L FIS  E +YN Y+  E MEDKVVVITGASS 
Sbjct  1     MVDLLNSVMNLVAPPATMVVMAFAWPLLSFISFSERVYNSYFATENMEDKVVVITGASSA  60

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGEQIAYEYAKR ANLVLVARRE RLR +S+ A+ +GA +V+I AADV+KE++CRRFI +
Sbjct  61    IGEQIAYEYAKRGANLVLVARREQRLRVVSDKAKQIGANHVIIIAADVIKEDDCRRFITQ  120

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
              +N+YGRVDHLVNTASLGHTFYFEE SDTTVFP LMDINFWGNVYPTYVALPYL+Q+ GR
Sbjct  121   AVNYYGRVDHLVNTASLGHTFYFEEVSDTTVFPHLMDINFWGNVYPTYVALPYLQQTNGR  180

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             ++VNASVE+WLPLPRMSLYSAAKA LVN YETLRFE+   +GIT+ATHGWIG+EM RGK 
Sbjct  181   IVVNASVENWLPLPRMSLYSAAKAALVNFYETLRFELNEDVGITIATHGWIGSEMTRGKF  240

Query  973   MVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNV  1149
             M+EEGAEMQWKEEREV A  GP+EEFAK+IV+GACRGD YVK+P+WYD FLLYRVF+PNV
Sbjct  241   MLEEGAEMQWKEEREVPANGGPLEEFAKMIVAGACRGDPYVKFPNWYDVFLLYRVFTPNV  300

Query  1150  LNWTFRLLFDNLSARTTSFIGTGRPI-----TMEssssssPLRLEAPSP  1281
             L WTF+LL   LS   +  +G G P+      M+      P R  A  P
Sbjct  301   LRWTFKLL---LSTEGSRRVGAGLPVDESSSQMKLMLEGGPPRFPASPP  346



>ref|XP_002872483.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH48742.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=382

 Score =   489 bits (1260),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 242/344 (70%), Positives = 285/344 (83%), Gaps = 1/344 (0%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             M+DL+NSV+NLV PPA++V++A AWP L FIS  E +YN Y+  E MEDKVVVITGASS 
Sbjct  1     MVDLLNSVMNLVAPPATMVVMAFAWPLLSFISFSERVYNSYFATENMEDKVVVITGASSA  60

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGEQIAYEYAKR ANLVLVARRE RLR +S  A+ +GA +V+I AADV+KE++C RFI +
Sbjct  61    IGEQIAYEYAKRGANLVLVARREQRLRVVSNKAKEIGANHVIIIAADVIKEDDCCRFITQ  120

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
              +N+YGRVDHLVNTASLGHTFYFEE SDTTVFP L+DINFWGNVYPTYVALPYL Q+ GR
Sbjct  121   AVNYYGRVDHLVNTASLGHTFYFEEVSDTTVFPHLLDINFWGNVYPTYVALPYLHQTNGR  180

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             ++VNASVE+WLPLPRMSLYSAAKA LVN YETLRFE+   +GIT+ATHGWIG+EM+RGK 
Sbjct  181   IVVNASVENWLPLPRMSLYSAAKAALVNFYETLRFELNGDVGITIATHGWIGSEMSRGKF  240

Query  973   MVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNV  1149
             M+EEGAEMQWKEEREV A  GP+EEFAK+IV+GACRGD YVK+P+WYD FLLYRVF+PNV
Sbjct  241   MLEEGAEMQWKEEREVPANGGPLEEFAKMIVAGACRGDAYVKFPNWYDVFLLYRVFTPNV  300

Query  1150  LNWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSP  1281
             L WTF+LL      R +S +G G  + ++ SSS   L LE   P
Sbjct  301   LRWTFKLLLSTEGTRRSSLVGVGSGMPVDESSSQMKLMLEGGPP  344



>ref|NP_192740.1| hydroxysteroid dehydrogenase 5 [Arabidopsis thaliana]
 sp|Q9T0G0.1|HSD5_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase-like 5; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase-like 5; AltName: 
Full=Hydroxysteroid dehydrogenase 5; Short=AtHSD5 [Arabidopsis 
thaliana]
 emb|CAB39626.1| putative oxidoreductase [Arabidopsis thaliana]
 emb|CAB78125.1| putative oxidoreductase [Arabidopsis thaliana]
 gb|AEE82830.1| hydroxysteroid dehydrogenase 5 [Arabidopsis thaliana]
Length=389

 Score =   490 bits (1261),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 242/344 (70%), Positives = 284/344 (83%), Gaps = 1/344 (0%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             M+DL+NSV+NLV PPA++V++A AWP L FIS  E  YN Y+  E MEDKVVVITGASS 
Sbjct  1     MVDLLNSVMNLVAPPATMVVMAFAWPLLSFISFSERAYNSYFATENMEDKVVVITGASSA  60

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGEQIAYEYAKR ANLVLVARRE RLR +S  A+ +GA +V+I AADV+KE++CRRFI +
Sbjct  61    IGEQIAYEYAKRGANLVLVARREQRLRVVSNKAKQIGANHVIIIAADVIKEDDCRRFITQ  120

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
              +N+YGRVDHLVNTASLGHTFYFEE SDTTVFP L+DINFWGNVYPTYVALPYL Q+ GR
Sbjct  121   AVNYYGRVDHLVNTASLGHTFYFEEVSDTTVFPHLLDINFWGNVYPTYVALPYLHQTNGR  180

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             ++VNASVE+WLPLPRMSLYSAAKA LVN YETLRFE+   +GIT+ATHGWIG+EM+ GK 
Sbjct  181   IVVNASVENWLPLPRMSLYSAAKAALVNFYETLRFELNGDVGITIATHGWIGSEMSGGKF  240

Query  973   MVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNV  1149
             M+EEGAEMQWKEEREV A  GP+EEFAK+IV+GACRGD YVK+P+WYD FLLYRVF+PNV
Sbjct  241   MLEEGAEMQWKEEREVPANGGPLEEFAKMIVAGACRGDAYVKFPNWYDVFLLYRVFTPNV  300

Query  1150  LNWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSP  1281
             L WTF+LL      R +S +G G  + ++ SSS   L LE   P
Sbjct  301   LRWTFKLLLSTEGTRRSSLVGVGSGMPVDESSSQMKLMLEGGPP  344



>ref|XP_002325513.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
 gb|EEE99894.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
Length=352

 Score =   488 bits (1255),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 229/313 (73%), Positives = 265/313 (85%), Gaps = 2/313 (1%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PPASLVMLA +WP LCFI+ CEWLY  +Y E  MEDKVV+ITGASSGIGEQIAYEYAKRR
Sbjct  13    PPASLVMLACSWPALCFINTCEWLYKSFYSEN-MEDKVVIITGASSGIGEQIAYEYAKRR  71

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
              NLVL+ARRE+RLR I E AR +GAK V+I AADVVKE++CRRF+ ETI+ +GRVDHLVN
Sbjct  72    VNLVLIARREHRLRGIREKARYIGAKQVMIMAADVVKEDDCRRFVNETISHFGRVDHLVN  131

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
             TASLGHTFYFEE  DT+V   L+DINFWGNVYPTYVALPY+ QS GRV+VNA+VESWLPL
Sbjct  132   TASLGHTFYFEEVGDTSVLKHLLDINFWGNVYPTYVALPYIHQSNGRVVVNAAVESWLPL  191

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
             PRMSLY+AAKA LVN YE+LRFEV   IGIT+ATHGWIG+EM RGK M E+GAEM WKEE
Sbjct  192   PRMSLYAAAKAALVNFYESLRFEVNGEIGITIATHGWIGSEMGRGKFMQEDGAEMLWKEE  251

Query  1012  REVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLS  1188
             REV+ T GPVE++A+ +VSGACRGD++VKYPSWYD FLLYR+F+P +LNWT R+L  +  
Sbjct  252   REVNGTGGPVEDYARRMVSGACRGDQFVKYPSWYDVFLLYRMFAPGLLNWTLRMLLASHG  311

Query  1189  ARTTSFIGTGRPI  1227
             +R  S  GT RPI
Sbjct  312   SRRMSLAGTERPI  324



>emb|CAN76088.1| hypothetical protein VITISV_028806 [Vitis vinifera]
Length=392

 Score =   482 bits (1241),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 252/365 (69%), Positives = 284/365 (78%), Gaps = 44/365 (12%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+NS+LNLVVPPASLVMLA AWP L FI+ACEW+YN  Y E  MEDKVV+ITGASSGI
Sbjct  1     MDLINSLLNLVVPPASLVMLAFAWPALSFINACEWVYNTLYSEN-MEDKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQ+AYEYAK+ A LVLVARRENRL  I ENAR LGAK+V+I AADVVK ++CRRF+ ET
Sbjct  60    GEQVAYEYAKKGAKLVLVARRENRLLGIGENARQLGAKHVMIMAADVVKLDDCRRFVTET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             +N+YGRVDHLVN ASLGHTFYFEEA DT+VFP LMDINFWGNVYPTYVALP+LRQS GRV
Sbjct  120   VNYYGRVDHLVNMASLGHTFYFEEAIDTSVFPPLMDINFWGNVYPTYVALPFLRQSNGRV  179

Query  796   IVNASVESWLPLPRMSLYS----------------------------------------A  855
             IVNASVE+WLPLPRMSLY+                                        A
Sbjct  180   IVNASVENWLPLPRMSLYARKRIGITIATHGWIGSDMTRGKFQYVGGWCLEMQWKEEREA  239

Query  856   AKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATGP  1035
             AKA L+N YETLRFE    +GIT+ATHGWIG++M RGK M+E+GAEMQWKEEREV   GP
Sbjct  240   AKAALINFYETLRFE-AKEVGITIATHGWIGSDMTRGKFMLEDGAEMQWKEEREVTG-GP  297

Query  1036  VEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFD-NLSARTTSFIG  1212
             VEEFA+L+V+GACRGD YVKYPSWYD FLLYRVF+PNVL WTFRLL   N + R+TS IG
Sbjct  298   VEEFARLMVAGACRGDAYVKYPSWYDIFLLYRVFAPNVLGWTFRLLLSTNGARRSTSLIG  357

Query  1213  TGRPI  1227
             TGRP+
Sbjct  358   TGRPL  362



>ref|XP_011036367.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Populus 
euphratica]
Length=353

 Score =   473 bits (1216),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 225/313 (72%), Positives = 263/313 (84%), Gaps = 3/313 (1%)
 Frame = +1

Query  295   PASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRA  474
             PASLVMLA +WP L FI+ CEWLY  +Y E+ MEDKVV+ITGASSGIGEQIAYEYAKR+ 
Sbjct  14    PASLVMLACSWPALRFINTCEWLYKSFYSED-MEDKVVIITGASSGIGEQIAYEYAKRKV  72

Query  475   NLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNT  654
             NLVL+ARRE+RLR I E AR +GAK V+I AADVVKE++CRRF+ ET++ +GRVDHLVNT
Sbjct  73    NLVLIARREHRLRGIREKARYIGAKQVMIMAADVVKEDDCRRFVNETVSHFGRVDHLVNT  132

Query  655   ASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLP  834
             ASLGH FYFEE  DT+V   L+DINFWGNVYPTYVALPY+ QS GRV+VNA+VESWLPLP
Sbjct  133   ASLGHIFYFEEVGDTSVLKHLLDINFWGNVYPTYVALPYIHQSNGRVVVNAAVESWLPLP  192

Query  835   RMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEER  1014
             RMSLY+AAKA LVN YE+LRFEV   IGIT+ATHGWIG+EM RGK M E+GAEM WKEER
Sbjct  193   RMSLYAAAKAALVNFYESLRFEVSGEIGITIATHGWIGSEMGRGKFMQEDGAEMLWKEER  252

Query  1015  EVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTF-LLYRVFSPNVLNWTFRLLFDNLS  1188
             E++ T GPVE++A+ +VSGACRGDEYVKYPSWYD F LLYR+F+P VLNWT R+L  +  
Sbjct  253   ELNGTGGPVEDYARRMVSGACRGDEYVKYPSWYDVFLLLYRMFAPGVLNWTLRMLLASPG  312

Query  1189  ARTTSFIGTGRPI  1227
             +R  S  GT RP+
Sbjct  313   SRRRSLAGTERPL  325



>ref|XP_008806995.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 isoform 
X1 [Phoenix dactylifera]
Length=336

 Score =   470 bits (1209),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 229/324 (71%), Positives = 278/324 (86%), Gaps = 10/324 (3%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+NS+LN VVPP S+VM+ALAWPTL F+ + EW+++  Y E  ME+KVVVITGASS I
Sbjct  1     MDLLNSILNFVVPPTSMVMMALAWPTLSFLHSVEWIFHSLYKEN-MENKVVVITGASSAI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQ+AYEYA+++ANLVLVA+RE RLR I ENARLLGAK V++ AADVVKEE+CRRFI ET
Sbjct  60    GEQLAYEYARKKANLVLVAKREQRLRGIRENARLLGAKQVIVIAADVVKEEDCRRFINET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             I+++G+++HLVN+ASLGHTF+FEEA+DT+VFP +MDINFWGNVYPTYVALPYLRQSRG++
Sbjct  120   ISYFGQLNHLVNSASLGHTFFFEEATDTSVFPHMMDINFWGNVYPTYVALPYLRQSRGQI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +VNASVESWLP+PRMSLY+AAKA L+N YETLRFE+ +++GIT+ATHGWIG E +RGK M
Sbjct  180   LVNASVESWLPMPRMSLYAAAKAALINFYETLRFEMKDAVGITIATHGWIGGETSRGKFM  239

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +EEGAEMQWKEERE   T G VEEFA+ +VSGACRG+ +VK+PSWYD FLLYRV  P+VL
Sbjct  240   IEEGAEMQWKEEREEPLTGGQVEEFARKMVSGACRGEAFVKHPSWYDIFLLYRVLIPDVL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRP  1224
              WTFRL+F N         GTG P
Sbjct  300   GWTFRLIFSN--------TGTGMP  315



>ref|XP_010910399.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 isoform 
X1 [Elaeis guineensis]
Length=342

 Score =   470 bits (1209),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 229/321 (71%), Positives = 276/321 (86%), Gaps = 2/321 (1%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDLVNS+LNLVVPP S+VM+ALAWPTL F+ A EW+++  Y E  ME+KVVVITGASS I
Sbjct  1     MDLVNSILNLVVPPTSMVMMALAWPTLSFLHAVEWIFHSLYREN-MENKVVVITGASSAI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQ+ YEYA+++ANLVLVARRE+RLR I ENARLLGAK VL+ AADVVKEE+CRRFI +T
Sbjct  60    GEQLVYEYARKKANLVLVARREHRLRGIRENARLLGAKQVLVIAADVVKEEDCRRFINDT  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             ++++G+++HLVN+ASLGHTF+FEEA+DT+VFP +MDINFWGNVYPTYVALPYLRQS GR+
Sbjct  120   VSYFGQLNHLVNSASLGHTFFFEEATDTSVFPHMMDINFWGNVYPTYVALPYLRQSHGRI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +VN SVESWLP+PRMSLY+AAKA L+N YETLRFE+ +++GIT+ATHGWIG E  RGK M
Sbjct  180   LVNTSVESWLPMPRMSLYAAAKAALINFYETLRFEMKDAVGITIATHGWIGGETGRGKFM  239

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +EEGAEMQWKEEREV  T G V EFA+ +VSGACRG+ YV++PSWYD FLLYRV  P+VL
Sbjct  240   IEEGAEMQWKEEREVPLTGGQVGEFARKMVSGACRGEAYVRHPSWYDIFLLYRVLIPDVL  299

Query  1153  NWTFRLLFDNLSARTTSFIGT  1215
              WTFRL+F     R  S +GT
Sbjct  300   GWTFRLIFSTRETRMPSLMGT  320



>gb|KDP45630.1| hypothetical protein JCGZ_17237 [Jatropha curcas]
Length=308

 Score =   466 bits (1200),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 224/312 (72%), Positives = 263/312 (84%), Gaps = 5/312 (2%)
 Frame = +1

Query  391   MEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAA  570
             MEDKVV++TGASSGIGEQIAYEYAKR+ANLVL+ARRE+RLR ISE AR +GAK+V I AA
Sbjct  1     MEDKVVIVTGASSGIGEQIAYEYAKRKANLVLIARREHRLRGISEKARQVGAKHVTIIAA  60

Query  571   DVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYP  750
             DVVKE++CRRF+ ETINFYGRVDHLVNTASLGHTFY EE +DT+VFP L+DINFWGNVYP
Sbjct  61    DVVKEDDCRRFVNETINFYGRVDHLVNTASLGHTFYMEEVTDTSVFPHLLDINFWGNVYP  120

Query  751   TYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVA  930
             T+VALPYL Q+ GR+IVNA++E+WLPLPRMSLY+AAKA L+N YETLRFE+ + IGIT+A
Sbjct  121   TFVALPYLHQTNGRIIVNAAIENWLPLPRMSLYAAAKAALINFYETLRFELNDDIGITIA  180

Query  931   THGWIGTEMARGKIMVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSW  1107
             THGWIG+EM+RGK  +EEGAEMQW EEREV A  GPVEE+AKLIVSGACRG+ YVK+PSW
Sbjct  181   THGWIGSEMSRGKFRIEEGAEMQWIEEREVQAAGGPVEEYAKLIVSGACRGNHYVKFPSW  240

Query  1108  YDTFLLYRVFSPNVLNWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSPAG  1287
             YD FLLYRVF+P+VLNW FRLL    SAR TS +GTGRP+       SSP +L     + 
Sbjct  241   YDVFLLYRVFAPSVLNWAFRLLLSGHSARRTSLVGTGRPMI----EGSSPRKLLTGPVSF  296

Query  1288  RPVTVLQQHKME  1323
                ++LQ  K+E
Sbjct  297   NNHSLLQMQKLE  308



>ref|XP_009387843.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Musa 
acuminata subsp. malaccensis]
Length=344

 Score =   466 bits (1198),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 233/347 (67%), Positives = 287/347 (83%), Gaps = 11/347 (3%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+N++LNLVVPPA +VMLA AWPTL F+ A EW +   Y E  M++KVV+ITGASS I
Sbjct  1     MDLLNAILNLVVPPAGMVMLAFAWPTLSFLHALEWFFKTLYREN-MDNKVVLITGASSAI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQ+AYEYA+R+ANLVLVARRE+RL  I ENARLLGAK+VL+ A+DVVKEEECRRFI +T
Sbjct  60    GEQLAYEYARRKANLVLVARREHRLWGIRENARLLGAKHVLVMASDVVKEEECRRFISDT  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             IN++G + HLVN ASLGH FYFEEA+D++VFP +MDINFWGNVYPTYVALPYLRQ+RGR+
Sbjct  120   INYFGHLHHLVNAASLGHNFYFEEATDSSVFPHMMDINFWGNVYPTYVALPYLRQTRGRI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +VNAS+ESWLP+PRMSLY+AAKA +++ YETLRFEV + +GIT+ATHGW G++++RGK M
Sbjct  180   LVNASMESWLPMPRMSLYAAAKAAVISFYETLRFEVKDDVGITIATHGWTGSDISRGKFM  239

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +EEG+EMQWKEEREV  T G VEEFAKL+V+GACRGD Y+K+P WYD F+LYRVF+P+VL
Sbjct  240   LEEGSEMQWKEEREVPLTGGHVEEFAKLMVAGACRGDTYLKHPRWYDIFMLYRVFAPDVL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSPAGRP  1293
              WTFRLL  +   + T     GRP+      +S P +L A SP G P
Sbjct  300   GWTFRLLLSDHRVKPT----IGRPL----LEASPPRKLSAFSP-GSP  337



>ref|XP_010927839.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 isoform 
X1 [Elaeis guineensis]
Length=342

 Score =   465 bits (1197),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 231/343 (67%), Positives = 278/343 (81%), Gaps = 14/343 (4%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+NS+L+ VVPP S+VM+A AWPTL F+ A EWL+   Y E  ME+KVVVITGASS I
Sbjct  1     MDLLNSILDFVVPPTSMVMMAFAWPTLSFLHAVEWLFRSLYKEN-MENKVVVITGASSAI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQ+AYEYA+++ANLVLVARRE RLR I ENARLLGAK VL+  ADVVKEE+CRRFI +T
Sbjct  60    GEQLAYEYARKKANLVLVARREQRLRGIRENARLLGAKQVLVIPADVVKEEDCRRFISDT  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             I+++G+++HLVN+ASLGHTF+FEEA DT+VFP +MD+NFWGNVYPTYVALPYLRQSRGR+
Sbjct  120   ISYFGQLNHLVNSASLGHTFFFEEAIDTSVFPHMMDVNFWGNVYPTYVALPYLRQSRGRI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +VNASVESWLP+P MSLY+AAKA ++N YETLRFEV +++GIT+ATHG +G E   GK+M
Sbjct  180   LVNASVESWLPMPGMSLYAAAKAAVINFYETLRFEVKDAVGITIATHGSVGGETRWGKLM  239

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +EEGAEMQWKEEREV    G +EEFAK +VSGACRG+ YVK+P WYD FLLYRV  P+VL
Sbjct  240   LEEGAEMQWKEEREVPLMGGQIEEFAKKMVSGACRGEAYVKHPCWYDIFLLYRVLVPDVL  299

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSP  1281
              WTFRLLF     R  S +GTG P+            L+AP P
Sbjct  300   GWTFRLLFSTRGTRVLSLMGTGPPL------------LDAPPP  330



>ref|XP_009408757.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Musa 
acuminata subsp. malaccensis]
Length=336

 Score =   441 bits (1134),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 206/300 (69%), Positives = 251/300 (84%), Gaps = 8/300 (3%)
 Frame = +1

Query  304   LVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLV  483
             +++LA AWPT+ F+ A EW +   Y E  ME+KVV+ITGASS IGEQ+AYEYA+R+ANLV
Sbjct  1     MIILAFAWPTISFLHALEWFFKTLYREN-MENKVVLITGASSAIGEQLAYEYARRKANLV  59

Query  484   LVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASL  663
             LVARRENRL  I ENARLLGAK+VL+ AADVVKEEECRRFI +TI+++G + HLVNTASL
Sbjct  60    LVARRENRLWGIRENARLLGAKHVLVMAADVVKEEECRRFISDTISYFGHLHHLVNTASL  119

Query  664   GHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMS  843
             GH FYFEEA+D  VFP +MDINFWGNVYPTYVALPYLRQ+RGR++V+AS+ESWLP+PRMS
Sbjct  120   GHNFYFEEATDPAVFPHMMDINFWGNVYPTYVALPYLRQTRGRILVDASMESWLPMPRMS  179

Query  844   LYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVH  1023
             LY+AAKA +VN YETLRFE+   +GIT+ATHGWIG++++RG+ M+EEGAEMQWKE+REV 
Sbjct  180   LYAAAKAAVVNFYETLRFELEEDVGITIATHGWIGSDVSRGRFMLEEGAEMQWKEDREVS  239

Query  1024  -------ATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFDN  1182
                    A G VEEFAKL+V+  CRG  + K+PSWYD FLLYRVF+P++L W FRLL  N
Sbjct  240   QLGIVRLAGGHVEEFAKLMVADVCRGYAHAKHPSWYDVFLLYRVFAPDILGWAFRLLLPN  299



>gb|KDO51722.1| hypothetical protein CISIN_1g039397mg [Citrus sinensis]
Length=349

 Score =   441 bits (1133),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 223/325 (69%), Positives = 264/325 (81%), Gaps = 17/325 (5%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+NS LNLVVPPASLVM+A AWP LCF++ CEWLYN +Y E  MEDKVV+ITGASS I
Sbjct  1     MDLLNSFLNLVVPPASLVMMAFAWPALCFVNGCEWLYNNFYSEN-MEDKVVIITGASSDI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQIAYEYAKR+ANLVLVARRENRL+  + +      +  L++  +  KE +        
Sbjct  60    GEQIAYEYAKRKANLVLVARRENRLQGSTIDEYNPINEVTLVSLNN--KESKA-------  110

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
                   VDHLVNTASLGHTF+FEE +DT++FP L+DINFWGNVYPT+VALPYL +S GRV
Sbjct  111   ------VDHLVNTASLGHTFFFEEVTDTSIFPRLLDINFWGNVYPTFVALPYLHESNGRV  164

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +VNASVE+WLPLPRMSLY++AKA LV  YE+LRFE+ + +GIT+ATHGWIG EM +GK M
Sbjct  165   VVNASVENWLPLPRMSLYASAKAALVTFYESLRFELNDEVGITIATHGWIGIEMTKGKFM  224

Query  976   VEEGAEMQWKEEREVH-ATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +E+GAEMQWKEEREVH A GPVE+FA+LIVSGACRGD YVK+PSWYD FLLYRVF+P+VL
Sbjct  225   LEDGAEMQWKEEREVHVAGGPVEDFARLIVSGACRGDTYVKFPSWYDVFLLYRVFAPHVL  284

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPI  1227
             NWTFRLL  +  AR TS IGTGRP+
Sbjct  285   NWTFRLLISSEGARRTSLIGTGRPL  309



>gb|ACF75106.1| Ste-b [Brassica napus]
Length=461

 Score =   445 bits (1144),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 227/352 (64%), Positives = 280/352 (80%), Gaps = 17/352 (5%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             M+DL+NSV+NLV PPA++V++A +WP LCFI+  E LYN Y+  E MEDKVVVITGASS 
Sbjct  1     MVDLLNSVMNLVAPPATMVVMAFSWPLLCFITFSERLYNSYFVTEDMEDKVVVITGASSA  60

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGEQIAYEYAKR ANLVLVARRE RLR +S NAR +GA +V+I AADVVKE++CRRFI +
Sbjct  61    IGEQIAYEYAKRGANLVLVARREQRLRVVSNNARQIGANHVIIIAADVVKEDDCRRFITQ  120

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSR--  786
              +N+YGRVDHLVN+ASLGHTFYF+E SDTTVFP L+DINFWGNVYPTYVALP+L++++  
Sbjct  121   AVNYYGRVDHLVNSASLGHTFYFDEVSDTTVFPHLLDINFWGNVYPTYVALPHLQKTQWP  180

Query  787   ------GRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIG  948
                   GR +  ++ +        SL+ AAKA LVN YETLRFE+   +GIT+ATHGWIG
Sbjct  181   DRCERIGRELAASTGDE-------SLF-AAKAALVNFYETLRFELNGDVGITIATHGWIG  232

Query  949   TEMARGKIMVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLL  1125
             +EM+RGK M+EEGAEMQWKEEREV A  GP+E+FAK+IV+GACRGD YVK+P+WYD FLL
Sbjct  233   SEMSRGKFMLEEGAEMQWKEEREVPANGGPLEDFAKMIVAGACRGDAYVKFPNWYDVFLL  292

Query  1126  YRVFSPNVLNWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSP  1281
             YRVF+PNVL WTF+ L  +  +R +S +G G+ + +E SSS   L LE  SP
Sbjct  293   YRVFTPNVLRWTFKPLLSSEGSRQSSLVGVGQGVLVEESSSQMKLMLEGGSP  344



>ref|XP_008806996.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 isoform 
X2 [Phoenix dactylifera]
Length=318

 Score =   432 bits (1110),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 216/324 (67%), Positives = 263/324 (81%), Gaps = 28/324 (9%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+NS+LN VVPP S+VM+ALAWPTL F+ + EW+++  Y E  ME+KVVVITGASS I
Sbjct  1     MDLLNSILNFVVPPTSMVMMALAWPTLSFLHSVEWIFHSLYKEN-MENKVVVITGASSAI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQ+AYEYA+++ANLVLVA+RE RLR I ENARLLGAK V++ AADVVKEE+CRRFI ET
Sbjct  60    GEQLAYEYARKKANLVLVAKREQRLRGIRENARLLGAKQVIVIAADVVKEEDCRRFINET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             I+++G+++HLVN+ASLGHTF+FEEA+DT+VFP +MDINFWGNVYPTYVALPYLRQSRG++
Sbjct  120   ISYFGQLNHLVNSASLGHTFFFEEATDTSVFPHMMDINFWGNVYPTYVALPYLRQSRGQI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +VNASVESWLP+PRMSLY+                  +++GIT+ATHGWIG E +RGK M
Sbjct  180   LVNASVESWLPMPRMSLYA------------------DAVGITIATHGWIGGETSRGKFM  221

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +EEGAEMQWKEERE   T G VEEFA+ +VSGACRG+ +VK+PSWYD FLLYRV  P+VL
Sbjct  222   IEEGAEMQWKEEREEPLTGGQVEEFARKMVSGACRGEAFVKHPSWYDIFLLYRVLIPDVL  281

Query  1153  NWTFRLLFDNLSARTTSFIGTGRP  1224
              WTFRL+F N         GTG P
Sbjct  282   GWTFRLIFSN--------TGTGMP  297



>ref|XP_006650876.1| PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydroxysteroid dehydrogenase-like 
5-like [Oryza brachyantha]
Length=340

 Score =   428 bits (1101),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 215/348 (62%), Positives = 261/348 (75%), Gaps = 25/348 (7%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PPAS+VMLA AWP L F+   EW+      E  M DKVV+ITGA+S IGEQIAYEYA+R 
Sbjct  14    PPASMVMLAFAWPALSFLRGVEWVVKTLTVEN-MHDKVVLITGAASAIGEQIAYEYARRN  72

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             ANLVLVARRE+RL AI E+AR LGA  VL+ AADVVKE++CRR + +TI+++G+++HLVN
Sbjct  73    ANLVLVARREHRLFAIRESARALGAGQVLVIAADVVKEDDCRRLVGDTISYFGQLNHLVN  132

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
             T SLGH F FEEA DT  FP LMD+NFWGNVYPTY ALPYLR+S GRV+VNA+VESWLP+
Sbjct  133   TVSLGHDFCFEEAGDTVAFPHLMDVNFWGNVYPTYAALPYLRRSHGRVVVNAAVESWLPM  192

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWK-E  1008
             PRMSLYSAAKA ++N YETLR+EVG+ +GI+VATHGWIG E   GK M+EEGAEMQWK E
Sbjct  193   PRMSLYSAAKAAVINFYETLRYEVGDEVGISVATHGWIGGEATGGKFMLEEGAEMQWKGE  252

Query  1009  EREVH-ATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFDNL  1185
             EREV  A G VE +A+++V+GACRGD +VK+PSWYD FL++R F+P+VL WTFRLL    
Sbjct  253   EREVPLAGGQVEAYARMVVAGACRGDAHVKHPSWYDVFLVFRAFAPDVLAWTFRLLLSTP  312

Query  1186  SARTTSFIGTGRPITMEssssssPLRLEAPSPAGRP--VTVLQQHKME  1323
             +          RP+            LE P PA  P     +QQHK+E
Sbjct  313   AP-------PARPL------------LEYP-PARSPGRAAAVQQHKLE  340



>ref|XP_010910406.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 isoform 
X2 [Elaeis guineensis]
Length=316

 Score =   426 bits (1096),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 208/285 (73%), Positives = 252/285 (88%), Gaps = 2/285 (1%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDLVNS+LNLVVPP S+VM+ALAWPTL F+ A EW+++  Y E  ME+KVVVITGASS I
Sbjct  1     MDLVNSILNLVVPPTSMVMMALAWPTLSFLHAVEWIFHSLYREN-MENKVVVITGASSAI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQ+ YEYA+++ANLVLVARRE+RLR I ENARLLGAK VL+ AADVVKEE+CRRFI +T
Sbjct  60    GEQLVYEYARKKANLVLVARREHRLRGIRENARLLGAKQVLVIAADVVKEEDCRRFINDT  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             ++++G+++HLVN+ASLGHTF+FEEA+DT+VFP +MDINFWGNVYPTYVALPYLRQS GR+
Sbjct  120   VSYFGQLNHLVNSASLGHTFFFEEATDTSVFPHMMDINFWGNVYPTYVALPYLRQSHGRI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +VN SVESWLP+PRMSLY+AAKA L+N YETLRFE+ +++GIT+ATHGWIG E  RGK M
Sbjct  180   LVNTSVESWLPMPRMSLYAAAKAALINFYETLRFEMKDAVGITIATHGWIGGETGRGKFM  239

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSW  1107
             +EEGAEMQWKEEREV  T G V EFA+ +VSGACRG+ YV++PSW
Sbjct  240   IEEGAEMQWKEEREVPLTGGQVGEFARKMVSGACRGEAYVRHPSW  284



>ref|XP_009797378.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 isoform 
X2 [Nicotiana sylvestris]
Length=312

 Score =   418 bits (1075),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 208/313 (66%), Positives = 235/313 (75%), Gaps = 46/313 (15%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PPASLVMLA AWP L FI+ CEWLYN ++G++ MEDKVV+ITGASSGIGEQIAYEYAKRR
Sbjct  13    PPASLVMLACAWPALTFINTCEWLYNTFFGDD-MEDKVVIITGASSGIGEQIAYEYAKRR  71

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
              NLVLVARRENRL  I E AR LGAKNVLITAADVVKE++CRRFI ET+NFYGRVDHLVN
Sbjct  72    TNLVLVARRENRLWGIREKARQLGAKNVLITAADVVKEDDCRRFITETVNFYGRVDHLVN  131

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
             T SLGHTFY EEA+DT VFPILM                                     
Sbjct  132   TVSLGHTFYLEEATDTNVFPILM-------------------------------------  154

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
                    AAKA ++N YETL+ EV + +GIT+ATHGWIGTE+ RGK+M++EGA+MQWKEE
Sbjct  155   -------AAKAAVINFYETLKLEVKDDVGITIATHGWIGTEITRGKLMMDEGADMQWKEE  207

Query  1012  REVHATG-PVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLS  1188
             REV A+G  VEEFAKLIV+GACRGD YVKYP WYD FLLYRVF+PNVL WTFR+LF +  
Sbjct  208   REVRASGSSVEEFAKLIVAGACRGDPYVKYPGWYDIFLLYRVFAPNVLQWTFRMLFAHQG  267

Query  1189  ARTTSFIGTGRPI  1227
             AR TSFIGT RP+
Sbjct  268   ARRTSFIGTARPL  280



>ref|NP_001051859.1| Os03g0842900 [Oryza sativa Japonica Group]
 gb|AAS07346.1| putative oxidoreductase [Oryza sativa Japonica Group]
 gb|AAT77030.1| putative steroleosin-B [Oryza sativa Japonica Group]
 gb|ABF99827.1| steroleosin-B, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13773.1| Os03g0842900 [Oryza sativa Japonica Group]
 gb|EAY92537.1| hypothetical protein OsI_14276 [Oryza sativa Indica Group]
Length=355

 Score =   418 bits (1075),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 197/294 (67%), Positives = 243/294 (83%), Gaps = 3/294 (1%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PPAS+VMLA AWPTL F+   EW+      E  M +KVV+ITGASS IGEQIAYEYA+R 
Sbjct  14    PPASMVMLAFAWPTLSFLRGVEWVVKTLTVEN-MHNKVVLITGASSAIGEQIAYEYARRN  72

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             ANLVLVARRE+RL A+ ENAR LGA  VL+ AADVVKE++CRR + +TI+F+G+++HLVN
Sbjct  73    ANLVLVARREHRLFAVRENARALGAGQVLVIAADVVKEDDCRRLVGDTISFFGQLNHLVN  132

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
             T SLGH F FEEA DT  FP LMD+NFWGNVYPTY ALPYLR+S GRV+VNA+VE WLP+
Sbjct  133   TVSLGHDFCFEEAGDTVAFPHLMDVNFWGNVYPTYAALPYLRRSHGRVVVNAAVEIWLPM  192

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWK-E  1008
             PRM+LYSAAKA +++ YE+LR+EVG+ +GI+VATHGWIG E + GK M+EEGAEMQWK E
Sbjct  193   PRMTLYSAAKAAVIDFYESLRYEVGDEVGISVATHGWIGGEASGGKFMLEEGAEMQWKGE  252

Query  1009  EREVH-ATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFR  1167
             EREV  A G VE +A+++V+GACRGD +VK+P+WYD FL++R F+P+VL WTFR
Sbjct  253   EREVPLAGGQVEAYARMVVAGACRGDAHVKHPNWYDVFLVFRAFAPDVLAWTFR  306



>gb|ABX82800.1| sterolesin-B [Brassica napus]
Length=253

 Score =   408 bits (1048),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 193/252 (77%), Positives = 222/252 (88%), Gaps = 1/252 (0%)
 Frame = +1

Query  328   PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             P LCFIS  E LYN Y+  E MEDKVVVITGASS IGEQIAYEYAKR ANLVLVARRE R
Sbjct  2     PLLCFISFTERLYNSYFVTEDMEDKVVVITGASSAIGEQIAYEYAKRGANLVLVARREQR  61

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             LR +S NAR +GA +V+I AADVVKE++CRRFI + +N+YGRVDHLVN+ASLGHTFYF+E
Sbjct  62    LRVVSNNARQIGANHVIIIAADVVKEDDCRRFITQAVNYYGRVDHLVNSASLGHTFYFDE  121

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
              SDTTVFP L+DINFWGNVYPTYVALP+LR++ GR++VNASVE+WLPLPRMSLYSAAKA 
Sbjct  122   VSDTTVFPHLLDINFWGNVYPTYVALPHLRKTNGRIVVNASVENWLPLPRMSLYSAAKAA  181

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHAT-GPVEE  1044
             LVN YETLRFE+   +GIT+ATHGWIG+EM+RGK M+EEGAEMQWKEEREV A  GP+E+
Sbjct  182   LVNFYETLRFELNGDVGITIATHGWIGSEMSRGKFMLEEGAEMQWKEEREVPANGGPLED  241

Query  1045  FAKLIVSGACRG  1080
             FAK+IV+GACRG
Sbjct  242   FAKMIVAGACRG  253



>ref|XP_007019843.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein isoform 2 
[Theobroma cacao]
 gb|EOY17068.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein isoform 2 
[Theobroma cacao]
Length=314

 Score =   409 bits (1052),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 220/363 (61%), Positives = 257/363 (71%), Gaps = 55/363 (15%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             MMDL++S LN +VPPAS+V+L  AWP LCF+ ACEWLYN  Y E  ++DKVV+ITGASSG
Sbjct  1     MMDLIDSFLNFLVPPASMVILFFAWPALCFVRACEWLYNTLYTENSIQDKVVIITGASSG  60

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGEQIAYEYA+RRANLVLVARRE+RLR ISE AR +GAKNV+I AADVVKE++CRRF+ E
Sbjct  61    IGEQIAYEYARRRANLVLVARREHRLRGISEKARHIGAKNVIIIAADVVKEDDCRRFVTE  120

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
             TINFYGRVDHLVN  SLGHTFYFEE +DT+VFP L+                        
Sbjct  121   TINFYGRVDHLVNAVSLGHTFYFEEVTDTSVFPHLL------------------------  156

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
                                 AAKA LVN YETLRFEV N +GIT+ATHGWIG EM RGK 
Sbjct  157   --------------------AAKAALVNFYETLRFEVNNEVGITIATHGWIGGEMTRGKF  196

Query  973   MVEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNV  1149
             M+EEGAEMQWKE+RE+  + G VEEFA+LIVSGACRGD YVKYPSW+DTFLLYR  +PNV
Sbjct  197   MLEEGAEMQWKEKREIAVSAGAVEEFARLIVSGACRGDAYVKYPSWHDTFLLYRAIAPNV  256

Query  1150  LNWTFRLLFDNLSARTTSFIGTGRPITMEs----sssssPLRLEAPSPAGRPVTVLQ-QH  1314
             LNW  RLL      R TS +G GR + +++    S S+SP++L    P G P+T  Q Q 
Sbjct  257   LNWMLRLLLSVHGTRRTSMMGVGRQLPVDAARYVSESTSPMKL----PTG-PITFSQPQQ  311

Query  1315  KME  1323
             KME
Sbjct  312   KME  314



>ref|XP_004981097.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5-like [Setaria 
italica]
Length=354

 Score =   409 bits (1051),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/304 (67%), Positives = 243/304 (80%), Gaps = 3/304 (1%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PPAS+VMLA AWPTL F+   EW+      E+++  KVVVITGASS IGEQIAYEYA+R 
Sbjct  14    PPASMVMLAFAWPTLSFLRGVEWVLKTLTKEDML-GKVVVITGASSAIGEQIAYEYARRN  72

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             ANLVLVARRE+RL AI +NARLLGA  VL+ AADVVKE++CRR + +T  ++G+++HLVN
Sbjct  73    ANLVLVARREHRLFAIRDNARLLGAGQVLVIAADVVKEDDCRRLVSDTFTYFGQLNHLVN  132

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
             T SLGH F FEEA DTT FP LMDINFWGNVYPTY ALPYLR+S GRV+VNASVESWLP+
Sbjct  133   TVSLGHDFNFEEAGDTTAFPHLMDINFWGNVYPTYAALPYLRRSHGRVVVNASVESWLPM  192

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEG-AEMQWKE  1008
             PRMSLYSAAKA +V+ YETLR+EV + +G+TVATHGW+G +   GK  +EEG AEMQWKE
Sbjct  193   PRMSLYSAAKAAVVDFYETLRYEVKDEVGVTVATHGWVGGDAGGGKFTLEEGAAEMQWKE  252

Query  1009  EREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFDNL  1185
             ERE   + G VE +A+ +V GACRGD YVK PSWYD FL++RVF+P+VL WTFRLL    
Sbjct  253   EREATLSGGQVEAYARALVGGACRGDAYVKRPSWYDVFLVFRVFAPDVLAWTFRLLLSTA  312

Query  1186  SART  1197
             +  T
Sbjct  313   APTT  316



>ref|NP_001145589.1| uncharacterized protein LOC100279063 [Zea mays]
 gb|ACG48762.1| hypothetical protein [Zea mays]
Length=377

 Score =   405 bits (1041),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 197/311 (63%), Positives = 241/311 (77%), Gaps = 17/311 (5%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PPAS+VMLA AWPTL F+   EW       E+++  KVVVITGASS IGEQIAYEYA+R 
Sbjct  14    PPASMVMLAFAWPTLSFLRGVEWTLKTLTKEDML-GKVVVITGASSAIGEQIAYEYARRN  72

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             ANLVLVARRE RL AI +NARLLGA +VL+ AADVVKE++CRR + +T++++G+++HLVN
Sbjct  73    ANLVLVARREQRLFAIRDNARLLGAGHVLVIAADVVKEDDCRRLVADTVSYFGQLNHLVN  132

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
             T SLGH F FEEA DTT FP LMDINFWGNVYPT+ ALPYLR+S GRV+VNASVESWLP+
Sbjct  133   TVSLGHDFSFEEAGDTTAFPHLMDINFWGNVYPTHAALPYLRRSHGRVVVNASVESWLPM  192

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMV------EEGA-  990
             PRMSLYSAAKA +V+ YETLR+EV   +G+TVATHGW+G +    K  +      +EGA 
Sbjct  193   PRMSLYSAAKAAVVDFYETLRYEVKEEVGVTVATHGWVGGDAGGSKFTLDQQQQHQEGAA  252

Query  991   --EMQWKE---EREVHAT----GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSP  1143
               ++QWK+   ERE  A     G VE +A+ +V+GACRGD YVK PSWYD FL++RVF+P
Sbjct  253   ADQVQWKQQQGEREAAAAALPGGHVEAYARALVAGACRGDAYVKRPSWYDVFLVFRVFAP  312

Query  1144  NVLNWTFRLLF  1176
             +VL WTFRLL 
Sbjct  313   DVLAWTFRLLL  323



>dbj|BAK05747.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   396 bits (1018),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 194/321 (60%), Positives = 234/321 (73%), Gaps = 12/321 (4%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PPAS+VMLA AWPTL F+ A EW       E+ M  KVV++TGASS IGEQ+AYEYA+R 
Sbjct  14    PPASMVMLAFAWPTLSFLRAIEWAVKALTKED-MRGKVVLVTGASSAIGEQVAYEYARRG  72

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             ANLVLVARRE+RL A+ ENAR LGA  VL+ AADVV+E++C R + +TI+++G++DHLVN
Sbjct  73    ANLVLVARREHRLFAVRENARALGAGQVLVVAADVVREDDCSRLVADTISYFGQLDHLVN  132

