BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27633_g1_i1 len=1404 path=[1382:0-1403]

Length=1404
                                                                      Score     E

dbj|BAK52267.1|  allene oxide synthase                                  702   0.0      
ref|XP_006366441.1|  PREDICTED: allene oxide synthase, chloroplas...    683   0.0      
emb|CAD29735.1|  allene oxide synthase                                  682   0.0      Solanum tuberosum [potatoes]
ref|XP_009616015.1|  PREDICTED: allene oxide synthase, chloroplastic    682   0.0      
ref|XP_011074474.1|  PREDICTED: allene oxide synthase                   682   0.0      
ref|XP_009778544.1|  PREDICTED: allene oxide synthase, chloroplas...    678   0.0      
ref|NP_001234833.1|  allene oxide synthase                              674   0.0      
ref|XP_004291923.1|  PREDICTED: allene oxide synthase, chloroplas...    667   0.0      
ref|XP_008220731.1|  PREDICTED: allene oxide synthase                   666   0.0      
gb|AFV68274.1|  allene oxide synthase                                   667   0.0      
gb|AIU98471.1|  chloroplast allene oxide synthase                       666   0.0      
gb|AGV22361.1|  chloroplast allene oxide synthase 6                     665   0.0      
ref|NP_001274390.1|  allene oxide synthase                              663   0.0      
emb|CAC82911.1|  allene oxide synthase                                  660   0.0      Nicotiana attenuata
ref|XP_007222520.1|  hypothetical protein PRUPE_ppa004133mg             659   0.0      
ref|XP_009773128.1|  PREDICTED: allene oxide synthase, chloroplas...    659   0.0      
ref|XP_009364212.1|  PREDICTED: allene oxide synthase, chloroplas...    659   0.0      
dbj|BAM76723.1|  allene oxyde synthase                                  659   0.0      
ref|XP_010106073.1|  Allene oxide synthase                              659   0.0      
ref|XP_009600537.1|  PREDICTED: allene oxide synthase, chloroplas...    658   0.0      
gb|AJD25174.1|  cytochrome P450 CYP74A1                                 658   0.0      
gb|ABC17856.1|  allene oxide synthase protein                           658   0.0      Lonicera japonica [Japanese honeysuckle]
gb|AHY03308.1|  allene oxide synthase                                   658   0.0      
ref|XP_008444665.1|  PREDICTED: allene oxide synthase                   655   0.0      
ref|XP_002283780.1|  PREDICTED: allene oxide synthase                   654   0.0      Vitis vinifera
ref|XP_006473410.1|  PREDICTED: allene oxide synthase, chloroplastic    654   0.0      
gb|ABS50433.1|  allene oxidase synthase                                 651   0.0      Hyoscyamus niger [black henbane]
ref|XP_006434896.1|  hypothetical protein CICLE_v10000825mg             652   0.0      
ref|NP_001275835.1|  allene oxide synthase                              651   0.0      
ref|XP_004501049.1|  PREDICTED: allene oxide synthase, chloroplas...    650   0.0      
gb|AAM66138.1|AF081954_1  allene oxide synthase                         648   0.0      Cucumis melo [Oriental melon]
ref|XP_006340212.1|  PREDICTED: allene oxide synthase, chloroplastic    647   0.0      
ref|XP_011031064.1|  PREDICTED: allene oxide synthase, chloroplas...    646   0.0      
dbj|BAJ78216.1|  allene oxide synthase                                  646   0.0      
ref|XP_002302453.1|  allene oxide synthase family protein               644   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008377365.1|  PREDICTED: allene oxide synthase, chloroplas...    645   0.0      
ref|XP_009365629.1|  PREDICTED: allene oxide synthase, chloroplas...    644   0.0      
gb|ABD15175.1|  allene oxide synthase 2                                 643   0.0      Solanum tuberosum [potatoes]
ref|XP_008377370.1|  PREDICTED: allene oxide synthase, chloroplas...    644   0.0      
ref|XP_008364980.1|  PREDICTED: allene oxide synthase, chloroplas...    644   0.0      
gb|EYU45088.1|  hypothetical protein MIMGU_mgv1a004427mg                643   0.0      
emb|CAD29736.2|  allene oxide synthase                                  642   0.0      Solanum tuberosum [potatoes]