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
             T SLGH F FEEA DT  FP LMDINFWGNVYPTY ALPYLRQS GRV+VNASV++WLP+
Sbjct  133   TVSLGHDFLFEEAGDTAAFPHLMDINFWGNVYPTYAALPYLRQSHGRVVVNASVDTWLPM  192

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGA------E  993
             PRMSLYSAAKA +V+ YETLR+EV + +GITVATHGWI  E    +  +EE A      +
Sbjct  193   PRMSLYSAAKAAVVDFYETLRYEVKDEVGITVATHGWISGEPGASRFSLEENAGATDQPQ  252

Query  994   MQW-KEEREVHATGP----VEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNW  1158
              QW K E       P    VEE+A+ +V GACRGD  V+ P WYD F ++R F+P+VL W
Sbjct  253   QQWTKAETTTPLPAPGGQAVEEYARAVVDGACRGDARVRRPGWYDVFHVFRAFAPDVLGW  312

Query  1159  TFRLLFDNLSARTTSFIGTGR  1221
             TFRLL     A  T   GTGR
Sbjct  313   TFRLLLSTAPAPPTVAAGTGR  333



>gb|EEE60277.1| hypothetical protein OsJ_13325 [Oryza sativa Japonica Group]
Length=348

 Score =   385 bits (989),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/292 (62%), Positives = 231/292 (79%), Gaps = 6/292 (2%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PPAS+VMLA AWPTL F+   EW+      E  M +KVV+ITGASS IGEQIAYEYA+R 
Sbjct  14    PPASMVMLAFAWPTLSFLRGVEWVVKTLTVEN-MHNKVVLITGASSAIGEQIAYEYARRN  72

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             ANLVLVARRE+RL A+ ENAR LGA  VL+ AADVVKE++CRR + +TI+F+G+++HLVN
Sbjct  73    ANLVLVARREHRLFAVRENARALGAGQVLVIAADVVKEDDCRRLVGDTISFFGQLNHLVN  132

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
             T SLGH F FEEA DT  FP LMD+NFWGNVYPTY ALPYLR+S GRV+VNA+VE WLP+
Sbjct  133   TVSLGHDFCFEEAGDTVAFPHLMDVNFWGNVYPTYAALPYLRRSHGRVVVNAAVEIWLPM  192

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
             PRM+LYSAAKA +++ YE+LR+EVG+ +GI+VATHGWIG E + G++     A  + ++ 
Sbjct  193   PRMTLYSAAKAAVIDFYESLRYEVGDEVGISVATHGWIGGEASGGQVH----ARGRRRDA  248

Query  1012  REVHATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFR  1167
              E      VE +A+++V+GACRGD +VK+P+WYD FL++R F+P+VL WTFR
Sbjct  249   ME-RGGARVEAYARMVVAGACRGDAHVKHPNWYDVFLVFRAFAPDVLAWTFR  299



>ref|XP_002463543.1| hypothetical protein SORBIDRAFT_01g001700 [Sorghum bicolor]
 gb|EER90541.1| hypothetical protein SORBIDRAFT_01g001700 [Sorghum bicolor]
Length=364

 Score =   384 bits (987),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 197/308 (64%), Positives = 236/308 (77%), Gaps = 14/308 (5%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PPAS+VMLA AWPTL F+   EW       E+++  KVVVITGASS IGEQIAYEYA+R 
Sbjct  14    PPASMVMLAFAWPTLSFLRGVEWALKTLTKEDML-GKVVVITGASSAIGEQIAYEYARRN  72

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             ANLVLVARRE RL  I +NAR LGA  VL+ AADVVKEE+CRR + +T++++G+++HLVN
Sbjct  73    ANLVLVARREQRLFGIRDNARQLGAGQVLVIAADVVKEEDCRRLVADTVSYFGQLNHLVN  132

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
             T SL H F FEEA DTT FP LMDINFWGNVYPTY ALPYLR+S GRV+VNASVESWLP+
Sbjct  133   TVSLSHDFSFEEAGDTTAFPHLMDINFWGNVYPTYAALPYLRRSHGRVVVNASVESWLPM  192

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMV----EEGAE--  993
             PRMSLYSAAKA +V+ YETLR+EV + +G+TVATHGW+G +   GK  +    +EGA   
Sbjct  193   PRMSLYSAAKAAVVDFYETLRYEVKDEVGVTVATHGWVGGDAGGGKFTLDHHHQEGAAEV  252

Query  994   MQWK-EEREVHAT------GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
              QWK EERE  A         VE +A+ +V+GACRGD YVK PSWYD FL++RVF+P+VL
Sbjct  253   QQWKQEEREAAAAAALPGGAHVEAYARALVAGACRGDAYVKRPSWYDVFLVFRVFAPDVL  312

Query  1153  NWTFRLLF  1176
              WTFRLL 
Sbjct  313   AWTFRLLL  320



>ref|XP_010927840.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 isoform 
X2 [Elaeis guineensis]
Length=298

 Score =   360 bits (923),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 193/343 (56%), Positives = 235/343 (69%), Gaps = 58/343 (17%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+NS+L+ VVPP S+VM+A AWPTL F+ A EWL+   Y E  ME+KVVVITGASS I
Sbjct  1     MDLLNSILDFVVPPTSMVMMAFAWPTLSFLHAVEWLFRSLYKEN-MENKVVVITGASSAI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQ+AYEYA+++ANLVLVARRE RLR I ENARLLGAK VL+  ADVVKEE+CRRFI +T
Sbjct  60    GEQLAYEYARKKANLVLVARREQRLRGIRENARLLGAKQVLVIPADVVKEEDCRRFISDT  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             I+++G+++HLVN+ASLGHTF+FEEA DT+VFP +M                         
Sbjct  120   ISYFGQLNHLVNSASLGHTFFFEEAIDTSVFPHMM-------------------------  154

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
                                AAKA ++N YETLRFEV +++GIT+ATHG +G E   GK+M
Sbjct  155   -------------------AAKAAVINFYETLRFEVKDAVGITIATHGSVGGETRWGKLM  195

Query  976   VEEGAEMQWKEEREVHAT-GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVL  1152
             +EEGAEMQWKEEREV    G +EEFAK +VSGACRG+ YVK+P WYD FLLYRV  P+VL
Sbjct  196   LEEGAEMQWKEEREVPLMGGQIEEFAKKMVSGACRGEAYVKHPCWYDIFLLYRVLVPDVL  255

Query  1153  NWTFRLLFDNLSARTTSFIGTGRPITMEssssssPLRLEAPSP  1281
              WTFRLLF     R  S +GTG P+            L+AP P
Sbjct  256   GWTFRLLFSTRGTRVLSLMGTGPPL------------LDAPPP  286



>ref|XP_008347866.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Malus 
domestica]
Length=279

 Score =   348 bits (892),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 166/236 (70%), Positives = 193/236 (82%), Gaps = 8/236 (3%)
 Frame = +1

Query  526   NARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTV  705
             NA+ L  K    T  DV    +C     ETI+F+GRVDHLVNT SLGHTFYFEE +DT+V
Sbjct  17    NAKFL--KKYHPTLWDVRDLSKC-----ETISFHGRVDHLVNTVSLGHTFYFEEVTDTSV  69

Query  706   FPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYE  885
             FP+L+DINFWGNVYPTYVALPYLR++ G++IVNASVESWLPLPRMSLY+AAKA LVN YE
Sbjct  70    FPLLLDINFWGNVYPTYVALPYLRRTNGKIIVNASVESWLPLPRMSLYAAAKAALVNFYE  129

Query  886   TLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHAT-GPVEEFAKLIV  1062
             TLR EV + +GIT+ATHGWIG+EM RGK M+EEGAEMQWKEEREVH   GPVE+FA+LIV
Sbjct  130   TLRLEVNHEVGITIATHGWIGSEMTRGKFMLEEGAEMQWKEEREVHVIGGPVEDFARLIV  189

Query  1063  SGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLSARTTSFIGTGRPIT  1230
             +GAC+GD YVKYPSWYD FLLYRVF PN+L+WTFRL+      R TS +GTG PI+
Sbjct  190   AGACQGDSYVKYPSWYDIFLLYRVFVPNILHWTFRLILPTHGGRRTSLVGTGGPIS  245



>ref|XP_003562566.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Brachypodium 
distachyon]
Length=392

 Score =   340 bits (872),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 171/327 (52%), Positives = 223/327 (68%), Gaps = 33/327 (10%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PPA++V LA AWPTL F+ A EW       E++   KVV++TGASS +GEQ+AYEYA+R 
Sbjct  14    PPATMVTLAFAWPTLTFLRAAEWAVKTLTQEDV-RGKVVLVTGASSAVGEQVAYEYARRG  72

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A+LVL ARRE RL A+ + AR LGA +VL+ AADVV++++CRR + +T+ + G++DHLVN
Sbjct  73    AHLVLAARREQRLFAVRDRARALGAGHVLVVAADVVRDDDCRRLVADTVAYLGQLDHLVN  132

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
               SLGH F+FE+A DT  F  LMDINFWGNVYPTY ALPYLR SRGRV+VNA+V++W+P+
Sbjct  133   AVSLGHDFFFEDAGDTAAFNHLMDINFWGNVYPTYAALPYLRLSRGRVVVNAAVDTWMPM  192

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATH-GW---------IGTEMARGKIMVE  981
             PRMSLYSAAKA +V+ YETLR+E+ + +GITVATH GW         I    A G+   E
Sbjct  193   PRMSLYSAAKAAVVDFYETLRYELKDDVGITVATHGGWMSAGDSASTISISGAGGRFTPE  252

Query  982   EGA-----EMQWKEEREVHATGPVE----------------EFAKLIVSGACRGDEYVKY  1098
             EG      +   K++RE  A   +                  +A+ +V GACRGD  V+ 
Sbjct  253   EGGASPETQQYGKQQREAAAAASLPILPPPEQALAQAAEEARYARAVVDGACRGDARVRR  312

Query  1099  P-SWYDTFLLYRVFSPNVLNWTFRLLF  1176
             P SW D FL++R F+P+VL WTFRLL 
Sbjct  313   PASWRDVFLVFRAFAPDVLGWTFRLLL  339



>gb|EMS48748.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Triticum 
urartu]
Length=266

 Score =   327 bits (839),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 183/225 (81%), Gaps = 1/225 (0%)
 Frame = +1

Query  292  PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
            PPAS+VMLA AWPTL F+ A EW       E+ M  KVV++TGASS IGEQ+AYEYA+R 
Sbjct  14   PPASMVMLAFAWPTLAFLRALEWAVKALTKED-MRGKVVLVTGASSAIGEQVAYEYARRG  72

Query  472  ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
            ANLVLVARRE+RL A+ ENAR LGA  VL+ AADVV+E++C R + +TI+++G++DHLVN
Sbjct  73   ANLVLVARREHRLFAVRENARALGAGQVLVVAADVVREDDCGRLVADTISYFGQLDHLVN  132

Query  652  TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
            T SLGH F FEEA DT  FP LMDINFWGNVYPTY ALPYLRQS GRV+VNASV++WLP+
Sbjct  133  TVSLGHDFLFEEAGDTAAFPHLMDINFWGNVYPTYAALPYLRQSHGRVVVNASVDTWLPM  192

Query  832  PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARG  966
            PRMSLYSAAKA +V+ YETLR+EV + +GITVATHGWIG E   G
Sbjct  193  PRMSLYSAAKAAVVDFYETLRYEVKDEVGITVATHGWIGGEPGAG  237



>ref|XP_002966954.1| hypothetical protein SELMODRAFT_87233 [Selaginella moellendorffii]
 gb|EFJ31553.1| hypothetical protein SELMODRAFT_87233 [Selaginella moellendorffii]
Length=347

 Score =   328 bits (840),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 162/312 (52%), Positives = 224/312 (72%), Gaps = 7/312 (2%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDLV   LNLVVPP  L  LALAWP L F++AC W  +  + E +   KVVV+TGA+SGI
Sbjct  1     MDLVQFFLNLVVPPTGLFFLALAWPPLTFMNACHWFLSFVFRENV-RGKVVVVTGATSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE+++YEYA   A L+LV  +E  LR ++   + +GA +V I  AD+  EEEC+RF+ ET
Sbjct  60    GEKLSYEYASHGAKLILVGNQEGLLRDVAGKCQRIGAMDVRIVTADLGHEEECKRFVEET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             ++ +GR+DHLVN A + H++ FEEA D + F  +MD+ FWG+VYPTY ALP+L++S G+V
Sbjct  120   VHQFGRLDHLVNNAGIMHSYLFEEAVDVSSFQSIMDVTFWGSVYPTYYALPHLKRSGGKV  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +VN+SV +WLP+PR+++Y+AA+A L+NL++TLR EVGNS+GIT+AT GW+ +E+ RGK +
Sbjct  180   VVNSSVSAWLPMPRLAIYNAAEAALLNLFDTLRVEVGNSVGITIATPGWVESEITRGKFV  239

Query  976   VEEGAEMQWKEEREVHATGPV-----EEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFS  1140
               EG  +   + R+V   GPV     EE AK I SG  RG  YV+ PSWY   LLYR+F+
Sbjct  240   SAEGEHVTMPDLRDV-TVGPVPVTYAEECAKAIFSGTVRGARYVRVPSWYGVTLLYRIFA  298

Query  1141  PNVLNWTFRLLF  1176
             P ++ WT+RLLF
Sbjct  299   PELIEWTYRLLF  310



>ref|XP_002994525.1| hypothetical protein SELMODRAFT_138761 [Selaginella moellendorffii]
 gb|EFJ04409.1| hypothetical protein SELMODRAFT_138761 [Selaginella moellendorffii]
Length=347

 Score =   328 bits (840),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 162/312 (52%), Positives = 224/312 (72%), Gaps = 7/312 (2%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDLV   LNLVVPP  L  LALAWP L F++AC W  +  + E +   KVVV+TGA+SGI
Sbjct  1     MDLVQFFLNLVVPPMGLFFLALAWPPLTFMNACHWFLSFVFRENV-RGKVVVVTGATSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE+++YEYA   A L+LV  +E  LR ++   + +GA +V I  AD+  EEEC+RF+ ET
Sbjct  60    GEKLSYEYASHGAKLILVGNQEGLLRDVAGKCQRIGAMDVRIVTADLGHEEECKRFVEET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             ++ +GR+DHLVN A + H++ FEEA D + F  +MD+ FWG+VYPTY ALP+L++S G+V
Sbjct  120   VHQFGRLDHLVNNAGIMHSYLFEEAVDVSSFQSIMDVTFWGSVYPTYYALPHLKRSGGKV  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +VN+SV +WLP+PR+++Y+AA+A L+NL++TLR EVGNS+GIT+AT GW+ +E+ RGK +
Sbjct  180   VVNSSVSAWLPMPRLAIYNAAEAALLNLFDTLRVEVGNSVGITIATPGWVESEITRGKFI  239

Query  976   VEEGAEMQWKEEREVHATGPV-----EEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFS  1140
               EG  +   + R+V   GPV     EE AK I SG  RG  YV+ PSWY   LLYR+F+
Sbjct  240   SAEGEHVTMPDLRDV-TVGPVPVTYAEECAKAIFSGTVRGARYVRVPSWYGVTLLYRIFA  298

Query  1141  PNVLNWTFRLLF  1176
             P ++ WT+RLLF
Sbjct  299   PELIEWTYRLLF  310



>ref|XP_006836805.1| hypothetical protein AMTR_s00099p00028560 [Amborella trichopoda]
 gb|ERM99658.1| hypothetical protein AMTR_s00099p00028560 [Amborella trichopoda]
Length=223

 Score =   317 bits (813),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 193/221 (87%), Gaps = 1/221 (0%)
 Frame = +1

Query  256  MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
            MDL+NS+L+LVVPPA L MLA AWP+L F+ ACE +Y+ ++ E  M++KVV++TGASSGI
Sbjct  1    MDLLNSLLDLVVPPAGLAMLAFAWPSLSFLHACEGVYHYFFSEN-MDNKVVIVTGASSGI  59

Query  436  GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
            GEQIAYEYAKR ANLVLVAR+E+RL  I ENAR LGA++V + AADVVKEE+CRRF+ ET
Sbjct  60   GEQIAYEYAKRGANLVLVARKEDRLWGIEENARALGARHVTVKAADVVKEEDCRRFVDET  119

Query  616  INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
            IN +G ++HLVNTASLGHTF+FEEA+DT+VFP +MDINFWGNVYPTY ALP+LR+S+GR+
Sbjct  120  INQFGHLNHLVNTASLGHTFFFEEATDTSVFPHMMDINFWGNVYPTYFALPHLRRSKGRI  179

Query  796  IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIG  918
            +VNASVESWLP+PRMSLY+AAKA ++N YETLRFE    +G
Sbjct  180  VVNASVESWLPMPRMSLYAAAKAAVLNFYETLRFEGKVHVG  220



>gb|EMT32988.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Aegilops 
tauschii]
Length=277

 Score =   302 bits (773),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 183/239 (77%), Gaps = 4/239 (2%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PPAS+VMLA AWPTL F+ A EW       E+ M  KVV++TGASS IGEQ+AYEYA+R 
Sbjct  14    PPASMVMLAFAWPTLSFLRALEWALKALTKED-MRGKVVLVTGASSAIGEQVAYEYARRG  72

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             ANLVLVARRE+RL A+ ENAR LGA +VL+ AADVV+E++C R + +TI+++G++DHLVN
Sbjct  73    ANLVLVARREHRLFAVRENARALGAGHVLVVAADVVREDDCGRLVADTISYFGQLDHLVN  132

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
             T SLGH F FEEA DT  FP LMDINFWGNVYPTY ALPYLRQS GRV+VNASV++WLP+
Sbjct  133   TVSLGHDFLFEEAGDTAAFPHLMDINFWGNVYPTYAALPYLRQSHGRVVVNASVDTWLPM  192

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI-MVEEGAEMQWK  1005
             PRMSLYSAAKA +V+ YETLR+EV +   I V    W+ + M R  +     G ++Q K
Sbjct  193   PRMSLYSAAKAAVVDFYETLRYEVKDEY-IKVVVPEWL-SGMTRNHVGFARAGPQLQNK  249



>ref|XP_008811369.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Phoenix 
dactylifera]
Length=330

 Score =   302 bits (773),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 156/320 (49%), Positives = 213/320 (67%), Gaps = 5/320 (2%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+   +NL  PP  L  L    P L F        +  + E+++  KVV+ITGASSGI
Sbjct  1     MDLITKFMNLFAPPTLLTALFFLLPPLYFFKLFLSFISSLFPEDMLH-KVVLITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GEQ+AY+YAK+ A LVLVARRE+ L  +++ A+ LG+ +VL+  ADV K EECRRFI   
Sbjct  60    GEQMAYQYAKKGACLVLVARRESSLLEVAKRAQELGSPDVLVLPADVAKPEECRRFIDAA  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             I+ +GR+DHLVN A + +   FEEA D T F  +MD+NFWG++YPTY ALP+L+Q+RGR+
Sbjct  120   ISHFGRLDHLVNNAGIANLCMFEEAEDVTNFTPVMDVNFWGSIYPTYFALPHLKQTRGRI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +VN+S   WLP+PRMS Y+A+KA L+N +ETLR E G+ IGIT+AT  WI +EM +GK +
Sbjct  180   VVNSSSAGWLPMPRMSFYNASKAALINFFETLRIEFGHEIGITIATPWWIESEMTQGKFL  239

Query  976   VEEGAEMQWKEEREVHA----TGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSP  1143
              +EG  +  +E R++       G  +   K IV+GACRGD YV  PSW+    L+RVF+P
Sbjct  240   SKEGKMVVDQELRDIQVGLFLVGYSDGCTKAIVNGACRGDRYVTEPSWFKMLYLWRVFAP  299

Query  1144  NVLNWTFRLLFDNLSARTTS  1203
              VL+W +  L+       TS
Sbjct  300   EVLDWLYHFLYVTKPGTPTS  319



>ref|XP_011015818.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5, partial 
[Populus euphratica]
Length=198

 Score =   296 bits (758),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 161/186 (87%), Gaps = 1/186 (1%)
 Frame = +1

Query  295  PASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRA  474
            PASLVMLA +WP L FI+ CEWLY  +Y E+ MEDKVV+ITGASSGIGEQIAYEYAKR+ 
Sbjct  14   PASLVMLACSWPALRFINTCEWLYKSFYSED-MEDKVVIITGASSGIGEQIAYEYAKRKV  72

Query  475  NLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNT  654
            NLVL+ARRE+RLR I E AR +GAK V+I AADVVKE++CRRF+ ET++ +GRVDHLVNT
Sbjct  73   NLVLIARREHRLRGIREKARYIGAKQVMIMAADVVKEDDCRRFVNETVSHFGRVDHLVNT  132

Query  655  ASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLP  834
            ASLGH FYFEE  DT+V   L+DINFWGNVYPTYVALPY+ QS GRV+VNA+VESWLPLP
Sbjct  133  ASLGHIFYFEEVGDTSVLKHLLDINFWGNVYPTYVALPYIHQSNGRVVVNAAVESWLPLP  192

Query  835  RMSLYS  852
            RMSLY+
Sbjct  193  RMSLYA  198



>ref|XP_010929561.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X2 [Elaeis guineensis]
Length=389

 Score =   301 bits (772),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/277 (53%), Positives = 199/277 (72%), Gaps = 4/277 (1%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E M  KVV+ITGASSGIGEQ+AY+YAK+ A LVLVARRE+ L  +++ A+ LG+ +VL+ 
Sbjct  43    EDMLHKVVLITGASSGIGEQMAYQYAKKGACLVLVARRESSLLEVAKRAQELGSPDVLVL  102

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
              ADV K EECRRFI  T++ +GR+DHLVN A + +   FEEA D T F  ++D+NFWG++
Sbjct  103   PADVAKPEECRRFIDATLSHFGRLDHLVNNAGIANLCMFEEAEDVTNFMPVLDVNFWGSI  162

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             YPTY ALP+L+Q+RGR++VN+S   WLP+PRMS Y+A+KA L+N +ETLR E G+ IGIT
Sbjct  163   YPTYFALPHLKQTRGRIVVNSSSSGWLPMPRMSFYNASKAALINFFETLRIEFGHEIGIT  222

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEEREVH-ATGPV---EEFAKLIVSGACRGDEYV  1092
             +AT GWI +EM +GK + +EG  +  +E R+V     PV   E+ AK IV+ ACRGD YV
Sbjct  223   IATPGWIESEMTQGKFLSKEGRMVVDQELRDVQVGLFPVSYSEDCAKAIVNSACRGDRYV  282

Query  1093  KYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLSARTTS  1203
               PSW+    L+RVF+P VL+W +  ++       TS
Sbjct  283   IEPSWFKGLYLWRVFAPEVLDWLYHFVYVTKPGTPTS  319



>ref|XP_010929560.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X1 [Elaeis guineensis]
Length=390

 Score =   301 bits (772),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 147/277 (53%), Positives = 199/277 (72%), Gaps = 4/277 (1%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E M  KVV+ITGASSGIGEQ+AY+YAK+ A LVLVARRE+ L  +++ A+ LG+ +VL+ 
Sbjct  43    EDMLHKVVLITGASSGIGEQMAYQYAKKGACLVLVARRESSLLEVAKRAQELGSPDVLVL  102

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
              ADV K EECRRFI  T++ +GR+DHLVN A + +   FEEA D T F  ++D+NFWG++
Sbjct  103   PADVAKPEECRRFIDATLSHFGRLDHLVNNAGIANLCMFEEAEDVTNFMPVLDVNFWGSI  162

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             YPTY ALP+L+Q+RGR++VN+S   WLP+PRMS Y+A+KA L+N +ETLR E G+ IGIT
Sbjct  163   YPTYFALPHLKQTRGRIVVNSSSSGWLPMPRMSFYNASKAALINFFETLRIEFGHEIGIT  222

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEEREVH-ATGPV---EEFAKLIVSGACRGDEYV  1092
             +AT GWI +EM +GK + +EG  +  +E R+V     PV   E+ AK IV+ ACRGD YV
Sbjct  223   IATPGWIESEMTQGKFLSKEGRMVVDQELRDVQVGLFPVSYSEDCAKAIVNSACRGDRYV  282

Query  1093  KYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLSARTTS  1203
               PSW+    L+RVF+P VL+W +  ++       TS
Sbjct  283   IEPSWFKGLYLWRVFAPEVLDWLYHFVYVTKPGTPTS  319



>ref|XP_006844627.1| hypothetical protein AMTR_s00016p00227990 [Amborella trichopoda]
 gb|ERN06302.1| hypothetical protein AMTR_s00016p00227990 [Amborella trichopoda]
Length=348

 Score =   296 bits (758),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 146/300 (49%), Positives = 203/300 (68%), Gaps = 7/300 (2%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PP ++V L+L +PT   +    +L +    ++ M  KVV+ITGASSGIGE +AY+YAKR 
Sbjct  13    PPTAIVFLSLCYPTYATLKLFLYLISPILADD-MRGKVVLITGASSGIGEHMAYQYAKRG  71

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A LVL+ARRE  L+ ++E AR LG+ +V++  ADV + +EC+RFI ETIN +GR+DHLVN
Sbjct  72    ARLVLIARREQSLQEVAEKARSLGSPDVIVVHADVTRVDECKRFIDETINHFGRLDHLVN  131

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
              A +     FEE +D T    +MD+NFWG+VYPTY A+P+LR+ RG+++ NAS   WLP 
Sbjct  132   NAGIVSLCMFEEVTDITKLEPVMDVNFWGSVYPTYYAIPHLRKVRGKIVANASAAGWLPT  191

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
              RMS+Y+A+KA ++N ++TLR EVG  IGIT+AT GWI +EM RGK + +EG  +  +E 
Sbjct  192   ARMSIYNASKAAMINFFDTLRMEVGPEIGITIATPGWIESEMTRGKFLNKEGEMVVNEET  251

Query  1012  REVHATGPV-----EEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             REV   GP+     +  A+ IV GAC GD  V  P W+     YR+  P V+ W +RLL+
Sbjct  252   REVQ-VGPMPIGYTQGCAEAIVKGACIGDRNVTEPFWFRVMFWYRLLVPEVMEWCYRLLY  310



>ref|XP_010929562.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X3 [Elaeis guineensis]
Length=349

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/268 (53%), Positives = 193/268 (72%), Gaps = 4/268 (1%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E M  KVV+ITGASSGIGEQ+AY+YAK+ A LVLVARRE+ L  +++ A+ LG+ +VL+ 
Sbjct  43    EDMLHKVVLITGASSGIGEQMAYQYAKKGACLVLVARRESSLLEVAKRAQELGSPDVLVL  102

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
              ADV K EECRRFI  T++ +GR+DHLVN A + +   FEEA D T F  ++D+NFWG++
Sbjct  103   PADVAKPEECRRFIDATLSHFGRLDHLVNNAGIANLCMFEEAEDVTNFMPVLDVNFWGSI  162

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             YPTY ALP+L+Q+RGR++VN+S   WLP+PRMS Y+A+KA L+N +ETLR E G+ IGIT
Sbjct  163   YPTYFALPHLKQTRGRIVVNSSSSGWLPMPRMSFYNASKAALINFFETLRIEFGHEIGIT  222

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEEREVH----ATGPVEEFAKLIVSGACRGDEYV  1092
             +AT GWI +EM +GK + +EG  +  +E R+V       G  E  AK IV+ ACRG+ YV
Sbjct  223   IATPGWIESEMTQGKFLSKEGRMVVDQELRDVLIGLVPVGDSEGCAKAIVTSACRGEPYV  282

Query  1093  KYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
               P W+    L+RVF P V++W   +L+
Sbjct  283   TEPWWFKVLYLWRVFVPEVMDWFIHMLY  310



>ref|XP_010249449.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=351

 Score =   293 bits (750),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 206/300 (69%), Gaps = 7/300 (2%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PP +L+ L L  P         +++   + E +   KVV+ITGASSGIGEQ+AY+YAKR 
Sbjct  15    PPTTLITLILFLPPFLVFKCFFYIFRAIFSENV-AGKVVLITGASSGIGEQLAYQYAKRG  73

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A L+LVARR+N L+ ++E AR  G+ +V++  ADV K ++C+RF+ E I+ +GR+DHLV+
Sbjct  74    ARLLLVARRKNCLQEVAEKARGFGSPDVVVVQADVSKVDDCKRFVDEAISHFGRMDHLVS  133

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
              A +     FE++SD T F  +MD NFWG+VY  Y A+P+LR+S+G++IVNAS   WLPL
Sbjct  134   NAGIASVCMFEDSSDITKFAPIMDTNFWGSVYTAYFAVPHLRKSKGKIIVNASSAGWLPL  193

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
             PRMS+Y+A+KA ++N YETLR E+G  IGIT+ T G+  +EM +GK + +EG EMQ  +E
Sbjct  194   PRMSVYNASKAAVINFYETLRVELGRDIGITIVTPGFTESEMMQGKFLTKEG-EMQVDQE  252

Query  1012  -REVH-ATGPVEE---FAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
              R+V   T PVE+    AK IV  ACRGD Y+  P W+    +++V  P+VL W +RLL+
Sbjct  253   MRDVEVGTFPVEKAEGCAKAIVKSACRGDRYLTQPLWFRVMFVWKVVCPHVLEWFYRLLY  312



>ref|XP_001767568.1| predicted protein [Physcomitrella patens]
 gb|EDQ67703.1| predicted protein [Physcomitrella patens]
Length=341

 Score =   290 bits (741),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 191/300 (64%), Gaps = 7/300 (2%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PP++ V L L WP L       W  +    E+ M  KVV+ITGASSGIGE IAYEYAK+ 
Sbjct  13    PPSAAVTLLLVWPVLALYKTMMWWLSWVLYED-MRGKVVLITGASSGIGEHIAYEYAKKG  71

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A L LV RREN L  +++ A   GA +V +   DV KE +C+RF+ ETI  YGR+DHLVN
Sbjct  72    ARLALVGRRENLLMEVADRAITRGASDVKVLVGDVTKEADCKRFLEETIQKYGRLDHLVN  131

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
              A + H+F+F E  D       +D  FWG VY TY A+P+LR++ G+V+V AS  SWLP 
Sbjct  132   NAGVAHSFFFSETKDLKALTSTLDTTFWGQVYMTYFAIPHLRRTHGKVLVMASTASWLPY  191

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
             PR +LY+A KAG++  ++TLR EVG+ IGIT+   GWI +E+ +GK + E+G     + E
Sbjct  192   PRQTLYNAGKAGVLAFFDTLRVEVGDVIGITIVMPGWIESEITKGKFIHEDGDIWTDQME  251

Query  1012  REVHATGP-----VEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             R++H  GP     V E A   V G  RG  YV  P +Y  FLLYR+F+P VL+W FRL+F
Sbjct  252   RDMH-IGPVPVTSVTECANAAVKGVIRGSHYVTVPFYYSAFLLYRMFAPEVLDWIFRLIF  310



>ref|XP_007160005.1| hypothetical protein PHAVU_002G285000g [Phaseolus vulgaris]
 gb|ESW31999.1| hypothetical protein PHAVU_002G285000g [Phaseolus vulgaris]
Length=347

 Score =   274 bits (700),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 188/265 (71%), Gaps = 4/265 (2%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E +  KV++ITGASSGIGE +AYEYAKR A L LVARRENR++ ++ NA+LLG+ +V+  
Sbjct  43    ENVAGKVILITGASSGIGEHLAYEYAKRGARLALVARRENRIKEVAGNAKLLGSPDVITI  102

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
              ADV + ++C+RF+  TIN +GR+DHLVN A +     FE+ +D T F   MDINFWG+ 
Sbjct  103   PADVSRPQDCQRFVESTINHFGRLDHLVNNAGIVALSLFEDTTDITKFAPAMDINFWGSA  162

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             Y TY ++P+LRQS+G+++  AS   WLP+PRMS+Y+A+KA +++LYETLR E+G  IGIT
Sbjct  163   YGTYFSIPHLRQSKGKIVAVASCNGWLPVPRMSIYNASKAAVISLYETLRTELGRDIGIT  222

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATG----PVEEFAKLIVSGACRGDEYV  1092
             + T G I +EM++GKI+ ++G  +  ++ R++  +G     V E AK IV+  CRGD Y+
Sbjct  223   IVTPGLIDSEMSQGKILSKDGRMVFDQQIRDMEGSGMPIKSVTEAAKAIVNSVCRGDSYL  282

Query  1093  KYPSWYDTFLLYRVFSPNVLNWTFR  1167
               P+W+ T   +++F P VL +  R
Sbjct  283   TEPAWFTTTFYWQIFCPEVLEFLNR  307



>ref|XP_002973836.1| hypothetical protein SELMODRAFT_100351 [Selaginella moellendorffii]
 gb|EFJ24791.1| hypothetical protein SELMODRAFT_100351 [Selaginella moellendorffii]
Length=346

 Score =   273 bits (698),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 151/330 (46%), Positives = 207/330 (63%), Gaps = 13/330 (4%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+  +LNLVVPP  LV L L WP + F+S   W+++    E +   KV VITGASSGI
Sbjct  1     MDLIQMLLNLVVPPLGLVFLLLTWPAVAFLSFWRWIFSYALAENV-RGKVAVITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE +AYEY KR A +VL  RREN+L+ + E     GA + L+  ADV +EEEC++ + ET
Sbjct  60    GEYMAYEYGKRGAKVVLCGRRENQLKNVQERVGSEGATDTLVVVADVSREEECKKVVDET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             IN  G++DHLV    + ++F+ EEA    +F  +MD+NF G VY TY ALP+LR+SRG++
Sbjct  120   INTLGKIDHLVCNHGIANSFFVEEAKGLEIFRKIMDVNFMGCVYTTYFALPHLRKSRGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSI-GITVATHGWIGTEMARGKI  972
             +V AS  SWLP+PRMS+Y+A+KA +VN ++TLR E+ + I G+T+A  G+I +EM  GK 
Sbjct  180   VVTASTASWLPIPRMSIYNASKAAVVNFFDTLRTELRSDIGGMTIAMPGYIHSEMTMGKF  239

Query  973   MVEEGA-EMQWKEEREVHATGPV---EEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFS  1140
             M  EG  +M       +    PV   +  AK IVS   RG+ YV  P+WY   LL+RVF 
Sbjct  240   MSAEGKHDMNVDIRDTLVGPSPVASTQYCAKQIVSAVTRGERYVVVPTWYKVSLLFRVFV  299

Query  1141  PNVLNWTFRLLFDNLSARTTSFIGTGRPIT  1230
             P +L     LLF          +  G+P+T
Sbjct  300   PQLLETFISLLF-------VKELQPGKPVT  322



>ref|XP_010026329.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Eucalyptus 
grandis]
 gb|KCW83128.1| hypothetical protein EUGRSUZ_B00089 [Eucalyptus grandis]
Length=349

 Score =   273 bits (698),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 138/304 (45%), Positives = 196/304 (64%), Gaps = 15/304 (5%)
 Frame = +1

Query  310   MLALAWPTLCFISACEWLYNLYYGE-----------EIMEDKVVVITGASSGIGEQIAYE  456
              L L  P   F S C +L   Y  +           E +E KVV+ITGASSGIGE +AYE
Sbjct  7     FLNLVAPPFTFFSLCLFLPPFYAFKFFLSTLSSVFSESVEGKVVLITGASSGIGEYLAYE  66

Query  457   YAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRV  636
             YA+R A L LVARREN LR ++E AR LG+ +V++  ADV + ++CRR + ET+N + R+
Sbjct  67    YARRGACLALVARRENSLREVAEGARELGSPDVIVIQADVSQVDDCRRLVNETMNHFQRL  126

Query  637   DHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVE  816
             DHLVN A +     FE+A D T F  +MD N+WG+VY T  A+PYLR SRG++IV +S  
Sbjct  127   DHLVNNAGINSVCKFEDAGDITHFRAVMDTNYWGSVYTTRFAVPYLRNSRGKIIVLSSAA  186

Query  817   SWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEM  996
             SWLP PR S Y+A+KA L++++ETLR E+G  IGIT+ T G+I +E+ +GK   +EG   
Sbjct  187   SWLPEPRTSFYNASKAALLSMFETLRVELGPDIGITIVTPGFIESELTQGKHFTKEGKLE  246

Query  997   QWKEEREVHAT----GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTF  1164
               ++ R+V  +    G V+  AK IV+ ACRGD Y+  P+W+     ++ F P ++ W++
Sbjct  247   VDQDLRDVQVSVFPVGSVQGCAKAIVNSACRGDRYLTEPAWFKMTYFWKAFCPEIVEWSY  306

Query  1165  RLLF  1176
             RL++
Sbjct  307   RLMY  310



>ref|XP_008239511.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Prunus 
mume]
Length=353

 Score =   271 bits (693),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/304 (45%), Positives = 196/304 (64%), Gaps = 16/304 (5%)
 Frame = +1

Query  313   LALAWPTLCFISACEWLYNLYYGE-----------EIMEDKVVVITGASSGIGEQIAYEY  459
             L L  P   F S C +L   Y  +           E +  KV++ITGASSGIGE +AYEY
Sbjct  11    LNLVAPPFTFFSLCLFLPPFYLFKSFLSVLSSIFSENVNGKVILITGASSGIGEHLAYEY  70

Query  460   AKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVD  639
             AKR A LVLV RRE+ LR + + A   G+ +VL+  ADV K E+C+R + ETIN +GR+D
Sbjct  71    AKRGARLVLVGRREDSLREVVDRASDCGSPDVLMVGADVSKVEDCKRIVDETINHFGRLD  130

Query  640   HLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVES  819
             HLVN A +      EEA+D T F  +MD NFWG+VY T  A+P+LR S+G+++V +S  S
Sbjct  131   HLVNNAGITSLGMLEEATDITNFRAIMDTNFWGSVYTTRFAIPHLRSSKGKIVVLSSAAS  190

Query  820   WLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEM-  996
             WLP+PR S+Y+A+KA L+++YETLR E G +I IT+ T G+I +E+ +GK ++ +  +M 
Sbjct  191   WLPIPRQSIYNASKAALLSMYETLRIEFGPNIQITIVTPGYIESELTQGKFLMSDDGKMI  250

Query  997   --QWKEEREVHAT--GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTF  1164
               Q   + +V AT  G VE  AK IV+  CRGD Y+  P+W+    +++VF P +L W +
Sbjct  251   VDQDLRDAQVSATPVGSVEGCAKAIVNSVCRGDRYLTEPAWFGVTYIWKVFCPELLEWGY  310

Query  1165  RLLF  1176
             RL++
Sbjct  311   RLMY  314



>ref|XP_008344913.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Malus 
domestica]
 ref|XP_008367477.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Malus 
domestica]
Length=350

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/301 (44%), Positives = 195/301 (65%), Gaps = 5/301 (2%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PP +   L +  P      +  ++ +  + E  ++ KVVVITGASSGIGE +AYEYAKR 
Sbjct  14    PPFTFFSLCVFLPPFYLFKSFSYVLSSIFSEN-LKGKVVVITGASSGIGEHLAYEYAKRG  72

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A L LV R EN LR + + A   G+ +VL+  ADV K E+C+R + +T+N YGR+DHLVN
Sbjct  73    ARLALVGRSENALREVVDRASDFGSPDVLMIRADVSKVEDCKRIVDDTMNHYGRLDHLVN  132

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
              A +      E+A+D T F  +MD NFWG+VY T+ ALP+L+ S+G+++V +S  SWLP+
Sbjct  133   NAGITLLSILEDATDITNFRTIMDTNFWGSVYTTHFALPHLKSSKGKIVVLSSSASWLPI  192

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
             PR S+Y+A+KA L+++YETLR E G  I IT+ T G+I +E+ +GK ++ EG     ++ 
Sbjct  193   PRQSIYNASKAALLSMYETLRIEFGPDIQITIVTPGFIESELTQGKFLMSEGKMTVDQDL  252

Query  1012  REVHAT----GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFD  1179
             R+   +      VE  AK IV+ ACRGD Y+  P+W+    L++VF P +L W +RL++ 
Sbjct  253   RDAQVSATPVAKVEGCAKSIVNSACRGDRYLTEPAWFRVTYLWKVFCPELLEWGYRLIYM  312

Query  1180  N  1182
             N
Sbjct  313   N  313



>ref|XP_009359396.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X2 [Pyrus x bretschneideri]
Length=350

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/301 (44%), Positives = 194/301 (64%), Gaps = 5/301 (2%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PP +   L +  P      +  ++ +  + E  +  KVVVITGASSGIGE +AYEYAKR 
Sbjct  14    PPFTFFSLCVFLPPFYLFKSFSYVLSSIFSEN-LNGKVVVITGASSGIGEHLAYEYAKRG  72

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A L LV RREN LR + + A   G+ +VL+  ADV K E+C+R + +T+N YGR+DHLVN
Sbjct  73    ARLALVGRRENALREVVDRASDFGSPDVLMIHADVSKVEDCKRIVDDTMNHYGRLDHLVN  132

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
              A +      E+A+D T F  +MD NFWG+VY T+ ALP+L+ S+G+++V +S  SWLP+
Sbjct  133   NAGITLLSILEDATDITNFRTIMDTNFWGSVYTTHFALPHLKSSKGKIVVLSSSASWLPI  192

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
             PR S+Y+A+KA L+++YETLR E G  I IT+ T G+I +E+ +GK ++ EG     ++ 
Sbjct  193   PRQSIYNASKAALLSMYETLRIEFGPDIQITIVTPGFIESELTQGKFLMSEGKMTVDQDL  252

Query  1012  REVHAT----GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFD  1179
             R+   +      V+  AK IV+ ACRGD Y+  P+W+    L++VF P +L W +RL+  
Sbjct  253   RDAQVSAIPVAKVQGCAKSIVNSACRGDRYLTEPAWFRVTYLWKVFCPELLEWGYRLVCM  312

Query  1180  N  1182
             N
Sbjct  313   N  313



>ref|XP_010250644.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=349

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/312 (45%), Positives = 199/312 (64%), Gaps = 7/312 (2%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MD ++ +LN V PP +LV L L  P L       ++      E+ +  KVV+ITGASSGI
Sbjct  1     MDTIHKLLNFVAPPLALVALCLTLPLLYICKIISYILRSISTED-LTGKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE +AYEY +R A LVLVARREN LR +++ A  LG+ +VL+  ADV K E+C+RFI E 
Sbjct  60    GEHLAYEYGRRGARLVLVARRENSLREVAKKAGQLGSPDVLVVRADVSKVEDCKRFIQEA  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             +N +GR+DHL+  A +     FE+A D T F  +MDINFWG++Y TY A+P+LR+S+G++
Sbjct  120   VNHFGRIDHLICNAGITCACIFEDALDVTNFRTVMDINFWGSIYSTYFAIPHLRKSKGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IV +S       P MSLY A+KA ++N YETLR E+G  + +T+ T G++ +EM +GK +
Sbjct  180   IVISSSAGSFVSPMMSLYGASKAAMINFYETLRVELGQEVKVTLVTPGFVESEMTQGKHL  239

Query  976   VEEGAEMQWKEEREVHATG-----PVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFS  1140
              + G+     E R+V A G      V E  K IV+GACRGD YV  PSW+    +++   
Sbjct  240   SKGGSLEVDAELRDV-AIGAVPVLSVSECTKSIVNGACRGDRYVTEPSWFGLLFVFQFCC  298

Query  1141  PNVLNWTFRLLF  1176
             P ++ W  R+L+
Sbjct  299   PELVEWFCRMLY  310



>gb|KHN16857.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Glycine 
soja]
Length=377

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/266 (48%), Positives = 183/266 (69%), Gaps = 4/266 (2%)
 Frame = +1

Query  382   EEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLI  561
              E +  KV++ITGASSGIGE +AYEY +R A L LVARRENRL+ ++  A+L G+  V+I
Sbjct  72    SENVAGKVILITGASSGIGEHLAYEYGRRGARLALVARRENRLKEVASIAKLFGSPEVII  131