gb|ABD15173.1|  allene oxide synthase 2                                 642   0.0      Solanum tuberosum [potatoes]
gb|ABD15176.1|  allene oxide synthase 2                                 641   0.0      Solanum tuberosum [potatoes]
gb|ABD15172.1|  allene oxide synthase 2                                 641   0.0      Solanum tuberosum [potatoes]
gb|ABD15174.1|  allene oxide synthase 2                                 641   0.0      Solanum tuberosum [potatoes]
ref|XP_007017426.1|  Allene oxide synthase                              641   0.0      
gb|AAN37417.1|  allene oxide synthase                                   640   0.0      Solanum tuberosum [potatoes]
gb|AAY27751.1|  allene oxide synthase                                   640   0.0      Hevea brasiliensis [Para rubber tree]
gb|ACU30142.1|  allene oxide synthase                                   640   0.0      Camellia sinensis [black tea]
gb|KDP38443.1|  hypothetical protein JCGZ_04368                         640   0.0      
ref|XP_011017270.1|  PREDICTED: allene oxide synthase, chloroplastic    638   0.0      
ref|XP_004499109.1|  PREDICTED: allene oxide synthase, chloroplas...    638   0.0      
ref|XP_010060886.1|  PREDICTED: allene oxide synthase                   639   0.0      
ref|NP_001236445.1|  allene oxide synthase                              636   0.0      
gb|AGP25595.1|  AOS1                                                    636   0.0      
ref|NP_001274707.1|  allene oxide synthase                              635   0.0      
emb|CDP07588.1|  unnamed protein product                                635   0.0      
gb|AED99866.1|  cytochrome P450                                         632   0.0      
gb|KDO84382.1|  hypothetical protein CISIN_1g039030mg                   632   0.0      
gb|ABC49700.1|  latex allene oxide synthase                             632   0.0      Hevea brasiliensis [Para rubber tree]
ref|NP_001236432.1|  allene oxide synthase                              631   0.0      
ref|XP_002510320.1|  cytochrome P450, putative                          628   0.0      Ricinus communis
gb|KFK32912.1|  hypothetical protein AALP_AA6G305300                    628   0.0      
ref|XP_002865507.1|  hypothetical protein ARALYDRAFT_494777             627   0.0      
ref|XP_003523882.2|  PREDICTED: allene oxide synthase, chloroplas...    627   0.0      
emb|CDY02409.1|  BnaA02g23180D                                          626   0.0      
ref|XP_007160802.1|  hypothetical protein PHAVU_001G017800g             625   0.0      
ref|XP_009123690.1|  PREDICTED: allene oxide synthase, chloroplastic    624   0.0      
ref|XP_006375037.1|  hypothetical protein POPTR_0014s03820g             624   0.0      
emb|CAC86897.1|  allene oxide synthase                                  623   0.0      Medicago truncatula
gb|KEH36125.1|  cytochrome P450 family fatty acid hydroperoxide l...    624   0.0      
ref|XP_010694121.1|  PREDICTED: allene oxide synthase, chloroplastic    622   0.0      
ref|XP_006403367.1|  hypothetical protein EUTSA_v10003180mg             622   0.0      
pdb|2RCH|A  Chain A, Crystal Structure Of Arabidopsis Thaliana Al...    620   0.0      
gb|AGB34186.1|  allene oxide synthase                                   621   0.0      
ref|XP_010442141.1|  PREDICTED: allene oxide synthase, chloroplas...    620   0.0      
ref|XP_010481971.1|  PREDICTED: allene oxide synthase, chloroplastic    620   0.0      
ref|NP_199079.1|  allene oxide synthase                                 620   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010494202.1|  PREDICTED: allene oxide synthase, chloroplas...    619   0.0      
pdb|2RCM|A  Chain A, Crystal Structure Of Arabidopsis Thaliana Al...    618   0.0      
gb|EYU36275.1|  hypothetical protein MIMGU_mgv1a004508mg                613   0.0      
sp|P48417.1|CP74_LINUS  RecName: Full=Allene oxide synthase, chlo...    610   0.0      Linum usitatissimum
ref|XP_010255032.1|  PREDICTED: allene oxide synthase-like              610   0.0      
ref|XP_010910500.1|  PREDICTED: allene oxide synthase 1, chloropl...    605   0.0      
ref|XP_010525633.1|  PREDICTED: allene oxide synthase, chloroplastic    600   0.0      
ref|XP_010530372.1|  PREDICTED: allene oxide synthase, chloroplas...    599   0.0      
gb|ABU62577.1|  chloroplast allene oxide synthase                       597   0.0      Passiflora edulis [passion fruit]
ref|XP_008801805.1|  PREDICTED: LOW QUALITY PROTEIN: allene oxide...    595   0.0      
ref|XP_006282285.1|  hypothetical protein CARUB_v10028569mg             593   0.0      
ref|XP_010263820.1|  PREDICTED: allene oxide synthase-like              594   0.0      
gb|ADN92996.2|  allene oxide synthase AOS                               585   0.0      
gb|AGV22360.1|  allene oxide synthase 2                                 586   0.0      
ref|XP_009388934.1|  PREDICTED: allene oxide synthase 1, chloropl...    588   0.0      
ref|XP_010941897.1|  PREDICTED: allene oxide synthase 1, chloropl...    588   0.0      
gb|AIU98468.1|  allene oxide synthase                                   583   0.0      
ref|XP_010547834.1|  PREDICTED: allene oxide synthase, chloroplas...    580   0.0      
emb|CAA63266.1|  allene oxide synthase                                  575   0.0      Arabidopsis thaliana [mouse-ear cress]
sp|Q40778.2|C74A2_PARAR  RecName: Full=Allene oxide synthase; Alt...    573   0.0      Parthenium argentatum
ref|XP_008792619.1|  PREDICTED: allene oxide synthase 1, chloropl...    575   0.0      
gb|ADZ24000.1|  allene oxide synthase                                   573   0.0      
emb|CDP07587.1|  unnamed protein product                                572   0.0      
gb|EPS63834.1|  allene oxide synthase protein                           566   0.0      
ref|XP_003558850.1|  PREDICTED: allene oxide synthase 1, chloropl...    563   0.0      
dbj|BAJ97490.1|  predicted protein                                      563   0.0      
emb|CBI19616.3|  unnamed protein product                                554   0.0      
ref|XP_009397307.1|  PREDICTED: allene oxide synthase 1, chloropl...    556   0.0      
gb|AGT16483.1|  cytochrome P450                                         554   0.0      
ref|XP_009412514.1|  PREDICTED: allene oxide synthase 1, chloropl...    551   0.0      
ref|XP_002463829.1|  hypothetical protein SORBIDRAFT_01g007000          550   0.0      Sorghum bicolor [broomcorn]
ref|XP_008644470.1|  PREDICTED: allene oxide synthase 1, chloropl...    549   0.0      
gb|AAS86334.1|  allene oxide synthase                                   544   0.0      Hevea brasiliensis [Para rubber tree]
ref|XP_008665482.1|  PREDICTED: allene oxide synthase 1, chloropl...    546   0.0      
gb|AEO13838.1|  allene oxide synthase                                   546   0.0      
ref|XP_008665483.1|  PREDICTED: allene oxide synthase 1, chloropl...    545   0.0      
ref|XP_002281190.1|  PREDICTED: allene oxide synthase, chloroplastic    533   0.0      Vitis vinifera
ref|XP_010255030.1|  PREDICTED: allene oxide synthase-like              532   0.0      
ref|NP_001051386.1|  Os03g0767000                                       528   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002281159.1|  PREDICTED: allene oxide synthase, chloroplastic    526   2e-180   Vitis vinifera
ref|XP_006856192.1|  hypothetical protein AMTR_s00059p00186400          522   3e-178   
ref|XP_002281226.1|  PREDICTED: allene oxide synthase, chloroplastic    517   7e-177   Vitis vinifera
ref|XP_008778307.1|  PREDICTED: allene oxide synthase 2-like            512   1e-174   
ref|XP_002281201.1|  PREDICTED: allene oxide synthase-like              510   5e-174   Vitis vinifera
ref|XP_011037601.1|  PREDICTED: allene oxide synthase-like              507   7e-173   
ref|NP_001268148.1|  fatty acid hydroperoxide lyase 2                   507   1e-172   
ref|XP_002468237.1|  hypothetical protein SORBIDRAFT_01g042270          506   1e-172   Sorghum bicolor [broomcorn]
gb|ACG28578.1|  cytochrome P450 CYP74A19                                503   3e-171   Zea mays [maize]
ref|XP_009412306.1|  PREDICTED: allene oxide synthase 2-like            503   3e-171   