Query  562   TAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGN  741
               ADV   ++C+RF+  TIN +G++DHLVN A +     FE  +D   F   MDINFWG+
Sbjct  132   IPADVSSSQDCKRFVDSTINHFGQLDHLVNNAGVSAPGLFESTTDIRNFAPAMDINFWGS  191

Query  742   VYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGI  921
              Y TY A+P+LR+S+G++I  AS   WLP+PRMS+Y+A+KA +++LYETLR E+G  IGI
Sbjct  192   AYGTYFAIPHLRKSKGKIIAIASCTGWLPVPRMSIYNASKAAVISLYETLRIELGRDIGI  251

Query  922   TVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHAT----GPVEEFAKLIVSGACRGDEY  1089
             T+ T G I +EM++GK++ +EG  +  +  R+V A+      V E AK IV+ ACRGD Y
Sbjct  252   TIVTPGLIESEMSQGKVLFKEGKMVSDQLIRDVQASLIPIRSVTEAAKSIVNSACRGDSY  311

Query  1090  VKYPSWYDTFLLYRVFSPNVLNWTFR  1167
             +  P+W+ T   +++F P+VL +  R
Sbjct  312   LTEPAWFTTTFYWKIFFPDVLEFCNR  337



>ref|XP_009359395.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X1 [Pyrus x bretschneideri]
Length=355

 Score =   266 bits (680),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/306 (43%), Positives = 194/306 (63%), Gaps = 10/306 (3%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PP +   L +  P      +  ++ +  + E  +  KVVVITGASSGIGE +AYEYAKR 
Sbjct  14    PPFTFFSLCVFLPPFYLFKSFSYVLSSIFSEN-LNGKVVVITGASSGIGEHLAYEYAKRG  72

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A L LV RREN LR + + A   G+ +VL+  ADV K E+C+R + +T+N YGR+DHLVN
Sbjct  73    ARLALVGRRENALREVVDRASDFGSPDVLMIHADVSKVEDCKRIVDDTMNHYGRLDHLVN  132

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
              A +      E+A+D T F  +MD NFWG+VY T+ ALP+L+ S+G+++V +S  SWLP+
Sbjct  133   NAGITLLSILEDATDITNFRTIMDTNFWGSVYTTHFALPHLKSSKGKIVVLSSSASWLPI  192

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
             PR S+Y+A+KA L+++YETLR E G  I IT+ T G+I +E+ +GK ++ EG     ++ 
Sbjct  193   PRQSIYNASKAALLSMYETLRIEFGPDIQITIVTPGFIESELTQGKFLMSEGKMTVDQDL  252

Query  1012  REVH---------ATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTF  1164
             R+ +             V+  AK IV+ ACRGD Y+  P+W+    L++VF P +L W +
Sbjct  253   RDCNFVQAQVSAIPVAKVQGCAKSIVNSACRGDRYLTEPAWFRVTYLWKVFCPELLEWGY  312

Query  1165  RLLFDN  1182
             RL+  N
Sbjct  313   RLVCMN  318



>ref|XP_010086991.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Morus notabilis]
 gb|EXB25270.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Morus notabilis]
Length=365

 Score =   265 bits (678),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 144/325 (44%), Positives = 198/325 (61%), Gaps = 19/325 (6%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MD +NSV N+++P  SL ++    P   F           + ++++  KVV+ITGASSGI
Sbjct  1     MDFINSVTNIIIPSISLTLMLFFLPPYLFFKYLFCTVRPIFKDDML-GKVVLITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE++AYEYA++ A L LVARRENRL++++  A LLG K+V+   ADV K E+C RF+ ET
Sbjct  60    GERMAYEYARKGARLALVARRENRLQSVASIATLLGCKDVITIRADVSKVEDCERFVYET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             IN+YGR+DHLVN A +     FEE+ D   F   MDINFWG+VY TY A+PYL+++RGR+
Sbjct  120   INYYGRLDHLVNNAGVAPVCMFEESPDIKKFTQAMDINFWGSVYATYFAIPYLKRTRGRI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +V +S  SWLP+PR+ +Y A+KA + + YETLR E+G  + IT+ T G   +EM  GK +
Sbjct  180   VVISSAASWLPVPRLGIYGASKAAVTSFYETLRVEIGRDVRITIVTPGLTESEMTLGKFL  239

Query  976   VEEGAEMQWKEEREVHATGP------------------VEEFAKLIVSGACRGDEYVKYP  1101
                G     +E R+     P                  V+E AK IV GAC+G  Y+  P
Sbjct  240   TGRGTLELGQELRDFELGSPNAYLIDGQVVMSMTPVMSVKETAKAIVEGACQGAYYLTVP  299

Query  1102  SWYDTFLLYRVFSPNVLNWTFRLLF  1176
             +W     L+ VF P VL W  RLL 
Sbjct  300   AWIKPTFLWHVFFPEVLEWCNRLLL  324



>ref|XP_010663769.1| PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydroxysteroid dehydrogenase 
1B-like [Vitis vinifera]
Length=348

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/314 (46%), Positives = 202/314 (64%), Gaps = 10/314 (3%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYG--EEIMEDKVVVITGASS  429
             MD+++S LNLV PP + V L L  P   F    ++  + ++    E +  KVV++TGASS
Sbjct  1     MDIIHSFLNLVAPPFTFVALFLLLPPFHFF---KFFLSTFWSILSENVTGKVVIVTGASS  57

Query  430   GIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFIL  609
             GIGE +AYEYAKR A LVL + RENRL+ +   AR LGA +V +  ADV K E+C+R + 
Sbjct  58    GIGEHVAYEYAKRGACLVLASTRENRLQEVGXVARALGAPDVRVVPADVSKLEDCKRIVD  117

Query  610   ETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRG  789
             E  N +GRVDHLVN A +      EEA+D T F  +MD+NFWG+VY T  A+P+LR S G
Sbjct  118   EAANHFGRVDHLVNNAGIQSASTLEEATDITNFRPVMDVNFWGSVYTTRFAIPHLRNSHG  177

Query  790   RVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSI-GITVATHGWIGTEMARG  966
             ++I  AS  +WLP+PRMS+Y+A+KA L++ Y+TLR E+G+ I GITV T G+I +EM +G
Sbjct  178   KIIGMASSAAWLPMPRMSIYNASKAALISFYDTLRIELGSDIGGITVVTPGFIESEMTQG  237

Query  967   KIMVEEGAEMQWKEEREVHAT----GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRV  1134
             + +  E      ++ R+   +    G  E  AK IV  ACRG++Y+  PSW+    L++V
Sbjct  238   EFLKNEDQIEVDQDMRDAQVSIIPVGRAEACAKAIVKSACRGEKYLTEPSWFRVTYLWKV  297

Query  1135  FSPNVLNWTFRLLF  1176
               P V+ W FRL +
Sbjct  298   LCPEVIEWCFRLFY  311



>ref|XP_004503736.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Cicer arietinum]
Length=351

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 146/313 (47%), Positives = 204/313 (65%), Gaps = 8/313 (3%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYY-GEEIMEDKVVVITGASSG  432
             MDL++  LN+V PP +   LAL  P    I    +L  +YY   E +  KVV ITGASSG
Sbjct  1     MDLIHKFLNIVAPPFTFFSLALFLPPYWAIKF--FLSTIYYIFTENVAGKVVHITGASSG  58

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGE +AYEYAKR A L L ARRE  LR +++ AR  G+ +V+I  ADV K E+C R I E
Sbjct  59    IGEHLAYEYAKRGALLALSARRETALREVADRARDYGSPDVIIIRADVSKVEDCLRLIDE  118

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
             T+  +GR+DHLVN A++     FEE +D T    +MD NFWG+VY T  ALP+LR SRG+
Sbjct  119   TVQHFGRLDHLVNNAAISAATLFEEVTDITDLRPVMDTNFWGSVYTTRFALPHLRNSRGK  178

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             ++V +S +SW+P PR S+Y+A+KA LV+LYETLR EVG+ IGIT+ T G+I +E+ +GK 
Sbjct  179   IVVLSSADSWMPAPRRSIYNASKAALVSLYETLRVEVGSDIGITIVTPGYIESELTKGKF  238

Query  973   MVEEGAEMQWKEE-REVHAT----GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVF  1137
             ++   A+M   ++ R+V  +    G V   AK IV+   RGD Y+  P+W+    + +V 
Sbjct  239   LLPPQAKMGVDQDMRDVEVSAMPVGSVSGCAKSIVNSTLRGDRYLTVPAWFRMTYVVKVL  298

Query  1138  SPNVLNWTFRLLF  1176
              P ++ W+FR+L+
Sbjct  299   CPELVEWSFRMLY  311



>ref|XP_010277349.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=317

 Score =   262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/272 (49%), Positives = 182/272 (67%), Gaps = 4/272 (1%)
 Frame = +1

Query  373   YYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKN  552
             Y   E M  KVV+ITGASSGIGE +AYEYAKR A+LVLVARREN LR I+E  RLLG+ +
Sbjct  39    YIYMENMAGKVVLITGASSGIGEHLAYEYAKRGASLVLVARRENYLRVIAEKCRLLGSPH  98

Query  553   VLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINF  732
             VL+  ADV K ++C+RF+ ET+N +GR+DHLV  A +     F+EA +   F  +MDINF
Sbjct  99    VLVVPADVSKVDDCQRFVEETVNQFGRLDHLVCNAGIDSFCLFKEAVNVANFTSVMDINF  158

Query  733   WGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNS  912
             WG++YPT  A+P+L++SRG+++VNAS   WL  P  S+Y A+KA L+N YETLR E+   
Sbjct  159   WGSIYPTRFAIPHLKRSRGKIVVNASATGWLVSPWSSVYGASKAALLNFYETLRVELAPE  218

Query  913   IGITVATHGWIGTEMARGKIMVEEG-AEMQWKEEREVHATGPVE---EFAKLIVSGACRG  1080
             I IT    G+I +EM +GK +  EG  ++  K +  V +  PV+   + AK IV G CRG
Sbjct  219   IKITTVAPGFIESEMIQGKHLTNEGEVKVDQKMKEIVASIFPVQSTGKCAKAIVDGTCRG  278

Query  1081  DEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             D YV  PSW+   +L++   P ++ W  R L+
Sbjct  279   DRYVIEPSWFRVLVLFQFVCPGLVEWLTRFLY  310



>ref|XP_004962634.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Setaria 
italica]
Length=348

 Score =   263 bits (673),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/299 (44%), Positives = 195/299 (65%), Gaps = 7/299 (2%)
 Frame = +1

Query  295   PASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRA  474
             PA +  L L +P      +C    +  + E++   KVV++TGASSGIGEQ+AY+YA +RA
Sbjct  14    PAMVAGLLLFYPPYYLFKSCYSFLSWLFPEDV-AGKVVLVTGASSGIGEQLAYQYALKRA  72

Query  475   NLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNT  654
             +L LVAR E+ LR +++ A  LGA++V++   DV   ++C+RF+   I+ Y R+DHLV  
Sbjct  73    SLALVARTESSLRHVADRAIELGARDVIVLPGDVANPDDCKRFVQTAISHYDRLDHLVCN  132

Query  655   ASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLP  834
             A +     F+E  D T +   +D+NFWG+V  T+ ALPYL++SRGR++V AS  +W P+P
Sbjct  133   AGIASVGAFQEIPDVTNYSSQLDVNFWGSVQTTFAALPYLKRSRGRIVVTASATAWNPVP  192

Query  835   RMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEER  1014
             RMS Y+AA A LVN +ETLR E+G+ IGIT+ T GWI +EM++GK + E G EM+  +E 
Sbjct  193   RMSFYNAANAALVNFFETLRTELGSEIGITIVTPGWIESEMSKGKYLKEHG-EMEVDQEM  251

Query  1015  EVHATG--PVE---EFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
                  G  PVE     A+ +V  AC+G+ Y+  P+W+    L+RVF+P V+   +RLL+
Sbjct  252   RDAQIGLFPVEYAKNCARAMVQAACQGERYLTVPAWFRAMYLWRVFAPEVVEVCYRLLY  310



>gb|KEH21006.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=351

 Score =   263 bits (673),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 133/276 (48%), Positives = 187/276 (68%), Gaps = 5/276 (2%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E +  KVV ITGASSGIGE +AYEYAKR A L L ARR+  LR +++ AR  G+ +V+I 
Sbjct  43    ENVAGKVVHITGASSGIGEHLAYEYAKRGARLALSARRDTALREVADRARDCGSPDVIIM  102

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
              ADV K ++CRR + ET+N +GR+DHLVN A++     FE  +D T +  LMD NFWG+V
Sbjct  103   RADVSKVDDCRRLVDETVNHFGRLDHLVNNAAISAAMMFEGVTDITNWRPLMDTNFWGSV  162

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             Y T  AL +LR SRG+++V +S++SW+P PR S+Y+A+KA LV+LYETLR EVG  +G+T
Sbjct  163   YTTRFALTHLRNSRGKIVVLSSIDSWMPAPRRSIYNASKAALVSLYETLRVEVGADVGVT  222

Query  925   VATHGWIGTEMARGKIMVEEGAEM---QWKEEREVHAT--GPVEEFAKLIVSGACRGDEY  1089
             + T G+I +E+ +GK+++    +M   Q   + EV AT  G V E AK IV+G  RGD Y
Sbjct  223   IVTPGYIESELTKGKVLLPPEGKMGVDQDMRDVEVSATPVGSVSECAKSIVNGTLRGDRY  282

Query  1090  VKYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLSART  1197
             +  P+W+    + +V  P +L W FR+L+   S+ T
Sbjct  283   LTAPAWFRMTYVVKVLCPELLEWGFRILYLTRSSNT  318



>ref|XP_006347480.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
tuberosum]
Length=349

 Score =   263 bits (672),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 140/318 (44%), Positives = 192/318 (60%), Gaps = 12/318 (4%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PP S   L L  P   F      +    + E++   KVV+ITGASSGIGE +AYEYAKR 
Sbjct  15    PPVSFFSLLLFLPPFQFFKCVLSILGTLFSEDVA-GKVVIITGASSGIGEYLAYEYAKRG  73

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A L L ARRE  L  ++E AR LG+ +V+   ADV K E+CRR + +T++ +GR+DHLVN
Sbjct  74    ACLTLAARRERSLNEVAEGARELGSPDVITIQADVSKAEDCRRIVDQTMSHFGRLDHLVN  133

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
              A +     FE+  D T F  +MDINFWG+VY T  A+PYLR S GR+IV +S  SWLP+
Sbjct  134   NAGVHAIALFEDTEDVTDFKSVMDINFWGSVYMTRFAIPYLRYSGGRIIVLSSSASWLPV  193

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
             PR S Y+A+KA +   +ETLR E+G  I IT+ T G++ +E+ +GK + + G     +  
Sbjct  194   PRSSFYNASKAAVSQFFETLRIELGQDIKITLVTPGFVESELTQGKYIGKGGDVEVDQGM  253

Query  1012  REVH----ATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF-  1176
             R+V         VE  AK IV+ ACRG+ YV  P+W+    L++VF+P VL W +RL+  
Sbjct  254   RDVFIGATPVAKVESCAKTIVNSACRGERYVTIPAWFRVSYLWKVFAPEVLEWMYRLMHL  313

Query  1177  ------DNLSARTTSFIG  1212
                   D LS +   + G
Sbjct  314   TGTSPEDALSKKVVDYTG  331



>ref|XP_010250645.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=353

 Score =   262 bits (670),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 135/300 (45%), Positives = 187/300 (62%), Gaps = 6/300 (2%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PP  L+ L L  P    +     +   ++ E +   KVV+ITGASSGIG+Q+AY+YAK+ 
Sbjct  16    PPVILLTLVLLSPPFLVLEFFLSILRSFFSENV-AGKVVLITGASSGIGKQLAYQYAKKG  74

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A LVLVARR+N L  ++E ARLLG+ +V+   ADV K ++C+RFI ET+N +GR+DHLV 
Sbjct  75    ACLVLVARRQNLLEEVAEKARLLGSPDVMSVQADVSKVDDCQRFIDETVNHFGRLDHLVT  134

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
              A +G    FE++++   F  +M INFWG++Y T+ A P+LR S+G++IV AS+  WLP+
Sbjct  135   NAGIGSVCMFEDSTEINKFTPVMGINFWGSIYATHFAAPHLRNSKGKMIVIASLAGWLPV  194

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
             PRMS Y A+KA L+  +ET R E G  I   +   G I +EM +G+ +  EG  M+  EE
Sbjct  195   PRMSFYCASKAALIKFHETYRIEYGADIRSVIVVPGLIESEMTKGRFLSNEGVLMEVDEE  254

Query  1012  -REVHAT----GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
              REV          E  AK IV GACRG+ YV  P WY   +  R   P VL W +RL++
Sbjct  255   SREVEVGVFPYASTEGCAKHIVDGACRGEPYVIEPRWYKAAIFCRSLCPEVLEWFYRLVY  314



>ref|XP_004241449.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
lycopersicum]
Length=349

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 140/318 (44%), Positives = 191/318 (60%), Gaps = 12/318 (4%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PP S   L L  P   F      +    + E++   KVV+ITGASSGIGE +AYEYAKR 
Sbjct  15    PPVSFFSLLLFLPPFQFFKCVLSILGTLFSEDVA-GKVVIITGASSGIGEYLAYEYAKRG  73

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A L L ARR+  L  ++E AR LG+ +V+   ADV K E+CRR + +T++ +GR+DHLVN
Sbjct  74    ACLTLAARRDRSLNEVAEGARELGSPDVITIQADVSKAEDCRRIVDQTMSHFGRLDHLVN  133

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
              A +     FE+  D T F  +MDINFWG+VY T  A+PYLR S GR+IV +S  SWLP 
Sbjct  134   NAGVHAIALFEDTEDVTDFKSVMDINFWGSVYMTRFAIPYLRYSGGRIIVLSSSASWLPA  193

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
             PR S Y+A+KA +   +ETLR E+G  I IT+ T G++ +E+ +GK + + G     +  
Sbjct  194   PRSSFYNASKAAVSQFFETLRIELGQDIKITLVTPGFVESELTQGKYIGKGGDVEVDQGM  253

Query  1012  REVH----ATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF-  1176
             R+V         VE  AK IV+ ACRG+ YV  PSW+    L++VF+P VL W +RL+  
Sbjct  254   RDVFIGATPVAKVESCAKTIVNSACRGERYVTIPSWFRVSYLWKVFAPEVLEWMYRLMHL  313

Query  1177  ------DNLSARTTSFIG  1212
                   D LS +   + G
Sbjct  314   TGTSPEDALSKKVADYTG  331



>ref|NP_001242368.1| uncharacterized protein LOC100787835 [Glycine max]
 gb|ACU17782.1| unknown [Glycine max]
Length=377

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/266 (47%), Positives = 181/266 (68%), Gaps = 4/266 (2%)
 Frame = +1

Query  382   EEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLI  561
              E +  KV++ITGASSGIGE +AYEY +R A L LVARRENRL+ ++  A+L G+  V+I
Sbjct  72    SENVAGKVILITGASSGIGEHLAYEYGRRGARLALVARRENRLKEVASIAKLFGSPEVII  131

Query  562   TAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGN  741
               ADV   ++C+RF+  TIN +G++DHLVN A +     FE  +D   F   MDINFWG+
Sbjct  132   IPADVSSSQDCKRFVDSTINHFGQLDHLVNNAGVSAPGLFESTTDIRNFAPAMDINFWGS  191

Query  742   VYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGI  921
              Y TY A+P+LR+S+G++I  AS   WLP+PRMS+Y+A+KA +++LYETLR E+G  IG+
Sbjct  192   AYGTYFAIPHLRKSKGKIIAIASCTGWLPVPRMSIYNASKAAVISLYETLRIELGRDIGM  251

Query  922   TVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHAT----GPVEEFAKLIVSGACRGDEY  1089
             T+ T G I +EM++GK++ +EG  +  +  R+  A+      V E  K IV+ ACRGD Y
Sbjct  252   TIVTPGLIESEMSQGKVLFKEGKMVSDQLIRDAQASLIPIRSVTEAVKSIVNSACRGDSY  311

Query  1090  VKYPSWYDTFLLYRVFSPNVLNWTFR  1167
             +  P+W+ T   +++F P+VL +  R
Sbjct  312   LTEPAWFTTTFYWKIFFPDVLEFCNR  337



>ref|XP_010241532.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=316

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/299 (44%), Positives = 191/299 (64%), Gaps = 9/299 (3%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PP SL +L+LA P L       ++   +  E I   KVV+ITGASSGIGE +AYEY +R 
Sbjct  13    PPVSLFILSLALPILFIFRILNYILTSFSSENITR-KVVLITGASSGIGEHLAYEYGRRG  71

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A LVLVARRE  L+ +++ A  LG+ +VL+  ADV K E+C+RFI E ++ +GR+DHL+ 
Sbjct  72    AFLVLVARREKSLKEVAKRAAELGSPDVLVVCADVSKPEDCQRFIDEAVSHFGRLDHLIC  131

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
              A +     FEE +D T F  +MD+NFWG++YPTY A+P+LR+S+G+++VN+S+    P 
Sbjct  132   NAGVTSGCKFEETNDITNFRPVMDVNFWGSIYPTYFAIPHLRRSKGKIVVNSSLAGSFPT  191

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGA---EMQW  1002
             P +SLY A+KA + N YETLR E+   + +T  T G+I TEM +GK + +EG+   E +W
Sbjct  192   PMLSLYGASKAAMENFYETLRVELAGEVKVTTVTPGFIDTEMTQGKHLSKEGSVKVEQEW  251

Query  1003  KEEREVHATGPVEE---FAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRL  1170
             K    +    PV      AK IV+GACRGD Y+  PSWY     ++ F   ++ +  R+
Sbjct  252   KN--TIIGAMPVMSAGACAKAIVNGACRGDRYLTVPSWYRVAFPFQFFCAELVAFWSRM  308



>ref|XP_008353114.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Malus 
domestica]
Length=288

 Score =   259 bits (661),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = +1

Query  256  MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
            MDL NSVLN VVPPASLVMLA AWP L F++ CEWLYNL+   EI+EDKVV+ITGASSGI
Sbjct  1    MDLFNSVLNWVVPPASLVMLAFAWPALTFVTGCEWLYNLF-NSEIVEDKVVIITGASSGI  59

Query  436  GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
            GEQIAYEYAKRRANLVLVARR+NRLR ISENAR +GAK+V+  AADVVKEEECRRFI ET
Sbjct  60   GEQIAYEYAKRRANLVLVARRQNRLRVISENARRMGAKHVMNIAADVVKEEECRRFISET  119

Query  616  INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
            I+FYGRVDHLVNT SLGHTFYFEE +DT+VFP L+DINFWGNV
Sbjct  120  ISFYGRVDHLVNTVSLGHTFYFEEVTDTSVFPQLLDINFWGNV  162



>ref|XP_006664013.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Oryza 
brachyantha]
Length=349

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/273 (48%), Positives = 184/273 (67%), Gaps = 6/273 (2%)
 Frame = +1

Query  373   YYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKN  552
             Y   E +  KVV+ITGASSGIGEQ+AY+YA +RA+LVLVARRE  LR +++ A  LGA +
Sbjct  40    YLFPEDLTRKVVLITGASSGIGEQLAYQYALKRASLVLVARREWSLRKVADQAFELGAPD  99

Query  553   VLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINF  732
             V+I   DV   E+C+RF+   I+ YGR+DHLV  A +     F+E  D T +   +D+NF
Sbjct  100   VIILPGDVANPEDCKRFVQAAIDHYGRLDHLVCNAGIASVGAFQEIPDVTNYRSQLDVNF  159

Query  733   WGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNS  912
             WG+V  T+ ALP+L++SRGR++V AS   W P+PRM  Y+AA A L+N YETLR E+G+ 
Sbjct  160   WGSVQSTFAALPHLKRSRGRIVVTASATGWNPVPRMIFYNAANAALINFYETLRTELGSQ  219

Query  913   IGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATG--PVE---EFAKLIVSGACR  1077
             +GIT+ T GWI +EM++GK + + G EM+  +E      G  PVE     AK +V  A +
Sbjct  220   VGITIVTPGWIESEMSKGKFLKDHG-EMEVDQEMRDAQIGLFPVEYAKNCAKAMVQAARQ  278

Query  1078  GDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             G+ Y+  PSW+ T  L+RVF+P ++ + +RLL+
Sbjct  279   GERYLTLPSWFSTMYLWRVFAPEIVEFCYRLLY  311



>tpg|DAA52416.1| TPA: hypothetical protein ZEAMMB73_783233 [Zea mays]
Length=259

 Score =   257 bits (657),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 150/198 (76%), Gaps = 15/198 (8%)
 Frame = +1

Query  628   GRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNA  807
             G V+HLVNT SLGH F FEEA DTT FP LMDINFWGNVYPT+ ALPYLR+S GRV+VNA
Sbjct  2     GAVNHLVNTVSLGHDFSFEEAGDTTAFPHLMDINFWGNVYPTHAALPYLRRSHGRVVVNA  61

Query  808   SVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMV---  978
             SVESWLP+PRMSLYSAAKA +V+ YETLR+EV   +G+TVATHGW+  +    K  +   
Sbjct  62    SVESWLPMPRMSLYSAAKAAVVDFYETLRYEVKEEVGVTVATHGWVSGDAGGSKFTLDQQ  121

Query  979   ---EEGA---EMQWKE--EREVHAT----GPVEEFAKLIVSGACRGDEYVKYPSWYDTFL  1122
                +EGA   ++QWK+  ERE  A     G VE +A+ +V+GACRGD YVK PSWYD FL
Sbjct  122   QHHQEGAAADQVQWKQQGEREPAAAALPGGHVEAYARALVAGACRGDAYVKRPSWYDVFL  181

Query  1123  LYRVFSPNVLNWTFRLLF  1176
             ++RVF+P+VL WTFRLL 
Sbjct  182   VFRVFAPDVLAWTFRLLL  199



>ref|XP_010243359.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=364

 Score =   261 bits (666),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 144/319 (45%), Positives = 204/319 (64%), Gaps = 8/319 (3%)
 Frame = +1

Query  247   IKMMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGAS  426
             +++MDL++ +LNLV+PP SL++L ++ P L        +    +  E +  KVV+ITGAS
Sbjct  23    VQVMDLIHQLLNLVLPPISLIILCVSIPLLLIFRLVRCIIQSIFISENLTGKVVLITGAS  82

Query  427   SGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFI  606
             SGIGE +AYEYAKRRA+LVLVARRE +LR I E AR LGA +V+I  ADV K  EC RF+
Sbjct  83    SGIGEYLAYEYAKRRASLVLVARRETKLREIGEKARQLGATDVVIAPADVSKAAECNRFV  142

Query  607   LETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSR  786
              ET+  YGR+DHLV  A +      E+ +D      +MDINFWG++Y T+ ALP+L++S+
Sbjct  143   QETVKHYGRLDHLVCNAGVVLYCPVEDTTDVEKLRPVMDINFWGSIYATHFALPHLKRSK  202

Query  787   GRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEV--GNSIGITVATHGWIGTEMA  960
             G +IVNAS++ WL  P   LY A+KA L+N +ETLR E+    ++ IT+   G+I +E+ 
Sbjct  203   GNIIVNASMKGWLVSPWSILYGASKAALINFFETLRVELPQDENVKITIVAPGFIKSEIT  262

Query  961   RGKIMVEEGAEMQWKEEREVHATG--PV---EEFAKLIVSGACRGDEYVKYPSWYDTFLL  1125
             +GK + +EG E+    E     +G  PV   EE A+ IV G CRG+ Y+  PSWY    L
Sbjct  263   QGKHLSKEG-EVVIDPEMSKMMSGKFPVESTEECARAIVKGVCRGERYIVEPSWYRVLPL  321

Query  1126  YRVFSPNVLNWTFRLLFDN  1182
             ++   P ++ W  R L+  
Sbjct  322   FQFMCPELVEWCSRCLYKT  340



>ref|XP_010086987.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
 gb|EXB25266.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
Length=373

 Score =   261 bits (666),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 128/279 (46%), Positives = 182/279 (65%), Gaps = 5/279 (2%)
 Frame = +1

Query  352   CEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENA  531
             C++L +  + E I   KVV+ITGASSGIGE +AYEY  R A L LVARRE+RLR + E A
Sbjct  34    CQFLLSYVFSENIA-GKVVLITGASSGIGEHLAYEYGSRGACLALVARREDRLRDVVEQA  92

Query  532   RLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFP  711
             R +G+ +VL+  ADV K E+C+R + ET++ +GR+DHLVN A +     FEE ++ T F 
Sbjct  93    RDIGSPDVLMIVADVSKVEDCKRIVDETMDHFGRLDHLVNNAGISSVSMFEEITNITAFR  152

Query  712   ILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETL  891
              LMD NFWG+VY T  A+P LR SRG+++V +S  SWLP PRMS+Y+A+KA L+ ++ETL
Sbjct  153   ALMDTNFWGSVYTTRFAIPRLRNSRGKIVVLSSSASWLPTPRMSIYNASKAALLTMFETL  212

Query  892   RFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATG----PVEEFAKLI  1059
             R E+G+ + IT+ T G+I +E+ +GK + +EG  +   + R+   +      V   AK I
Sbjct  213   RVELGSVVNITIVTPGFIESELTQGKFLDQEGKMIIDPDVRDAQISAVPIRTVRACAKSI  272

Query  1060  VSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             V    RG  Y+  P W+    +++VF P VL W FR  +
Sbjct  273   VKSTLRGQRYLTEPPWFKVSYIWKVFCPEVLEWGFRFFY  311



>ref|XP_004235330.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
lycopersicum]
Length=352

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/310 (46%), Positives = 198/310 (64%), Gaps = 5/310 (2%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             ++DL++  LNLV PP +L  L +  P   FI     +   ++ E +   KV+VITGASSG
Sbjct  3     LLDLIHKFLNLVAPPFTLFTLLIFLPPYQFIKYFLSILGKFFSENV-AGKVIVITGASSG  61

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGE +AYEYA+R A L + ARRE  LR ++E A  LGA +VL+  ADV K E+CRR + +
Sbjct  62    IGEYLAYEYARRGACLTIAARREKSLREVAERALDLGALDVLVVPADVSKVEDCRRVVDK  121

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
             T++ YGR+DHLVN A +     FEE  D T    +MDINFWG+VY T  A+PYLR S GR
Sbjct  122   TMSHYGRLDHLVNNAGVTSVSLFEEIEDITNMRSIMDINFWGSVYMTRFAIPYLRYSEGR  181

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             ++V +S  SW+P PRMSLY+A+KA +V  +E LR E G  I IT+ T G++ +E+ +GK 
Sbjct  182   IVVLSSAASWMPAPRMSLYAASKAAMVLFFEALRIEFGRDIKITLVTPGFVESEITQGKF  241

Query  973   MVEEGAEMQWKEEREVHA----TGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFS  1140
             + + G      + R+V         VE+ A+ IV+GACRG+ Y+  PSW+    L++VF 
Sbjct  242   IDKTGKVDVNPQMRDVEVGLTPVMKVEDCAEAIVNGACRGERYITVPSWFRVTYLWKVFC  301

Query  1141  PNVLNWTFRL  1170
             P+V+ W  RL
Sbjct  302   PDVVEWFLRL  311



>ref|XP_002463266.1| hypothetical protein SORBIDRAFT_02g040840 [Sorghum bicolor]
 gb|EER99787.1| hypothetical protein SORBIDRAFT_02g040840 [Sorghum bicolor]
Length=348

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/303 (44%), Positives = 192/303 (63%), Gaps = 15/303 (5%)
 Frame = +1

Query  295   PASLVMLALAWPTLCFISAC----EWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYA  462
             PA +  L L +P       C     WL+      E +  KVV+ITGASSGIGEQ+AY+YA
Sbjct  14    PAMVACLLLFYPPYYLFKTCYSFLSWLF-----PEDLAGKVVLITGASSGIGEQLAYQYA  68

Query  463   KRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDH  642
              +RA+L LVARRE+ LR +++ A  LGA++V++   DV   ++C RF+   I+ Y R+DH
Sbjct  69    LKRASLALVARRESSLRHVADRALELGARDVIVLPGDVSAPDDCNRFVQTAISHYDRLDH  128

Query  643   LVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESW  822
             LV  A +     F+E  D T +   +D+NFWG+V  T+ ALP+L++SRGR++V AS   W
Sbjct  129   LVCNAGIASVGAFQEIPDVTKYSSQLDVNFWGSVQTTFAALPHLKRSRGRIVVTASATGW  188

Query  823   LPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQW  1002
              P+PRMS Y+AA A L+N +ETLR E+GN +GITV T GWI +EM++GK + E G E++ 
Sbjct  189   NPVPRMSFYNAANAALINFFETLRTELGNQVGITVVTPGWIESEMSKGKYLKEHG-EVEV  247

Query  1003  KEEREVHATG--PVE---EFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFR  1167
              +E      G  PVE     AK +V  A +G+ Y+  P+W+    L+RVF+P V+   +R
Sbjct  248   DQEMRDAQIGLFPVEYAKNCAKAMVQAAQQGERYLTVPAWFRPMYLWRVFAPEVVEACYR  307

Query  1168  LLF  1176
             LL+
Sbjct  308   LLY  310



>ref|XP_009405178.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Musa 
acuminata subsp. malaccensis]
Length=354

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 180/269 (67%), Gaps = 4/269 (1%)
 Frame = +1

Query  382   EEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLI  561
             +E M  KVV+ITGASSGIGEQ+AYEYAKR A++ L ARRE  L  +S  AR LGA +VL+
Sbjct  43    KEDMTGKVVLITGASSGIGEQLAYEYAKRGASMALAARRERALETVSAKARELGAPDVLV  102

Query  562   TAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGN  741
              AAD+    E  R +  TI  +G+++HLV  A L  + +FEE +  T F  LMD+NFWG+
Sbjct  103   IAADISNPSEANRVVQATIGRFGQLNHLVCNAGLWCSCFFEEITSITAFTQLMDVNFWGS  162

Query  742   VYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGI  921
             VYPTY ALP+L+ +RG+++VNAS+   +P PRMSLY+A+KA ++  YETLR E+G+ + I
Sbjct  163   VYPTYYALPFLKNTRGKIVVNASMAGRVPTPRMSLYNASKAAMIRFYETLRSELGSDVRI  222

Query  922   TVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHA----TGPVEEFAKLIVSGACRGDEY  1089
             T+   G++ +E+ +GK + + G     +E R++       G  ++ A+LIV GACRGDEY
Sbjct  223   TIVNLGYVASELTKGKAVQKNGEVAINQEARDILVGPLPIGSTKKCAQLIVGGACRGDEY  282

Query  1090  VKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             + +PSWY  F +    +P ++ W  R  +
Sbjct  283   ISWPSWYKPFHVVMSLAPEIVIWFSRCFY  311



>ref|XP_010695411.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Beta 
vulgaris subsp. vulgaris]
Length=342

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/297 (45%), Positives = 191/297 (64%), Gaps = 7/297 (2%)
 Frame = +1

Query  301   SLVMLALAWPTLCFISACEWLYNL-YYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRAN  477
             + + + ++ P L F+     + NL Y   E +  KVV+ITGASSGIGE +AYEYA+R A 
Sbjct  16    TFMTILISLPPLLFLRFV--ISNLRYIFSENVAGKVVLITGASSGIGEHLAYEYARRGAC  73

Query  478   LVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTA  657
             L LVARR   L+ +++ A  LGA +V++  ADV K E+ + FI ET+  +GR+DHLVN A
Sbjct  74    LALVARRRQHLQNVAKTAHHLGAPDVIVIPADVSKLEDSKHFITETVEHFGRLDHLVNNA  133

Query  658   SLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPR  837
              +     FEE +  T    +M+ NFWG+VY T+ A+P+LR S+G++IV AS  +WLP PR
Sbjct  134   GIATMSMFEEFTCVTNAAPVMETNFWGSVYSTHFAIPHLRTSKGKIIVIASSGAWLPAPR  193

Query  838   MSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEERE  1017
             ++LYSA+KA LV  +ETLR E+G  IGIT+ T G I +E+ +GK +  EG  +  +E R+
Sbjct  194   LALYSASKAALVIFFETLRVELGGDIGITIVTPGLIESELTKGKFLSPEGKMVVDQEMRD  253

Query  1018  VHATG----PVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             V  +     PVE  +K IV   CRGD Y+  PSW    +L+++F P +L+W  R+L 
Sbjct  254   VQVSAVPVEPVERCSKAIVDSVCRGDRYLTVPSWMRVTVLWKMFLPEILDWCNRMLL  310



>ref|XP_008446259.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Cucumis 
melo]
Length=349

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/320 (42%), Positives = 201/320 (63%), Gaps = 14/320 (4%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PP + + L L  P    + +   L+ + + E++   KVV+ITGASSGIGE +AYEYAKR 
Sbjct  13    PPFTFITLFLLLPPYQALKSFLSLFCVLFTEDV-NGKVVLITGASSGIGEHLAYEYAKRG  71

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A LVLVARR+N L  +++ AR  G+ NV+   ADV K E+CRR I ET+N + R+DHLVN
Sbjct  72    ACLVLVARRQNLLEEVADIARYYGSPNVITIKADVSKFEDCRRVINETMNHFRRLDHLVN  131

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
              A++ H   FE+ +D T F  +MDIN+WG +Y T++A+PYLR SRG+++  ++  +WLP 
Sbjct  132   NAAITHLVLFEDIADITAFKQVMDINYWGAIYLTHLAIPYLRISRGQIVALSAPPAWLPA  191

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEG-AEMQWKE  1008
             PRMS+Y+++KA + +++ETLR E+   IG+T+ T G++ +E+ +GK +   G  E++   
Sbjct  192   PRMSIYNSSKAAIKSMFETLRVELAPDIGVTIVTPGFVESELTQGKALNAFGKVELRQDM  251

Query  1009  EREVHATGPV---EEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF-  1176
                +    PV   EE AK +V G CRG  YV  PSWY     ++ F P ++ W +R++  
Sbjct  252   RDALIGIVPVETAEECAKGVVRGVCRGYRYVTEPSWYKVLYYWKAFCPELVEWCYRIMTM  311

Query  1177  --------DNLSARTTSFIG  1212
                     D LS +T  + G
Sbjct  312   PAAGGSESDALSKQTLDYTG  331



>ref|XP_002511145.1| Corticosteroid 11-beta-dehydrogenase, putative [Ricinus communis]
 gb|EEF51747.1| Corticosteroid 11-beta-dehydrogenase, putative [Ricinus communis]
Length=349

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 139/309 (45%), Positives = 198/309 (64%), Gaps = 5/309 (2%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+N+ LNLV PP +   L    P          ++N  + E++   KVV+ITGASSGI
Sbjct  1     MDLINTFLNLVAPPFTFFSLCFLLPPYLIYKGFSSVFNFIFSEDVT-GKVVLITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE +AYEYAKR A L LVARRE RLR +   A   G+ +VL+  ADV K ++C R + ET
Sbjct  60    GEHLAYEYAKRGACLALVARREKRLRDVVYRAEEYGSPDVLMILADVQKVDDCNRLVEET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             I+ +GR+DHLVN A +      EE +D T F  +MD NFWG+ Y T+ A+PYLR +RG++
Sbjct  120   ISHFGRLDHLVNNAGISSAAMLEEITDITTFRTIMDTNFWGSAYITHFAVPYLRGTRGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IV AS  SWLP PR S+Y+A+KA LV  +ETLR E+G+ I + + T G+I +E+ +GK +
Sbjct  180   IVIASSASWLPSPRFSIYNASKAALVAFFETLRVELGSDIHVLIVTPGFIESELTQGKFL  239

Query  976   VEEGAEMQWKEEREVHATG-PVE---EFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSP  1143
             + EG     ++ R+V  +  PV+   E A+ IV+ A RGD+Y+  P W+    +++VF P
Sbjct  240   LAEGKVDLDQDARDVQVSAIPVQAVTECARSIVNSARRGDKYLTEPKWFRMTWIWKVFCP  299

Query  1144  NVLNWTFRL  1170
             + + W +RL
Sbjct  300   DAIEWNYRL  308



>ref|NP_001136546.1| corticosteroid 11-beta-dehydrogenase isozyme 1 isoform 1 [Zea 
mays]
 ref|XP_008650969.1| PREDICTED: corticosteroid 11-beta-dehydrogenase isozyme 1 isoform 
1 isoform X1 [Zea mays]
 gb|ACF80369.1| unknown [Zea mays]
 gb|ACF82139.1| unknown [Zea mays]
 gb|ACG48671.1| corticosteroid 11-beta-dehydrogenase isozyme 1 [Zea mays]
 tpg|DAA63855.1| TPA: corticosteroid 11-beta-dehydrogenase isozyme 1 isoform 1 
[Zea mays]
 tpg|DAA63856.1| TPA: corticosteroid 11-beta-dehydrogenase isozyme 1 isoform 2 
[Zea mays]
Length=349

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 190/302 (63%), Gaps = 13/302 (4%)
 Frame = +1

Query  295   PASLVMLALAWPTLCFISAC----EWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYA  462
             PA +  L L +P       C     WL+      E +  KVV+ITGASSGIGEQ+AY+YA
Sbjct  16    PAMVASLLLFYPPYYLFKTCYSFLSWLF-----PEDLAGKVVLITGASSGIGEQLAYQYA  70

Query  463   KRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDH  642
               RA+L LVARRE+ LR +++ A  LGA++V++   DV   ++C RF+   I+ Y R+DH
Sbjct  71    LNRASLALVARRESSLRHVADRALELGARDVVVLPGDVSTPDDCDRFVRTAISHYDRLDH  130

Query  643   LVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESW  822
             LV  A +     FEE  D T +   +D+NFWG+V  T+ ALP+L++SRGR++V AS   W
Sbjct  131   LVCNAGVASVGAFEEIPDVTSYSSQLDVNFWGSVQTTFAALPHLKRSRGRIVVTASATGW  190

Query  823   LPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQW  1002
              P+PRMS+Y+AA A L+N +ETLR E+GN +GITV T GW+ +EM+RGK + E G     
Sbjct  191   NPVPRMSIYNAANAALINFFETLRTELGNQVGITVVTPGWVESEMSRGKFLKEHGQVEVD  250

Query  1003  KEEREVH-ATGPVE---EFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRL  1170
             +E R+      PVE     AK +V  A +G+ Y+  P+W+    L+R+F+P V+   +RL
Sbjct  251   QEMRDAQIGLFPVEYAKNCAKAMVQAARQGERYLTVPAWFGAMYLWRLFAPEVVEACYRL  310

Query  1171  LF  1176
             L+
Sbjct  311   LY  312



>ref|XP_002266761.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B isoform X1 
[Vitis vinifera]
Length=326

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 196/302 (65%), Gaps = 10/302 (3%)
 Frame = +1

Query  301   SLVMLALAWPTLCFISACEWLYNL------YYGEEIMEDKVVVITGASSGIGEQIAYEYA  462
             SLV++ L   +LC+I    +L+ L      ++ +E M  KVV+ITGASSGIGEQ+AYEYA
Sbjct  12    SLVIIPLVLVSLCWILPLLFLFRLIFSFFQFFSQENMAGKVVLITGASSGIGEQMAYEYA  71

Query  463   KRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDH  642
             K+ A LV+VARR+ +L  ++  AR LG+ +V++   DV    EC++FI E I+ +GR+DH
Sbjct  72    KKGACLVIVARRKKKLEEVAAQARELGSPDVVVVCGDVSNINECKQFIDEAIHHFGRLDH  131

Query  643   LVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESW  822
             LVN A +   + FEE +D T F +LMD+NFWG VYPTY A+P+LR+++G++ VN+S  ++
Sbjct  132   LVNNAGVTGGYPFEEITDITKFALLMDVNFWGTVYPTYFAIPHLRKTKGKIFVNSSSCAF  191

Query  823   LPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQW  1002
             L  PR+S YSA+KA L+  +E LR E+  S+ IT+AT G I +EM+RGKI+ ++G  +  
Sbjct  192   LQPPRLSFYSASKAALIGFFEALRIELAPSVTITIATLGIIDSEMSRGKILSKDGELILS  251