tpg|DAA44175.1|  TPA: putative cytochrome P450 superfamily protei...    502   6e-171   
emb|CAG17875.1|  allene oxide synthase                                  494   5e-170   Prunus persica
gb|KCW63868.1|  hypothetical protein EUGRSUZ_G01537                     495   2e-168   
ref|XP_009393009.1|  PREDICTED: allene oxide synthase 2-like            495   3e-168   
ref|XP_010065434.1|  PREDICTED: allene oxide synthase-like              495   3e-168   
ref|XP_010913749.1|  PREDICTED: allene oxide synthase 2-like            494   7e-168   
ref|XP_010068499.1|  PREDICTED: allene oxide synthase-like              493   1e-167   
ref|XP_004985140.1|  PREDICTED: allene oxide synthase 2-like            492   3e-167   
ref|XP_011037602.1|  PREDICTED: allene oxide synthase-like              491   7e-167   
ref|XP_002305404.2|  hypothetical protein POPTR_0004s15590g             490   2e-166   Populus trichocarpa [western balsam poplar]
ref|XP_010065432.1|  PREDICTED: allene oxide synthase-like              490   2e-166   
ref|XP_010096244.1|  Allene oxide synthase                              490   3e-166   
ref|XP_010065433.1|  PREDICTED: allene oxide synthase-like              488   2e-165   
ref|XP_002305405.1|  allene oxide synthase family protein               487   3e-165   Populus trichocarpa [western balsam poplar]
ref|XP_010066073.1|  PREDICTED: allene oxide synthase, chloroplas...    486   5e-165   
gb|ABK93995.1|  unknown                                                 486   9e-165   Populus trichocarpa [western balsam poplar]
gb|EYU37739.1|  hypothetical protein MIMGU_mgv1a005707mg                484   6e-164   
ref|XP_010068502.1|  PREDICTED: allene oxide synthase, chloroplas...    483   1e-163   
emb|CDO97108.1|  unnamed protein product                                483   2e-163   
ref|NP_001105244.1|  allene oxide synthase1                             483   2e-163   Zea mays [maize]
ref|XP_010068135.1|  PREDICTED: allene oxide synthase-like              482   4e-163   
ref|XP_008236725.1|  PREDICTED: allene oxide synthase-like              482   4e-163   
gb|KDP46195.1|  hypothetical protein JCGZ_10035                         482   4e-163   
ref|XP_008454884.1|  PREDICTED: allene oxide synthase, chloroplas...    481   5e-163   
gb|ACN27878.1|  unknown                                                 481   7e-163   Zea mays [maize]
emb|CAE18065.1|  cytochrome P450                                        481   8e-163   Prunus dulcis [sweet almond]
ref|XP_010065431.1|  PREDICTED: allene oxide synthase-like              481   1e-162   
ref|XP_004137005.1|  PREDICTED: allene oxide synthase, chloroplas...    479   3e-162   
ref|NP_001145914.1|  uncharacterized protein LOC100279433               479   3e-162   Zea mays [maize]
ref|XP_004166204.1|  PREDICTED: allene oxide synthase, chloroplas...    478   1e-161   
ref|XP_007199988.1|  hypothetical protein PRUPE_ppa025045mg             476   1e-160   
ref|XP_004292467.1|  PREDICTED: allene oxide synthase-like              474   5e-160   
ref|XP_006423164.1|  hypothetical protein CICLE_v10028333mg             474   6e-160   
ref|XP_010096245.1|  Allene oxide synthase                              474   8e-160   
gb|ACR36602.1|  unknown                                                 472   2e-159   Zea mays [maize]
ref|XP_008344492.1|  PREDICTED: allene oxide synthase-like              472   2e-159   
ref|XP_007143237.1|  hypothetical protein PHAVU_007G055700g             472   4e-159   
ref|XP_009627350.1|  PREDICTED: 9-divinyl ether synthase-like           471   9e-159   
ref|XP_009345782.1|  PREDICTED: allene oxide synthase-like              470   1e-158   
ref|XP_008454885.1|  PREDICTED: allene oxide synthase 2-like            470   2e-158   
gb|AFH89624.1|  allene oxide synthase                                   471   2e-158   
ref|XP_009804872.1|  PREDICTED: 9-divinyl ether synthase-like           470   2e-158   
ref|XP_010690971.1|  PREDICTED: allene oxide synthase-like              472   2e-158   
ref|XP_002863754.1|  predicted protein                                  469   2e-158   
ref|XP_010068136.1|  PREDICTED: LOW QUALITY PROTEIN: allene oxide...    474   3e-158   
ref|XP_009350924.1|  PREDICTED: allene oxide synthase-like              470   7e-158   
emb|CBI32529.3|  unnamed protein product                                467   7e-158   
ref|NP_001284390.1|  allene oxide synthase 2-like                       468   1e-157   
ref|XP_009337896.1|  PREDICTED: allene oxide synthase-like              468   2e-157   
dbj|BAE45341.1|  allene oxide synthase                                  461   4e-157   Pisum sativum [garden pea]
ref|XP_010915208.1|  PREDICTED: allene oxide synthase 2-like            466   9e-157   
ref|NP_001276295.1|  allene oxide synthase, chloroplastic-like          465   2e-156   
ref|XP_009349452.1|  PREDICTED: allene oxide synthase-like              464   3e-156   
ref|XP_002313825.2|  allene oxide synthase family protein               464   5e-156   Populus trichocarpa [western balsam poplar]
dbj|BAK05658.1|  predicted protein                                      464   5e-156   
gb|ACZ28493.1|  allene oxide synthase                                   463   6e-156   
gb|AHM92934.1|  AOS                                                     462   3e-155   
ref|XP_010036438.1|  PREDICTED: allene oxide synthase 2-like            461   3e-155   
ref|XP_003558446.1|  PREDICTED: allene oxide synthase 2-like            460   2e-154   
ref|XP_006365486.1|  PREDICTED: 9-divinyl ether synthase-like           460   2e-154   
ref|XP_004498182.1|  PREDICTED: allene oxide synthase, chloroplas...    459   3e-154   
gb|AFA28141.1|  allene oxide synthase                                   457   5e-154   
ref|XP_010096254.1|  Allene oxide synthase                              459   7e-154   
gb|AGU41845.1|  allene oxide synthase                                   457   9e-154   
ref|XP_009760041.1|  PREDICTED: 9-divinyl ether synthase-like iso...    457   1e-153   
ref|XP_007041376.1|  Fatty acid hydroperoxide lyase 2                   457   2e-153   
emb|CAB86383.1|  allene oxide synthase                                  457   2e-153   Hordeum vulgare [barley]
gb|AGH32771.1|  hydroperoxide lyase                                     456   7e-153   
ref|XP_009789831.1|  PREDICTED: 9-divinyl ether synthase-like           455   9e-153   
dbj|BAJ78218.1|  9/13-hydroperoxide lyase                               456   1e-152   
emb|CAB86384.1|  allene oxide synthase                                  455   1e-152   Hordeum vulgare [barley]
gb|KCW62912.1|  hypothetical protein EUGRSUZ_G00504                     454   2e-152   
ref|XP_003537908.1|  PREDICTED: allene oxide synthase, chloroplas...    454   2e-152   
ref|XP_007131886.1|  hypothetical protein PHAVU_011G049600g             454   2e-152   
gb|AGI15963.1|  hydroperoxide lyase                                     453   6e-152   
emb|CDO97109.1|  unnamed protein product                                452   1e-151   
ref|XP_009789760.1|  PREDICTED: 9-divinyl ether synthase-like           452   2e-151   
gb|AAF64041.1|AF229811_1  fatty acid hydroperoxide lyase                452   2e-151   Cucumis sativus [cucumbers]
gb|AFG26687.1|  cytochrome P450 CYP74C                                  452   2e-151   
ref|XP_009618647.1|  PREDICTED: 9-divinyl ether synthase-like           452   2e-151   
gb|ACZ28492.1|  allene oxide synthase                                   452   3e-151   
ref|NP_001274399.1|  allene oxide synthase, chloroplastic-like          451   3e-151   
gb|KHN06162.1|  Allene oxide synthase, chloroplastic                    451   4e-151   
gb|ABA54984.1|  allene oxide syntase                                    451   8e-151   Solanum tuberosum [potatoes]
emb|CAI30876.1|  allene oxide synthase                                  450   2e-150   Solanum tuberosum [potatoes]
gb|AFA28136.1|  allene oxide synthase                                   447   3e-150   
ref|XP_007153145.1|  hypothetical protein PHAVU_003G010700g             450   4e-150   
gb|AFA28140.1|  allene oxide synthase                                   447   4e-150   