Query  1003  KE-EREVHATGPV---EEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRL  1170
              E  + V    PV   E   K IV   CRG+ YV  P WY    L +   P ++ W + +
Sbjct  252   PENSKGVFEGFPVMNTEPATKSIVDSICRGERYVTEPQWYGAIHLLKDLCPEMVEWYYSI  311

Query  1171  LF  1176
             ++
Sbjct  312   MY  313



>gb|ACG24673.1| corticosteroid 11-beta-dehydrogenase isozyme 1 [Zea mays]
Length=349

 Score =   258 bits (658),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 190/302 (63%), Gaps = 13/302 (4%)
 Frame = +1

Query  295   PASLVMLALAWPTLCFISAC----EWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYA  462
             PA +  L L +P       C     WL+      E +  KVV+ITGASSGIGEQ+AY+YA
Sbjct  16    PAMVASLLLFYPPYYLFKTCYSFLSWLF-----PEDLAGKVVLITGASSGIGEQLAYQYA  70

Query  463   KRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDH  642
               RA+L LVARRE+ LR +++ A  LGA++V++   DV   ++C RF+   I+ Y R+DH
Sbjct  71    LNRASLALVARRESSLRHVADRALELGARDVVVLPGDVSAPDDCDRFVRTAISHYDRLDH  130

Query  643   LVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESW  822
             LV  A +     FEE  D T +   +D+NFWG+V  T+ ALP+L++SRGR++V AS   W
Sbjct  131   LVCNAGVASVGAFEEIPDVTSYSSQLDVNFWGSVQTTFAALPHLKRSRGRIVVTASATGW  190

Query  823   LPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQW  1002
              P+PRMS+Y+AA A L+N +ETLR E+GN +GITV T GW+ +EM+RGK + E G     
Sbjct  191   NPVPRMSIYNAANAALINFFETLRTELGNQVGITVVTPGWVESEMSRGKFLKEHGQVEVD  250

Query  1003  KEEREVH-ATGPVE---EFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRL  1170
             +E R+      PVE     AK +V  A +G+ Y+  P+W+    L+R+F+P V+   +RL
Sbjct  251   QEMRDAQIGLFPVEYAKNCAKAMVQAARQGERYLTVPAWFGAMYLWRLFAPEVVEACYRL  310

Query  1171  LF  1176
             L+
Sbjct  311   LY  312



>ref|XP_004297522.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Fragaria vesca subsp. vesca]
Length=348

 Score =   258 bits (658),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/272 (46%), Positives = 181/272 (67%), Gaps = 4/272 (1%)
 Frame = +1

Query  400   KVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVV  579
             KV++ITGASSGIGE +AYEYA R A L LVARRE+RL+ ++  A  +G+ +VLI  ADV 
Sbjct  48    KVILITGASSGIGEHLAYEYASRGACLALVARREHRLQQVANRAVSIGSPDVLIIPADVS  107

Query  580   KEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYV  759
             K E+C+RF+  T+N +GR+DHLVN A +     FEE  D T     MD+NFWG+VY +Y 
Sbjct  108   KVEDCKRFVDATVNHFGRLDHLVNNAGIAPICMFEETPDVTKLAPAMDVNFWGSVYSSYF  167

Query  760   ALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHG  939
             A+P+L+QS+GR+I  +S   WL  PR+S+YSA+K  +++ YETLR E G+ +GIT+ T G
Sbjct  168   AIPHLKQSQGRIIGISSAAGWLRTPRLSMYSASKTAVISFYETLRVETGDEVGITLVTPG  227

Query  940   WIGTEMARGKIMVEEGAEMQWKEEREVHAT----GPVEEFAKLIVSGACRGDEYVKYPSW  1107
              + +EM +GK + +EG  +  +E R+   +     PV+E A+ IV GAC G +Y+  P+W
Sbjct  228   LVESEMTQGKFLNKEGRLVLDQELRDAEMSLMPVLPVKEAAEAIVDGACEGVKYLTVPAW  287

Query  1108  YDTFLLYRVFSPNVLNWTFRLLFDNLSARTTS  1203
                 + ++VFSP  L W  R+L  + S   T+
Sbjct  288   VRQSIYWKVFSPETLEWCNRILLMSRSGDETN  319



>ref|XP_008392822.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Malus 
domestica]
Length=349

 Score =   257 bits (657),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 140/313 (45%), Positives = 197/313 (63%), Gaps = 9/313 (3%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNL--YYGEEIMEDKVVVITGASS  429
             MD++N VLN+ +PP SL  L    PT  F   C+ L +   +   E +  KV++ITGASS
Sbjct  1     MDIINKVLNVTIPPMSLAWLLFVLPTYLF---CKLLLSAARHVFSEDVGGKVILITGASS  57

Query  430   GIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFIL  609
             GIGE +AYEYA+R A L LVARRENRLR ++  A   G+ +VL   ADV + E+C+RF+ 
Sbjct  58    GIGEHLAYEYARRGACLALVARRENRLRDVANTAICFGSPDVLAITADVSRVEDCKRFVD  117

Query  610   ETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRG  789
              T+N +GR+DHLVN A +     FEE +D T     MDINFWG+VY TY A+P+L++S G
Sbjct  118   VTVNHFGRLDHLVNNAGIVPVCLFEETTDVTNLAPAMDINFWGSVYGTYFAIPHLKRSGG  177

Query  790   RVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGK  969
             R++   S   WL  PR+S+Y A KA  +  YETL+ E+G  +GIT+ T G I +E+++GK
Sbjct  178   RIVAITSSAGWLRAPRLSMYGATKAAAIAFYETLKVEIGREVGITIVTPGMIESEISQGK  237

Query  970   IMVEEGAEMQWKEEREVHAT----GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVF  1137
              + +EG  +  +E R++  +     PV+E AK IV  ACRG+ Y+  P+W      ++VF
Sbjct  238   FLSKEGQVVLDQELRDLEVSIIPILPVKEAAKSIVDSACRGENYLTVPAWIWQSFYWKVF  297

Query  1138  SPNVLNWTFRLLF  1176
              P +L W  R L 
Sbjct  298   FPEILEWCNRTLL  310



>ref|XP_010536612.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B [Tarenaya 
hassleriana]
Length=349

 Score =   257 bits (657),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 125/267 (47%), Positives = 178/267 (67%), Gaps = 4/267 (1%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E ++ KVV+ITGASSGIGE +AYEY  R A L L ARR+NRL+ ++E A  LG+ +V+  
Sbjct  43    ENLQGKVVIITGASSGIGEHLAYEYGSRGACLALAARRKNRLQEVAELALELGSPDVITV  102

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
              ADV + E+CRR + +TI+ +GR+DHLVN A +     FE  +D T    +MDINFWG V
Sbjct  103   LADVSQPEDCRRIVDDTISHFGRLDHLVNNAGIASMAMFENVTDITTTRTVMDINFWGPV  162

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             Y T  ALPYL+Q+ G+++V +S  +WL  PRMS+Y+A+KA L N ++TLR E+G  IGIT
Sbjct  163   YMTRAALPYLKQANGKIVVMSSAAAWLTAPRMSIYNASKAALWNFFDTLRIELGRDIGIT  222

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEEREVH----ATGPVEEFAKLIVSGACRGDEYV  1092
             + T G+I +E+ +GK + EEG  +  ++ R+V       G V + A+ IV   CRG +YV
Sbjct  223   IVTPGYIESELTQGKYLSEEGEMIVDQDMRDVQIGVCPVGSVTDCARAIVRAVCRGQKYV  282

Query  1093  KYPSWYDTFLLYRVFSPNVLNWTFRLL  1173
               PSW+    L++VF P ++ +  RLL
Sbjct  283   TEPSWFKVTYLWKVFCPEIIEYGCRLL  309



>gb|EYU23068.1| hypothetical protein MIMGU_mgv1a009201mg [Erythranthe guttata]
Length=349

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/311 (45%), Positives = 191/311 (61%), Gaps = 5/311 (2%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+++ LNL  PP +   L    P          +    + E++   KVVVITGASSGI
Sbjct  1     MDLIHTFLNLAAPPFTFFSLMFLLPPFQIFKFFLSVLGTLFSEDV-AGKVVVITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE +AYEYAKR A LVL ARRE  L+ ++E AR  G+ +V++  ADV K E+CR+ I  T
Sbjct  60    GESLAYEYAKRGACLVLAARRERSLQEVAETARDCGSPDVVVVRADVSKVEDCRKIIDHT  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             +N +GR+DHLVN A +      EE  D T F  +MD+NFWG VY T  A PYLR SRGR+
Sbjct  120   MNHFGRLDHLVNNAGITSVAMLEEVDDVTDFRAIMDVNFWGFVYMTRFAAPYLRNSRGRI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +V +S  SWLP PRMS Y+A+KA +   +ETLR E G  IGIT+ T G+I +E+ +GK +
Sbjct  180   VVISSSASWLPSPRMSFYNASKAAIAQFFETLRVEFGPDIGITLVTPGFIESELTQGKFL  239

Query  976   VEEGAEMQWKEEREVHAT----GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSP  1143
              +EG  +  +E R+V         VE  AK IV  A RG+ Y+  P+W     L+++F P
Sbjct  240   NKEGKLVVDQEMRDVQVNMFPVQRVESCAKSIVRSAIRGERYLTEPAWVRVTHLWKLFMP  299

Query  1144  NVLNWTFRLLF  1176
               + W +RL++
Sbjct  300   EAMEWMYRLMY  310



>ref|XP_009760328.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nicotiana 
sylvestris]
Length=352

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/271 (48%), Positives = 179/271 (66%), Gaps = 5/271 (2%)
 Frame = +1

Query  373   YYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKN  552
             ++ E++   KVV+ITGASSGIGE +AYEYA+R A L + ARRE  LR ++E A  LG+ +
Sbjct  43    FFSEDV-SGKVVIITGASSGIGEYLAYEYARRGACLTIAARREKSLREVAERALDLGSPD  101

Query  553   VLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINF  732
             VL+  ADV K ++C+R + +T++ +GR+DHLVN A +     F+E  + T F  +MDINF
Sbjct  102   VLVVPADVSKVDDCKRIVDKTMSHFGRLDHLVNNAGVTAVSLFDETEEITNFRSIMDINF  161

Query  733   WGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNS  912
             WG+VY T  A+PYLR S GRVIV +S  SW+P PR+SLY A+KA +   ++TLR E G  
Sbjct  162   WGSVYMTRFAIPYLRYSEGRVIVLSSSASWVPAPRLSLYCASKAAMAQFFDTLRVEFGQD  221

Query  913   IGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHA----TGPVEEFAKLIVSGACRG  1080
             I IT+ T G++ +EM +GK M + G      + R V         VEE AK IV+GACRG
Sbjct  222   IKITLVTPGYVESEMTQGKFMDKTGKVDVNPQMRNVQVGIIPVVKVEECAKAIVNGACRG  281

Query  1081  DEYVKYPSWYDTFLLYRVFSPNVLNWTFRLL  1173
             + YV  PSW+    L++VF P V++W  RLL
Sbjct  282   ERYVTVPSWFRVTYLWKVFCPEVVDWILRLL  312



>ref|NP_001066740.1| Os12g0464400 [Oryza sativa Japonica Group]
 dbj|BAF29759.1| Os12g0464400, partial [Oryza sativa Japonica Group]
Length=393

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/326 (44%), Positives = 204/326 (63%), Gaps = 8/326 (2%)
 Frame = +1

Query  214   KAGRQEKKSKLIKMMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIM  393
             + GR+E + K   M+DLVN VLN V  PA +  L L +P            +  + +++ 
Sbjct  33    RGGRKEGRKK-ATMVDLVNGVLNWVATPAMVASLLLFYPPYYLFKTVHSFLSYLFPDDLA  91

Query  394   EDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAAD  573
               KVV+ITGASSGIGEQ+AY YA  RA+LVLVARRE  LR +++ A  LGA +V+I   D
Sbjct  92    R-KVVLITGASSGIGEQLAYNYALNRASLVLVARREWSLRKVADQAFELGAPDVIILPGD  150

Query  574   VVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPT  753
             V   E+C+RF+   I+ YGR+DHLV  A +     F+E  D T +    D+NFWG+V  T
Sbjct  151   VANPEDCKRFVQTAIDHYGRLDHLVCNAGIASVGAFQEIPDVTNYSSQFDVNFWGSVQST  210

Query  754   YVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVAT  933
             + ALP+L++SRGR++V AS   W P+PRM+ Y+AA A L+N YETLR E+G+ +GIT+ T
Sbjct  211   FEALPHLKRSRGRIVVTASATGWNPVPRMTFYNAANAALINFYETLRTELGSQVGITIVT  270

Query  934   HGWIGTEMARGKIMVEEGAEMQWKEEREVHATG--PVE---EFAKLIVSGACRGDEYVKY  1098
              GWI +EM++GK + + G EM+  +E      G  PVE     AK +V    +G   +  
Sbjct  271   PGWIESEMSKGKFLKDHG-EMEVDQEMRDAQIGLFPVEYAKNCAKAMVQAVRQGKRCLTV  329

Query  1099  PSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             P W+ T  L+RVF+P V+ + +RLL+
Sbjct  330   PPWFSTMYLWRVFAPEVVEFCYRLLY  355



>ref|XP_009629548.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nicotiana 
tomentosiformis]
Length=348

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/271 (48%), Positives = 179/271 (66%), Gaps = 5/271 (2%)
 Frame = +1

Query  373   YYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKN  552
             ++ E++   KVV+ITGASSGIGE +AYEYA+R A L + ARRE  LR ++E A  LG+ +
Sbjct  43    FFSEDV-SGKVVIITGASSGIGEYLAYEYARRGACLTIAARREKSLREVAERALDLGSPD  101

Query  553   VLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINF  732
             VL+  ADV K E+C+R + +T++ +GR+DHLVN A +     F+E  + T F  +MDINF
Sbjct  102   VLVVPADVSKVEDCKRIVDKTMSHFGRLDHLVNNAGVTAVSLFDETEEITNFRSVMDINF  161

Query  733   WGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNS  912
             WG+VY T  A+PYLR S GRVIV +S  SW+P PR+SLY A+KA +   ++TLR E G  
Sbjct  162   WGSVYMTRFAIPYLRYSEGRVIVLSSSASWVPTPRLSLYCASKAAMAQFFDTLRVEFGQD  221

Query  913   IGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHA----TGPVEEFAKLIVSGACRG  1080
             I IT+ T G++ +EM +GK + + G      + R+V         VEE AK IV+GACRG
Sbjct  222   IKITLVTPGYVESEMTQGKFINKTGKVDVKTQMRDVQVGIIPVVKVEECAKTIVNGACRG  281

Query  1081  DEYVKYPSWYDTFLLYRVFSPNVLNWTFRLL  1173
             + YV  PSW     L++VF P V++W  RLL
Sbjct  282   ERYVTVPSWVRVTYLWKVFCPEVVDWILRLL  312



>ref|XP_010039131.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Eucalyptus 
grandis]
 gb|KCW49098.1| hypothetical protein EUGRSUZ_K02704 [Eucalyptus grandis]
Length=369

 Score =   256 bits (655),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 132/287 (46%), Positives = 182/287 (63%), Gaps = 5/287 (2%)
 Frame = +1

Query  328   PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             P   FI    + +   + E++   KVV+ITGASSGIGE +AY YAKR A L LVARRENR
Sbjct  43    PPYLFIKLLLFAFRSAFSEDV-AGKVVLITGASSGIGEHLAYSYAKRGACLALVARRENR  101

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             L  ++  A  LG+ +V++   DV + E+C RF+  TI+ +GR+DHLV  A +     FE+
Sbjct  102   LTDVANIAYQLGSPDVVVIRGDVTRAEDCERFVNRTIDHFGRLDHLVTNAGVSPMCMFED  161

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
               D T    +MDINFWG+VY +Y ALPYL++SRG+++V AS   WLP PRMS Y+A+KA 
Sbjct  162   CPDITKLAPVMDINFWGSVYSSYFALPYLKRSRGKIVVIASAAGWLPAPRMSFYNASKAA  221

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVH-ATGPVEE  1044
             L++ YETLR E+G+ I IT+ T G I +EM +GK + +EG  +   + R+V     P+  
Sbjct  222   LISFYETLRTELGSEITITIVTPGLIESEMTQGKFLSKEGRMVLDPQLRDVQIGVMPIRS  281

Query  1045  F---AKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
                 A+ IV GACRGD Y+  P+W  +   ++VF P VL W   LL 
Sbjct  282   VGAAAEEIVKGACRGDNYLTEPAWVKSTFYWKVFCPEVLEWCNWLLL  328



>ref|XP_004162136.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cucumis sativus]
Length=349

 Score =   255 bits (652),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 129/299 (43%), Positives = 185/299 (62%), Gaps = 5/299 (2%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PP + V L    P    +    +L    + E++   KVV+ITGASSGIGE +AY+YA+R 
Sbjct  13    PPITFVSLGFFLPPYVVLKYFLYLVRGIFTEDV-AGKVVLITGASSGIGEHLAYQYAQRG  71

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A L LV RR++ L  +++ AR  G+ +V+   ADV K ++ RR I +TIN +GR+DHLVN
Sbjct  72    ARLALVDRRKSPLHEVADIARYYGSPDVITIPADVSKLQDSRRIIYDTINHFGRLDHLVN  131

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
              A + +   FEE  D T F  +MD N+WG+VY T  A+PYLR +RG++IV +S  +WLP 
Sbjct  132   NAGVANMTLFEEMKDITSFNQIMDTNYWGSVYTTQFAIPYLRNNRGKIIVLSSTAAWLPA  191

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
             PRMS+Y+A KA L +++ETLR E+   IGIT+ T G++ +E+ +GK +   GA    ++ 
Sbjct  192   PRMSIYNATKAALKSMFETLRVELAPDIGITIVTPGFVESELTKGKALYSHGAMEVHQDV  251

Query  1012  REVHATG----PVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             R+          VE  AK IV   CRGD Y+  PSWY++    +VF P VL W +R+  
Sbjct  252   RDALIGAIPVETVEACAKAIVRSVCRGDRYLTEPSWYNSVYYLKVFCPEVLEWCYRMFM  310



>ref|XP_004145221.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cucumis sativus]
 ref|XP_004153123.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cucumis sativus]
Length=349

 Score =   255 bits (652),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 129/299 (43%), Positives = 185/299 (62%), Gaps = 5/299 (2%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PP + V L    P    +    +L    + E++   KVV+ITGASSGIGE +AY+YA+R 
Sbjct  13    PPITFVSLGFFLPPYVVLKYFLYLVRGIFTEDV-AGKVVLITGASSGIGEHLAYQYAQRG  71

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A L LV RR++ L  +++ AR  G+ +V+   ADV K ++ RR I +TIN +GR+DHLVN
Sbjct  72    ARLALVDRRKSPLHEVADIARYYGSPDVITIPADVSKLQDSRRIIYDTINHFGRLDHLVN  131

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
              A + +   FEE  D T F  +MD N+WG+VY T  A+PYLR +RG++IV +S  +WLP 
Sbjct  132   NAGVANMTLFEEMKDITSFNQIMDTNYWGSVYTTQFAIPYLRNNRGKIIVLSSTAAWLPA  191

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
             PRMS+Y+A KA L +++ETLR E+   IGIT+ T G++ +E+ +GK +   GA    ++ 
Sbjct  192   PRMSIYNATKAALKSMFETLRVELAPDIGITIVTPGFVESELTKGKALYSHGAMEVHQDV  251

Query  1012  REVHATG----PVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             R+          VE  AK IV   CRGD Y+  PSWY++    +VF P VL W +R+  
Sbjct  252   RDALIGAIPVETVEACAKAIVRSVCRGDRYLTEPSWYNSVYYLKVFCPEVLEWCYRIFM  310



>gb|ABS28874.1| steroleosin-A [Arachis hypogaea]
 gb|ABX38844.1| steroleosin A [Arachis hypogaea]
Length=349

 Score =   255 bits (651),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/288 (46%), Positives = 184/288 (64%), Gaps = 9/288 (3%)
 Frame = +1

Query  325   WPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARREN  504
             W     +S   WL +     E +  KVV ITGASSGIGE +AYEYAKR A L L ARRE 
Sbjct  28    WGLKFMVSILSWLLS-----ENVAGKVVHITGASSGIGEYLAYEYAKRGACLALSARRET  82

Query  505   RLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFE  684
              L  +++ AR LG+ +V++  ADV K E+C R I +T+N +GR+DHLVN A++     FE
Sbjct  83    ALHQVADTARHLGSPDVIVMRADVSKPEDCMRLIDQTVNHFGRLDHLVNNAAISIATLFE  142

Query  685   EASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKA  864
             E  D +    +M+ NFWG+VY T  AL +LR+SRG+++V +SV+SWLP PR  +YSA+KA
Sbjct  143   ETPDISNLRPIMETNFWGSVYTTRYALQHLRKSRGKIVVMSSVDSWLPAPRRHIYSASKA  202

Query  865   GLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHAT----G  1032
              LV+LYETLR EVG+ IGIT+ T G+I +E+ +GK +  +G     ++ R+V  +    G
Sbjct  203   ALVSLYETLRVEVGSEIGITIVTPGYIESEITKGKFLSAQGEVDVDQDLRDVEVSAVPVG  262

Query  1033  PVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
              V   A+ I+    RGD  +  PSW+    L ++  P +L WTFRLL+
Sbjct  263   SVSGCAESIIKSTLRGDRCLTVPSWFRMTYLIKLLCPELLEWTFRLLY  310



>ref|XP_008239509.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Prunus 
mume]
Length=343

 Score =   255 bits (651),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 133/303 (44%), Positives = 189/303 (62%), Gaps = 13/303 (4%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCF----ISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEY  459
             PP SL       P   F    +SA   ++      E +  KVV+ITGASSGIGE +AYEY
Sbjct  14    PPISLTFFLFLLPPYLFYKFLLSAVRSVFT-----EDVAGKVVLITGASSGIGEHMAYEY  68

Query  460   AKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVD  639
             A+R A L LV RREN L++++  A  +G+ +VL+  ADV K E CRRF+   +N +GR+D
Sbjct  69    ARRGACLALVDRRENLLQSVASRAMSIGSPDVLVIPADVSKVENCRRFVDVAVNHFGRLD  128

Query  640   HLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVES  819
             HLVN A +     FEEA+D T     MD NFWG+VY TY A+P+L++SRG+++  AS   
Sbjct  129   HLVNNAGITPVCLFEEATDVTKIAPAMDTNFWGSVYGTYFAIPHLKRSRGKIVGIASSAG  188

Query  820   WLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQ  999
             WL +PR+SLY A K+ +++ YETLR E+G  +GIT+ T G + +EM +GK + +EG  + 
Sbjct  189   WLRVPRLSLYGATKSAVISFYETLRVEIGREVGITIVTPGLVESEMTKGKFLSKEGQLVL  248

Query  1000  WKEEREVHAT----GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFR  1167
              +E R+V  +     PV+E AK IV  ACRG+ Y+  P+W      ++VF P +L W+  
Sbjct  249   DQELRDVEVSIMPILPVKEAAKSIVDSACRGENYLTVPAWVWHSFYWKVFFPELLEWSNH  308

Query  1168  LLF  1176
             +L 
Sbjct  309   MLL  311



>ref|XP_004145220.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Cucumis sativus]
 ref|XP_004153124.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Cucumis sativus]
 ref|XP_004162135.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Cucumis sativus]
 gb|KGN64428.1| hypothetical protein Csa_1G051660 [Cucumis sativus]
Length=349

 Score =   255 bits (651),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 129/298 (43%), Positives = 191/298 (64%), Gaps = 5/298 (2%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PP + + L L  P    + +   L  + + E +   KVV+ITGASSGIGE +AYEYAKR 
Sbjct  13    PPFTFISLFLLLPPYQALKSFLSLLGVLFTENV-HGKVVLITGASSGIGEHLAYEYAKRG  71

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A LVLVARR+N L  +++ AR  G+  V+   ADV K E+CRR I ET+N +GR+DHLVN
Sbjct  72    ACLVLVARRQNLLEEVADIARYYGSPGVITIKADVSKFEDCRRVINETMNNFGRLDHLVN  131

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
              A++ H   FE+ +D   F  +MDIN+WG VY T++A+PYLR SRG+++  ++  +WLP 
Sbjct  132   NAAITHLVLFEDIADIAAFKQVMDINYWGAVYMTHLAIPYLRYSRGKIVALSAPPAWLPS  191

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEG-AEMQWKE  1008
             PRMS+Y+++KA + +++ETLR E+   IG+T+ T G++ +E+ +GK +   G  E++   
Sbjct  192   PRMSIYNSSKAAIKSMFETLRVELAPEIGVTIVTPGFVESELTQGKALNAFGKVELRQDM  251

Query  1009  EREVHATGPVE---EFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLL  1173
                +    PVE   E AK +V G CRG  YV  PSWY     ++ F P ++ W +R++
Sbjct  252   RDALIGIVPVETADECAKGVVRGVCRGYRYVTEPSWYKVLFYWKAFCPELIEWCYRIM  309



>ref|XP_010913000.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Elaeis 
guineensis]
Length=349

 Score =   254 bits (650),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 124/271 (46%), Positives = 185/271 (68%), Gaps = 4/271 (1%)
 Frame = +1

Query  358   WLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARL  537
             W+    + EE M+ KVV+ITGASSGIGE IAY+YA R A+LVLVARRE+ L ++++ A  
Sbjct  35    WILVRPFSEEDMKGKVVLITGASSGIGEHIAYQYAVRGASLVLVARREHALNSVAKTAIE  94

Query  538   LGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPIL  717
             LGA +VL+  AD+    E +R + ETI  +GR++HLV  A +  +  FE+ ++ + F  +
Sbjct  95    LGAPDVLVKPADISIPNESKRIMEETIAHFGRLNHLVVNAGIWSSCLFEDITNISAFTQV  154

Query  718   MDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRF  897
             MD+NFWG+VYPTY A+P+L+ S G +IV AS+   +P  RMS Y+A+KA L+  YETLR 
Sbjct  155   MDVNFWGSVYPTYYAIPHLKTSHGNIIVTASMAGHVPTARMSFYNASKAALIRFYETLRS  214

Query  898   EVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVH----ATGPVEEFAKLIVS  1065
             E+G+ I IT+ T G++ +E+ +GK++ +EG     ++ R+V       G  ++ A++IV 
Sbjct  215   ELGSEIRITIITPGYVESEITQGKVLKKEGEVGIDEDARDVQLGPLPVGSTKKCAEIIVD  274

Query  1066  GACRGDEYVKYPSWYDTFLLYRVFSPNVLNW  1158
             GAC+GDEYV +PSW+  F +   F+P V+NW
Sbjct  275   GACKGDEYVTWPSWFKPFYMVMCFAPEVMNW  305



>ref|XP_010695677.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Beta 
vulgaris subsp. vulgaris]
Length=348

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/311 (44%), Positives = 194/311 (62%), Gaps = 6/311 (2%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+N+ LNL  PP + V L L  P    +     ++  +Y E++   KVV+ITGASSGI
Sbjct  1     MDLINTFLNLTAPPFTFVSLCLLLPPFQILKFILSIFASFYPEDVF-GKVVLITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE +AYEYAKR A LVL ARRE  LR +++    +GA + ++ + DV K E+CRR I  T
Sbjct  60    GEHLAYEYAKRGACLVLSARREGSLREVADLCLEMGAPDAIVVSGDVAKVEDCRRIIDAT  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             I+ YGR+DHLVN A +     F+E  D T    +MDINFWG+VY T  A+P+LR + G++
Sbjct  120   ISRYGRLDHLVNNAGVVGVNQFDELEDVTRMRPVMDINFWGSVYITRFAIPHLRYTGGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +V +S  SW+P+PR S Y+A+KA ++  +ETLR E+G+ + IT+ T G I +E  +GK+ 
Sbjct  180   VVMSSSASWMPVPRESFYNASKAAMLAFFETLRVELGSDVKITIVTPGVIESEFTKGKVW  239

Query  976   VEEGAEMQWKEEREVHA----TGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSP  1143
              E G ++  +E R+V       G VE  AK I+   CRGD YV  P+W+      ++  P
Sbjct  240   TEGGMKVD-QELRDVQVNVIPVGTVEGTAKSIIRSVCRGDRYVTTPAWFKVTYFLKMLCP  298

Query  1144  NVLNWTFRLLF  1176
              VL W +R LF
Sbjct  299   EVLEWAYRFLF  309



>dbj|BAK03741.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/280 (46%), Positives = 182/280 (65%), Gaps = 4/280 (1%)
 Frame = +1

Query  400   KVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVV  579
             KVV+ITGASSGIGE +AYEYAKR ANL LVARRE  LR +++NA  LG+ NVL+  ADV 
Sbjct  65    KVVLITGASSGIGEHLAYEYAKRGANLALVARREASLREVADNASALGSPNVLVLPADVS  124

Query  580   KEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYV  759
             K ++CR+F+ +T+ ++GR+DHLVN AS+     FEE  D   F  +MDINFWG+VYPT  
Sbjct  125   KPDDCRKFMDDTVAYFGRLDHLVNNASIWQVCKFEEVEDVHYFRTVMDINFWGHVYPTRY  184

Query  760   ALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHG  939
             A+P+L+++ GR++   S  S++ + R + Y+A+KA  +N Y+TLR E+G  + IT    G
Sbjct  185   AIPHLKKTHGRIVGVTSNSSYIFIGRNTFYNASKAAALNFYDTLRMELGGDVHITEIVPG  244

Query  940   WIGTEMARGKIMVEEGAEMQWKEERE-VHATGPVEE---FAKLIVSGACRGDEYVKYPSW  1107
              + +E+ +GK++ +EG     ++ER+ +H   P E    FAK +V   CRG+ YV  P W
Sbjct  245   VVESEITKGKMLTKEGEMKVDQDERDAIHGPTPAEPVAAFAKTVVRDVCRGERYVFEPRW  304

Query  1108  YDTFLLYRVFSPNVLNWTFRLLFDNLSARTTSFIGTGRPI  1227
             Y    L+RV  P +L+W+ RLL      R  +    GR I
Sbjct  305   YMAVYLFRVCFPEILSWSSRLLTVKTLGRPATTDTVGRQI  344



>ref|XP_008446273.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Cucumis 
melo]
Length=351

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 178/278 (64%), Gaps = 4/278 (1%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E +  KVV+ITGASSGIGE +AYEYAKR A L LVARRE+RLR ++E A +LG+   L+ 
Sbjct  43    EDVAGKVVLITGASSGIGEHVAYEYAKRGAYLALVARREHRLREVAEVAEILGSPFALVI  102

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
              ADV K ++C+R +  T+  +GR+DHLVN A +     FEE  D      +MD +FWG V
Sbjct  103   HADVSKVDDCKRCVQTTLAHFGRLDHLVNNAGITSINLFEEYDDPRNVASVMDTDFWGTV  162

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             Y TY A+PYL+Q+RG++I  AS  +WLP PR+S Y+A+KA +++ YETLR E+G  +GIT
Sbjct  163   YCTYYAIPYLKQTRGKIIGIASSAAWLPTPRLSFYTASKAAVISFYETLRVEIGRDVGIT  222

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEERE-VHATGPVEEF---AKLIVSGACRGDEYV  1092
             + T G   +EM +GK M E+G     +E R+ V +  P+E     A+ IV G CRGDEYV
Sbjct  223   IVTPGLTESEMTQGKFMFEDGKMYLDQELRDAVMSVMPIEAVGSAAEAIVKGGCRGDEYV  282

Query  1093  KYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLSARTTSF  1206
               P W      +R+F P ++ W   L     S+ T SF
Sbjct  283   TEPPWMRMTFYWRMFLPEMVEWLNHLFIMTGSSPTESF  320



>emb|CBI38150.3| unnamed protein product [Vitis vinifera]
Length=279

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 177/266 (67%), Gaps = 4/266 (2%)
 Frame = +1

Query  391   MEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAA  570
             M  KVV+ITGASSGIGEQ+AYEYAK+ A LV+VARR+ +L  ++  AR LG+ +V++   
Sbjct  1     MAGKVVLITGASSGIGEQMAYEYAKKGACLVIVARRKKKLEEVAAQARELGSPDVVVVCG  60

Query  571   DVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYP  750
             DV    EC++FI E I+ +GR+DHLVN A +   + FEE +D T F +LMD+NFWG VYP
Sbjct  61    DVSNINECKQFIDEAIHHFGRLDHLVNNAGVTGGYPFEEITDITKFALLMDVNFWGTVYP  120

Query  751   TYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVA  930
             TY A+P+LR+++G++ VN+S  ++L  PR+S YSA+KA L+  +E LR E+  S+ IT+A
Sbjct  121   TYFAIPHLRKTKGKIFVNSSSCAFLQPPRLSFYSASKAALIGFFEALRIELAPSVTITIA  180

Query  931   THGWIGTEMARGKIMVEEGAEMQWKE-EREVHATGPV---EEFAKLIVSGACRGDEYVKY  1098
             T G I +EM+RGKI+ ++G  +   E  + V    PV   E   K IV   CRG+ YV  
Sbjct  181   TLGIIDSEMSRGKILSKDGELILSPENSKGVFEGFPVMNTEPATKSIVDSICRGERYVTE  240

Query  1099  PSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             P WY    L +   P ++ W + +++
Sbjct  241   PQWYGAIHLLKDLCPEMVEWYYSIMY  266



>gb|ABA98146.2| oxidoreductase, short chain dehydrogenase/reductase family protein, 
expressed [Oryza sativa Japonica Group]
Length=349

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/299 (44%), Positives = 187/299 (63%), Gaps = 7/299 (2%)
 Frame = +1

Query  295   PASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRA  474
             PA +  L L +P            +  + +++   KVV+ITGASSGIGEQ+AY YA  RA
Sbjct  15    PAMVASLLLFYPPYYLFKTVHSFLSYLFPDDLAR-KVVLITGASSGIGEQLAYNYALNRA  73

Query  475   NLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNT  654
             +LVLVARRE  LR +++ A  LGA +V+I   DV   E+C+RF+   I+ YGR+DHLV  
Sbjct  74    SLVLVARREWSLRKVADQAFELGAPDVIILPGDVANPEDCKRFVQTAIDHYGRLDHLVCN  133

Query  655   ASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLP  834
             A +     F+E  D T +    D+NFWG+V  T+ ALP+L++SRGR++V AS   W P+P
Sbjct  134   AGIASVGAFQEIPDVTNYSSQFDVNFWGSVQSTFEALPHLKRSRGRIVVTASATGWNPVP  193

Query  835   RMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEER  1014
             RM+ Y+AA A L+N YETLR E+G+ +GIT+ T GWI +EM++GK + + G EM+  +E 
Sbjct  194   RMTFYNAANAALINFYETLRTELGSQVGITIVTPGWIESEMSKGKFLKDHG-EMEVDQEM  252

Query  1015  EVHATG--PVE---EFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
                  G  PVE     AK +V    +G   +  P W+ T  L+RVF+P V+ + +RLL+
Sbjct  253   RDAQIGLFPVEYAKNCAKAMVQAVRQGKRCLTVPPWFSTMYLWRVFAPEVVEFCYRLLY  311



>ref|XP_004153125.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cucumis sativus]
 gb|KGN64429.1| hypothetical protein Csa_1G051670 [Cucumis sativus]
Length=347

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/278 (47%), Positives = 178/278 (64%), Gaps = 4/278 (1%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E +  KVV+ITGASSGIGE +AYEYAKR A L LVARRE+RLR ++E A +LG+   L+ 
Sbjct  43    EDVAGKVVLITGASSGIGEHVAYEYAKRGAYLALVARREHRLREVAEVAEILGSPFALLI  102

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
              ADV   ++C+R +  T+  +GR+DHLVN A +     FEE  D      +MD +FWG V
Sbjct  103   HADVSNVDDCKRCVQTTLTHFGRLDHLVNNAGITSINLFEEYDDPRNVASVMDTDFWGTV  162

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             Y TY A+PYL+Q+RG++I  AS  +WLP PR+S YSA+KA +++ YETLR E+G  IGIT
Sbjct  163   YCTYYAIPYLKQTRGKIIGIASSAAWLPTPRLSFYSASKAAVISFYETLRVEIGRDIGIT  222

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEERE-VHATGPVEEF---AKLIVSGACRGDEYV  1092
             + T G   +EM +GK M E+G     +E R+ V +  P+E     AK IV+G CRGDEYV
Sbjct  223   IVTPGLTESEMTQGKFMFEDGKMYLDQELRDAVMSVMPIEAVGSAAKAIVNGGCRGDEYV  282

Query  1093  KYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLSARTTSF  1206
               P W      +++F P ++ W   L     S+ T SF
Sbjct  283   TEPPWIRMTFYWKMFLPEMVEWLNYLFIMTGSSPTESF  320



>gb|ABI20736.1| 11-beta-hydroxysteroid dehydrogenase-like protein [Triticum aestivum]
Length=349

 Score =   253 bits (645),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 128/298 (43%), Positives = 188/298 (63%), Gaps = 5/298 (2%)
 Frame = +1

Query  295   PASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRA  474
             PA +  L L +P       C    +  + ++ ++ KVV+ITGASSGIGEQ+AY+YA + A
Sbjct  14    PAMVAALLLFYPPYYLFKLCYSFLSYLFPDD-LKRKVVLITGASSGIGEQLAYQYAAKGA  72

Query  475   NLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNT  654
              L LVAR+E  LR +++ A  LGA +V+I   DV   ++C RF+  T++ YGR+DHLV  
Sbjct  73    CLALVARKEWSLRQVADRAFDLGAPDVIILPGDVADPDDCNRFVQATVDHYGRLDHLVCN  132

Query  655   ASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLP  834
             A +     F+E  D T +   +D+NFWG V  T  ALP+L+++RGR++V AS   W P+P
Sbjct  133   AGIASVGAFQEIPDVTNYSSQLDVNFWGAVQSTSAALPHLKRTRGRIVVTASATGWNPVP  192

Query  835   RMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEER  1014
             RM  Y+AA A L+N +ETLR E+G+ +GIT+ T GWI +EM++GK + E G     +E R
Sbjct  193   RMIFYNAANAALINFFETLRSELGSEVGITIVTPGWIESEMSKGKFLKEHGGVEVDQEYR  252

Query  1015  EVH-ATGPVE---EFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             +      PVE     A+ +V  A +GD Y+  PSW+ T  L+RVF+P V+ + +RLL+
Sbjct  253   DAQIGLFPVEYAKNCARAMVQAARQGDRYLTVPSWFGTMYLWRVFAPEVVEFCYRLLY  310



>ref|XP_003581150.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Brachypodium 
distachyon]
Length=368

 Score =   253 bits (645),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/283 (44%), Positives = 182/283 (64%), Gaps = 4/283 (1%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E +  KVV++TGASSGIGEQIAY+YAK+ A L LVARRE  LR ++  A  LG+ +VL+ 
Sbjct  62    EDVAGKVVLVTGASSGIGEQIAYQYAKKGARLALVARREGSLRDVAARATDLGSPDVLVL  121

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
               DV + E+C+ F+  T+  +GR+DHLVN A L +  +F++  D   F  ++D+NFWG V
Sbjct  122   PGDVARPEDCKAFVEATVERFGRLDHLVNNAGLANVCWFQDVPDVADFKQVLDVNFWGTV  181

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             +PT+ ALP+L++SRG++ VN+S  + L +PRMS Y+A+KA ++N  ETLR E+GN +G+T
Sbjct  182   HPTHCALPHLKRSRGKIFVNSSAAAMLAMPRMSFYNASKAAVLNFAETLRMELGNEVGVT  241

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEEREVH-ATGPV---EEFAKLIVSGACRGDEYV  1092
             VAT GWI +EM +GK + ++G     ++ R+      PV   E  A+ IV   CRG   V
Sbjct  242   VATPGWIESEMTKGKHLSKDGTVEVDQDTRDTQVGLFPVVRAERCAEAIVDAVCRGRRSV  301

Query  1093  KYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLSARTTSFIGTGR  1221
               P+WY    L+R F+P V +   R+ +   S    S + T R
Sbjct  302   TVPAWYRALFLWRAFAPEVGDLFQRVFYRRSSGDEGSQMRTRR  344



>gb|ABO71657.1| short-chain dehydrogenase reductase [Brassica napus]
Length=349

 Score =   252 bits (644),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 129/287 (45%), Positives = 182/287 (63%), Gaps = 5/287 (2%)
 Frame = +1

Query  328   PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             P   F    + +++  + E +   KVV+ITGASSGIGEQ+AYEYA + A L L ARR+NR
Sbjct  25    PPFYFFKFVQSIFSTIFSENVY-GKVVLITGASSGIGEQLAYEYASKGACLALTARRKNR  83

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             L  ++E AR +G+ NV+   ADV K ++CRR + ETI+ +GR+DHLVN A +     FE 
Sbjct  84    LEEVAEIAREVGSPNVVTVHADVSKPDDCRRIVDETISHFGRLDHLVNNAGIMQISMFEN  143

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
               + T    +MD NFWG VY T  ALPYLRQS G+++  +S  +WL  PRMSLY+A+KA 
Sbjct  144   IEEITRTRAVMDTNFWGAVYTTRAALPYLRQSNGKIVAMSSSAAWLTAPRMSLYNASKAA  203

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATG----P  1035
             L+N +ETLR E+G+ + IT+ T G+I +E+ +GK +  EG  +  ++ R+V         
Sbjct  204   LLNFFETLRIELGSDVHITIVTPGYIESELTQGKYVSGEGELVVNQDIRDVQIGAFLVTS  263

Query  1036  VEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             V   AK IV G CR + YV  PSW+    L++VF P ++ W  RL+F
Sbjct  264   VSGCAKGIVKGVCRKERYVTEPSWFKVTYLWKVFCPELIEWGCRLMF  310



>gb|ACG69523.1| steroleosin SLO1-2 [Brassica napus]
 emb|CDY68167.1| BnaCnng57830D [Brassica napus]
Length=349

 Score =   252 bits (643),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 133/296 (45%), Positives = 184/296 (62%), Gaps = 7/296 (2%)
 Frame = +1

Query  328   PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             P   F    + +++  + E +   KVV+ITGASSGIGEQ+AYEYA + A L L ARR+NR
Sbjct  25    PPFYFFKFVQSIFSTIFSENLY-GKVVLITGASSGIGEQLAYEYASKGACLALTARRKNR  83

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             L  ++E AR +G+ NV+   ADV K ++CRR + ETI+ +GR+DHLVN A +     FE 
Sbjct  84    LEEVAEIAREVGSPNVVTVHADVSKPDDCRRIVDETISHFGRLDHLVNNAGIMQISMFEN  143

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
               + T    +MD NFWG+VY T  ALPYLRQS G+++  +S  +WL  PRMS Y+A+KA 
Sbjct  144   IEEITRTRAVMDTNFWGSVYTTRAALPYLRQSNGKIVAMSSSAAWLTAPRMSFYNASKAA  203

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVH----ATGP  1035
             L+N +ETLR E+G+ + IT+ T G+I +E+ +GK    EG  +  ++ R+V         
Sbjct  204   LLNFFETLRIELGSDVHITIVTPGYIESELTQGKYFSGEGELVVNQDIRDVQIGAFPVTS  263

Query  1036  VEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLSARTTS  1203
             V   AK IV G CR   YV  PSW+    L++VF P ++ W  RLLF  LS   TS
Sbjct  264   VSGCAKGIVKGVCRKQRYVTEPSWFKVTYLWKVFCPELIEWGCRLLF--LSGHGTS  317



>ref|XP_003576230.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Brachypodium 
distachyon]
Length=349

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/312 (44%), Positives = 195/312 (63%), Gaps = 5/312 (2%)
 Frame = +1

Query  253   MMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSG  432
             MMDLVN VLN V  P+ +    L +P       C    +  + E+ +  KVV+ITGASSG
Sbjct  1     MMDLVNGVLNWVAAPSMVASFLLFYPPYYLFKTCYSFLSYLFPED-LSRKVVLITGASSG  59

Query  433   IGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILE  612
             IGE +AY+YA + A+L LVARRE  LR +++ A  LGA +VLI   DV   E+C RF+  
Sbjct  60    IGEHLAYQYAMKGASLALVARREWSLRQVADKALELGAPDVLILPGDVSNSEDCTRFVQA  119

Query  613   TINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGR  792
             TI+ Y R+DHLV  A +     F+E  D T +   +D+NFWG V  T+ ALP+L++SRGR
Sbjct  120   TIDRYSRLDHLVCNAGIASVGAFQEIPDVTNYSSQLDVNFWGAVQSTFAALPHLKRSRGR  179

Query  793   VIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKI  972
             ++V AS   W P+PRM  Y+AA A L+N +ETLR E+G+ +GIT+ T GWI +EM++GK 
Sbjct  180   IVVTASATGWNPVPRMIFYNAANAALINFFETLRTELGSEVGITIVTPGWIESEMSKGKF  239

Query  973   MVEEGAEMQWKEEREVH-ATGPVE---EFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFS  1140
             + E G     +E R+      PVE     AK +V  A +G+ Y+  P+W+ T  L+RV +
Sbjct  240   LKEHGGVEVDQEFRDAQIGMFPVEYAKNCAKAMVQAARQGERYLTVPAWFSTMYLWRVLA  299

Query  1141  PNVLNWTFRLLF  1176
             P V+ + +RLL+
Sbjct  300   PEVVEFCYRLLY  311



>ref|XP_010695678.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Beta 
vulgaris subsp. vulgaris]
Length=349

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/299 (43%), Positives = 188/299 (63%), Gaps = 5/299 (2%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PP +  +L L  P   F+  C  ++   + E++   KVV+ITGASSGIGEQ+AYEYA+R 
Sbjct  13    PPFTFFILCLFLPPFHFLKFCLSVFTSIFSEDV-AGKVVIITGASSGIGEQLAYEYARRG  71

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A LVL ARRE  LR ++     LG+ + +   ADV    +C+R +  TI  +GRVDHLVN
Sbjct  72    AYLVLAARREKSLREVANMCLELGSPDSITVNADVSNVNDCKRIVDTTITNFGRVDHLVN  131

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
              A +       +  D T+   +MDINFWG+VY T  A+P+L+++ G++IV +S  SWLP 
Sbjct  132   NAGITSISMLADYEDITIPRSIMDINFWGSVYITQFAIPHLKRTGGKIIVMSSSASWLPT  191

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
             PRMS+Y+A+KA +V LYETLR E+G+ I IT+AT G++ +EM +GK +  EG        
Sbjct  192   PRMSIYNASKAAMVALYETLRVELGSDIQITIATPGFVESEMTKGKHLAPEGLMNVDVNM  251

Query  1012  REVHAT-GPV---EEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             R+V  +  PV   E  AK I++ ACRG+ YV  P+WY     ++ F P +++W FR+ +
Sbjct  252   RDVQVSVFPVASGERCAKAIITSACRGERYVTEPTWYRVSSWWKAFWPELVDWLFRMFY  310



>dbj|BAJ85563.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=349

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/266 (47%), Positives = 177/266 (67%), Gaps = 4/266 (2%)
 Frame = +1

Query  391   MEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAA  570
             ++ KVV+ITGASSGIGEQ+AY+YA + A L LVARRE  LR +++ A  LGA +V+I   
Sbjct  45    LKRKVVLITGASSGIGEQLAYQYAAKGACLALVARREWSLRQVADRAFDLGAPDVIILPG  104

Query  571   DVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYP  750
             DV   ++C RFI  TI+ YGR+DHLV  A +     F+E  D T +   +D+NFWG V  
Sbjct  105   DVADPDDCNRFIQATIDHYGRLDHLVCNAGIASVGAFQEIPDVTNYSSQLDVNFWGAVQS  164

Query  751   TYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVA  930
             T+ ALP+L+++RGR++V AS   W P+PRM  Y+AA A L+N +ETLR E+G+ +GIT+ 
Sbjct  165   TFAALPHLKRTRGRIVVTASATRWNPVPRMIFYNAANAALINFFETLRAELGSEVGITIV  224

Query  931   THGWIGTEMARGKIMVEEGAEMQWKEEREVH-ATGPVE---EFAKLIVSGACRGDEYVKY  1098
             T GWI +EM++GK + E G     +E R+      PVE     A+ +V  A +GD Y+  
Sbjct  225   TPGWIESEMSKGKFLKEHGGVEVDQEFRDAQVGLFPVEYAKNCARAMVQAARQGDRYLTV  284

Query  1099  PSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             PSW+ T  L+RVF+P V+ + +RLL+
Sbjct  285   PSWFGTMYLWRVFAPEVVEFCYRLLY  310



>ref|XP_004162134.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like, 
partial [Cucumis sativus]
Length=429

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/278 (47%), Positives = 178/278 (64%), Gaps = 4/278 (1%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E +  KVV+ITGASSGIGE +AYEYAKR A L LVARRE+RLR ++E A +LG+   L+ 
Sbjct  43    EDVAGKVVLITGASSGIGEHVAYEYAKRGAYLALVARREHRLREVAEVAEILGSPFALLI  102

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
              ADV   ++C+R +  T+  +GR+DHLVN A +     FEE  D      +MD +FWG V
Sbjct  103   HADVSNVDDCKRCVQTTLTHFGRLDHLVNNAGITSINLFEEYDDPRNVASVMDTDFWGTV  162

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             Y TY A+PYL+Q+RG++I  AS  +WLP PR+S YSA+KA +++ YETLR E+G  IGIT
Sbjct  163   YCTYYAIPYLKQTRGKIIGIASSAAWLPTPRLSFYSASKAAVISFYETLRVEIGRDIGIT  222

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEERE-VHATGPVEEF---AKLIVSGACRGDEYV  1092
             + T G   +EM +GK M E+G     +E R+ V +  P+E     AK IV+G CRGDEYV
Sbjct  223   IVTPGLTESEMTQGKFMFEDGKMYLDQELRDAVMSVMPIEAVGSAAKAIVNGGCRGDEYV  282

Query  1093  KYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLSARTTSF  1206
               P W      +++F P ++ W   L     S+ T SF
Sbjct  283   TEPPWIRMTFYWKMFLPEMVEWLNYLFIMTGSSPTESF  320


 Score = 80.9 bits (198),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 7/87 (8%)
 Frame = +1

Query  352  CEWLYN----LYYGEEIMED---KVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRL  510
            C+WL +    +++     ED   KVV+ITGASSGIGE +AYEYAKR A L LVARRENRL
Sbjct  343  CDWLPHTTDIVFHQSVFREDVAGKVVLITGASSGIGEHLAYEYAKRGAYLALVARRENRL  402

Query  511  RAISENARLLGAKNVLITAADVVKEEE  591
            R ++  A+ LG+   L+  AD+ K E+
Sbjct  403  REVAAVAQYLGSPYALVIPADISKIED  429



>emb|CDY16353.1| BnaA02g11570D [Brassica napus]
Length=349

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/287 (45%), Positives = 181/287 (63%), Gaps = 5/287 (2%)
 Frame = +1

Query  328   PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             P   F    + +++  + E +   KVV+ITGASSGIGEQ+AYEYA + A L L ARR+NR
Sbjct  25    PPFYFFKFVQSIFSTIFSENVY-GKVVLITGASSGIGEQLAYEYASKGACLALTARRKNR  83

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             L  ++E AR +G+ NV+   ADV K ++CRR + ETI+ +GR+DHLVN A +     FE 
Sbjct  84    LEEVAEIAREVGSPNVVTVHADVSKPDDCRRIVDETISHFGRLDHLVNNAGIMQISMFEN  143

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
               + T    +MD NFWG VY T  ALPYLRQS G+++  +S  +WL  PRMS Y+A+KA 
Sbjct  144   IEEITRTRAVMDTNFWGAVYTTRAALPYLRQSNGKIVAMSSSAAWLTAPRMSFYNASKAA  203

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVH----ATGP  1035
             L+N +ETLR E+G+ + IT+ T G+I +E+ +GK +  EG  +  ++ R+V         
Sbjct  204   LLNFFETLRIELGSDVHITIVTPGYIESELTQGKYVSGEGELVVNQDIRDVQIGAFPVTS  263

Query  1036  VEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             V   AK IV G CR + YV  PSW+    L++VF P ++ W  RL+F
Sbjct  264   VSGCAKGIVKGVCRKERYVTEPSWFKVTYLWKVFCPELIEWGCRLMF  310



>ref|XP_008439964.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Cucumis 
melo]
Length=349

 Score =   251 bits (640),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/298 (42%), Positives = 181/298 (61%), Gaps = 5/298 (2%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PP + V L    P         +L    + E++   KVV+ITGASSGIGE +AY+YA+R 
Sbjct  13    PPITFVSLGFLLPPYVVFKYFLYLVRGIFSEDV-AGKVVLITGASSGIGEHLAYQYAQRG  71

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A L LV RRE  L  +++ AR  G+ +++   ADV   ++CRR I ETIN +GR+DHLVN
Sbjct  72    ARLALVDRRERPLHEVADIARYYGSPDIITIPADVSNLQDCRRIIDETINHFGRLDHLVN  131

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
              A + +   FEE  D T    +MD N+WG+VY T  A+PYLR +RG+++V +S  +WLP 
Sbjct  132   NAGVANMTLFEEIEDITSLNQIMDTNYWGSVYTTQFAIPYLRNNRGKIVVLSSTAAWLPA  191

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEE  1011
             PRM++Y+A KA L +++ETLR E+   IGIT+ T G++ +E+ +GK +   G     ++ 
Sbjct  192   PRMNIYNATKAALRSMFETLRVELAPDIGITIVTPGFVESELTKGKALYSHGTIEVHQDV  251

Query  1012  REVHATG----PVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLL  1173
             R+          VE  AK IV   CRGD Y+  PSWY++    +VF P VL W +R+ 
Sbjct  252   RDALIGAIPVETVEACAKAIVRSVCRGDRYLTEPSWYNSVYYMKVFCPEVLEWFYRIF  309



>ref|XP_009127346.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B [Brassica 
rapa]
Length=349

 Score =   251 bits (640),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/287 (45%), Positives = 181/287 (63%), Gaps = 5/287 (2%)
 Frame = +1

Query  328   PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             P   F    + +++  + E +   KVV+ITGASSGIGEQ+AYEYA + A L L ARR+NR
Sbjct  25    PPFYFFKFVQSIFSTIFSENVY-GKVVLITGASSGIGEQLAYEYASKGACLALTARRKNR  83

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             L  ++E AR +G+ NV+   ADV K ++CRR + ETI+ +GR+DHLVN A +     FE 
Sbjct  84    LEEVAEIAREVGSPNVVTVHADVSKPDDCRRIVDETISHFGRLDHLVNNAGIMQISMFEN  143

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
               + T    +MD NFWG VY T  ALPYLRQS G+++  +S  +WL  PRMS Y+A+KA 
Sbjct  144   IEEITRTRAVMDTNFWGAVYTTRAALPYLRQSNGKIVAMSSSAAWLTAPRMSFYNASKAA  203

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVH----ATGP  1035
             L+N +ETLR E+G+ + IT+ T G+I +E+ +GK +  EG  +  ++ R+V         
Sbjct  204   LLNFFETLRIELGSDVHITIVTPGYIESELTQGKYVSGEGELVVNQDIRDVQIGAFPVTS  263

Query  1036  VEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             V   AK IV G CR + YV  PSW+    L++VF P ++ W  RL+F
Sbjct  264   VSGCAKGIVKGVCRKERYVTEPSWFKVTYLWKVFCPELIEWGCRLMF  310



>gb|ACG69522.1| steroleosin SLO1-1 [Brassica napus]
Length=349

 Score =   250 bits (639),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/287 (45%), Positives = 182/287 (63%), Gaps = 5/287 (2%)
 Frame = +1

Query  328   PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             P   F    + +++  + E +   KVV+ITGASSGIGEQ+AYEYA + A L L ARR+NR
Sbjct  25    PPFYFFKFVQSIFSTIFSENVY-GKVVLITGASSGIGEQLAYEYASKGACLALTARRKNR  83

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             L  ++E AR +G+ NV+   ADV K ++CRR + ETI+ +GR+DHLVN A +     FE 
Sbjct  84    LEEVAEIAREVGSPNVVTVHADVSKPDDCRRIVDETISHFGRLDHLVNNAGIMQISMFEN  143

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
               + T    +MD NFWG VY T  ALPYLRQS G+++  +S  +WL  PRMS Y+A+KA 
Sbjct  144   IEEITRTRAVMDTNFWGAVYTTRAALPYLRQSNGKIVAMSSSAAWLTAPRMSFYNASKAA  203

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATG-PVEE  1044
             L+N +ETLR E+G+ + IT+ T G+I +E+ +GK +  EG  +  ++ R+V     PV  
Sbjct  204   LLNFFETLRIELGSDVHITIVTPGYIESELTQGKYVSGEGELVVNQDIRDVQIGAFPVTS  263

Query  1045  F---AKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
                 AK IV G CR + YV  PSW+    L++VF P ++ W  RL+F
Sbjct  264   VSGRAKGIVKGVCRKERYVTEPSWFKVTYLWKVFCPELIEWGCRLMF  310



>ref|XP_007211139.1| hypothetical protein PRUPE_ppa026374mg [Prunus persica]
 gb|EMJ12338.1| hypothetical protein PRUPE_ppa026374mg [Prunus persica]
Length=337

 Score =   249 bits (637),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/294 (44%), Positives = 186/294 (63%), Gaps = 7/294 (2%)
 Frame = +1

Query  310   MLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLV  489
              L L  P   F S C +L   Y  +  +   V+    + +  G+ +AYEYAKR A LVLV
Sbjct  7     FLNLVAPPFTFFSLCLFLPPFYLFKSFL--SVLSSIFSENVNGKHLAYEYAKRGARLVLV  64

Query  490   ARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGH  669
              RRE+ LR + + A   G+ +VL+  ADV K E+C+R + ETIN +GR+DHLVN A +  
Sbjct  65    GRREDSLREVVDRASDCGSPDVLMVRADVSKVEDCKRIVDETINHFGRLDHLVNNAGITS  124

Query  670   TFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLY  849
                 EEA+D T F  +MD NFWG+VY T  A+P+LR S+G+++V +S  SWLP+PR S+Y
Sbjct  125   LGMLEEATDITNFRAIMDTNFWGSVYTTRFAIPHLRSSKGKIVVLSSAASWLPIPRQSIY  184

Query  850   SAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEM---QWKEEREV  1020
             +A+KA L+++YETLR E G +I IT+ T G+I +E+ +GK ++ +  EM   Q   + +V
Sbjct  185   NASKAALLSMYETLRVEFGPNIQITIVTPGYIESELTQGKFLMSDDGEMIVDQDLRDAQV  244

Query  1021  HAT--GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
              AT  G VE  AK IV+  CRGD Y+  P W+    +++VF P +L W +RL++
Sbjct  245   SATPVGSVEGCAKAIVNSVCRGDRYLTEPEWFGVTYIWKVFCPELLEWGYRLMY  298



>ref|XP_006347650.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
tuberosum]
Length=344

 Score =   249 bits (637),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 133/292 (46%), Positives = 184/292 (63%), Gaps = 7/292 (2%)
 Frame = +1

Query  340   FISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAI  519
             FI     + +  Y E++   KVVVITGASSGIGE +AYEYA+R A L + ARRE  L  +
Sbjct  32    FIKFILSILSTVYSEDV-AGKVVVITGASSGIGEHLAYEYARRGACLAIAARREKSLLEV  90

Query  520   SENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDT  699
             +E A  LGA +VL+  ADV   ++CRR +  T++ +GR+DHLVN A +     FEE  D 
Sbjct  91    AERALDLGAPDVLVVPADVSNVDDCRRIVDRTMSHFGRLDHLVNNAGVTAVALFEEIEDI  150

Query  700   TVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNL  879
             T F  +MDINFWG++Y T  A+PYLR+S GR+IV +S  SW+P PRMSLY+ +   L+  
Sbjct  151   TNFRSIMDINFWGSIYMTKFAIPYLRRSEGRIIVLSSAASWIPAPRMSLYAVSPPTLILF  210

Query  880   YETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHAT----GPVEEF  1047
             +E LR E G  I IT+ T G++ +EM +GK + + G      + R+   +      VEE 
Sbjct  211   FEALRIEFGRDIKITLITPGYVESEMTQGKFIDKTGKVDVDPQMRDAQVSIIPVVKVEEC  270

Query  1048  AKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLSARTTS  1203
             AK IV+G+CRG+ YV  P+W+    L++VF P V+ W  RLL+  LS+  TS
Sbjct  271   AKAIVNGSCRGERYVTVPAWFKVTYLWKVFFPEVVEWILRLLW--LSSSGTS  320



>ref|XP_004297523.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Fragaria vesca subsp. vesca]
Length=412

 Score =   252 bits (643),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 176/267 (66%), Gaps = 4/267 (1%)
 Frame = +1

Query  382   EEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLI  561
              E +  KVV+ITGASSGIGE +AYEYA+R A L LV RREN LR + + A   G  +V++
Sbjct  105   SENVSGKVVLITGASSGIGEHLAYEYARRGARLALVGRRENALREVVDRAVNCGCPDVIM  164

Query  562   TAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGN  741
               ADV K E+C+R + ETI+ +GR+DHLVN A +      EEA+D T F  +MD NFWG+
Sbjct  165   IVADVSKAEDCKRLVDETISHFGRLDHLVNNAGITACSMLEEATDITNFRSVMDTNFWGS  224

Query  742   VYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGI  921
             VY T+ A P+LR ++GR++  +SV SWLP PRMS+Y+A+KA + +++ETLR E+G  + I
Sbjct  225   VYTTHFAAPHLRNNKGRIVAISSVNSWLPAPRMSIYNASKAAMSSMFETLRVELGPEVHI  284

Query  922   TVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATG-PVE---EFAKLIVSGACRGDEY  1089
             T+ T G+I +EM +GK +  EG     +E R+V  +  PVE   + A  IV+G CRG   
Sbjct  285   TIVTPGYIESEMNKGKYLSTEGRMTVDQEMRDVQVSAMPVERVQDCAYAIVNGVCRGQRC  344

Query  1090  VKYPSWYDTFLLYRVFSPNVLNWTFRL  1170
             +  P W++   +++VF P +  W F+ 
Sbjct  345   LTEPRWWNVVYMWKVFCPELFEWGFKF  371



>emb|CDY34029.1| BnaC03g27860D [Brassica napus]
Length=341

 Score =   249 bits (636),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 129/287 (45%), Positives = 180/287 (63%), Gaps = 5/287 (2%)
 Frame = +1

Query  328   PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             P   F    + +++  + E  +  KVV+ITGASSGIGE++AYEYA + A L L A R+NR
Sbjct  25    PPFIFFKFLQSIFSTIFCEN-LNGKVVLITGASSGIGERLAYEYASKGACLALTALRKNR  83

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             L  ++E AR +G+ NV+   ADV K ++CRR + ETI+ +GR+DHLVN A +     FE 
Sbjct  84    LEEVAEIAREVGSPNVVTVHADVSKPDDCRRIVDETISHFGRLDHLVNNAGITKISMFEN  143

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
               + T    +MD NFWG+VY T  ALPYLRQS G+++V +S  +WL  PRMS Y+A+KA 
Sbjct  144   FEEITRTRSVMDTNFWGSVYTTRAALPYLRQSNGKIVVMSSSAAWLTAPRMSFYNASKAA  203

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATG----P  1035
             L+N +ETLR E+G  + IT+ T G+   E+A+GK    EG  +  ++ R+V   G     
Sbjct  204   LLNFFETLRIELGGDVHITIVTPGYTQFELAQGKYFSAEGELVVDQDVRDVQVGGFPVAS  263

Query  1036  VEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             V   AK IV+G CR   YV  PSW+    L++VF P ++ W  RLLF
Sbjct  264   VSGCAKEIVNGVCRKQRYVTEPSWFKVTYLWKVFCPELIEWGCRLLF  310



>gb|EEC69238.1| hypothetical protein OsI_38254 [Oryza sativa Indica Group]
Length=357

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 132/307 (43%), Positives = 190/307 (62%), Gaps = 15/307 (5%)
 Frame = +1

Query  295   PASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRA  474
             PA +  L L +P            +  + +++   KVV+ITGASSGIGEQ+AY+YA  RA
Sbjct  15    PAMVASLLLFYPPYYLFKTVHSFLSYLFPDDLAR-KVVLITGASSGIGEQLAYQYALNRA  73

Query  475   NLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGR-------  633
             +LVLVARRE  LR +++ A  LGA +V+I   DV   E+C+RF+  TI+ YGR       
Sbjct  74    SLVLVARREWSLRKVADQAFELGAPDVIILRGDVANPEDCKRFVQTTIDHYGRCKSPTSL  133

Query  634   -VDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNAS  810
              +DHLV  A +     F+E  D T +    D+NFWG+V  T+ ALP+L++SRGR++V AS
Sbjct  134   ILDHLVCNAGIASVGAFQEIPDVTNYSSQFDVNFWGSVQSTFEALPHLKRSRGRIVVTAS  193

Query  811   VESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGA  990
                W P+PRM+ Y+AA A L+N YETLR E+G+ +GIT+ T GWI +EM++GK + + G 
Sbjct  194   ATGWNPVPRMTFYNAANAALINFYETLRTELGSQVGITIVTPGWIESEMSKGKFLKDHG-  252

Query  991   EMQWKEEREVHATG--PVE---EFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLN  1155
             EM+  +E      G  PVE     AK +V    +G+  +  P W+ T  L+RVF+P V+ 
Sbjct  253   EMEVDQEMRDAQIGLFPVEYAKNCAKAMVQAVRQGERCLTVPPWFSTMYLWRVFAPEVVE  312

Query  1156  WTFRLLF  1176
             + +RLL+
Sbjct  313   FCYRLLY  319



>gb|ABM90633.1| short-chain dehydrogenase reductase [Brassica napus]
 gb|ADW77633.1| steroleosin-A [Brassica napus]
 gb|ADW77634.1| steroleosin-A [Brassica napus]
Length=349

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/263 (48%), Positives = 172/263 (65%), Gaps = 4/263 (2%)
 Frame = +1

Query  400   KVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVV  579
             KVV+ITGASSGIGEQ+AYEYA + A L L ARR+NRL  ++E AR +G+ NV+   ADV 
Sbjct  48    KVVLITGASSGIGEQLAYEYASKGACLALTARRKNRLEEVAEIAREVGSPNVVTVHADVS  107

Query  580   KEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYV  759
             K ++CRR + ETI+ +GR+DHLVN A +     FE   + T    +MD NFWG VY T  
Sbjct  108   KPDDCRRIVDETISHFGRLDHLVNNAGIMQISMFENIEEITRTRAVMDTNFWGAVYTTRA  167

Query  760   ALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHG  939
             ALPYLRQS G+++  +S  +WL  PRMS Y+A+KA L+N +ETLR E+G+ + IT+ T G
Sbjct  168   ALPYLRQSNGKIVAMSSSAAWLTAPRMSFYNASKAALLNFFETLRIELGSDVHITIVTPG  227

Query  940   WIGTEMARGKIMVEEGAEMQWKEEREVH----ATGPVEEFAKLIVSGACRGDEYVKYPSW  1107
             +I +E+ +GK +  EG  +  ++ R+V         V   AK IV G CR + YV  PSW
Sbjct  228   YIESELTQGKYVSGEGELVVNQDIRDVQIGAFPVTSVSGCAKGIVKGVCRKERYVTEPSW  287

Query  1108  YDTFLLYRVFSPNVLNWTFRLLF  1176
             +    L++VF P ++ W  RL+F
Sbjct  288   FKVTYLWKVFCPELIEWGCRLMF  310



>ref|XP_006436879.1| hypothetical protein CICLE_v10031927mg [Citrus clementina]
 ref|XP_006493235.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Citrus 
sinensis]
 gb|ESR50119.1| hypothetical protein CICLE_v10031927mg [Citrus clementina]
Length=359

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 173/268 (65%), Gaps = 4/268 (1%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E +  KVV+ITGASSGIG+ +AYEYA+RRA LVLVARRE +LR +++ A L+G+   L  
Sbjct  43    EDVAGKVVLITGASSGIGKHLAYEYARRRARLVLVARRERQLREVADQAELMGSPFALAI  102

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
              ADV K ++C+ F+  T+  +GR+DHLV  A +     FE+ +D T     MDINFWG+ 
Sbjct  103   PADVSKVDDCKHFVDVTMEHFGRLDHLVTNAGVVPMCLFEDYTDITKPAPAMDINFWGSA  162

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             Y TY A+PYL+Q++G++IV AS   WLP PRMS Y+A+KA  + LYETLR E G  IGIT
Sbjct  163   YGTYFAIPYLKQTKGKIIVVASAAGWLPPPRMSFYNASKAAKIALYETLRIEFGGDIGIT  222

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEEREVHAT----GPVEEFAKLIVSGACRGDEYV  1092
             + T G I +E+  GK + + G     +E R+V  +     P EE AK IV+ ACRGD Y+
Sbjct  223   IVTPGLIESEITGGKFLNKNGKLEVDQEIRDVQISLLPVQPTEECAKAIVNSACRGDRYL  282

Query  1093  KYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
               PSW      +++  P ++ W  R+L 
Sbjct  283   TQPSWVGVTYYWKMLWPEIIEWCNRVLL  310



>ref|XP_010482368.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Camelina 
sativa]
Length=350

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/288 (43%), Positives = 179/288 (62%), Gaps = 7/288 (2%)
 Frame = +1

Query  328   PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             P   F    + +++  + E  +  KVV+ITGASSGIGE +AYEYA R A L L ARR+NR
Sbjct  25    PPFYFFKLVQSIFSTIFSEN-LHGKVVLITGASSGIGEHLAYEYASRGACLALTARRKNR  83

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             L  ++E AR +G+ NV    ADV K ++CRR + +TI  +GR+DHLVN A +     FE+
Sbjct  84    LEEVAEIAREIGSPNVFTVHADVSKPDDCRRLVDDTITHFGRLDHLVNNAGITQISMFED  143

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
               D T    ++D NFWG+VY T  ALPYLRQS G+++  +S  +WL  PRMS Y+A+KA 
Sbjct  144   VEDITRNKAVLDTNFWGSVYTTRAALPYLRQSNGKIVAMSSSAAWLTAPRMSFYNASKAA  203

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATGP----  1035
             L++ +ET+R E+G  + IT+ T G+I +E+ +GK +  EG  +  ++ R+V   GP    
Sbjct  204   LLSFFETMRIELGGDVHITIVTPGYIESELTQGKYLSGEGELIVNQDVRDVQ-IGPFPVA  262

Query  1036  -VEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
                  AK IV+G CR   YV  PSW+    L++V  P ++ W  RLL+
Sbjct  263   SASGCAKAIVNGVCRKQRYVTEPSWFKVTYLWKVLCPELIEWGCRLLY  310



>gb|ACG69524.1| steroleosin SLO1-3 [Brassica napus]
Length=341

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/287 (45%), Positives = 179/287 (62%), Gaps = 5/287 (2%)
 Frame = +1

Query  328   PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             P   F    + +++  + E  +  KVV+ITGASSGIGE++AYEYA + A L L A R+NR
Sbjct  25    PPFIFFKFLQSIFSTIFCEN-LNGKVVLITGASSGIGERLAYEYASKGACLALTALRKNR  83

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             L  ++E AR +G+ NV+   ADV K ++CRR + ETI+ +GR+DHLVN A +     FE 
Sbjct  84    LEEVAEIAREVGSPNVVTVHADVSKPDDCRRIVDETISHFGRLDHLVNNAGITKISMFEN  143

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
               + T    +MD NFWG+VY T  ALPYLRQS G+++V +S  +WL  PRMS Y+A+KA 
Sbjct  144   FEEITRTRSVMDTNFWGSVYTTRAALPYLRQSNGKIVVMSSSAAWLTAPRMSFYNASKAA  203

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHA----TGP  1035
             L+N +ETLR E+G  + IT+ T G+   E+A+GK    EG  +  ++ R+V         
Sbjct  204   LLNFFETLRIELGGDVHITIVTPGYTQFELAQGKYFSAEGELVVDQDVRDVQVGAFPVAS  263

Query  1036  VEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             V   AK IV+G CR   YV  PSW+    L++VF P ++ W  RLLF
Sbjct  264   VSACAKEIVNGVCRKQRYVTEPSWFKVTYLWKVFCPELIEWGCRLLF  310



>ref|NP_001291322.1| 11-beta-hydroxysteroid dehydrogenase 1B-like [Sesamum indicum]
 gb|AAL09328.1|AF302806_1 steroleosin [Sesamum indicum]
 gb|AAL13315.1|AF421889_1 steroleosin [Sesamum indicum]
Length=348

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 176/268 (66%), Gaps = 5/268 (2%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E +  KVVVITGASSGIGE +AYEYAKR A LVL ARRE  L+ ++E AR LG+ +V++ 
Sbjct  43    EDVAGKVVVITGASSGIGESLAYEYAKRGACLVLAARRERSLQEVAERARDLGSPDVVVV  102

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
              ADV K E+CR+ + +T+N +GR+DHLVN A +      EE  D T +   MDINFWG V
Sbjct  103   RADVSKAEDCRKVVDQTMNRFGRLDHLVNNAGIMSVSMLEEVEDITGYRETMDINFWGYV  162

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             Y T  A PYLR SRGR++V +S  SW+P PRMS Y+A+KA +   +ETLR E G  IGIT
Sbjct  163   YMTRFAAPYLRNSRGRIVVLSSSSSWMPTPRMSFYNASKAAISQFFETLRVEFGPDIGIT  222

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEEREVH-ATGP---VEEFAKLIVSGACRGDEYV  1092
             + T G+I +E+ +GK     G  +  ++ R+V  +T P   VE  A+ IV  A RG+ YV
Sbjct  223   LVTPGFIESELTQGKFY-NAGERVIDQDMRDVQVSTTPILRVESAARSIVRSAIRGERYV  281

Query  1093  KYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
               P+W+     +++F P V+ W FRL++
Sbjct  282   TEPAWFRVTYWWKLFCPEVMEWVFRLMY  309



>ref|NP_568742.1| hydroxysteroid dehydrogenase 1 [Arabidopsis thaliana]
 ref|NP_680418.1| hydroxysteroid dehydrogenase 1 [Arabidopsis thaliana]
 sp|P0DKC6.1|HSD1B_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase 1B; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase 1B; AltName: Full=Hydroxysteroid 
dehydrogenase 1; Short=AtHSD1 [Arabidopsis 
thaliana]
 sp|P0DKC5.1|HSD1A_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase 1A; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase 1A; AltName: Full=Hydroxysteroid 
dehydrogenase 1; Short=AtHSD1 [Arabidopsis 
thaliana]
 gb|AAL38621.1|AF446888_1 AT5g50700/MFB16_9 [Arabidopsis thaliana]
 dbj|BAA96983.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 dbj|BAB09145.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 gb|AAK96564.1| AT5g50700/MFB16_9 [Arabidopsis thaliana]
 gb|AAL32846.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 gb|AAM10215.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 dbj|BAD95411.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 gb|AED95967.1| hydroxysteroid dehydrogenase 1 [Arabidopsis thaliana]
 gb|AED95981.1| hydroxysteroid dehydrogenase 1 [Arabidopsis thaliana]
Length=349

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/288 (44%), Positives = 179/288 (62%), Gaps = 7/288 (2%)
 Frame = +1

Query  328   PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             P   F    + +++  + E +   KVV+ITGASSGIGEQ+AYEYA R A L L ARR+NR
Sbjct  25    PPFYFFKFLQSIFSTIFSENLY-GKVVLITGASSGIGEQLAYEYACRGACLALTARRKNR  83

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             L  ++E AR LG+ NV+   ADV K ++CRR + +TI  +GR+DHLVN A +     FE 
Sbjct  84    LEEVAEIARELGSPNVVTVHADVSKPDDCRRIVDDTITHFGRLDHLVNNAGMTQISMFEN  143

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
               D T    ++D NFWG+VY T  ALPYLRQS G+++  +S  +WL  PRMS Y+A+KA 
Sbjct  144   IEDITRTKAVLDTNFWGSVYTTRAALPYLRQSNGKIVAMSSSAAWLTAPRMSFYNASKAA  203

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATGP----  1035
             L++ +ET+R E+G  + IT+ T G+I +E+ +GK    EG  +  ++ R+V   GP    
Sbjct  204   LLSFFETMRIELGGDVHITIVTPGYIESELTQGKYFSGEGELIVNQDMRDVQV-GPFPVA  262

Query  1036  -VEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
                  AK IV+G CR   YV  PSW+    L++V  P ++ W  RLL+
Sbjct  263   SASGCAKSIVNGVCRKQRYVTEPSWFKVTYLWKVLCPELIEWGCRLLY  310



>ref|XP_004145219.1| PREDICTED: uncharacterized protein LOC101220214 [Cucumis sativus]
Length=520

 Score =   253 bits (645),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 132/278 (47%), Positives = 178/278 (64%), Gaps = 4/278 (1%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E +  KVV+ITGASSGIGE +AYEYAKR A L LVARRE+RLR ++E A +LG+   L+ 
Sbjct  43    EDVAGKVVLITGASSGIGEHVAYEYAKRGAYLALVARREHRLREVAEVAEILGSPFALLI  102

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
              ADV   ++C+R +  T+  +GR+DHLVN A +     FEE  D      +MD +FWG V
Sbjct  103   HADVSNVDDCKRCVQTTLTHFGRLDHLVNNAGITSINLFEEYDDPRNVASVMDTDFWGTV  162

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             Y TY A+PYL+Q+RG++I  AS  +WLP PR+S YSA+KA +++ YETLR E+G  IGIT
Sbjct  163   YCTYYAIPYLKQTRGKIIGIASSAAWLPTPRLSFYSASKAAVISFYETLRVEIGRDIGIT  222

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEERE-VHATGPVEEF---AKLIVSGACRGDEYV  1092
             + T G   +EM +GK M E+G     +E R+ V +  P+E     AK IV+G CRGDEYV
Sbjct  223   IVTPGLTESEMTQGKFMFEDGKMYLDQELRDAVMSVMPIEAVGSAAKAIVNGGCRGDEYV  282

Query  1093  KYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLSARTTSF  1206
               P W      +++F P ++ W   L     S+ T SF
Sbjct  283   TEPPWIRMTFYWKMFLPEMVEWLNYLFIMTGSSPTESF  320


 Score =   132 bits (332),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 92/150 (61%), Gaps = 4/150 (3%)
 Frame = +1

Query  721   DINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFE  900
             D+NFWG VY +Y  +P+L+QSRG++I  AS  +WLP PR+S Y+++KA +++ YETLR E
Sbjct  324   DVNFWGMVYCSYYGIPHLKQSRGKIIGIASSAAWLPAPRLSFYTSSKAAVISFYETLRVE  383

Query  901   VGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATG----PVEEFAKLIVSG  1068
             VG  IGIT+ T G + +EM +GK M ++G     ++ R+   +     P+++  K I+  
Sbjct  384   VGRDIGITIVTPGLVESEMTQGKFMSKDGHLYLDQQLRDATVSAMPIMPIDDAVKGILRS  443

Query  1069  ACRGDEYVKYPSWYDTFLLYRVFSPNVLNW  1158
              C+GD Y   P W      Y+   P ++ W
Sbjct  444   VCKGDRYATEPRWMKMAFYYKTLWPELVEW  473



>ref|XP_002865819.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42078.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=349

 Score =   248 bits (632),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 128/278 (46%), Positives = 175/278 (63%), Gaps = 13/278 (5%)
 Frame = +1

Query  358   WLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARL  537
             +L NLY        KVV+ITGASSGIGEQ+AYEYA R A L L ARR+NRL  ++E AR 
Sbjct  41    FLENLY-------GKVVLITGASSGIGEQLAYEYACRGACLALTARRKNRLEEVAEIARE  93

Query  538   LGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPIL  717
             LG+ NV+   ADV K ++CRR + +TI  +GR+DHLVN A +     FE   D T    +
Sbjct  94    LGSPNVVTVHADVSKPDDCRRIVDDTITHFGRLDHLVNNAGMTQISMFENIEDITRTKAV  153

Query  718   MDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRF  897
             +D NFWG+VY T  ALPYLRQS G+++  +S  +WL  PRMS Y+A+KA L++ +ET+R 
Sbjct  154   LDTNFWGSVYTTRAALPYLRQSNGKIVAMSSSAAWLTAPRMSFYNASKAALLSFFETMRI  213

Query  898   EVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATGP-----VEEFAKLIV  1062
             E+G  + IT+ T G+I +E+ +GK    EG  +  ++ R+V   GP         AK IV
Sbjct  214   ELGGDVHITIVTPGYIESELTQGKYFSGEGELIVNQDMRDVQ-IGPFPVSSASGCAKAIV  272

Query  1063  SGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             +G CR   YV  PSW+    L++V  P ++ W  RLL+
Sbjct  273   NGVCRKQRYVTVPSWFKVTYLWKVLCPELIEWGCRLLY  310



>ref|XP_009134064.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Brassica 
rapa]
Length=341

 Score =   247 bits (631),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 128/287 (45%), Positives = 178/287 (62%), Gaps = 5/287 (2%)
 Frame = +1

Query  328   PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             P   F    + +++  + E  +  KVV+ITGASSGIGE++AYEYA + A L L A R+NR
Sbjct  25    PPFIFFKFLQSIFSTIFCEN-LNGKVVLITGASSGIGERLAYEYASKGACLALTALRKNR  83

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             L  ++E AR +G+ NV+   ADV K ++CRR + ETI+ +GR+DHLVN A +     FE 
Sbjct  84    LEEVAEIAREVGSPNVVTVHADVSKPDDCRRIVDETISHFGRLDHLVNNAGITKISMFEN  143

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
               + T    +MD NFWG+VY T  ALPYLRQS G+++V +S  +WL  PRMS Y+A+KA 
Sbjct  144   FEEITRTRSVMDTNFWGSVYTTRAALPYLRQSNGKIVVMSSSAAWLTAPRMSFYNASKAA  203

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHA----TGP  1035
             L+N +ETLR E+G  + IT+ T G+   E+A+GK    EG  +  +  R+V         
Sbjct  204   LLNFFETLRIELGGDVHITIVTPGYTQFELAQGKYFSAEGELVVDQNVRDVQVGAFPVAS  263

Query  1036  VEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             V   AK IV+G CR   YV  PSW+    L++VF P ++ W  RLLF
Sbjct  264   VSACAKEIVNGVCRKQRYVTEPSWFKVTYLWKVFCPELIEWGCRLLF  310



>ref|XP_010442253.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Camelina 
sativa]
Length=350

 Score =   247 bits (631),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 178/288 (62%), Gaps = 7/288 (2%)
 Frame = +1

Query  328   PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             P   F    + +++  + E  +  KVV+ITGASSGIGE +AYEYA R A L L ARR+NR
Sbjct  25    PPFYFFKFVQSIFSTIFSEN-LHGKVVLITGASSGIGENLAYEYASRGACLALTARRKNR  83

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             L  ++E AR +G+ NV    ADV K ++CRR + +TI  +GR+DHLVN A +     FE+
Sbjct  84    LEEVAEIAREIGSPNVFTVHADVSKPDDCRRLVDDTITHFGRLDHLVNNAGITQISMFED  143

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
               D T    ++D NFWG+VY T  ALPYLRQS G+++  +S  +WL  PRMS Y+A+KA 
Sbjct  144   VEDITRNKAVLDTNFWGSVYTTRAALPYLRQSNGKIVAMSSAAAWLTAPRMSFYNASKAA  203

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATGP----  1035
             L++ +ET+R E+G  + IT+ T G+I +E+ +GK    EG  +  ++ R+V   GP    
Sbjct  204   LLSFFETMRIELGGDVHITIVTPGYIESELTQGKYFSGEGELIVNQDVRDVQ-IGPFPVA  262

Query  1036  -VEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
                  AK IV+G CR   YV  PSW+    L++V  P ++ W  RL++
Sbjct  263   SASGCAKAIVNGVCRKQRYVTEPSWFKVTYLWKVLCPELIEWGCRLMY  310



>ref|XP_004503837.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cicer arietinum]
Length=347

 Score =   247 bits (630),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 125/272 (46%), Positives = 176/272 (65%), Gaps = 5/272 (2%)
 Frame = +1

Query  400   KVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVV  579
             KV++ITGASSGIGE +AYEY KR A L LVARRENRL  ++  A+  G+ +V+   ADV 
Sbjct  48    KVILITGASSGIGEHMAYEYGKRGARLALVARRENRLNEVASKAKFFGSPDVITIPADVS  107

Query  580   KEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYV  759
               ++C+RF+  T+N +G++DHLVN A +     FE+ +D T F   MDINFWG+ Y TY 
Sbjct  108   CVQDCKRFVDLTVNHFGQLDHLVNNAGIVPLCLFEDTTDITNFVPAMDINFWGSAYGTYF  167

Query  760   ALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHG  939
             ++P+L++ +G+++  AS   WLP PRM  Y+A+KA ++ LYE+LR E+G  IGIT+ T G
Sbjct  168   SIPHLKKFKGKIVAIASSAGWLPAPRMMFYNASKAAMITLYESLRTELGRDIGITIVTPG  227

Query  940   WIGTEMARGKIMVEEGAEMQWKEEREVHAT----GPVEEFAKLIVSGACRGDEYVKYPSW  1107
              I +EM +GK + +EG  +  +E R+V  +      V E AK IV+ ACRGD Y+  P+W
Sbjct  228   LIESEMTQGKFLSKEGRMVLDQEMRDVQISMVPIRSVTEAAKAIVNSACRGDLYLTEPAW  287

Query  1108  YDTFLLYRVFSPNVLNWTFR-LLFDNLSARTT  1200
               T   +++F P VL    R LL    S R T
Sbjct  288   IRTTFYWKMFCPEVLEILNRWLLLSGSSERET  319



>ref|XP_003579631.2| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Brachypodium 
distachyon]
Length=352

 Score =   246 bits (629),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 138/314 (44%), Positives = 192/314 (61%), Gaps = 14/314 (4%)
 Frame = +1

Query  307   VMLALAWPTLCFISACEWLYNLYYG------EEIMEDKVVVITGASSGIGEQIAYEYAKR  468
             + +ALA P + F+ A  ++Y L          E +  KVV+ITGASSGIGE +AYEYAKR
Sbjct  15    LQVALAAPLVLFLPAY-YVYKLTTSLLRSLFPEDVAGKVVLITGASSGIGEHLAYEYAKR  73

Query  469   RANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLV  648
              ANL LVARRE  LR +++NA  LG+  VL+  ADV K +ECR+FI +T+ ++GR+DHLV
Sbjct  74    GANLALVARREASLRKVADNALALGSPVVLVLPADVSKPDECRKFIDDTVTYFGRLDHLV  133

Query  649   NTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLP  828
             N AS+     FEE  D   F  LMDINFWG+VYPT  A+P+L+++ GR++   S  S++ 
Sbjct  134   NNASIWQVCKFEEVEDVNYFRELMDINFWGHVYPTRHAIPHLKRTHGRIVGVTSNSSYIF  193

Query  829   LPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKE  1008
             + R + Y+A+KA  +N Y+TLR E+   I IT    G I +E+ +GK++ +EG EM+  +
Sbjct  194   IGRNTFYNASKAAALNFYDTLRMELAGEIRITEVVPGVIESEITKGKMLTKEG-EMKVNQ  252

Query  1009  EREVHATGP-----VEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLL  1173
             +      GP     V  FAK +V   CRG  YV  P WY    ++R+  P +L W  RLL
Sbjct  253   DERDAILGPTPAESVGNFAKTVVRDVCRGARYVFEPRWYMAVYMFRLCFPEILAWNSRLL  312

Query  1174  -FDNLSARTTSFIG  1212
                 L   TT  +G
Sbjct  313   AVKTLGPATTDTLG  326



>ref|XP_008798974.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X1 [Phoenix dactylifera]
Length=349