gb|ABI93819.1|  fatty acid 9/13-hydroperoxide lyase                     449   6e-150   Solanum pennellii
ref|NP_001234502.1|  cytochrome P450 CYP74C4                            449   7e-150   
gb|KCW62907.1|  hypothetical protein EUGRSUZ_G00499                     445   1e-149   
gb|KCW62903.1|  hypothetical protein EUGRSUZ_G00493                     446   2e-149   
gb|ABR16111.1|  unknown                                                 446   3e-149   Picea sitchensis
ref|XP_011088323.1|  PREDICTED: allene oxide synthase-like              446   4e-149   
gb|AFA28139.1|  allene oxide synthase                                   444   4e-149   
gb|KDO51417.1|  hypothetical protein CISIN_1g043892mg                   445   6e-149   
ref|XP_004230843.1|  PREDICTED: 9-divinyl ether synthase                446   7e-149   
gb|AFA28137.1|  allene oxide synthase                                   444   7e-149   
ref|NP_001265949.1|  9-divinyl ether synthase-like                      446   1e-148   
ref|XP_010068132.1|  PREDICTED: allene oxide synthase-like              447   1e-148   
gb|KHN04746.1|  Allene oxide synthase, chloroplastic                    444   3e-148   
ref|XP_006364096.1|  PREDICTED: 9-divinyl ether synthase-like           443   6e-148   
gb|KCW62904.1|  hypothetical protein EUGRSUZ_G00496                     441   9e-148   
gb|ABR16049.1|  unknown                                                 442   1e-147   Picea sitchensis
gb|ABK25164.1|  unknown                                                 441   4e-147   Picea sitchensis
gb|KEH40767.1|  fatty acid hydroperoxide lyase                          440   9e-147   
ref|XP_009400043.1|  PREDICTED: allene oxide synthase 2-like            440   1e-146   
gb|EYU42637.1|  hypothetical protein MIMGU_mgv1a005446mg                440   1e-146   
gb|ABC75838.1|  cytochrome P450 CYP74C9                                 437   8e-146   Petunia integrifolia subsp. inflata
gb|AFA28138.1|  allene oxide synthase                                   435   1e-145   
gb|KCW63874.1|  hypothetical protein EUGRSUZ_G01541                     435   2e-145   
dbj|BAJ78219.1|  9/13-hydroperoxide lyase                               436   6e-145   
ref|XP_010255209.1|  PREDICTED: allene oxide synthase, chloroplas...    432   4e-144   
gb|AFA28142.1|  allene oxide synthase                                   430   6e-144   
emb|CAC86899.1|  9/13 hydroperoxide lyase                               431   6e-143   Medicago truncatula
ref|XP_003606860.1|  Allene oxide synthase                              429   3e-142   
gb|ACJ85747.1|  unknown                                                 428   6e-142   Medicago truncatula
gb|AAU93400.1|  plastid allene oxide synthase                           419   4e-141   Humulus lupulus [common hop]
gb|KCW63873.1|  hypothetical protein EUGRSUZ_G01540                     419   7e-140   
gb|AAO43440.1|  allene oxide synthase                                   414   5e-137   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001049436.1|  Os03g0225900                                       413   2e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009761532.1|  PREDICTED: 9-divinyl ether synthase                412   1e-135   
gb|AAP75620.1|  allene oxide synthase                                   410   3e-135   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009631642.1|  PREDICTED: 9-divinyl ether synthase                410   3e-135   
emb|CAI30435.1|  unspecific 9/13 divinyl ether synthase                 409   6e-135   Allium sativum
gb|AAL17675.1|  allene oxide synthase                                   409   1e-134   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001759629.1|  predicted protein                                  409   1e-134   
ref|XP_006365485.1|  PREDICTED: 9-divinyl ether synthase-like           405   2e-133   
sp|Q0PHS9.1|DES_CAPAN  RecName: Full=9-divinyl ether synthase; Sh...    401   1e-131   Capsicum annuum
ref|XP_001767870.1|  predicted protein                                  401   1e-131   