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/297 (42%), Positives = 188/297 (63%), Gaps = 5/297 (2%)
 Frame = +1

Query  301   SLVMLALAW-PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRAN  477
             ++ M  LA+ P         W+    + EE M  KVV+ITGASSGIGE +AY+YA R A+
Sbjct  15    AIAMFLLAYLPVRLVWRVVRWMLVRPFSEEDMNGKVVLITGASSGIGECVAYQYATRGAS  74

Query  478   LVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTA  657
             LVLVARRE+ L++++  A  LGA  VL+  AD+   +E +R I ETI  +G+++HLV  A
Sbjct  75    LVLVARREHALKSVARTANELGAPEVLVKPADISIPDESKRIIEETIAHFGQLNHLVVNA  134

Query  658   SLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPR  837
              +  +   E+ ++ + F  +MD+NFWG+VYPTY A+P+L+ S G +IV ASV   +P  R
Sbjct  135   GIWSSCLVEDITNISAFTQVMDVNFWGSVYPTYYAIPHLKTSHGNIIVTASVAGHVPTAR  194

Query  838   MSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEERE  1017
             M +Y+A+KA ++  YETLR E+G+ I IT+ T G++ +E+ +GKI+ ++G     +E R+
Sbjct  195   MGIYNASKAAVIRFYETLRSELGSEIRITIITPGYVESELTKGKIVKKDGEVGVDEEARD  254

Query  1018  VH----ATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             +       G  E  A++IV  AC GDEYV +PSW+  F     F+P V+NW  R  +
Sbjct  255   IQLGPLPVGRTERCAEIIVDSACNGDEYVTWPSWFKPFYAVMSFAPEVVNWFSRTFY  311



>emb|CDP19890.1| unnamed protein product [Coffea canephora]
Length=494

 Score =   251 bits (640),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/292 (43%), Positives = 191/292 (65%), Gaps = 8/292 (3%)
 Frame = +1

Query  304   LVMLALAWPTLCFISACEWL--YNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRAN  477
             +V+  + W  L F S  ++L  +  Y+  E ++ KVV+ITGASSGIGE + YEYAKR A 
Sbjct  10    IVIQTILWILLPFFSIYKFLMFFYRYFSTEDIKGKVVLITGASSGIGEHLTYEYAKRGAC  69

Query  478   LVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTA  657
             LV+VARREN L+ ++ENAR LG+ +V+   ADV+K ++C+RF+ ET++ +GR+DH+VN A
Sbjct  70    LVIVARRENLLKEVAENARKLGSPDVVPICADVLKVDDCKRFVEETVDHFGRLDHVVNNA  129

Query  658   SLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPR  837
              +      E+A+D T    + D+NFWG+VYPTY A+P+L++S+G ++VNAS  + L  P 
Sbjct  130   GIVSMCLIEDAADITNLQPVTDVNFWGSVYPTYFAIPHLKRSKGSILVNASSAAVLSPPG  189

Query  838   MSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEG-----AEMQW  1002
             +S+YSA+KA LV+ YET+R E+ + I IT+AT G + +E+ +GK M + G     +E+ +
Sbjct  190   LSIYSASKAALVSFYETIRVELASEISITIATLGPVESEITKGKHMTKHGTTEFDSELVF  249

Query  1003  KEEREVHATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNW  1158
              +   + A     + AK IV   CR + YV  P W    LL ++  P ++ W
Sbjct  250   IDADRLPAMSS-PDCAKAIVDSVCRKERYVTVPKWCKVLLLLKILCPELIEW  300


 Score =   119 bits (299),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 96/168 (57%), Gaps = 12/168 (7%)
 Frame = +1

Query  634   VDHLVNTASLGHTFYFEEASDTTVF-PILMDI-------NFWGNVYPTYVALPYLRQSRG  789
             VDHLVN A +G     E+A+D T F P++ DI       NFWG+V P Y A+P L++++G
Sbjct  326   VDHLVNNAGIGSICLIEDATDITKFEPVMFDIIQMVQDVNFWGSVCPIYFAMPSLKRTKG  385

Query  790   RVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGK  969
              + VNAS  S L  P +S+Y+A+KA L+++YET+R E+   I IT AT G I  EM++GK
Sbjct  386   SIFVNASASSRLNPPGISIYAASKAALLSIYETMRAELAPEISITTATLGVIEPEMSKGK  445

Query  970   IMVEEG-AEMQWKEEREVHATGPV---EEFAKLIVSGACRGDEYVKYP  1101
              +  EG  ++            PV      AK IV   CR + YV  P
Sbjct  446   YLNREGITQVNSDSANTFINQLPVMSASACAKSIVDAICRKERYVTEP  493



>ref|XP_006436878.1| hypothetical protein CICLE_v10031969mg [Citrus clementina]
 ref|XP_006493234.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Citrus 
sinensis]
 gb|ESR50118.1| hypothetical protein CICLE_v10031969mg [Citrus clementina]
Length=349

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 135/311 (43%), Positives = 196/311 (63%), Gaps = 5/311 (2%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+N  LNLV PP +L  L L  P          ++N  + E++   KVV+ITGASSGI
Sbjct  1     MDLINKFLNLVAPPFTLFSLCLFLPPFLCYKFLLSVFNSIFSEDV-SGKVVIITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE +AYEYA+R A L L ARRE  L  +++ AR +G+ +V+   ADV K ++CR  + ET
Sbjct  60    GEHLAYEYARRGACLALCARREKSLEEVADTAREIGSPDVITIRADVSKVDDCRSLVEET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             +N +GR+DHLVN A +     FE+  + T F  +MDINFWG+VY T  A+P+LR ++G++
Sbjct  120   MNHFGRLDHLVNNAGISSVAPFEDTVNITDFKQIMDINFWGSVYTTRFAVPHLRYTKGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
              V +S  SWL  PRMS Y+A+KA LV  +ETLR E+G+ +G+T+ T G+I +E+ +GK +
Sbjct  180   AVLSSSASWLTAPRMSFYNASKAALVLFFETLRVELGSDVGVTIVTPGFIESELTQGKFL  239

Query  976   VEEGAEMQWKEEREVH-ATGPVE---EFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSP  1143
               EG     +  R+   +T PV+     AK IV+  CRGD Y+  PSW+ T    +V  P
Sbjct  240   TGEGRIQIDENLRDAQVSTIPVQSAWSCAKAIVNSVCRGDTYLVVPSWFRTTYWMKVLCP  299

Query  1144  NVLNWTFRLLF  1176
              +L + +R+ +
Sbjct  300   ELLEFWYRVFY  310



>gb|EEE53178.1| hypothetical protein OsJ_36031 [Oryza sativa Japonica Group]
Length=357

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/307 (43%), Positives = 187/307 (61%), Gaps = 15/307 (5%)
 Frame = +1

Query  295   PASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRA  474
             PA +  L L +P            +  + +++   KVV+ITGASSGIGEQ+AY YA  RA
Sbjct  15    PAMVASLLLFYPPYYLFKTVHSFLSYLFPDDLAR-KVVLITGASSGIGEQLAYNYALNRA  73

Query  475   NLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGR-------  633
             +LVLVARRE  LR +++ A  LGA +V+I   DV   E+C+RF+   I+ YGR       
Sbjct  74    SLVLVARREWSLRKVADQAFELGAPDVIILPGDVANPEDCKRFVQTAIDHYGRCKSPISL  133

Query  634   -VDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNAS  810
              +DHLV  A +     F+E  D T +    D+NFWG+V  T+ ALP+L++SRGR++V AS
Sbjct  134   ILDHLVCNAGIASVGAFQEIPDVTNYSSQFDVNFWGSVQSTFEALPHLKRSRGRIVVTAS  193

Query  811   VESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGA  990
                W P+PRM+ Y+AA A L+N YETLR E+G+ +GIT+ T GWI +EM++GK + + G 
Sbjct  194   ATGWNPVPRMTFYNAANAALINFYETLRTELGSQVGITIVTPGWIESEMSKGKFLKDHG-  252

Query  991   EMQWKEEREVHATG--PVE---EFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLN  1155
             EM+  +E      G  PVE     AK +V    +G   +  P W+ T  L+RVF+P V+ 
Sbjct  253   EMEVDQEMRDAQIGLFPVEYAKNCAKAMVQAVRQGKRCLTVPPWFSTMYLWRVFAPEVVE  312

Query  1156  WTFRLLF  1176
             + +RLL+
Sbjct  313   FCYRLLY  319



>ref|XP_010442549.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B [Camelina 
sativa]
Length=350

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 177/288 (61%), Gaps = 7/288 (2%)
 Frame = +1

Query  328   PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             P   F    + +++  + E  +  KVV+ITGASSGIGE +AYEYA R A L L ARR+NR
Sbjct  25    PPFYFFKFVQSIFSTIFSEN-LHGKVVLITGASSGIGEHLAYEYASRGACLALTARRKNR  83

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             L  ++E AR +G+ NV    ADV K ++CRR + +TI  +GR+DHLVN A +     FE+
Sbjct  84    LEEVAEIAREIGSPNVFTVHADVSKPDDCRRLVDDTITHFGRLDHLVNNAGITQISMFED  143

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
               D T    ++D NFWG+VY T  ALPYLRQS G+++  +S  +WL  PRMS Y+A+KA 
Sbjct  144   VEDITRNKAVLDTNFWGSVYTTRAALPYLRQSNGKIVAMSSSAAWLTAPRMSFYNASKAA  203

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATGP----  1035
             L++ +ET+R E+G  + IT+ T G+I +E+ +GK     G  +  ++ R+V   GP    
Sbjct  204   LLSFFETMRIELGGDVHITIVTPGYIESELTQGKYFSGAGELIVNQDVRDVQ-IGPFPVA  262

Query  1036  -VEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
                  AK IV+G CR   YV  PSW+    L++V  P ++ W  RLL+
Sbjct  263   SASGCAKAIVNGVCRKQRYVTEPSWFKVTYLWKVLCPELIEWGCRLLY  310



>gb|KFK22922.1| hypothetical protein AALP_AAs48765U000100 [Arabis alpina]
Length=349

 Score =   245 bits (626),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 180/287 (63%), Gaps = 5/287 (2%)
 Frame = +1

Query  328   PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             P   F    + +++  + E +   KVV+ITGASSGIGEQ+AYEY  R A L L ARR+NR
Sbjct  25    PPFYFFKFVQSIFSTIFSENLY-GKVVLITGASSGIGEQLAYEYGSRGACLALTARRKNR  83

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             L  ++E AR +G+ NV+   ADV K ++CRR + +TI+ +GR+DHLVN A +     FE 
Sbjct  84    LEEVAEIAREMGSPNVITVHADVSKPDDCRRIVDDTISHFGRLDHLVNNAGMTQISMFEN  143

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
               + +    +MD NFWG+VY T  ALPYLRQS G+++  +S  +WL  PRMS Y+A+KA 
Sbjct  144   IEEISRTKAVMDTNFWGSVYVTRAALPYLRQSNGKIVAMSSSAAWLTAPRMSFYNASKAA  203

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATG-PVEE  1044
             ++N +ET+R E+   + IT+ T G+I +E+ +GK    EG  +  ++ R+V     PV  
Sbjct  204   VLNFFETMRIELAGDVHITIVTPGYIESELTQGKYFSGEGELIVNQDIRDVQIGAFPVAS  263

Query  1045  ---FAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
                 AK IV+G CR   YV  PSW+    L++VF P+++ W  RLL+
Sbjct  264   ASGCAKAIVNGVCRKQRYVTEPSWFRVTYLWKVFCPDLIEWLCRLLY  310



>ref|XP_004977951.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Setaria 
italica]
Length=350

 Score =   245 bits (626),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 133/310 (43%), Positives = 187/310 (60%), Gaps = 5/310 (2%)
 Frame = +1

Query  304   LVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLV  483
             + +LA+  P         +L    + E++   KVV+ITGASSGIGE +AYEYAKRRA L 
Sbjct  17    MALLAVLLPPYYVWKLTTYLLGAVFPEDV-AGKVVLITGASSGIGEHLAYEYAKRRAYLA  75

Query  484   LVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASL  663
             LVARRE  LR + + A  LG+  VL+  ADV K E+C +FI +TI ++GR+DHLVN AS+
Sbjct  76    LVARREMSLREVGDRALGLGSPGVLVLPADVSKPEDCEKFIDDTIRYFGRLDHLVNNASI  135

Query  664   GHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMS  843
                  FEE  D   F  LMDINFWG+VYPT +A+P+L+++ GR++   S  S++ + R +
Sbjct  136   WQVCMFEEVEDVNHFRTLMDINFWGHVYPTRLAIPHLKKTHGRIVGVTSNSSYIFIGRNT  195

Query  844   LYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREV-  1020
              Y+A+KA  +N Y+TLR E+G  I IT    G + +E+ +GKI+ +EG     ++ER+  
Sbjct  196   FYNASKAAALNFYDTLRMELGGDIRITEVVPGVVESEITKGKILTKEGEMKVDQDERDAI  255

Query  1021  ---HATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLSA  1191
                    PV +FA+ +V   CRG  YV  P WY    L RV  P VL W  RLL    + 
Sbjct  256   LGPTPAEPVGDFARAVVRDVCRGARYVFEPRWYMGVYLLRVCLPEVLAWNSRLLTVGRAG  315

Query  1192  RTTSFIGTGR  1221
              T++    G+
Sbjct  316   ATSTTDTLGK  325



>ref|XP_007038038.1| Hydroxysteroid dehydrogenase 1 [Theobroma cacao]
 gb|EOY22539.1| Hydroxysteroid dehydrogenase 1 [Theobroma cacao]
Length=351

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 128/305 (42%), Positives = 182/305 (60%), Gaps = 16/305 (5%)
 Frame = +1

Query  310   MLALAWPTLCFISACEWLYNLY-----------YGEEIMEDKVVVITGASSGIGEQIAYE  456
              L L  P   F S C +L   Y           +  E +  KVV+ITGASSGIGE +AYE
Sbjct  7     FLNLVAPWFTFFSLCLFLPPFYLFKFFLATLGSFFSENVSGKVVIITGASSGIGEHLAYE  66

Query  457   YAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRV  636
             Y +R A L L ARRE  L+ +++ A  LG+ +V+   ADV   ++C+R + ET+N +GR+
Sbjct  67    YGRRGARLALTARREKSLQEVADRAHDLGSPDVITIRADVSNVDDCQRLVEETVNHFGRL  126

Query  637   DHLVNTASLGHTFYFEEAS-DTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASV  813
             DHLVN A +     FE A  D T F  +MD NFWG+VY T  A+P+LR S+G+++V +S 
Sbjct  127   DHLVNNAGITSVCMFEGAPPDMTNFRAVMDTNFWGSVYTTRFAVPHLRNSKGKIVVLSSA  186

Query  814   ESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAE  993
              SWLP PR S+Y+A+KA L   ++TLR E+G  + IT+ T G I +E+ R K + +EG  
Sbjct  187   NSWLPEPRTSVYNASKAALAAFFDTLRIELGQDVTITIVTPGHIESEITRDKHLSKEGKM  246

Query  994   MQWKEEREVHAT----GPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWT  1161
                ++ R+V  +      V E A+ IV+ ACRGD  +  PSWY    L+++F P V+ W 
Sbjct  247   EVEQDMRDVQVSAIPVASVSECAQAIVNSACRGDRSLTQPSWYSATCLWKLFFPEVIEWG  306

Query  1162  FRLLF  1176
              RL +
Sbjct  307   CRLFY  311



>ref|XP_004975422.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Setaria 
italica]
Length=370

 Score =   245 bits (625),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 121/296 (41%), Positives = 187/296 (63%), Gaps = 5/296 (2%)
 Frame = +1

Query  301   SLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANL  480
             SL++LA+  P           + +   E++   KVV++TGASSGIGEQIAY+YAK+ A L
Sbjct  35    SLLLLAIFLPPYYVYKLATSAFAVVAPEDV-AGKVVLVTGASSGIGEQIAYQYAKKGARL  93

Query  481   VLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTAS  660
              LVARRE  L  ++  A+ +G+ +VL+ A DV   E+CRRF+  T+  +G++DHLVN A 
Sbjct  94    ALVARREASLHDVAAKAKDVGSPDVLVVAGDVANPEDCRRFVQTTVEHFGQLDHLVNNAG  153

Query  661   LGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRM  840
             +    +FEE  D   F  ++ +NFWG V+PT+ ALP+L++S G++  N+S  + L +PRM
Sbjct  154   VASVCWFEEVPDVADFKQVLAVNFWGTVHPTHCALPHLKKSGGKIFANSSAAAVLAMPRM  213

Query  841   SLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREV  1020
             S Y+A+KA ++N +ETLR E+ + +GIT+AT GWI +EM +GK + +EG     ++ R+ 
Sbjct  214   SFYNASKAAVLNFFETLRMELRDEVGITIATPGWIESEMTKGKHLSKEGTVEVDQDMRDA  273

Query  1021  H-ATGPV---EEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
                  PV   E  A+ IV   CRG  ++  P WY    L+R+ +P V +++ R+ +
Sbjct  274   QVGLFPVVRAERCAEAIVDAVCRGRRHLTVPLWYRAMFLWRMLAPEVADFSQRVFY  329



>gb|KDP22587.1| hypothetical protein JCGZ_26418 [Jatropha curcas]
Length=396

 Score =   246 bits (627),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 136/319 (43%), Positives = 196/319 (61%), Gaps = 15/319 (5%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+N ++N+V  P +++ L    PT  F       YN  + E++   KVV+ITGASSGI
Sbjct  37    MDLINKLMNIVFAPLAVLALYHFLPTYHFFKYLLSTYNKIFSEDV-SGKVVLITGASSGI  95

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE +AYEYA+R A L LVARR++RL+ ++  A  +G+ + +I   DV K  +C+ F+  T
Sbjct  96    GEHLAYEYARRGACLALVARRKHRLQVVAAIAEEIGSPDAIILPGDVTKTNDCQEFVDAT  155

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             +  +  VDHLV  A +     FE+  D T F   MDINFWG+VY ++ A+P+L++++G++
Sbjct  156   VKHF--VDHLVANAGVTPVSMFEDVPDITNFTPTMDINFWGSVYSSHFAIPHLKRTKGKI  213

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IV AS  SWLP PRMS Y+A+KA LV++YETLR E+   IGIT+ T G I +EM  GK +
Sbjct  214   IVIASCASWLPTPRMSFYNASKAALVSMYETLRIELAPEIGITIVTPGLIESEMTGGKFL  273

Query  976   VEEGAEMQWKEEREVH---------ATGPVE---EFAKLIVSGACRGDEYVKYPSWYDTF  1119
              ++G     +E R+V             PVE   E AK IV  ACRG++Y+  P WY   
Sbjct  274   NQQGQLEADQEMRDVGLYEHYHVILVVMPVESTPECAKAIVKSACRGEKYLTEPDWYRAI  333

Query  1120  LLYRVFSPNVLNWTFRLLF  1176
               ++VF P+V+ W+ R   
Sbjct  334   FFWKVFCPDVIEWSNRFFL  352



>gb|KDO64429.1| hypothetical protein CISIN_1g042560mg, partial [Citrus sinensis]
Length=287

 Score =   242 bits (618),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 163/245 (67%), Gaps = 4/245 (2%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E +  KVV+ITGASSGIG+ +AYEYA+RRA LVLVARRE +LR +++ A L+G+   L  
Sbjct  43    EDVAGKVVLITGASSGIGKHLAYEYARRRARLVLVARRERQLREVADQAELMGSPFALAI  102

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
              ADV K E+C+ F+  T+  +GR+DHLV  A +     FE+ +D T     MDINFWG+ 
Sbjct  103   PADVSKVEDCKHFVDVTMEHFGRLDHLVTNAGVVPMCLFEDYTDITKPAPAMDINFWGSA  162

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             Y TY A+PYL+Q++G++IV AS   WLP PRMS Y+A+KA  + LYETLR E G  IGIT
Sbjct  163   YGTYFAIPYLKQTKGKIIVVASAAGWLPPPRMSFYNASKAAKIALYETLRVEFGGDIGIT  222

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEEREVHAT----GPVEEFAKLIVSGACRGDEYV  1092
             + T G I +E+  GK + + G     +E R+V  +     P EE AK IV+ ACRGD Y+
Sbjct  223   IVTPGLIESEITGGKFLNKNGKLEVDQEIRDVQISLLPVQPTEECAKAIVNSACRGDRYL  282

Query  1093  KYPSW  1107
               PSW
Sbjct  283   TQPSW  287



>ref|XP_006402075.1| hypothetical protein EUTSA_v10015475mg [Eutrema salsugineum]
 gb|ESQ43528.1| hypothetical protein EUTSA_v10015475mg [Eutrema salsugineum]
Length=349

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/288 (44%), Positives = 178/288 (62%), Gaps = 7/288 (2%)
 Frame = +1

Query  328   PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             P   F    + +++  + E +   KVV+ITGASSGIGE +AYEYA R A L L ARR+NR
Sbjct  25    PPFYFFKFLQSIFSTIFSENLY-GKVVLITGASSGIGENLAYEYASRGACLALTARRKNR  83

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             L  ++E AR +G+ NV    ADV K ++CRR + ETI  +GR+DHLVN A +     FE+
Sbjct  84    LEEVAEIAREIGSPNVFTVHADVSKPDDCRRIVDETITHFGRLDHLVNIAGITQISMFED  143

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
               D T    +MD NFWG+VY T  ALPYLRQS G+++  +S  +WL  PRMS+Y+A+KA 
Sbjct  144   VEDITRTKSVMDTNFWGSVYTTRAALPYLRQSNGKIVAMSSSAAWLTAPRMSIYNASKAA  203

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATGPV---  1038
             +++ +ET+R E+G  + IT+ T G++ +E+ +GK    EG E+ + ++      GPV   
Sbjct  204   VLSFFETMRIELGGDVHITIVTPGFVESELTQGKYYSGEG-ELVFNQDMRDAQIGPVPVA  262

Query  1039  --EEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
                  AK IV+G CR   YV  PSW     L++VF P ++    RLLF
Sbjct  263   SASGCAKGIVNGVCRKQRYVTEPSWVKVTYLWKVFCPELIERGCRLLF  310



>ref|XP_006653339.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Oryza 
brachyantha]
Length=354

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 176/268 (66%), Gaps = 4/268 (1%)
 Frame = +1

Query  382   EEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLI  561
             E+ +  KVV+ITGASSGIGE +AYEYA+R A L LVARRE  LR + + A  LG+  VL+
Sbjct  47    EDDVAGKVVLITGASSGIGEHLAYEYARRGAYLALVARREESLREVGDAAAALGSPGVLV  106

Query  562   TAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGN  741
             T ADV   ++CR+F+ +TI ++GR+DHLVN A++     FEE +D   F  LMDINFWG+
Sbjct  107   TPADVSSPDDCRKFVDDTIRYFGRLDHLVNNAAIWQVGKFEEVTDVNHFRKLMDINFWGH  166

Query  742   VYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGI  921
             VYPT  A+P+L+++ GR++   S  S++ +PR + Y+A+KA ++N Y+TLR E+   + +
Sbjct  167   VYPTRYAIPHLKKTHGRIVGVTSNSSYIFIPRNTFYNASKAAVLNFYDTLRMELAGDVAV  226

Query  922   TVATHGWIGTEMARGKIMVEEGAEMQWKEERE-VHATGPVE---EFAKLIVSGACRGDEY  1089
             T    G + +E+ +GK++ ++GA    + ER+ +  T P E   +FA+  V GACRG  +
Sbjct  227   TEVVPGVVESEITKGKMLTKDGAMAVDQAERDAILGTAPAERAGDFARAAVRGACRGQRH  286

Query  1090  VKYPSWYDTFLLYRVFSPNVLNWTFRLL  1173
             V  P WY    L RV  P  L W+ RLL
Sbjct  287   VFEPRWYRAAYLLRVCLPEALEWSARLL  314



>ref|XP_006366592.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
tuberosum]
Length=353

 Score =   243 bits (621),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/281 (44%), Positives = 179/281 (64%), Gaps = 5/281 (2%)
 Frame = +1

Query  328   PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             P   F+    +++   + E +   KVVVITGASSGIGE +AYEYAK+ A LVL ARR   
Sbjct  29    PLYLFLKFLYFIFRCIFIENV-AGKVVVITGASSGIGEHLAYEYAKKGARLVLAARRRKS  87

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             L  +++ A  LG+  V+   ADV K E+C+R I ETI+ +GR+DHLV+ A++   + FE+
Sbjct  88    LEQVADMAYWLGSPRVISIHADVSKVEDCQRLIEETISNFGRLDHLVSNAAVTPLYMFED  147

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
               + T     MDINFWG VY T+ A+PYL++++G+++   S   +LP  R+S Y+A+KA 
Sbjct  148   LVEVTNAAPAMDINFWGAVYTTHFAIPYLKETKGKIVAITSSAGYLPAARISFYNASKAA  207

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGA----EMQWKEEREVHATGP  1035
             L++ +ETLR E+G  IGIT+ T G I +EM +GK +  EG     ++    E  V    P
Sbjct  208   LISFFETLRVELGTQIGITIVTPGLIESEMTKGKFLTTEGKLEVDQVMRDVEMSVTPILP  267

Query  1036  VEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNW  1158
             VE+ A+ IV  ACRGD+Y+  P W+ TF +Y +F P V++W
Sbjct  268   VEKCARSIVKSACRGDKYLTEPLWFKTFFIYVLFFPEVVDW  308



>ref|XP_010910414.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Elaeis 
guineensis]
Length=349

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/270 (44%), Positives = 182/270 (67%), Gaps = 4/270 (1%)
 Frame = +1

Query  358   WLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARL  537
             W+    + +E ++ KVV+ITGASSGIGE IAY+YA R A+LVLVARRE+ L ++++ A  
Sbjct  35    WMLVRPFSQEDVKGKVVLITGASSGIGEHIAYQYAMRGASLVLVARREHALNSVAKTAIE  94

Query  538   LGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPIL  717
             LGA +VL+  AD+    E  R I ETI  +G+++HLV  A +  +  FE+ ++ + F  +
Sbjct  95    LGAPDVLVKPADISIPNESERIIEETIAHFGQLNHLVVNAGIWSSCLFEDIANISAFTQV  154

Query  718   MDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRF  897
             MD+NFWG+VYPTY A+P+L+ S G +IV AS+  ++P  RMS Y+A+KA ++  YETLR 
Sbjct  155   MDVNFWGSVYPTYYAIPHLKTSHGNIIVTASMAGYVPTARMSFYNASKAAMIRFYETLRS  214

Query  898   EVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVH----ATGPVEEFAKLIVS  1065
             E+G+ I IT+ T G++ +E+ +GK++ ++G     +E R+V       G  ++ A++IV 
Sbjct  215   ELGSEIRITIITPGYVESEITQGKVLKKDGEVGIDEEARDVQLGPFPVGSTKKCAEIIVD  274

Query  1066  GACRGDEYVKYPSWYDTFLLYRVFSPNVLN  1155
              AC+GDEYV +PSW+  F +    +P V+N
Sbjct  275   SACKGDEYVTWPSWFKPFFMVMCLAPEVVN  304



>ref|XP_006282100.1| hypothetical protein CARUB_v10028347mg [Capsella rubella]
 gb|EOA14998.1| hypothetical protein CARUB_v10028347mg [Capsella rubella]
Length=349

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/288 (43%), Positives = 179/288 (62%), Gaps = 7/288 (2%)
 Frame = +1

Query  328   PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             P   F    + +++  + E  +  KVV+ITGASSGIGE++AYEYA R A L L ARR+NR
Sbjct  25    PPFYFFKFLQSIFSTIFSEN-LHGKVVLITGASSGIGERLAYEYACRGACLALTARRKNR  83

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             L  ++E AR +G+ NV+   ADV K ++CRR + +TI  +GR+DHLVN A +     FE 
Sbjct  84    LEEVAEIAREVGSPNVITVHADVSKPDDCRRIVDDTITHFGRLDHLVNNAGITQISMFEN  143

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
               D T    ++D NFWG+VY T  ALPYLRQ+ G+++  +S  +WL  PRMS Y+A+KA 
Sbjct  144   VEDITRTKAVLDTNFWGSVYTTRAALPYLRQTNGKIVAMSSSAAWLTAPRMSFYNASKAA  203

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATGP----  1035
             L++ +ET+R E+G  + IT+ T G+I +E+ +GK    EG  +  ++ R+V   GP    
Sbjct  204   LLSFFETMRIELGGDVHITIVTPGYIESELTQGKYFSGEGELIVNQDVRDVQ-IGPFPVA  262

Query  1036  -VEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
                  AK IV+G CR   YV  PSW+    +++V  P ++ W  RLL+
Sbjct  263   SAAGCAKSIVNGVCRKQRYVTEPSWFKVTYIWKVLCPELIEWGCRLLY  310



>ref|XP_010253812.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=326

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/272 (45%), Positives = 181/272 (67%), Gaps = 4/272 (1%)
 Frame = +1

Query  370   LYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAK  549
             L +  + +  KVV+ITGASSGIGE +AYEYA+R A+LVLVARRE  LR ++E AR LG+ 
Sbjct  38    LTFSSQNIAGKVVLITGASSGIGEHLAYEYARRGASLVLVARREKSLREVAERARQLGSP  97

Query  550   NVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDIN  729
             +VL+  ADV K  EC+RF+  T++ + R+DHLV  A + ++  FE   +  +   +MDIN
Sbjct  98    DVLVIRADVSKVAECKRFVDRTMDHFRRMDHLVCNAGVYNSHLFECGINAEISKPVMDIN  157

Query  730   FWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGN  909
             FWG++YPTY A+P+L++S+G++IVNASV  W   P  S+Y A+KA L+N +ETLR E+  
Sbjct  158   FWGSIYPTYFAIPHLKKSKGKIIVNASVAGWAISPWASVYGASKAALINFFETLRLELAQ  217

Query  910   SIGITVATHGWIGTEMARGKIMVEEGA-EMQWKEEREVHATGPVE---EFAKLIVSGACR  1077
              + IT+    +I +E+ +GK + +EG  E+  K  + +++   V+   E AK IV+GACR
Sbjct  218   EVTITIVAPAFIQSEITQGKHLNKEGILEVDPKLRKIINSRFQVKSAGECAKAIVNGACR  277

Query  1078  GDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLL  1173
             G+ YV  PS+Y    L+    P ++ W  RL+
Sbjct  278   GERYVVEPSYYRLLFLFHFMCPEIVEWFVRLI  309



>emb|CAH66438.1| OSIGBa0132D06.4 [Oryza sativa Indica Group]
 gb|EAY93903.1| hypothetical protein OsI_15676 [Oryza sativa Indica Group]
Length=368

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/268 (44%), Positives = 169/268 (63%), Gaps = 4/268 (1%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E +  KVV++TGASSGIGEQ+AY YA+R A L LVARRE  L  ++  AR LG+ +VL  
Sbjct  62    EDVAGKVVLVTGASSGIGEQVAYRYARRGARLALVARREASLGEVAARARALGSPDVLAV  121

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
               DV + ++CRRF+  T+  +GR+DHLVN A L +  +FEE  D   F  ++D+NFWG V
Sbjct  122   PGDVARPDDCRRFVQATVEHFGRLDHLVNNAGLANVCWFEEVPDVANFKQVLDVNFWGTV  181

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             +PT+ ALP+L+ SRG++ VN+S  + L +PRMS Y+A+KA + N  ETLR E+   +G+T
Sbjct  182   HPTHAALPHLKASRGKIFVNSSASAVLAMPRMSFYNASKAAVHNFAETLRMELHGEVGVT  241

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEEREVH-ATGPV---EEFAKLIVSGACRGDEYV  1092
             VAT GW+ +EM +GK +   GA    ++ R+      PV   E  A+ IV    RG   V
Sbjct  242   VATPGWVDSEMTKGKHLSSHGAMEVDQDTRDAQVGVFPVERGERCAEAIVDAVARGRRRV  301

Query  1093  KYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
               P+WY    L+R  +P V +   R+ +
Sbjct  302   TSPAWYGALFLWRTMAPEVADACQRVFY  329



>ref|NP_001052642.1| Os04g0390700 [Oryza sativa Japonica Group]
 emb|CAD40535.1| OSJNBa0055C08.3 [Oryza sativa Japonica Group]
 dbj|BAF14556.1| Os04g0390700 [Oryza sativa Japonica Group]
 dbj|BAG98013.1| unnamed protein product [Oryza sativa Japonica Group]
Length=368

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/268 (44%), Positives = 169/268 (63%), Gaps = 4/268 (1%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E +  KVV++TGASSGIGEQ+AY YA+R A L LVARRE  L  ++  AR LG+ +VL  
Sbjct  62    EDVAGKVVLVTGASSGIGEQVAYRYARRGARLALVARREASLGEVAARARALGSPDVLAV  121

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
               DV + ++CRRF+  T+  +GR+DHLVN A L +  +FEE  D   F  ++D+NFWG V
Sbjct  122   PGDVARPDDCRRFVQATVEHFGRLDHLVNNAGLANVCWFEEVPDVANFKQVLDVNFWGTV  181

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             +PT+ ALP+L+ SRG++ VN+S  + L +PRMS Y+A+KA + N  ETLR E+   +G+T
Sbjct  182   HPTHAALPHLKASRGKIFVNSSASAVLAMPRMSFYNASKAAVHNFAETLRMELHGEVGVT  241

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEEREVH-ATGPV---EEFAKLIVSGACRGDEYV  1092
             VAT GW+ +EM +GK +   GA    ++ R+      PV   E  A+ IV    RG   V
Sbjct  242   VATPGWVDSEMTKGKHLSSHGAMEVDQDTRDAQVGVFPVERGERCAEAIVDAVARGRRRV  301

Query  1093  KYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
               P+WY    L+R  +P V +   R+ +
Sbjct  302   TSPAWYGALFLWRTMAPEVADACQRVFY  329



>ref|XP_010271121.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X2 [Nelumbo nucifera]
Length=364

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/270 (46%), Positives = 175/270 (65%), Gaps = 4/270 (1%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E M  KVVVITG SSGIGE IAYEYAKRRA+LVLVARRE +L++++E  R LG+ +V+I 
Sbjct  78    ENMAGKVVVITGGSSGIGEHIAYEYAKRRASLVLVARREAKLQSVAERTRQLGSPDVVIV  137

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
              ADV    EC+RF+ E +N +GR+DHLV  A +      E+ ++      +MDINFWG V
Sbjct  138   PADVSMAAECKRFVEEAVNHFGRLDHLVCNAGVVVYCPVEDTTNVEKLRPVMDINFWGPV  197

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             Y T+ ALP+LR+S+GR+IVNAS++ WL  P   LY A+KA +V+  ETLR E+   + +T
Sbjct  198   YATHFALPHLRKSKGRIIVNASMKGWLVSPWSILYGASKAAIVSFCETLRVELAQDVKVT  257

Query  925   VATHGWIGTEMARGKIMVEEG-AEMQWKEEREVHATGPV---EEFAKLIVSGACRGDEYV  1092
             +   G++ +E+ +GK + +EG  E+  +  + +    PV   E+ A+ IV G CRGD Y+
Sbjct  258   IVAPGFVNSEITQGKHISKEGEVEVDQEMSKVMSGKFPVESTEDCARAIVDGVCRGDRYI  317

Query  1093  KYPSWYDTFLLYRVFSPNVLNWTFRLLFDN  1182
               PSWY   L ++   P ++ W  R L+  
Sbjct  318   IEPSWYRILLQFQFLCPELVEWFARSLYKT  347



>ref|NP_001239786.1| uncharacterized protein LOC100808990 [Glycine max]
 gb|ACU21528.1| unknown [Glycine max]
 gb|KHN17485.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Glycine 
soja]
Length=323

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 129/308 (42%), Positives = 191/308 (62%), Gaps = 11/308 (4%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PP SL+++ +  P L  +     +    Y E +   KVV+ITGA+SGIGEQ+AYEYA+R 
Sbjct  13    PPLSLIVIFIFTPPLLLVKLLMCVKKFLYTENV-AGKVVLITGAASGIGEQVAYEYARRG  71

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A L LV  R+++L A+++ AR LG+ +V I  ADV K ++C RF+ ET+N +GR+DHLVN
Sbjct  72    AKLSLVDIRKDKLVAVADKARSLGSPDVTIIGADVSKVQDCNRFVDETVNHFGRLDHLVN  131

Query  652   TASLG-HTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLP  828
              A +   +   E+  D + F  +MDINFWG VY T  A+P+L+ ++GR+IV AS   W P
Sbjct  132   NAGISRKSVGVEDWLDVSEFTPIMDINFWGAVYGTLYAIPHLKINKGRIIVIASGCGWFP  191

Query  829   LPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKE  1008
             LPR+S+Y+A+KA ++N +ETLR E+G  IGIT+AT G++ T++            M+++ 
Sbjct  192   LPRISIYNASKAAVINFFETLRMELGWDIGITIATPGFVKTDLTL--------RAMEFEP  243

Query  1009  EREVHATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLS  1188
                    G   E A  IV  ACRGD YV  PSW    L +++  P +++W   L+F  +S
Sbjct  244   TVGRIPMGSACECAIAIVDSACRGDMYVTNPSWVKVLLPWKLLCPELVDWACCLVF-GVS  302

Query  1189  ARTTSFIG  1212
               ++S  G
Sbjct  303   QNSSSMKG  310



>gb|KGN64430.1| hypothetical protein Csa_1G051680 [Cucumis sativus]
Length=351

 Score =   242 bits (617),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 128/305 (42%), Positives = 187/305 (61%), Gaps = 5/305 (2%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL+N+ LNL++PP SL+      P   F  +   +    + E++   KVV+ITGASSGI
Sbjct  1     MDLLNNFLNLILPPTSLISFFFFLPIYLFFKSLSSIIRSVFSEDV-AGKVVLITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE +AYEYAKR A L LVARRENRLR ++  A+ LG+   L+  AD+ K E+C+R I  T
Sbjct  60    GEHLAYEYAKRGAYLALVARRENRLREVAAVAQYLGSPYALVIPADISKIEDCKRCIQTT  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             +  + R+DHLVN A +     FEE  +      +MD+NFWG VY +Y  +P+L+QSRG++
Sbjct  120   VTHFRRLDHLVNNAGVSSVNLFEEYDNLQNAVPVMDVNFWGMVYCSYYGIPHLKQSRGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             I  AS  +WLP PR+S Y+++KA +++ YETLR EVG  IGIT+ T G + +EM +GK M
Sbjct  180   IGIASSAAWLPAPRLSFYTSSKAAVISFYETLRVEVGRDIGITIVTPGLVESEMTQGKFM  239

Query  976   VEEGAEMQWKEEREVHATG----PVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSP  1143
              ++G     ++ R+   +     P+++  K I+   C+GD Y   P W      Y+   P
Sbjct  240   SKDGHLYLDQQLRDATVSAMPIMPIDDAVKGILRSVCKGDRYATEPRWMKMAFYYKTLWP  299

Query  1144  NVLNW  1158
              ++ W
Sbjct  300   ELVEW  304



>gb|EYU23067.1| hypothetical protein MIMGU_mgv1a009247mg [Erythranthe guttata]
Length=348

 Score =   241 bits (616),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 125/282 (44%), Positives = 177/282 (63%), Gaps = 5/282 (2%)
 Frame = +1

Query  325   WPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARREN  504
             +P      +  +L+   + E +   KVVVI GASSG+GE IAYEY KR A LV+ ARRE 
Sbjct  24    FPGYLLFKSLRYLWRSVFIENV-AGKVVVIAGASSGMGEHIAYEYGKRGAFLVIGARREK  82

Query  505   RLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFE  684
              L+ ++E A LLG+   +    D+ K E+CRR I E IN +G++DHLV +A +     FE
Sbjct  83    ALQQVAETAHLLGSPRAIPIRTDISKPEDCRRLIQEAINQFGKLDHLVMSAGVTPVSLFE  142

Query  685   EASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKA  864
             E    T F   MDINFWG  Y TY A PYLR ++G+++V AS  SWL  PR+S Y+A+KA
Sbjct  143   ETFKVTNFAPAMDINFWGLAYTTYFAAPYLRMTKGKIVVIASSASWLNAPRLSFYNASKA  202

Query  865   GLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATG-PVE  1041
              +V+ +ETLR E G+ IGIT+ T G I +EM +GK + +EG  +  ++ R+V  +  P+E
Sbjct  203   AVVSFFETLRVEFGSGIGITLVTPGLIESEMTKGKFLNKEGKMVVDQDMRDVVMSAVPIE  262

Query  1042  EFAKL---IVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNW  1158
               A+L    V+ ACRGD+Y+  P W+ T L  ++F P  ++W
Sbjct  263   RVARLAKSTVNAACRGDKYLTVPPWFKTTLFIKMFFPEGVDW  304



>ref|XP_011023955.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Populus 
euphratica]
Length=298

 Score =   240 bits (612),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 119/272 (44%), Positives = 169/272 (62%), Gaps = 18/272 (7%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E +  KVV+ITGASSGIGE +AYEYA+R A L L ARRE RLRA+++ AR LG+ +V++ 
Sbjct  43    EKVAGKVVLITGASSGIGEYLAYEYARRGACLALSARREGRLRAVADKARELGSPDVIVI  102

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
             A D+ K E+C RF+ E +N +G++DHLVN A +     FE+  + + F  +M+ NFWG+V
Sbjct  103   ATDISKVEDCERFVNEAMNHFGKLDHLVNNAGVAQIDMFEDCKEISDFATIMNTNFWGSV  162

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             Y ++ A+P+LR+S+GR++  +S+  W  +PRMS Y A+KA + + YETLR E G+ I IT
Sbjct  163   YASHFAIPHLRKSKGRIVGISSIAGWCSVPRMSFYCASKAAITSFYETLRAECGSDIRIT  222

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYVKYPS  1104
             + T G + +EM RG  +                 +   E  AK IV  ACRGD Y+  PS
Sbjct  223   IVTPGVVESEMTRGDFL-----------------SKSTERCAKAIVDSACRGDRYLVEPS  265

Query  1105  WYDTFLLYRVFSPNVLNWTF-RLLFDNLSART  1197
             W     L +V  P VL W F R+L    S ++
Sbjct  266   WARITFLMKVLCPEVLEWWFHRILVAESSKKS  297



>gb|EAZ30541.1| hypothetical protein OsJ_14589 [Oryza sativa Japonica Group]
Length=326

 Score =   241 bits (614),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 117/268 (44%), Positives = 168/268 (63%), Gaps = 4/268 (1%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E +  KVV++ GASSGIGEQ+AY YA++ A L LVARRE  L  ++  AR LG+ +VL  
Sbjct  20    EEVAGKVVLVKGASSGIGEQVAYRYARKGARLALVARREASLGEVAARARALGSPDVLAV  79

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
               DV + ++CRRF+  T+  +GR+DHLVN A L +  +FEE  D   F  ++D+NFWG V
Sbjct  80    PGDVARPDDCRRFVQATVEHFGRLDHLVNNAGLANVCWFEEVPDVANFKQVLDVNFWGTV  139

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             +PT+ ALP+L+ SRG++ VN+S  + L +PRMS Y+A+KA + N  ETLR E+   +G+T
Sbjct  140   HPTHAALPHLKASRGKIFVNSSASAVLAMPRMSFYNASKAAVHNFAETLRMELHGEVGVT  199

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEEREVH-ATGPV---EEFAKLIVSGACRGDEYV  1092
             VAT GW+ +EM +GK +   GA    ++ R+      PV   E  A+ IV    RG   V
Sbjct  200   VATPGWVDSEMTKGKHLSSHGAMEVDQDTRDAQVGVFPVERGERCAEAIVDAVARGRRRV  259

Query  1093  KYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
               P+WY    L+R  +P V +   R+ +
Sbjct  260   TSPAWYGALFLWRTMAPEVADACQRVFY  287



>ref|XP_002321718.2| hypothetical protein POPTR_0015s11200g [Populus trichocarpa]
 gb|EEF05845.2| hypothetical protein POPTR_0015s11200g [Populus trichocarpa]
Length=307

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/273 (43%), Positives = 169/273 (62%), Gaps = 8/273 (3%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E +  KVV+ITGASSGIGE +AYEYA+R A L L ARR+ RLRA++  AR LG+ +V++ 
Sbjct  43    EKVAGKVVLITGASSGIGEYLAYEYARRGACLALAARRQERLRAVAGKARALGSPDVIVI  102

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
               D+ K E+  RFI E +N +G++DHLVN A +     FE+    + F  L D NFWG+V
Sbjct  103   PTDISKVEDSERFINEAVNHFGKLDHLVNNAGVVQIDMFEDCKQISDFATLTDTNFWGSV  162

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             Y T+ A+P+LR+S+GR++  +S+  W  +PRMS Y A+KA + + YETLR E G+ IGIT
Sbjct  163   YTTHFAIPHLRKSKGRIVGISSIAGWFTVPRMSFYCASKAAITSFYETLRAEFGSDIGIT  222

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYVKYPS  1104
             + T G + +EM++G  + +   +    E          E  AK IV  ACRGD Y+  PS
Sbjct  223   IVTPGVVESEMSQGDFLSKAQIDFVPAES--------TERCAKAIVDSACRGDRYLTEPS  274

Query  1105  WYDTFLLYRVFSPNVLNWTFRLLFDNLSARTTS  1203
             W     L +V  P VL W F ++    S++ ++
Sbjct  275   WARMTFLLKVLCPEVLEWLFHMVLVAKSSKKSN  307



>ref|XP_002321719.2| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
 gb|EEF05846.2| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
Length=298

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/272 (44%), Positives = 169/272 (62%), Gaps = 18/272 (7%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E +  KVV+ITGASSGIGE +AYEYA+R A L L ARRE RLRA+++ AR LG+ +V++ 
Sbjct  43    EKVAGKVVLITGASSGIGEYLAYEYARRGACLALSARREERLRAVADKARELGSPDVIVI  102

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
             A D+ K E+C RF+ E +N +G++DHLVN A +     FE+    + F  +M+ NFWG+V
Sbjct  103   ATDISKVEDCERFVNEAMNHFGKLDHLVNNAGVAQIDMFEDCKQISDFATIMNTNFWGSV  162

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             Y ++ A+P+LR+S+GR++  +S+  W  +PRMS YSA+KA + + YETLR E G+ I IT
Sbjct  163   YASHFAIPHLRKSKGRIVGISSIAGWCSVPRMSFYSASKAAITSFYETLRAEFGSDIRIT  222

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYVKYPS  1104
             + T G + +EM +G  +                 +   E  AK IV  ACRGD Y+  PS
Sbjct  223   IVTPGLVESEMTQGDFL-----------------SKSTERCAKAIVDSACRGDRYLVEPS  265

Query  1105  WYDTFLLYRVFSPNVLNWTF-RLLFDNLSART  1197
             W     L +V  P VL W F R+L    S ++
Sbjct  266   WARITFLMKVLCPEVLEWWFHRILVAKSSKKS  297



>gb|KEH21004.1| hydroxysteroid 11-beta-dehydrogenase-like protein [Medicago truncatula]
Length=324

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/296 (45%), Positives = 181/296 (61%), Gaps = 10/296 (3%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PP SL+ + +      F+    +  NL + E  ME KVV+ITGA+SGIGE++AYEYAKR 
Sbjct  13    PPLSLISIPITMLPYLFVKLLVYAKNLVHTES-MERKVVLITGAASGIGEELAYEYAKRG  71

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A L L+  R+  L  +++ AR LG+ +V I  ADV K E+ +RFI ET+  +GR+DHLVN
Sbjct  72    ARLSLIDIRKENLVTVADMARSLGSPDVTIIGADVSKVEDSKRFIDETMKHFGRLDHLVN  131

Query  652   TASL-GHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLP  828
              A + G     E+  D T +  +MD NFWG V+ T  A+P+L+ S+GR+IV AS   W P
Sbjct  132   NAGVSGIPILIEDIHDLTKYNPIMDTNFWGAVHGTLYAIPHLKNSKGRIIVVASGCGWFP  191

Query  829   LPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKE  1008
             LPR+S+Y+A+KA  ++ +ETLR E+G SIGIT+ T G+I T MA      EE A +QW  
Sbjct  192   LPRLSIYNASKAATISFFETLRIELGWSIGITIVTPGFIKTNMALKA--YEEEASLQWI-  248

Query  1009  EREVHATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
                    G   E AK IV  ACRGD YV  PSW       ++  P +++W  R +F
Sbjct  249   -----PLGSANECAKDIVKSACRGDMYVTNPSWLKAVFPSKLLFPELVDWAERHIF  299



>ref|XP_008446283.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Cucumis 
melo]
Length=352

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/305 (42%), Positives = 186/305 (61%), Gaps = 5/305 (2%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MD +N+ LNL++PP SLV      P   F  +   +    + E++   KVV+ITGASSGI
Sbjct  1     MDPLNNFLNLILPPTSLVSFFFFLPIYLFFKSLSSIIRSIFSEDV-AGKVVLITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE +AYEYAKR A L LVARRENRLR ++  A+ LG+   L+  AD+ K E+C+R I  T
Sbjct  60    GEHLAYEYAKRGAYLALVARRENRLREVAAVAQYLGSPYALVIPADISKIEDCKRCIQTT  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             +  + R+DHLVN A +     FEE  +      +MD+NFWG VY +Y  +P+L+QSRG++
Sbjct  120   VTHFRRLDHLVNNAGVSSVNLFEEYDNLQNAVPVMDVNFWGMVYCSYYGIPHLKQSRGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             I  AS  +WLP PR+S Y+++KA +++ YETLR EVG  IGIT+ T G + +EM +GK +
Sbjct  180   IGIASSAAWLPAPRLSFYTSSKAAVISFYETLRVEVGRDIGITIVTPGLVESEMTQGKFI  239

Query  976   VEEGAEMQWKEEREVHATG----PVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSP  1143
              ++G     ++ R+   +     P+++  K I+   CRGD Y   P W      Y+   P
Sbjct  240   SKDGRLYLDQQLRDATVSAMPIMPIDDAVKGILRSVCRGDRYATEPRWMRMAFYYKTLWP  299

Query  1144  NVLNW  1158
              ++ W
Sbjct  300   ELVEW  304



>ref|XP_002446312.1| hypothetical protein SORBIDRAFT_06g013990 [Sorghum bicolor]
 gb|EES10640.1| hypothetical protein SORBIDRAFT_06g013990 [Sorghum bicolor]
Length=348

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/306 (43%), Positives = 183/306 (60%), Gaps = 6/306 (2%)
 Frame = +1

Query  310   MLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLV  489
             +L L  P         +L    + E +   KVV+ITGA+SGIGE +AYEYAKR A L LV
Sbjct  18    LLPLILPAYYVYKVTTYLLGAVFPENVA-GKVVLITGAASGIGEHLAYEYAKRGAYLALV  76

Query  490   ARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGH  669
             ARRE  LR + + A  LG+  VL+  ADV K ++C  FI +TI +YGR+DHLVN AS+  
Sbjct  77    ARREASLREVGDVALGLGSPGVLVLPADVSKPQDCESFIDDTIRYYGRLDHLVNNASVWK  136

Query  670   TFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLY  849
                FEE  D + F  LMDINFWG+VYPT +A+P+L++S GR++   S  S++ + R + Y
Sbjct  137   VCKFEEIEDVSHFRALMDINFWGHVYPTRLAIPHLKRSHGRIVGVTSNSSYIFIGRNTFY  196

Query  850   SAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREV---  1020
             +A+KA  +N Y+TLR E+G  I IT    G + +E+ +GK++ +EG     ++ER+    
Sbjct  197   NASKAAALNFYDTLRMELGGDIRITEVVPGVVESEITKGKMLTKEGEMKVDQDERDAILG  256

Query  1021  -HATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLL-FDNLSAR  1194
                  PV +FA+ +V   CRG  YV  P WY    L R   P VL W  RLL  D + A 
Sbjct  257   PTPAEPVGDFARTVVRDVCRGARYVFEPRWYMGVYLLRACIPEVLAWNSRLLTVDRVGAS  316

Query  1195  TTSFIG  1212
             TT  +G
Sbjct  317   TTDTLG  322



>ref|XP_011044100.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Populus 
euphratica]
Length=307

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/276 (44%), Positives = 170/276 (62%), Gaps = 11/276 (4%)
 Frame = +1

Query  373   YYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKN  552
             Y   E +  KVV+ITGASSGIGE +AYEYA+R A L L ARRE RLRA+S+ AR+LG+ +
Sbjct  39    YITSEKVAGKVVLITGASSGIGEYLAYEYARRGACLALAARREERLRAVSDKARMLGSPD  98

Query  553   VLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINF  732
              ++ + D+ K E+C RFI E +N +GR+DHLVN A +     FE     +   ILM+INF
Sbjct  99    AIVISTDISKVEDCERFITEAVNHFGRLDHLVNNAGIIQIDMFEHCKQISDCAILMNINF  158

Query  733   WGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNS  912
             WG+VY T  A+P+LR+S+GR++  +S+  W  +P+MS Y A+KA + + YETL  E G  
Sbjct  159   WGSVYVTRFAIPHLRKSKGRIVGISSIAGWCSVPKMSFYCASKAAITSFYETLAAEFGPD  218

Query  913   IGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYV  1092
             IGIT+ T G + +EM +G  +         K + +       E  A+ IV+ ACRGD Y+
Sbjct  219   IGITIVTPGVVESEMTQGDFIS--------KAQMDFVPAESTERCAEAIVNSACRGDRYL  270

Query  1093  KYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLSARTT  1200
               PSW     L +V  P V+ W    +   L+ART+
Sbjct  271   VEPSWTRMSFLLKVLCPEVMEWYLHWV---LAARTS  303



>ref|XP_002446311.1| hypothetical protein SORBIDRAFT_06g013980 [Sorghum bicolor]
 gb|EES10639.1| hypothetical protein SORBIDRAFT_06g013980 [Sorghum bicolor]
Length=406

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 186/302 (62%), Gaps = 17/302 (6%)
 Frame = +1

Query  301   SLVMLALAWPTLCFISACEWLYNLY---YGEEIMED---KVVVITGASSGIGEQIAYEYA  462
             SLV+LA+  P         ++Y L    +   + ED   KVV+ITGASSGIGEQIAY+YA
Sbjct  73    SLVLLAIFLPPY-------YIYKLTTSAFAAAVPEDVAGKVVLITGASSGIGEQIAYQYA  125

Query  463   KRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDH  642
             K+ A L LVARR   L  ++  A+ +G+ +VL+ A DV   E+C+RF+  T+  +GR+DH
Sbjct  126   KKGARLALVARRVGSLHDVATRAKDVGSPDVLVVAGDVANLEDCQRFVQATVEHFGRLDH  185

Query  643   LVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESW  822
             LVN A + +  +FEE  D      ++ +NFWG VYPT+ ALP+L++S G++  N+S  + 
Sbjct  186   LVNNAGVAYVCWFEEVPDVADLKQVLAVNFWGAVYPTHCALPHLKKSGGKIFANSSAAAM  245

Query  823   LPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQW  1002
             L +PRMS Y+A+KA ++N +ETLR E+ + +GIT+AT GWI +EM +GK + +EG     
Sbjct  246   LAMPRMSFYNASKAAVLNFFETLRIELHDEVGITIATPGWIESEMTKGKHLSKEGTVEVD  305

Query  1003  KEEREVH-ATGPVEEFAKL---IVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRL  1170
             ++ R+      PV   A+    IV   CRG  ++  P WY    L+R  +P V + + RL
Sbjct  306   QDTRDAQVGLFPVLHAARCAEAIVDAICRGRRHLTVPLWYRALFLWRTLTPEVTDLSQRL  365

Query  1171  LF  1176
              +
Sbjct  366   FY  367



>ref|XP_010271122.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X3 [Nelumbo nucifera]
Length=335

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/307 (42%), Positives = 187/307 (61%), Gaps = 11/307 (4%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGE------QIAY  453
             PP +L++L ++   L        +    + E  M  KVVVITG SSGIGE       IAY
Sbjct  13    PPIALIILCVSTLFLLIFRLFSCISRSIFSEN-MAGKVVVITGGSSGIGEVYRSSTHIAY  71

Query  454   EYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGR  633
             EYAKRRA+LVLVARRE +L++++E  R LG+ +V+I  ADV    EC+RF+ E +N +GR
Sbjct  72    EYAKRRASLVLVARREAKLQSVAERTRQLGSPDVVIVPADVSMAAECKRFVEEAVNHFGR  131

Query  634   VDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASV  813
             +DHLV  A +      E+ ++      +MDINFWG VY T+ ALP+LR+S+GR+IVNAS+
Sbjct  132   LDHLVCNAGVVVYCPVEDTTNVEKLRPVMDINFWGPVYATHFALPHLRKSKGRIIVNASM  191

Query  814   ESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEG-A  990
             + WL  P   LY A+KA +V+  ETLR E+   + +T+   G++ +E+ +GK + +EG  
Sbjct  192   KGWLVSPWSILYGASKAAIVSFCETLRVELAQDVKVTIVAPGFVNSEITQGKHISKEGEV  251

Query  991   EMQWKEEREVHATGPV---EEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWT  1161
             E+  +  + +    PV   E+ A+ IV G CRGD Y+  PSWY   L ++   P ++ W 
Sbjct  252   EVDQEMSKVMSGKFPVESTEDCARAIVDGVCRGDRYIIEPSWYRILLQFQFLCPELVEWF  311

Query  1162  FRLLFDN  1182
              R L+  
Sbjct  312   ARSLYKT  318



>ref|NP_001152614.1| steroleosin [Zea mays]
 gb|ACG48577.1| steroleosin [Zea mays]
 tpg|DAA38130.1| TPA: steroleosin [Zea mays]
Length=350

 Score =   239 bits (609),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 134/307 (44%), Positives = 184/307 (60%), Gaps = 8/307 (3%)
 Frame = +1

Query  310   MLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLV  489
             +L L  P         +L    + E++   KVV+ITGASSGIGE +AYEYAKR A L LV
Sbjct  21    LLPLVLPAYYVYKLTTYLLGAVFPEDV-AGKVVLITGASSGIGEHLAYEYAKRGAYLALV  79

Query  490   ARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGH  669
             ARRE  LR + + A  LG+  VL+  ADV K  +C  FI +TI+++GR+DHLVN AS+  
Sbjct  80    ARREASLREVGDVALGLGSPGVLVLPADVSKPRDCEGFIDDTISYFGRLDHLVNNASIWQ  139

Query  670   TFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLY  849
                FEE  D      LMDINFWG+VYPT +A+P+LR+SRGR++   S  S++ + R + Y
Sbjct  140   VCKFEEIQDVRHLRALMDINFWGHVYPTRLAIPHLRRSRGRIVGVTSNSSYIFIGRNTFY  199

Query  850   SAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHAT  1029
             +A+KA  ++ Y+TLR E+G+ I IT    G + +E+ +GK M+ +G EM+  ++      
Sbjct  200   NASKAAALSFYDTLRMELGSDIRITEVVPGVVESEITKGK-MLTKGGEMKVDQDERDAIL  258

Query  1030  G-----PVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLL-FDNLSA  1191
             G     PV +FA+ +V   CRG  YV  P WY    L R   P VL W  RLL  D + A
Sbjct  259   GPTPAEPVGDFARTVVRDVCRGARYVFEPRWYMGVYLLRACLPEVLAWNSRLLTVDTVGA  318

Query  1192  RTTSFIG  1212
              TT  +G
Sbjct  319   STTDTLG  325



>ref|XP_010323832.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
lycopersicum]
Length=353

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/281 (43%), Positives = 176/281 (63%), Gaps = 5/281 (2%)
 Frame = +1

Query  328   PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             P   FI    +++   + E +   KVVVITGASSGIGE +AYEYAK+ A LVL ARR   
Sbjct  29    PLYLFIKFLYFIFRSIFIENV-AGKVVVITGASSGIGEHLAYEYAKKGARLVLAARRHKS  87

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             L  +++ A  LG+ +V+   ADV K E+C+R I ETI  +GR+DHLV+ A++   + FE+
Sbjct  88    LEQVADMAYWLGSPHVISVHADVSKVEDCKRLINETITNFGRLDHLVSNAAVTPLYMFED  147

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
               D T     MDINFWG VY  + A+PYL++++G+++   S   +LP  R+S Y+A+KA 
Sbjct  148   LVDVTNAAPAMDINFWGAVYTMHFAIPYLKETKGKIVAITSSAGYLPAARISFYNASKAA  207

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGA----EMQWKEEREVHATGP  1035
             L++ +ETLR E+G  IGIT+   G   +EM +GK +  EG     ++    E  V    P
Sbjct  208   LISFFETLRVELGARIGITIVNPGLTESEMTKGKFLTTEGKLEVDQVMRDVEMSVTPILP  267

Query  1036  VEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNW  1158
             VE+ A+ IV+ ACRGD+Y+  P W+  F +Y +F P V++W
Sbjct  268   VEKSARSIVNSACRGDKYLMEPPWFKAFFVYVLFFPEVVDW  308



>ref|XP_011023956.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Populus 
euphratica]
 ref|XP_011023957.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Populus 
euphratica]
Length=307

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/273 (43%), Positives = 168/273 (62%), Gaps = 8/273 (3%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E +  KVV+ITGASSGIGE +AYEYA+R A L L ARR+ RLRA+++ AR LG+ +V++ 
Sbjct  43    ETVAGKVVLITGASSGIGEYLAYEYARRGACLALAARRQERLRAVADKARALGSPDVIVI  102

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
               D+ K E+  RFI E +N +G++DHLVN A +     FE+    + F  L + NFWG+V
Sbjct  103   PTDISKLEDSERFINEAVNHFGKLDHLVNNAGVVQIDMFEDCKQISDFATLTNTNFWGSV  162

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             Y T+ A+P+LR+S+GR    +S+  W P+PRMS Y A+KA + + YETLR EVG+ IGIT
Sbjct  163   YTTHFAIPHLRKSKGRFGGISSIAGWFPVPRMSFYGASKAAITSFYETLRAEVGSDIGIT  222

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYVKYPS  1104
             + T G + +EM +   + +   +    E          E  AK IV  ACRGD  +  PS
Sbjct  223   IVTPGVVDSEMTQEDFLSKAQIDFVPAES--------TERCAKAIVDSACRGDRCLIEPS  274

Query  1105  WYDTFLLYRVFSPNVLNWTFRLLFDNLSARTTS  1203
             W     L +V  P VL W+F ++    S++ ++
Sbjct  275   WTRMLFLLKVLCPEVLEWSFHMVLAAKSSKKSN  307



>ref|XP_007038039.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein, putative 
[Theobroma cacao]
 gb|EOY22540.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein, putative 
[Theobroma cacao]
Length=407

 Score =   239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/265 (45%), Positives = 169/265 (64%), Gaps = 7/265 (3%)
 Frame = +1

Query  376   YGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNV  555
             +  E +  KVV+ITGASSGIGE +AYEYA++ A L L+ARRE+RL  +++ +R LG+ +V
Sbjct  137   FCSENVAGKVVLITGASSGIGEHLAYEYARKGARLALIARREDRLCVVADESRRLGSPDV  196

Query  556   LITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFW  735
             ++  ADV K E+C+RFI + +N++GR+DHL + A++     FE+ +  + F   M  NFW
Sbjct  197   VVIPADVSKLEDCKRFIDKAVNYFGRLDHLASNAAIVKLGLFEDVTQISEFAPTMSTNFW  256

Query  736   GNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSI  915
             G+ Y T+ A+P+LR+S+G++IV ASV  W PLP+ S Y+A KA L++ YETLR E G+ I
Sbjct  257   GSAYGTHFAVPHLRKSKGKIIVIASVAGWAPLPKTSFYNAGKAALISFYETLRVEFGSDI  316

Query  916   GITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYVK  1095
             GIT+ T G I T+M +G+    E        E         E  AK IV+ ACRGD  + 
Sbjct  317   GITIVTPGLIKTDMVQGEAFTSEVQVGFIPGES-------AEGCAKAIVASACRGDRCLT  369

Query  1096  YPSWYDTFLLYRVFSPNVLNWTFRL  1170
              PSWY    L ++  P +L W  RL
Sbjct  370   EPSWYRVGPLLKMLCPELLEWACRL  394



>emb|CDY09733.1| BnaC07g33280D [Brassica napus]
Length=309

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 127/307 (41%), Positives = 190/307 (62%), Gaps = 9/307 (3%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MD+++ +LN+++PP +++ L L +P   FI     +   +   E +  KVV+ITGASSGI
Sbjct  1     MDMLHIILNILLPPLTIIFLFLFYPIYLFIKLLNCVRK-HLCVENVAGKVVLITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE +AYEYAK+ A+L LVARRE+RL+ +++ +R LG+++V+I   DV K  +C +FI ET
Sbjct  60    GEHVAYEYAKKGADLALVARREDRLQIVADTSRKLGSRDVIIIPGDVTKINDCMKFISET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             I+ +G+VDHL+N A +  T  FE  S       +MD NFWG+ Y TY A+P+LR+S+G++
Sbjct  120   ISHFGKVDHLINNAGVSQTVLFENFSQIQDANPIMDTNFWGSTYITYYAIPHLRKSKGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +V AS  + + +P  ++YSA+KA L+  YE LR E+   I +T+   G I T+M   +I+
Sbjct  180   VVIASAAAKIAIPVATIYSASKAALLGFYEALRIELNPDIKVTIVFPGLISTDMTTPEII  239

Query  976   VEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLN  1155
                G++    E        PV   AK I  G CRG+EYV+ PSW   F L +   P V+N
Sbjct  240   KRHGSDFMVSE--------PVSRCAKAIFQGVCRGEEYVETPSWIKWFFLVKSVCPEVIN  291

Query  1156  WTFRLLF  1176
               F   F
Sbjct  292   SIFNYSF  298



>gb|KHG19414.1| Dehydrogenase/reductase SDR family protein 7-like protein [Gossypium 
arboreum]
Length=350

 Score =   237 bits (605),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/303 (41%), Positives = 186/303 (61%), Gaps = 16/303 (5%)
 Frame = +1

Query  310   MLALAWPTLCFISACEWLYNLYYG-----------EEIMEDKVVVITGASSGIGEQIAYE  456
              L L  PT  F S    L   Y+             E +  KV+VITGASSGIGE +AYE
Sbjct  7     FLNLVAPTFTFFSFVFLLPPFYFFNFFLSILRSVFSENVAGKVIVITGASSGIGEHLAYE  66

Query  457   YAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRV  636
             Y +R A L L ARRE  L+ I++ AR LG+ +V++  ADV K ++CRR + ET+N +GR+
Sbjct  67    YGRRGARLALTARREKSLQEIADRARDLGSPDVIVIRADVSKVDDCRRLVEETVNHFGRL  126

Query  637   DHLVNTASLGHTFYFEEA-SDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASV  813
             DHLVN A +     FE+A  D ++F  +MD NFWG+VY T  A+P+L+ S+G+++V +S 
Sbjct  127   DHLVNNAGINTVCMFEDAPPDMSLFRAIMDTNFWGSVYTTRFAVPHLKNSKGKIVVMSSA  186

Query  814   ESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAE  993
              SW+  PR S+Y+A+KA L   ++TLR E+G+ + IT+ T G+I +E+ +GK +  +G  
Sbjct  187   ASWMNDPRTSVYNASKAALTAFFDTLRIELGSEVKITIVTPGFIESEITQGKFLQRDGNM  246

Query  994   MQWKEEREVHATG-PVEE---FAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWT  1161
                ++ R+V  +  PV      A+ IV+ A +GD Y+  PSW+    L+++F P ++ W 
Sbjct  247   EVQQDMRDVQVSSIPVASASGCAQAIVNSASKGDRYLTQPSWFRVTYLWKMFFPELVEWG  306

Query  1162  FRL  1170
             + L
Sbjct  307   YIL  309



>ref|XP_009602452.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nicotiana 
tomentosiformis]
Length=353

 Score =   237 bits (604),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 136/355 (38%), Positives = 195/355 (55%), Gaps = 36/355 (10%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             P  S   L    P   F+    +++   + E +   KVV+ITGASSGIGE +AYEYAKR 
Sbjct  17    PHISTTALIHFMPLYLFLKFLHFIFRSIFSENV-AGKVVLITGASSGIGEHLAYEYAKRG  75

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A LVL ARR   L+ +++ A  LG+ +V+   ADV K E+C+R I E IN +GR+DHLV 
Sbjct  76    ARLVLAARRHRSLQQVADMAYWLGSPDVVPVHADVSKVEDCQRLIEEAINNFGRLDHLVI  135

Query  652   TASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPL  831
              A++   + FE+  + T     MDINFWG VY T+ A+P+L++++G+++   S    L  
Sbjct  136   NAAVTPLYMFEDLIEVTNAAPAMDINFWGAVYTTHFAIPHLKETKGKIVAITSSAGVLNA  195

Query  832   PRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGA----EMQ  999
              R+S Y+A+KA +++ YETLR E+G  IGIT+ T G + +E+ +GK +  EG     ++ 
Sbjct  196   ARISFYNASKAAMISFYETLRVELGTQIGITIVTPGLVESELTKGKFLTTEGKLEVNQVM  255

Query  1000  WKEEREVHATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFD  1179
                E  V    PV++ A+ IV  ACRGD Y+  P W+ T  +YR+F P +L W  R    
Sbjct  256   RDVEMSVTPILPVQKCARAIVKSACRGDNYLTEPPWFRTLFVYRIFFPELLEWFQRWFL-  314

Query  1180  NLSARTTSFIGTGRPITMEssssssPLRLEAPSPA----------GRPVTVLQQH  1314
                     F G G+P T            EAPS            G P +VL  H
Sbjct  315   --------FPGRGQPPT------------EAPSKIILDVTGFKEYGYPKSVLSPH  349



>ref|XP_011073098.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 6 [Sesamum 
indicum]
Length=349

 Score =   236 bits (603),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 125/279 (45%), Positives = 173/279 (62%), Gaps = 6/279 (2%)
 Frame = +1

Query  334   LCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLR  513
             LCF S   + +   + E +   KVVVI GASSGIGE +AYEY KR A LV+ ARREN LR
Sbjct  28    LCFKS-LHFFWRSIFSENV-AGKVVVIAGASSGIGEHVAYEYGKRGAFLVIGARRENALR  85

Query  514   AISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEAS  693
              ++E A L+G+   +   +D+ K E+C+  I E IN +GR+DHLV  A +     FE+  
Sbjct  86    EVAERAYLVGSPRAIPVPSDISKVEDCKTLIQEAINQFGRLDHLVMAAGVTPVSMFEDTF  145

Query  694   DTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLV  873
               T F   MDINFWG  Y TY A PYLR ++GR++V AS  SWL  PR+S Y+A+KA +V
Sbjct  146   QVTNFAPAMDINFWGLAYATYFAAPYLRMTKGRIVVIASSASWLNAPRLSFYNASKAAVV  205

Query  874   NLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATG-PVE---  1041
             + +ETLR E G+ I IT+ T G + +EM +GK + +EG  +  ++ R+V  +  P+E   
Sbjct  206   SFFETLRTEFGSDIRITLVTPGLVESEMTKGKFLDKEGKMVVDQDMRDVVMSAIPIELVG  265

Query  1042  EFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNW  1158
               AK IV GACRGD+Y+  P W+ T    ++  P   +W
Sbjct  266   RCAKAIVDGACRGDKYLTVPPWFRTTFFIKMMLPEATDW  304



>emb|CDP19889.1| unnamed protein product [Coffea canephora]
Length=328

 Score =   236 bits (601),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 121/283 (43%), Positives = 178/283 (63%), Gaps = 7/283 (2%)
 Frame = +1

Query  361   LYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLL  540
             +++ Y   E ++ KVV+ITGASSGIGE  AYEYAKRRA LV+VARREN LR ++E AR L
Sbjct  31    IFHRYLSSESIKGKVVLITGASSGIGEHRAYEYAKRRACLVIVARRENLLREVAEKARKL  90

Query  541   GAKNVLITAADVVK-EEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPIL  717
             G+ +V+   ADV+  +E+C+RF+ E +N +GR+DHLVN A +      E+A+D T F  +
Sbjct  91    GSPDVVPICADVLMVDEDCKRFVEEAVNHFGRLDHLVNNAGISSMCLIEDATDITRFQPV  150

Query  718   MDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRF  897
             MD+NFWG++YPTY A+PYL++++G + VNAS  +++     S+Y+A+KA L++ YET+R 
Sbjct  151   MDVNFWGSIYPTYFAMPYLKRTKGSISVNASASAYMHPSGFSIYTASKAALLSFYETMRS  210

Query  898   EVGNSIGITVATHGWIGTEMARGKIMVEEGA-----EMQWKEEREVHATGPVEEFAKLIV  1062
             E+   I IT+AT G + +EM +GK +  EG      E+      ++ A       AK IV
Sbjct  211   EMPPEISITIATLGLVESEMTKGKHLNREGTTEVSPELADTLINQLPAMS-TSACAKSIV  269

Query  1063  SGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFDNLSA  1191
                CR + YV  P W     L +   P ++ +  R L   + A
Sbjct  270   EAVCRKERYVTEPKWCAVLFLLKAPCPGIIEFVNRRLHLRVKA  312



>emb|CAH66439.1| OSIGBa0132D06.5 [Oryza sativa Indica Group]
Length=355

 Score =   236 bits (603),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 170/263 (65%), Gaps = 5/263 (2%)
 Frame = +1

Query  400   KVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVV  579
             KVV+ITGASSGIGE +AYEYA+R A L LVARRE  LR + + A   G+  VL+ A DV 
Sbjct  52    KVVLITGASSGIGEHLAYEYARRGAYLALVARREESLREVGDAALAAGSPGVLVVAGDVS  111

Query  580   KEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYV  759
               ++CR+F+ +TI ++GR+DHLVN AS+     FEE +D   F  LMDINFWG+VYPT  
Sbjct  112   SPDDCRKFVDDTIRYFGRLDHLVNNASIWQVGKFEELTDVNHFRKLMDINFWGHVYPTRH  171

Query  760   ALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEV-GNSIGITVATH  936
             A+P+L+++RGR++   S  S++ +PR + Y+A+KA   NLYETLR E+ G+ I IT    
Sbjct  172   AIPHLKKTRGRIVGVTSNSSYIFMPRNTFYNASKAAAANLYETLRMELAGDGIAITEVIP  231

Query  937   GWIGTEMARGKIMVEEGAEMQWKEERE-VHATGPVE---EFAKLIVSGACRGDEYVKYPS  1104
             G + +E+ +GK++ +EG     ++ER+ +    PVE   EFA+  V G C G+ YV  P 
Sbjct  232   GVVESEITKGKMLTKEGDMRVDQDERDAILGAAPVERAGEFARATVRGVCGGERYVFEPR  291

Query  1105  WYDTFLLYRVFSPNVLNWTFRLL  1173
             WY      RV  P  L W  RLL
Sbjct  292   WYRAAYTLRVCFPEALEWCARLL  314



>ref|XP_007038040.1| Hydroxysteroid dehydrogenase 2, putative [Theobroma cacao]
 gb|EOY22541.1| Hydroxysteroid dehydrogenase 2, putative [Theobroma cacao]
Length=434

 Score =   239 bits (609),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 131/315 (42%), Positives = 191/315 (61%), Gaps = 19/315 (6%)
 Frame = +1

Query  292   PPASLVMLALAW---PTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYA  462
             PP  L+++AL +   P L F   C     +Y  +E +  KVV+ITGASSGIGE +AYEYA
Sbjct  12    PP--LLIIALVFILPPFLVFKLLCSIQRFVY--KENVAGKVVLITGASSGIGEHLAYEYA  67

Query  463   KRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDH  642
             +R A L LVARR +RL+ ++E AR +G+ +V++  ADV K E+C+RF+ +T+N +G++DH
Sbjct  68    RRGARLALVARRTDRLQKVAERARQMGSPDVIVITADVSKVEDCKRFVDKTVNHFGQLDH  127

Query  643   LVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESW  822
             LVN A +G    F+  ++ + F  +MDINFWG+VY T+ A+P+LR+ RG++IV +S  +W
Sbjct  128   LVNNAGVGAVQSFKVTNNISDFVPVMDINFWGSVYGTHFAVPHLRKRRGKMIVMSSASAW  187

Query  823   LPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQW  1002
             L LP+ S Y+A+KA  +  YE+LR EVG  IGIT+ T G++ +EM R        +  Q 
Sbjct  188   LGLPKTSFYAASKAAQIGFYESLRIEVGPEIGITIVTPGFVESEMTR--------SNQQR  239

Query  1003  KEEREVHATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFDN  1182
             K + +     P +  AK IV   CRGD Y+  P W     L +    N L  T  +  +N
Sbjct  240   KGKLQFLGNEPADVCAKAIVESTCRGDMYLTEPFWVRPLYLLKFL--NFLKRTINI--EN  295

Query  1183  LSARTTSFIGTGRPI  1227
             LS +     G    I
Sbjct  296   LSGKVVLITGASSGI  310


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 56/85 (66%), Gaps = 7/85 (8%)
 Frame = +1

Query  385  EIMEDKVVVITGASSGIGE-------QIAYEYAKRRANLVLVARRENRLRAISENARLLG  543
            E +  KVV+ITGASSGIGE        +A+EYA R A L L ARRE+R RA++E A  LG
Sbjct  294  ENLSGKVVLITGASSGIGEVLLWAMKHLAHEYANRGARLALAARREHRPRAVAEKASQLG  353

Query  544  AKNVLITAADVVKEEECRRFILETI  618
            + + ++   DV K E+C++F+ + +
Sbjct  354  SPDAIVVRVDVSKAEDCKQFVNKAV  378



>ref|XP_009778659.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X1 [Nicotiana sylvestris]
Length=327

 Score =   235 bits (600),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 119/288 (41%), Positives = 177/288 (61%), Gaps = 5/288 (2%)
 Frame = +1

Query  313   LALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVA  492
             L + +P  C      +LY L   E  M+ KVV+ITGASSGIGE++AYEYA+R +++V+VA
Sbjct  24    LCVIFPFFCIFRIVLFLYRLVVSEN-MKGKVVLITGASSGIGEELAYEYARRGSSIVIVA  82

Query  493   RRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHT  672
             RRE +LR ++E AR LG+ +VL   ADV   ++C+R + +T+N +GR+DHLVN A +   
Sbjct  83    RREEQLRKVAEKARSLGSPDVLSIRADVSNVDDCKRLVDQTVNHFGRLDHLVNNAGISSV  142

Query  673   FYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYS  852
                 + +D T +  +MDINFWG+VYPTY A+P+L+++RG+V VN+S  + L  P +S Y+
Sbjct  143   CSINDVTDITKYTSVMDINFWGSVYPTYFAIPHLKKTRGKVFVNSSSVAILHPPSLSFYT  202

Query  853   AAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATG  1032
             A+KA L+  YET+R E+   I IT+AT G+  +E+ RGK  +++G      E        
Sbjct  203   ASKAALIGFYETMRLELAPEISITIATLGFTDSEIIRGK-HLKDGVLQVESELANNVVVL  261

Query  1033  PV---EEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFR  1167
             PV    + AK IVS  CR   Y+  P ++      +   P    W +R
Sbjct  262   PVISSSDCAKSIVSAICRKKRYITEPKYFWVLFFAKTACPQAFEWYYR  309



>ref|XP_010271120.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X1 [Nelumbo nucifera]
Length=370

 Score =   237 bits (604),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 123/276 (45%), Positives = 175/276 (63%), Gaps = 10/276 (4%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGE------QIAYEYAKRRANLVLVARRENRLRAISENARLLGA  546
             E M  KVVVITG SSGIGE       IAYEYAKRRA+LVLVARRE +L++++E  R LG+
Sbjct  78    ENMAGKVVVITGGSSGIGEVYRSSTHIAYEYAKRRASLVLVARREAKLQSVAERTRQLGS  137

Query  547   KNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDI  726
              +V+I  ADV    EC+RF+ E +N +GR+DHLV  A +      E+ ++      +MDI
Sbjct  138   PDVVIVPADVSMAAECKRFVEEAVNHFGRLDHLVCNAGVVVYCPVEDTTNVEKLRPVMDI  197

Query  727   NFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVG  906
             NFWG VY T+ ALP+LR+S+GR+IVNAS++ WL  P   LY A+KA +V+  ETLR E+ 
Sbjct  198   NFWGPVYATHFALPHLRKSKGRIIVNASMKGWLVSPWSILYGASKAAIVSFCETLRVELA  257

Query  907   NSIGITVATHGWIGTEMARGKIMVEEG-AEMQWKEEREVHATGPV---EEFAKLIVSGAC  1074
               + +T+   G++ +E+ +GK + +EG  E+  +  + +    PV   E+ A+ IV G C
Sbjct  258   QDVKVTIVAPGFVNSEITQGKHISKEGEVEVDQEMSKVMSGKFPVESTEDCARAIVDGVC  317

Query  1075  RGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFDN  1182
             RGD Y+  PSWY   L ++   P ++ W  R L+  
Sbjct  318   RGDRYIIEPSWYRILLQFQFLCPELVEWFARSLYKT  353



>gb|EEC77184.1| hypothetical protein OsI_15677 [Oryza sativa Indica Group]
Length=355

 Score =   236 bits (602),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 128/277 (46%), Positives = 175/277 (63%), Gaps = 6/277 (2%)
 Frame = +1

Query  400   KVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVV  579
             KVV+ITGASSGIGE +AYEYA+R A L LVARRE  LR + + A   G+  VL+ A DV 
Sbjct  52    KVVLITGASSGIGEHLAYEYARRGAYLALVARREESLREVGDAALAAGSPGVLVVAGDVS  111

Query  580   KEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYV  759
               ++CR+F+ +TI ++GR+DHLVN AS+     FEE +D   F  LMDINFWG+VYPT  
Sbjct  112   SPDDCRKFVDDTIRYFGRLDHLVNNASIWQVGKFEELTDVNHFRKLMDINFWGHVYPTRH  171

Query  760   ALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEV-GNSIGITVATH  936
             A+P+L+++RGR++   S  S++ +PR + Y+A+KA   NLYETLR E+ G+ I IT    
Sbjct  172   AIPHLKKTRGRIVGVTSNSSYIFMPRNTFYNASKAAAANLYETLRMELAGDGIAITEVIP  231

Query  937   GWIGTEMARGKIMVEEGAEMQWKEERE-VHATGPVE---EFAKLIVSGACRGDEYVKYPS  1104
             G + +E+ +GK++ +EG     ++ER+ +    PVE   EFA+  V G C G+ YV  P 
Sbjct  232   GVVESEITKGKMLTKEGDMRVDQDERDAILGAAPVERAGEFARAAVRGVCGGERYVFEPR  291

Query  1105  WYDTFLLYRVFSPNVLNWTFRLLFD-NLSARTTSFIG  1212
             WY      RV  P  L W  RLL    L   TT  +G
Sbjct  292   WYRAAYTLRVCFPEALEWCARLLTVWRLGPATTDTVG  328



>gb|EPS67142.1| hypothetical protein M569_07637, partial [Genlisea aurea]
Length=294

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/286 (42%), Positives = 175/286 (61%), Gaps = 4/286 (1%)
 Frame = +1

Query  334   LCFISACEWLYNLYYGEEI--MEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENR  507
             L F   C +++     EE   +  K V+ITGASSGIGE +AYEYAKR A+L LVARRE+R
Sbjct  6     LLFDVLCSFVFRHNKLEERNGLHGKAVLITGASSGIGEYMAYEYAKRGASLALVARREDR  65

Query  508   LRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEE  687
             L+ +   AR  G+ +VL+   DV   ++CR+F+  T+N +GR+DHLVN A + + +    
Sbjct  66    LQKVGAKARCFGSPDVLVICGDVSSFDDCRKFVNTTVNHFGRLDHLVNNAGIFNFYSVNW  125

Query  688   ASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAG  867
               + T F  +MD NFWG+VYPTY A+P+L+++RG+++VN+SV + + +P ++ Y A+KA 
Sbjct  126   GVEITKFSPVMDTNFWGSVYPTYFAMPHLKKTRGKIVVNSSVAATVHIPTLAFYCASKAA  185

Query  868   LVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREV--HATGPVE  1041
             L + YE LR EV   +GIT+AT G++ +EM+ GK+M +EG         +V        E
Sbjct  186   LWSFYEALRAEVEPEVGITIATLGFVESEMSDGKVMSKEGKMNDGVRIPQVVRETIMGTE  245

Query  1042  EFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFD  1179
               A+ IV GACRG   V  P W+    +     P++L W F    D
Sbjct  246   ACARAIVGGACRGRRRVTEPQWFKVLAMANYLFPDILQWVFTFFVD  291



>ref|XP_009597072.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X1 [Nicotiana tomentosiformis]
Length=327

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/300 (40%), Positives = 178/300 (59%), Gaps = 5/300 (2%)
 Frame = +1

Query  295   PASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRA  474
             P  L  L + +P  C      +LY L   E  M+ KVV+ITGASSGIGE++AYEYA+R +
Sbjct  18    PLVLGTLCVIFPFFCIFRIVLFLYRLVVSEN-MKGKVVLITGASSGIGEELAYEYARRGS  76

Query  475   NLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNT  654
             ++V+VARRE +L+ ++E A  LG+ +VL   ADV   ++C+R + +T+N +GR+DHLVN 
Sbjct  77    SIVIVARREEQLQKVAEKAMCLGSPDVLSIRADVSNVDDCKRLVDQTVNHFGRLDHLVNN  136

Query  655   ASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLP  834
             A +       + +D T F  +MDINFWG+VYPTY A+P+L+++RG+V VN+S  + L  P
Sbjct  137   AGITSLCSINDVTDITKFTSVMDINFWGSVYPTYFAIPHLKKTRGKVFVNSSSVAILHPP  196

Query  835   RMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEER  1014
              +S Y+A+KA L+  YET+R E+   I IT+AT G+  +E+ RGK  +++G      E  
Sbjct  197   SLSFYTASKAALIGFYETMRLELAPEISITIATLGFTDSEITRGK-HLKDGVLQVESELA  255

Query  1015  EVHATGPV---EEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFDNL  1185
                   PV    + AK IVS  CR   Y+  P ++      +   P    W  R     L
Sbjct  256   NNVVVLPVISSSDCAKSIVSAICRKKRYITEPKYFWVLFFAKTVCPRAFEWFNRTFMSKL  315



>ref|XP_010555563.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Tarenaya 
hassleriana]
Length=306

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/260 (45%), Positives = 167/260 (64%), Gaps = 8/260 (3%)
 Frame = +1

Query  373   YYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKN  552
             Y   E +  KV++ITGASSGIGE +AYEYA+R A + LVARRE RLRA++E +R LG+ +
Sbjct  39    YINAENVAGKVILITGASSGIGEHLAYEYARRGARMALVARREERLRAVAEKSRRLGSPD  98

Query  553   VLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINF  732
             V++   DV   E+C+RF+  TI+ +GR+DHLVN A +G    FE  S  +    +M+INF
Sbjct  99    VIVITGDVSVVEDCKRFVQGTIDHFGRLDHLVNNAGIGEVKAFESYSRISEAARVMEINF  158

Query  733   WGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNS  912
             WG+VY T++++P+L++S+G++I  +SV  WL  P M  Y AAKA ++N YE LR E+G+ 
Sbjct  159   WGSVYTTHLSVPHLKRSKGKIIAVSSVSGWLSQPYMGFYGAAKAAMINFYEALRIELGHE  218

Query  913   IGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYV  1092
             IGITVAT G I T+M    ++  EG    W+    + ATG     AK IV G CR D  V
Sbjct  219   IGITVATPGLIQTDMVTPDVLATEG----WEWVPMLSATG----CAKGIVDGVCRRDRNV  270

Query  1093  KYPSWYDTFLLYRVFSPNVL  1152
               PSW++     +   P ++
Sbjct  271   TVPSWFNVLFWLKTLVPELM  290



>ref|XP_010249087.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X1 [Nelumbo nucifera]
Length=379

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/268 (45%), Positives = 170/268 (63%), Gaps = 4/268 (1%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E M  KV +ITGASSGIGE IAYEYAK+ A+LVLVARREN LR ++  A  LG+ +VL  
Sbjct  73    ENMTGKVALITGASSGIGEHIAYEYAKKGASLVLVARRENSLREVARKAVQLGSPDVLAV  132

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
              ADV K  EC++F+ E +N +GR+DHLV  A +     FE+ +    F  LMDINFWG++
Sbjct  133   PADVSKVHECKKFVEEAVNHFGRLDHLVCNAGIISFCAFEDITGIGNFTPLMDINFWGSI  192

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             Y T  A+P+L++++G++I NAS   WL  P +SLY A+KA ++N YE LR E+   + +T
Sbjct  193   YTTSFAIPHLKKTKGKIIANASSSGWLISPTLSLYGASKAAVINFYERLRKELEPDVKVT  252

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEEREVH----ATGPVEEFAKLIVSGACRGDEYV  1092
             +A  G+I +EM++GK +  EG     +E R+V         V + A+ IV+ ACRG+ YV
Sbjct  253   IAALGFIESEMSQGKHLDNEGVVKVNQEMRDVSIGILPILSVGKCAESIVNKACRGERYV  312

Query  1093  KYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
               P W+   +L +   P +L W    L+
Sbjct  313   IEPPWFKVLILIQFLCPTLLEWAVHFLY  340



>ref|XP_009136723.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 3 [Brassica 
rapa]
Length=309

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/307 (41%), Positives = 188/307 (61%), Gaps = 9/307 (3%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MD+++ +LN+++PP +++ L L +P   FI     +   +   E +  KVV+ITGASSGI
Sbjct  1     MDMLHIILNILLPPLTIIFLFLFYPIYLFIKLLNCVRK-HLCVENVAGKVVLITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE +AYEYAK+ A+L LVARRE+RL  ++E +R LG+++V+I   DV K  +C +FI ET
Sbjct  60    GEHVAYEYAKKGADLALVARREDRLHIVAETSRKLGSRDVIIIPGDVTKINDCMKFISET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             I+ +G+VDHL+N A +  T  FE  S       +MD NFWG+   TY A+P+LR+S+G++
Sbjct  120   ISHFGKVDHLINNAGVSQTVLFENFSQIQDANPIMDTNFWGSTNITYYAIPHLRKSKGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +V AS  + + +P  ++YSA+KA L+  YE LR E+   I +T+   G I T+M   +I+
Sbjct  180   VVIASAAAKIAIPVATIYSASKAALLGFYEALRIELNPDIKVTIVFPGLISTDMTTPEII  239

Query  976   VEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLN  1155
                G++    E        PV   AK I  G CRG+EYV+ PSW   F L +   P V+N
Sbjct  240   KRHGSDFMVSE--------PVSRCAKAIFQGVCRGEEYVETPSWIKWFFLVKSVCPEVIN  291

Query  1156  WTFRLLF  1176
               F   F
Sbjct  292   SIFNYSF  298



>ref|XP_007211157.1| hypothetical protein PRUPE_ppa027140mg [Prunus persica]
 gb|EMJ12356.1| hypothetical protein PRUPE_ppa027140mg [Prunus persica]
Length=326

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/269 (44%), Positives = 173/269 (64%), Gaps = 21/269 (8%)
 Frame = +1

Query  382   EEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLI  561
              E +  KVV+ITGASSGIGE +AYEYA+R A L LVARREN L++++  A  +G+ ++L+
Sbjct  43    SEDVAGKVVLITGASSGIGEHMAYEYARRGACLALVARRENLLQSVASRAMSIGSPDILV  102

Query  562   TAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGN  741
               ADV K E CRRF+   +N +GR+DHLVN A                  I  D NFWG+
Sbjct  103   IPADVSKVENCRRFVDVAVNHFGRLDHLVNNAG-----------------ITPDTNFWGS  145

Query  742   VYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGI  921
             VY TY A+P+L++SRG+++  AS   WL +PR+SLY A K+ +++ YETLR E+G  +GI
Sbjct  146   VYGTYFAIPHLKRSRGKIVGIASSAGWLRVPRLSLYGATKSAVISFYETLRVEIGREVGI  205

Query  922   TVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHAT----GPVEEFAKLIVSGACRGDEY  1089
             T+ T G + +EM +GK + +EG  +  ++ R+V  +     PV+E AK IV  ACRG+ Y
Sbjct  206   TIVTPGLVESEMTKGKFLSKEGQLVLDQQLRDVEVSIMPILPVKEAAKSIVDSACRGENY  265

Query  1090  VKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             +  P+W      ++VF P +L+W+ R+L 
Sbjct  266   LTVPAWVWHSFYWKVFFPELLDWSNRMLL  294



>ref|XP_002322680.1| hypothetical protein POPTR_0016s04930g [Populus trichocarpa]
 gb|EEF04441.1| hypothetical protein POPTR_0016s04930g [Populus trichocarpa]
Length=311

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/265 (42%), Positives = 168/265 (63%), Gaps = 11/265 (4%)
 Frame = +1

Query  382   EEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLI  561
              E +  KVV+ITGASSGIGE +AYEYA R A L LVARRE+RLRA+++ AR LG+ +V  
Sbjct  43    SENVAGKVVLITGASSGIGEDLAYEYAVRGARLALVARREDRLRAVADKARNLGSPDVFQ  102

Query  562   TAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGN  741
               AD+ K E+CRR I ET+N +G++DHLVN A +    YFE+ ++ +    +MD+NFWG+
Sbjct  103   VRADISKVEDCRRIIDETLNHFGQLDHLVNNAGISQAAYFEDCTEVSDLTHIMDVNFWGS  162

Query  742   VYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGI  921
              + +  A+P+L++S+G+++V +S+  W   P++S+Y+A+KA L++ Y TLR E+G+ IGI
Sbjct  163   TFCSRFAIPHLKRSKGKIVVISSIAPWSLTPKLSVYNASKAALISFYGTLRLEIGSHIGI  222

Query  922   TVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYVKYP  1101
             T+   G I TEM     + +   +     E       P  + AK IV   CRGD Y+  P
Sbjct  223   TIVMPGLIDTEMTSPSSLAKYSVKYCPPNE-------PANQCAKAIVKSTCRGDRYLTEP  275

Query  1102  SWYDTFLLYRVFSPNVLN----WTF  1164
             SW++   +++   P  L+    W F
Sbjct  276   SWWNALFMFKSLCPEALDLILCWAF  300



>ref|NP_001052643.2| Os04g0390800 [Oryza sativa Japonica Group]
 dbj|BAF14557.2| Os04g0390800, partial [Oryza sativa Japonica Group]
Length=361

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 127/277 (46%), Positives = 175/277 (63%), Gaps = 6/277 (2%)
 Frame = +1

Query  400   KVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVV  579
             +VV+ITGASSGIGE +AYEYA+R A L LVARRE  LR + + A   G+  VL+ A DV 
Sbjct  58    RVVLITGASSGIGEHLAYEYARRGAYLALVARREESLREVGDAALAAGSPGVLVVAGDVS  117

Query  580   KEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYV  759
               ++CR+F+ +TI ++GR+DHLVN AS+     FEE +D   F  LMDINFWG+VYPT  
Sbjct  118   SPDDCRKFVDDTIRYFGRLDHLVNNASIWQVGKFEELTDVNHFRKLMDINFWGHVYPTRH  177

Query  760   ALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEV-GNSIGITVATH  936
             A+P+L+++RGR++   S  S++ +PR + Y+A+KA   NLYETLR E+ G+ I IT    
Sbjct  178   AIPHLKKTRGRIVGVTSNSSYIFMPRNTFYNASKAAAANLYETLRMELAGDGIAITEVIP  237

Query  937   GWIGTEMARGKIMVEEGAEMQWKEERE-VHATGPVE---EFAKLIVSGACRGDEYVKYPS  1104
             G + +E+ +GK++ +EG     ++ER+ +    PVE   EFA+  V G C G+ YV  P 
Sbjct  238   GVVESEITKGKMLTKEGDMRVDQDERDAILGAAPVERAGEFARAAVRGVCGGERYVFEPR  297

Query  1105  WYDTFLLYRVFSPNVLNWTFRLLFD-NLSARTTSFIG  1212
             WY      RV  P  L W  RLL    L   TT  +G
Sbjct  298   WYRAAYTLRVCFPEALEWCARLLTVWRLGPATTDTVG  334



>emb|CDX90560.1| BnaA03g42210D [Brassica napus]
Length=309

 Score =   233 bits (594),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 126/307 (41%), Positives = 189/307 (62%), Gaps = 9/307 (3%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MD+++ +LN+++PP +++ L L +P   FI     +   +   E +  KVV+ITGASSGI
Sbjct  1     MDMLHIILNILLPPLTIIFLFLFYPIYLFIKLLNCVRK-HLCVENVAGKVVLITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE +AYEYAK+ A+L LVARRE+RL+ +++ +R LG+++V+I   DV K  +C +FI ET
Sbjct  60    GEHVAYEYAKKGADLALVARREDRLQIVADTSRKLGSRDVIIIPGDVTKINDCMKFISET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             I+ +G+VDHL+N A +  T  FE  S       +MD NFWG+   TY A+P+LR+S+G++
Sbjct  120   ISHFGKVDHLINNAGVSQTVLFENFSQIQDANPIMDTNFWGSTNITYYAIPHLRKSKGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +V AS  + + +P  ++YSA+KA L+  YE LR E+   I +T+   G I T+M   +I+
Sbjct  180   VVIASAAAKIAIPVATIYSASKAALLGFYEALRIELNPDIKVTIVFPGLISTDMTTPEII  239

Query  976   VEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLN  1155
                G++    E        PV   AK I  G CRG+EYV+ PSW   F L +   P V+N
Sbjct  240   KRHGSDFMVSE--------PVSRCAKAIFQGVCRGEEYVETPSWIKWFFLVKSVCPEVIN  291

Query  1156  WTFRLLF  1176
               F   F
Sbjct  292   SIFNYSF  298



>ref|XP_006404394.1| hypothetical protein EUTSA_v10011076mg [Eutrema salsugineum]
 gb|ESQ45847.1| hypothetical protein EUTSA_v10011076mg [Eutrema salsugineum]
Length=309

 Score =   233 bits (593),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 126/307 (41%), Positives = 192/307 (63%), Gaps = 9/307 (3%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MD++N++LNL++PP +++ L L +P    I     L+     E +   KVV+ITGASSGI
Sbjct  1     MDMLNTILNLLIPPLTIIFLFLFYPFYLLIKLVICLHKHLRFENV-AGKVVLITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE +AYEYAK+ A L LVARR++RL+ ++E +R LG+ +V+I   DV K E+C++FI ET
Sbjct  60    GEHLAYEYAKKGAYLALVARRKDRLQIVAETSRQLGSGDVIIIPGDVAKVEDCKKFIDET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             I+ +G++DHL+N A +  T +FE+        I+MDINFWG+ Y TY A+P+LR+S+G++
Sbjct  120   IHHFGKLDHLINNAGVSKTVHFEDFIQIQDANIIMDINFWGSTYITYFAIPHLRKSKGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IV  S  + +PLP  S+YSA+KA L+ L+ETLR E+   I IT+   G I T+M   + M
Sbjct  180   IVITSGAANIPLPLTSIYSASKAALLGLFETLRVELSPEIKITIVLPGVISTDMTTHQFM  239

Query  976   VEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLN  1155
              + G++    E         V + AK I  G  RG+ Y++ P W     L +   P +++
Sbjct  240   DKYGSDFILSES--------VSKCAKAIFKGIGRGETYIEEPCWIKWMFLVKYVCPEIVD  291

Query  1156  WTFRLLF  1176
             +    L+
Sbjct  292   YALNYLY  298



>ref|XP_010270763.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=318

 Score =   233 bits (593),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 133/306 (43%), Positives = 180/306 (59%), Gaps = 6/306 (2%)
 Frame = +1

Query  295   PASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRA  474
             P +L  L +  P L FI             E M  KVV+ITGASSGIGE +AYEYAKR A
Sbjct  14    PVALTFLFIVLPLL-FIGRFISSLIRSLSSENMSGKVVLITGASSGIGEHLAYEYAKRGA  72

Query  475   NLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNT  654
              LVLVARRE  L  +++ A  LG+ +V +  ADV + +EC+RF+ ET+  +GR+DHLV  
Sbjct  73    FLVLVARREKMLVEVAKKAGQLGSPDVFVIRADVSQADECKRFVQETVRRFGRLDHLVCN  132

Query  655   ASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLP  834
             A +     FE     +    +MDINFWG++YPTY A+P+LR+S+G+++VNAS  SWL  P
Sbjct  133   AGIVSFGKFENVLGFSNLKSVMDINFWGSIYPTYFAIPHLRKSKGKIVVNASGTSWLISP  192

Query  835   RMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEM-ARGKIMVEEGAEMQWKEE  1011
               S Y A+KA +VN YET+R E+   I IT+A   +  +EM + GK + ++G     +E 
Sbjct  193   FFSFYGASKAAIVNFYETMRIELAPEIKITIAAPWYTESEMVSHGKSLTKDGVVENSREM  252

Query  1012  REVH-ATGPVEEF---AKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFRLLFD  1179
             REV     PV      AK IV+GAC G+ YV  P  Y    L + F P ++ W  R L+ 
Sbjct  253   REVLIGKLPVMRVGVCAKDIVNGACSGERYVIEPFCYKILFLLQFFYPGIVEWAARRLYM  312

Query  1180  NLSART  1197
               S  T
Sbjct  313   GKSGTT  318



>ref|XP_006653338.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Oryza 
brachyantha]
Length=313

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/274 (43%), Positives = 171/274 (62%), Gaps = 5/274 (2%)
 Frame = +1

Query  301   SLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANL  480
             SL++LA+  P  C              E++   KV ++TGASSGIGEQ+AY YA+R A L
Sbjct  35    SLLLLAVFMPPYCAYRLASSALAAAAPEDVA-GKVALVTGASSGIGEQVAYRYARRGARL  93

Query  481   VLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVNTAS  660
              LVARRE  LR ++  AR LG+ +VL+   DV + ++CRRF+  T+  +GR+DHLVN A 
Sbjct  94    ALVARREASLREVAARARELGSPDVLVVPGDVARPDDCRRFVQATVEHFGRLDHLVNNAG  153

Query  661   LGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRM  840
             L +  +FE+  D   F  ++D+NFWG V+PT+ ALP+LR+S G++ VN+S  + L +PRM
Sbjct  154   LANVCWFEDVPDVANFKQVLDVNFWGTVHPTHAALPHLRESGGKIFVNSSAAAELAMPRM  213

Query  841   SLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQWKEEREV  1020
             S Y+A+KA +++  ETLR E+   +G+TVAT GW+ +EM +GK +   GA    ++ R+ 
Sbjct  214   SFYNASKAAVLSFAETLRVELHGEVGVTVATPGWVESEMTKGKHLSGHGAVEVDQDVRDA  273

Query  1021  H-ATGPV---EEFAKLIVSGACRGDEYVKYPSWY  1110
                  PV   E  A+ IV    RG   V  P+WY
Sbjct  274   QVGVFPVERGERCAEAIVDAVARGRRRVTVPAWY  307



>ref|XP_004153126.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Cucumis sativus]
Length=344

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/262 (44%), Positives = 165/262 (63%), Gaps = 4/262 (2%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E +  KVV+ITGASSGIGE +AYEYAKR A L LVARRENRLR ++  A+ LG+   L+ 
Sbjct  36    EDVAGKVVLITGASSGIGEHLAYEYAKRGAYLALVARRENRLREVAAVAQYLGSPYALVI  95

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
              AD+ K E+C+R I  T+  + R+DHLVN A +     FEE  +      +MD+NFWG V
Sbjct  96    PADISKIEDCKRCIQTTVTHFRRLDHLVNNAGVSSVNLFEEYDNLQNAVPVMDVNFWGMV  155

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             Y +Y  +P+L+QSRG++I  AS  +WLP PR+S Y+++KA +++ YETLR EVG  IGIT
Sbjct  156   YCSYYGIPHLKQSRGKIIGIASSAAWLPAPRLSFYTSSKAAVISFYETLRVEVGRDIGIT  215

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATG----PVEEFAKLIVSGACRGDEYV  1092
             + T G + +EM +GK M ++G     ++ R+   +     P+++  K I+   C+GD Y 
Sbjct  216   IVTPGLVESEMTQGKFMSKDGHLYLDQQLRDATVSAMPIMPIDDAVKGILRSVCKGDRYA  275

Query  1093  KYPSWYDTFLLYRVFSPNVLNW  1158
               P W      Y+   P ++ W
Sbjct  276   TEPRWMKMAFYYKTLWPELVEW  297



>ref|XP_002983555.1| hypothetical protein SELMODRAFT_234271 [Selaginella moellendorffii]
 gb|EFJ15456.1| hypothetical protein SELMODRAFT_234271 [Selaginella moellendorffii]
Length=339

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 134/321 (42%), Positives = 187/321 (58%), Gaps = 21/321 (7%)
 Frame = +1

Query  292   PPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGIGEQIAYEYAKRR  471
             PP  LV L L WP +  +S   W+++    E +   KV VITG SSGIGE +AYEY KR 
Sbjct  8     PPLGLVFLLLTWPAVACLSFWRWVFSYALAENV-RGKVAVITGPSSGIGEYMAYEYGKRG  66

Query  472   ANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDHLVN  651
             A +VL+ RREN+L+ + E  R   A + L+  ADV +EEEC++ +  TIN  G++ +L +
Sbjct  67    AKVVLIGRRENQLKNVQERVRSERATDTLVVVADVSREEECKKVVDVTINTLGKI-YLCD  125

Query  652   TA--SLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESWL  825
             T   +L        AS +       D+NF G VY TY ALP+LR+SRG+++V AS  SWL
Sbjct  126   TQLITLSAIMVLRTASSSRK---RKDVNFMGCVYTTYFALPHLRKSRGKIVVTASTASWL  182

Query  826   PLPRMSLYSAAKAGLVNLYETLRFEVGNSI-GITVATHGWIGTEMARGKIMVEEGAEMQW  1002
             P+PRMS+Y+A+KA +VN ++TLR E  + I G+T+A  G+I +EM  GK M  EG +   
Sbjct  183   PIPRMSMYNASKAAVVNFFDTLRTEERSDIGGMTIAMPGYIHSEMTMGKFMSAEGKQYMN  242

Query  1003  KEEREVHATGP-----VEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFR  1167
              + R+    GP      +  AK IVS A RG+ YV  P+WY    L+RVF P +L     
Sbjct  243   VDIRDT-LVGPSPVASTQYCAKQIVSAATRGERYVVVPAWYKVSPLFRVFVPQLLETFIS  301

Query  1168  LLFDNLSARTTSFIGTGRPIT  1230
             L F          +  G+P+T
Sbjct  302   LFF-------VKELQPGKPVT  315



>ref|XP_010271842.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X2 [Nelumbo nucifera]
Length=287

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/269 (46%), Positives = 165/269 (61%), Gaps = 5/269 (2%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E M  KVV+ITGASS IGE IAYEYAKR A LVLVA RE+ L  ++  AR LG+ +V++ 
Sbjct  2     ENMAGKVVLITGASSAIGEHIAYEYAKRGAYLVLVATREDCLGKVAGRARQLGSPDVVLI  61

Query  565   AADVVKEEECRRFILETINF-YGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGN  741
              ADV + +EC+RF+ E +N  +GR+DHLV          FE+A+D   F  +MD+NFWG+
Sbjct  62    CADVSQIKECKRFVEEAVNHHFGRLDHLVCNTGTESFGLFEDAADVAKFAPVMDVNFWGS  121

Query  742   VYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGI  921
             V P   A+P+LR+SRGR++VNASV  W   P  S+Y A KA LVN YET R ++   + I
Sbjct  122   VAPACFAIPHLRKSRGRIVVNASVLGWTVSPWASVYGATKAALVNFYETFRIDLKQEVKI  181

Query  922   TVATHGWIGTEMARGKIMVEEGAEMQWKEEREV----HATGPVEEFAKLIVSGACRGDEY  1089
             T     +I  EM + K     G  +  ++ R++     A    EE AK IV+GACRGD Y
Sbjct  182   TTVAPAFIEAEMLQEKHSSNTGDIVADEKMRKIMVSLFAVRSSEECAKAIVNGACRGDRY  241

Query  1090  VKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             V  P WY  F+L++   P ++ W    LF
Sbjct  242   VIEPPWYKVFILFQFVCPGLVQWCAHWLF  270



>ref|XP_010515042.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 3 [Camelina 
sativa]
Length=309

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 125/307 (41%), Positives = 189/307 (62%), Gaps = 9/307 (3%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MD++ S+LNL+VPP +++ L L +P    +     L+  Y   E +  KVV+ITGASSGI
Sbjct  1     MDMLTSILNLLVPPLTIIFLFLFYPFYLLVKLVRCLHK-YLRFENVAGKVVLITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE +AYEYAK+ A L LVARR++RL  ++E +R LG+ +V+I   DV K E+C++FI ET
Sbjct  60    GEHVAYEYAKKGACLALVARRKDRLEIVAETSRQLGSGDVIIILGDVAKVEDCKKFIDET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             ++ +G++DHL+N A +  T  FE+ +       +MD+NFWG  Y TY A+P+LR+S+G++
Sbjct  120   VHHFGKLDHLINNAGVFQTVLFEDFTQIQDANPIMDVNFWGTTYSTYFAIPHLRKSKGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             IV AS  + +PLP  S+YSA+KA L+  +ETLR E+   I IT+   G I T+M     +
Sbjct  180   IVIASGSANIPLPLASIYSASKAALLRFFETLRIELSPDIKITIVLPGVISTDMTTPHCL  239

Query  976   VEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLN  1155
              + G++    E         V + AK I  G  RGD Y++ PSW     + +   P +++
Sbjct  240   EKYGSDFLLSES--------VSKCAKSIFRGIGRGDTYIEEPSWMKWVFVMKNVCPEIVD  291

Query  1156  WTFRLLF  1176
             +    LF
Sbjct  292   YVLNYLF  298



>gb|KDP22588.1| hypothetical protein JCGZ_26419 [Jatropha curcas]
Length=302

 Score =   230 bits (586),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/256 (45%), Positives = 164/256 (64%), Gaps = 8/256 (3%)
 Frame = +1

Query  400   KVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVV  579
             KV++ITGASSGIGE IAYEYA++ A L L ARRE+RL+A+++ AR LG+ +V+    DV 
Sbjct  41    KVILITGASSGIGEHIAYEYARKGARLALAARREDRLQAVADKARKLGSPDVIAMRTDVS  100

Query  580   KEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYV  759
             + E+C+RFI E  N +GR+DHLVN A +      E+  D + F  +MD+NFWG+V  + +
Sbjct  101   RIEDCKRFIDEAFNHFGRLDHLVNNAGIAPRSMLEDCYDFSSFVPVMDVNFWGSVRCSQL  160

Query  760   ALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHG  939
             A+PYLR++RG+++V AS+  WL  P++S Y+A+KA L++ YET+R E G+ IGIT+   G
Sbjct  161   AVPYLRKNRGKIVVIASIAPWLSTPKLSFYNASKAALISFYETMRIECGSHIGITIVIPG  220

Query  940   WIGTEMARGKIMVEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYVKYPSWYDTF  1119
              I +E+     + E GAE    E  +V         AK IV+ A RGD Y+  PS     
Sbjct  221   LIESEITTPDFLSEFGAESAAVESTQV--------CAKAIVNSARRGDMYLTVPSGMKVM  272

Query  1120  LLYRVFSPNVLNWTFR  1167
              L + F P +L   FR
Sbjct  273   FLLKTFCPELLERLFR  288



>ref|XP_010503335.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 2 [Camelina 
sativa]
Length=309

 Score =   230 bits (586),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 123/307 (40%), Positives = 186/307 (61%), Gaps = 9/307 (3%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL++++LNL++PP ++  L L +P   FI     LY   + E +   KVV+ITGASSGI
Sbjct  1     MDLIHTILNLLLPPLTISFLVLFYPLYLFIKLVSCLYKHLWFENV-AGKVVLITGASSGI  59

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE +AYEYAK+ A L LVARR++RL  ++E +R LG+ +V+I   DV   E+C++FI ET
Sbjct  60    GEHVAYEYAKKGACLALVARRKDRLEIVAETSRQLGSGDVIIIPGDVSNVEDCKKFIDET  119

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             I  +G++DHL+N A +  T  FE  +       +MDINFWG+ Y TY A+P+LR+S+G++
Sbjct  120   ILHFGKLDHLINNAGVPQTILFENFTQIQDANHIMDINFWGSTYITYFAIPHLRKSKGKI  179

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +V  S  + +PLP  S+YSA+KA L+  +ETLR E+   I IT+   G+I T M     +
Sbjct  180   VVTTSASAVIPLPSASVYSASKAALLKFFETLRVEISPDIKITIVIPGFISTNMTTPLFI  239

Query  976   VEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLN  1155
                G+++   E         V + AK I  G  RG+ Y+  PSW     + +   P +++
Sbjct  240   DMYGSDLILSES--------VSKCAKSIFKGIARGETYIAEPSWIKWIFMIQKVCPEIVD  291

Query  1156  WTFRLLF  1176
             +    +F
Sbjct  292   YVLNYIF  298



>ref|XP_010271841.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X1 [Nelumbo nucifera]
Length=328

 Score =   230 bits (587),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 123/269 (46%), Positives = 165/269 (61%), Gaps = 5/269 (2%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E M  KVV+ITGASS IGE IAYEYAKR A LVLVA RE+ L  ++  AR LG+ +V++ 
Sbjct  43    ENMAGKVVLITGASSAIGEHIAYEYAKRGAYLVLVATREDCLGKVAGRARQLGSPDVVLI  102

Query  565   AADVVKEEECRRFILETINF-YGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGN  741
              ADV + +EC+RF+ E +N  +GR+DHLV          FE+A+D   F  +MD+NFWG+
Sbjct  103   CADVSQIKECKRFVEEAVNHHFGRLDHLVCNTGTESFGLFEDAADVAKFAPVMDVNFWGS  162

Query  742   VYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGI  921
             V P   A+P+LR+SRGR++VNASV  W   P  S+Y A KA LVN YET R ++   + I
Sbjct  163   VAPACFAIPHLRKSRGRIVVNASVLGWTVSPWASVYGATKAALVNFYETFRIDLKQEVKI  222

Query  922   TVATHGWIGTEMARGKIMVEEGAEMQWKEEREV----HATGPVEEFAKLIVSGACRGDEY  1089
             T     +I  EM + K     G  +  ++ R++     A    EE AK IV+GACRGD Y
Sbjct  223   TTVAPAFIEAEMLQEKHSSNTGDIVADEKMRKIMVSLFAVRSSEECAKAIVNGACRGDRY  282

Query  1090  VKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             V  P WY  F+L++   P ++ W    LF
Sbjct  283   VIEPPWYKVFILFQFVCPGLVQWCAHWLF  311



>ref|XP_010656935.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Vitis 
vinifera]
Length=331

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/300 (39%), Positives = 182/300 (61%), Gaps = 11/300 (4%)
 Frame = +1

Query  301   SLVMLALAWPTLCFISACEWLYNLY------YGEEIMEDKVVVITGASSGIGEQIAYEYA  462
             +LV+  L +  +C I     ++ L       +  E M  KVV+ITGASSGIGE +AYEYA
Sbjct  12    NLVLTPLVFAIICLILPFLIIFRLVVSISSRFSSENMARKVVLITGASSGIGEHMAYEYA  71

Query  463   KRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDH  642
             K  A L LVARR+ +L A++  AR LG+ +VL   ADV    +C+R I +TIN +G+++H
Sbjct  72    KMGACLALVARRKEKLEAVAARARGLGSPDVLALRADVSNVNDCKRSIDDTINHFGKLNH  131

Query  643   LVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESW  822
             LVN A +G     EE +D T    LMD+N+WG+VYPTY A+P+LR+++G+++VN+S  + 
Sbjct  132   LVNNAGIGSVCALEEITDITNSGSLMDVNYWGSVYPTYFAIPHLRKTKGKIVVNSSTSAL  191

Query  823   LPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQW  1002
             +  P MS Y+++KA ++  +E+LR E+   + +++ T G++ +EM  GK++   G  +  
Sbjct  192   VQPPSMSFYTSSKAAVIGFFESLRGELDPEVTVSIVTLGFVESEMTEGKLVSGNGEVIVA  251

Query  1003  KEE-REVHATGPVEE----FAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFR  1167
                 + +  TG  +      AK+IV   CRG+ YV  P WY    L++   P V+ W FR
Sbjct  252   PNLIKAISPTGLPKMRAGLAAKVIVDAICRGERYVTEPKWYRMLTLFKYLCPEVIEWHFR  311



>ref|XP_010086989.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
 gb|EXB25268.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
Length=311

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/305 (40%), Positives = 189/305 (62%), Gaps = 8/305 (3%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MDL++  LNLV+PPA+L+ + +  P        +   NL+   E +  KVV+ITG SSGI
Sbjct  1     MDLIHKFLNLVLPPAALIAILVFLPPFLIYKLFKHFTNLFKPTENLAGKVVLITGGSSGI  60

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE +AYEYA+R A+L LVARRE RL+A++  A  LG+ + ++  ADV + E+C+R + ET
Sbjct  61    GEHLAYEYARRGASLALVARREERLKAVATKAVGLGSPDAIVICADVSEVEDCKRLVDET  120

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             ++ +G++DHLVN A +     FE+++  +    +MDINFWG+VY T  A+P+LR+++G++
Sbjct  121   MDHFGQLDHLVNNAGVLQVSLFEDSTQLSAIRSIMDINFWGSVYCTQFAVPHLRKAKGKI  180

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +V +S  +W   PR+S+Y+A+KA  ++ +ETL+ E G+ +GIT+ T G + +EM   +  
Sbjct  181   VVTSSSGAWYSPPRLSVYNASKAAQISFFETLKSEYGSDVGITIVTPGLVESEMTGDQFW  240

Query  976   VEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLN  1155
              + G +    E          E  AK IV  ACRGD Y+  PSW      ++V  P ++ 
Sbjct  241   SKSGIKGIPVES--------AEGCAKAIVDSACRGDMYLTEPSWCKVGFWFKVIWPQLVQ  292

Query  1156  WTFRL  1170
               F L
Sbjct  293   KCFHL  297



>ref|XP_011033248.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Populus 
euphratica]
Length=310

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/264 (42%), Positives = 166/264 (63%), Gaps = 11/264 (4%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E +  KVV+ITGASSGIGE +AYEYA R A L LVARRE+RLRA+++ AR LG+ NV   
Sbjct  43    ENVAGKVVLITGASSGIGEDLAYEYAVRGARLALVARREDRLRAVADKARNLGSPNVFHV  102

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNV  744
              ADV K E+C+R I ET+N +G +DHLVN A +    YFE+ ++ +    +MD+NFWG+ 
Sbjct  103   RADVSKVEDCKRIIDETLNHFGHLDHLVNNAGISQAEYFEDCTEVSDLTHIMDVNFWGSA  162

Query  745   YPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGIT  924
             + +  A+P+L++S+G+++V +SV  W   P++S+Y+A+KA L++ Y+TLR E+G+ IGIT
Sbjct  163   FCSRFAIPHLKRSKGKIVVISSVAPWSRTPKLSVYNASKAALISFYDTLRVEIGSHIGIT  222

Query  925   VATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYVKYPS  1104
             +   G I TEM     + +   +     E          + A+ IV   CRGD Y+  PS
Sbjct  223   IVMPGLIDTEMTSPSSLAKYSLKFCPPNE-------SANQCAQAIVKSTCRGDRYLTEPS  275

Query  1105  WYDTFLLYRVFSPNVLN----WTF  1164
             W++   + +   P  L+    W F
Sbjct  276   WWNALFIVKSLCPEALDLLLCWNF  299



>ref|NP_190319.1| hydroxysteroid dehydrogenase 2 [Arabidopsis thaliana]
 sp|Q9STY8.1|HSD2_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase-like 2; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase-like 2; AltName: 
Full=Hydroxysteroid dehydrogenase 2; Short=AtHSD2 [Arabidopsis 
thaliana]
 emb|CAB51207.1| putative protein [Arabidopsis thaliana]
 gb|AEE78268.1| hydroxysteroid dehydrogenase 2 [Arabidopsis thaliana]
Length=308

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/307 (40%), Positives = 188/307 (61%), Gaps = 10/307 (3%)
 Frame = +1

Query  256   MDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYYGEEIMEDKVVVITGASSGI  435
             MD+++++LN ++PP ++  L L +P   F      L +L++  E +  KVV+ITGASSGI
Sbjct  1     MDMLHTILNFLLPPLTISFLVLFYPFYLFTKLMSCLKHLHF--ENVTGKVVLITGASSGI  58

Query  436   GEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILET  615
             GE +AYEYAK+ A L LVARR++RL  ++E +R LG+ +V+I   DV   E+C++FI ET
Sbjct  59    GEHVAYEYAKKGAKLALVARRKDRLEIVAETSRQLGSGDVIIIPGDVSNVEDCKKFIDET  118

Query  616   INFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRV  795
             I+ +G++DHL+N A +  T  FE+ +       +MDINFWG+ Y TY A+P+LR+S+G++
Sbjct  119   IHHFGKLDHLINNAGVPQTVIFEDFTQIQDANSIMDINFWGSTYITYFAIPHLRKSKGKI  178

Query  796   IVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIM  975
             +V +S  + +PL   S+YSA+KA LV  +ETLR E+   I IT+A  G+I T+M   +  
Sbjct  179   VVISSATAIIPLQAASVYSASKAALVKFFETLRVEISPDIKITIALPGFISTDMTTPQFK  238

Query  976   VEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLN  1155
                G++    E         V   AK I  G  RG+ YV  PSW     L +   P +++
Sbjct  239   EMYGSDFILSES--------VSRCAKAIFRGIGRGEAYVIEPSWIKWIFLIKNVCPEIVD  290

Query  1156  WTFRLLF  1176
             +    +F
Sbjct  291   YLLDYIF  297



>ref|XP_007160006.1| hypothetical protein PHAVU_002G285100g [Phaseolus vulgaris]
 gb|ESW32000.1| hypothetical protein PHAVU_002G285100g [Phaseolus vulgaris]
Length=320

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 168/264 (64%), Gaps = 9/264 (3%)
 Frame = +1

Query  382   EEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLI  561
             +E +  KVV+ITGA+SGIGE+IAYEYA+R A L LV  R+ +L A+ + AR LG+ +V I
Sbjct  42    KENVASKVVLITGAASGIGEEIAYEYARRGAKLSLVDIRKEKLEAVGDKARSLGSPDVAI  101

Query  562   TAADVVKEEECRRFILETINFYGRVDHLVNTASL-GHTFYFEEASDTTVFPILMDINFWG  738
               ADV K ++C+ F+ ETIN++GR+DHLVN A + G +   E     +    +MD+NFWG
Sbjct  102   IGADVSKVQDCKLFVHETINYFGRLDHLVNNAGIGGKSVRVENLRHVSDCAAVMDVNFWG  161

Query  739   NVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIG  918
              V  T  A P+L+ ++GR+IV ASV  W P+P +S+Y+A+KA +++ +ETLR EVG +I 
Sbjct  162   AVNATLYATPHLKINKGRIIVIASVSGWFPMPLISIYNASKAAIISFFETLRMEVGCTIA  221

Query  919   ITVATHGWIGTEMARGKIMVEEGAEMQWKEEREVHATGPVEEFAKLIVSGACRGDEYVKY  1098
             IT+AT G I T + R  + +++ A  +          G   E AK IV  ACRGD YV Y
Sbjct  222   ITIATPGLINTHLTRA-LKLDKVALGKV-------PLGSANECAKAIVESACRGDMYVTY  273

Query  1099  PSWYDTFLLYRVFSPNVLNWTFRL  1170
             PSWY     +++  P  ++W   L
Sbjct  274   PSWYKVLFPWKLLHPQFVDWACNL  297



>emb|CBI38151.3| unnamed protein product [Vitis vinifera]
Length=370

 Score =   230 bits (587),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/300 (39%), Positives = 182/300 (61%), Gaps = 11/300 (4%)
 Frame = +1

Query  301   SLVMLALAWPTLCFISACEWLYNLY------YGEEIMEDKVVVITGASSGIGEQIAYEYA  462
             +LV+  L +  +C I     ++ L       +  E M  KVV+ITGASSGIGE +AYEYA
Sbjct  51    NLVLTPLVFAIICLILPFLIIFRLVVSISSRFSSENMARKVVLITGASSGIGEHMAYEYA  110

Query  463   KRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVKEEECRRFILETINFYGRVDH  642
             K  A L LVARR+ +L A++  AR LG+ +VL   ADV    +C+R I +TIN +G+++H
Sbjct  111   KMGACLALVARRKEKLEAVAARARGLGSPDVLALRADVSNVNDCKRSIDDTINHFGKLNH  170

Query  643   LVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVALPYLRQSRGRVIVNASVESW  822
             LVN A +G     EE +D T    LMD+N+WG+VYPTY A+P+LR+++G+++VN+S  + 
Sbjct  171   LVNNAGIGSVCALEEITDITNSGSLMDVNYWGSVYPTYFAIPHLRKTKGKIVVNSSTSAL  230

Query  823   LPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGITVATHGWIGTEMARGKIMVEEGAEMQW  1002
             +  P MS Y+++KA ++  +E+LR E+   + +++ T G++ +EM  GK++   G  +  
Sbjct  231   VQPPSMSFYTSSKAAVIGFFESLRGELDPEVTVSIVTLGFVESEMTEGKLVSGNGEVIVA  290

Query  1003  KEE-REVHATGPVEE----FAKLIVSGACRGDEYVKYPSWYDTFLLYRVFSPNVLNWTFR  1167
                 + +  TG  +      AK+IV   CRG+ YV  P WY    L++   P V+ W FR
Sbjct  291   PNLIKAISPTGLPKMRAGLAAKVIVDAICRGERYVTEPKWYRMLTLFKYLCPEVIEWHFR  350



>ref|XP_010251331.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=330

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 131/311 (42%), Positives = 190/311 (61%), Gaps = 17/311 (5%)
 Frame = +1

Query  238   SKLIKMMDlvnsvlnlvvPPASLVMLALAWPTLCFISACEWLYNLYY-----GEEIMEDK  402
             SK    MD+++  ++LV+PP  +V L L  P   FI   + +++L         E M  K
Sbjct  23    SKCRAAMDVIHKFIHLVLPPVIVVTLCLILP---FIFTMKLVFSLIMRPSPLSGENMSGK  79

Query  403   VVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLITAADVVK  582
             VV+ITG SSGIGE +AYEYAK  A+LVL+ARREN LR ++  A  LG+ +VL+  ADV K
Sbjct  80    VVLITGGSSGIGEHLAYEYAKGGASLVLIARRENSLREVARKAVGLGSPDVLVVGADVSK  139

Query  583   EEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINFWGNVYPTYVA  762
              +EC++F+   +N +GR+DHLV  A +     F++ +       LMDINFWG+ YPTY A
Sbjct  140   VDECKQFVEAAVNHFGRLDHLVCNAGIISFCAFKDVTSIASCTSLMDINFWGSFYPTYFA  199

Query  763   LPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGN---SIGITVAT  933
             +P+L++S+G++IVNAS   W+  P M+ Y A KA L+N YE LR E+      + +T+  
Sbjct  200   VPHLKRSKGKIIVNASSSGWMGSPAMTFYGATKAALINHYEKLRTELAPDALDVTVTITA  259

Query  934   HGWIGTEMARGKIMVEEGAEMQWKEEREVHATG-----PVEEFAKLIVSGACRGDEYVKY  1098
              G+I +EM++GK +  +G  M  ++ R+V A G      V + A+ IV  ACRGD YV  
Sbjct  260   PGFIESEMSQGKHLSGKGVVMVDQDMRDV-AIGVLPVLSVGKCAEAIVKKACRGDGYVIE  318

Query  1099  PSWYDTFLLYR  1131
             P W++   L R
Sbjct  319   PWWFNMLQLCR  329



>ref|XP_010536607.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Tarenaya 
hassleriana]
Length=305

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 119/267 (45%), Positives = 165/267 (62%), Gaps = 10/267 (4%)
 Frame = +1

Query  373   YYGEEIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKN  552
             Y+  E +  KV+++TGASSGIGE IAYEYA+R A L LVARRE+RLRA++E +R LG+ +
Sbjct  39    YFNAENVAGKVILVTGASSGIGEHIAYEYARRGARLALVARREDRLRAVAEKSRRLGSPD  98

Query  553   VLITAADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEASDTTVFPILMDINF  732
             V++ + DV   E+C+RF+ ETIN +GR+DHLVN A +     FE+ S  T    +M+INF
Sbjct  99    VVVISGDVSNVEDCKRFVQETINHFGRLDHLVNNAGISELKAFEDYSCITDASRVMNINF  158

Query  733   WGNVYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNS  912
             WG+VY T+ A+PYL++SRG++I  +SV  WL  P +S Y AAKA ++N YE LR E+G  
Sbjct  159   WGSVYVTHFAVPYLKRSRGKIIAISSVSVWLSPPYLSFYVAAKAAMINFYEALRVELGRE  218

Query  913   IGITVATHGWIGTEMARGKIMVEEG-AEMQWKEEREVHATGPVEEFAKLIVSGACRGDEY  1089
             I +TV   G I T+M   +++  EG A +     R           A+ IV G CR + +
Sbjct  219   ITVTVVNPGLIQTDMVTPEMVAAEGWAWLPLTSARSC---------ARGIVEGVCRRERF  269

Query  1090  VKYPSWYDTFLLYRVFSPNVLNWTFRL  1170
             V  P WY          P +  W  RL
Sbjct  270   VTEPKWYAVSFWLMALCPELTEWYGRL  296



>ref|XP_010270764.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X1 [Nelumbo nucifera]
Length=321

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 127/270 (47%), Positives = 170/270 (63%), Gaps = 6/270 (2%)
 Frame = +1

Query  385   EIMEDKVVVITGASSGIGEQIAYEYAKRRANLVLVARRENRLRAISENARLLGAKNVLIT  564
             E M  KVV+ITGASSGIGE +AYEYAK+ A LVLVARRE  L  +++ A  LG+ +VL  
Sbjct  44    EKMAGKVVLITGASSGIGEHLAYEYAKKGAFLVLVARREEMLEQVAKKAGQLGSPDVLEI  103

Query  565   AADVVKEEECRRFILETINFYGRVDHLVNTASLGHTFYFEEA-SDTTVFPILMDINFWGN  741
              ADV + +EC+RF+ ET+  +GR+DHLV  A +     FE+     + F I MD NFWG 
Sbjct  104   RADVSQVDECKRFVQETVRRFGRLDHLVCNAGIASYCKFEDGLIGFSNFRIAMDTNFWGY  163

Query  742   VYPTYVALPYLRQSRGRVIVNASVESWLPLPRMSLYSAAKAGLVNLYETLRFEVGNSIGI  921
             VYPTY A+P+L++S+G++IVNASV SW   P  S Y A+KA LVN ++TLR E+   I I
Sbjct  164   VYPTYFAIPHLKKSKGKIIVNASVASWFITPYASSYGASKAALVNFFDTLRVELAPEIKI  223

Query  922   TVATHGWIGTEMA-RGKIMVEEGAEMQWKEEREVHATG-PVEEF---AKLIVSGACRGDE  1086
             T+A  G+  +EM   GK + +EG      E  EV     P+      A+ IV+GAC G+ 
Sbjct  224   TIAAPGFTESEMINNGKNLTKEGVVEDNPEMIEVLVGKFPIRRVGVCAEAIVNGACCGER  283

Query  1087  YVKYPSWYDTFLLYRVFSPNVLNWTFRLLF  1176
             YV  PSWY  F+ ++ F P ++ W   L F
Sbjct  284   YVIEPSWYKMFINFQFFCPEIVEWFIVLWF  313



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4468074281172