emb|CAC86919.1|  allene oxide synthase                                  401   1e-131   Physcomitrella patens
sp|Q9AVQ1.1|DES_SOLTU  RecName: Full=9-divinyl ether synthase; Sh...    400   3e-131   Solanum tuberosum [potatoes]
ref|NP_001234527.1|  9-divinyl ether synthase                           397   3e-130   
ref|NP_001046308.1|  Os02g0218800                                       395   6e-129   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ28703.1|  hypothetical protein OsJ_12717                          391   3e-127   Oryza sativa Japonica Group [Japonica rice]
emb|CBI32527.3|  unnamed protein product                                394   4e-127   
ref|XP_004951443.1|  PREDICTED: allene oxide synthase 4-like            390   9e-127   
gb|EAY85033.1|  hypothetical protein OsI_06390                          389   2e-126   Oryza sativa Indica Group [Indian rice]
ref|XP_002991302.1|  hypothetical protein SELMODRAFT_133317             389   2e-126   
ref|XP_002451776.1|  hypothetical protein SORBIDRAFT_04g007640          388   6e-126   Sorghum bicolor [broomcorn]
ref|XP_008679839.1|  PREDICTED: allene oxide synthase 3-like            387   1e-125   
ref|XP_004954632.1|  PREDICTED: allene oxide synthase 4-like            382   5e-124   
gb|EEE58630.1|  hypothetical protein OsJ_09990                          380   1e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009794807.1|  PREDICTED: 9-divinyl ether synthase-like           373   6e-122   
ref|XP_006651849.1|  PREDICTED: allene oxide synthase 1, chloropl...    366   4e-120   
ref|XP_003571117.1|  PREDICTED: allene oxide synthase 3-like            368   4e-118   
ref|XP_006843809.1|  hypothetical protein AMTR_s00007p00254060          363   1e-116   
emb|CBI32528.3|  unnamed protein product                                361   5e-116   
gb|ACZ67202.1|  cytochrome P450 allene oxide synthase                   352   6e-116   Populus nigra [Lombardy poplar]
gb|EAY85032.1|  hypothetical protein OsI_06389                          360   1e-115   Oryza sativa Indica Group [Indian rice]
gb|ACZ67201.1|  cytochrome P450 allene oxide synthase                   349   5e-115   Populus deltoides
gb|EEE56568.1|  hypothetical protein OsJ_05909                          358   8e-115   
ref|NP_001046307.1|  Os02g0218700                                       358   1e-114   
ref|XP_006843808.1|  hypothetical protein AMTR_s00007p00253830          356   4e-114   
gb|ACZ67200.1|  cytochrome P450 allene oxide synthase                   346   1e-113   
ref|XP_009404395.1|  PREDICTED: allene oxide synthase, chloroplastic    350   1e-111   
dbj|BAC55190.1|  allene oxide synthase                                  340   5e-111   
ref|XP_002978716.1|  allene oxide synthase                              347   1e-110   
ref|XP_004144503.1|  PREDICTED: allene oxide synthase, chloroplas...    343   7e-109   
gb|KGN43502.1|  13-hydroperoxide lyase                                  343   7e-109   
ref|XP_010089462.1|  Allene oxide synthase                              343   7e-109   
ref|XP_002978826.1|  hypothetical protein SELMODRAFT_271334             341   3e-108   
gb|ACZ17394.1|  fatty acid hydroperoxide lyase                          341   4e-108   
ref|XP_002978827.1|  hypothetical protein SELMODRAFT_228572             341   4e-108   
ref|XP_002984736.1|  hypothetical protein SELMODRAFT_181219             340   1e-107   
gb|AFC17171.1|  cytochrome P450 allene oxide synthase                   330   1e-107   
ref|NP_001268011.1|  fatty acid hydroperoxide lyase                     340   1e-107   
ref|XP_010926169.1|  PREDICTED: allene oxide synthase, chloroplastic    339   2e-107   
ref|XP_006447600.1|  hypothetical protein CICLE_v10014991mg             338   6e-107   
ref|XP_008780926.1|  PREDICTED: allene oxide synthase, chloroplastic    338   8e-107   
emb|CBI28837.3|  unnamed protein product                                339   9e-107   
ref|XP_007215278.1|  hypothetical protein PRUPE_ppa004799mg             337   1e-106   
ref|XP_002972651.1|  hypothetical protein SELMODRAFT_98717              337   2e-106   
ref|NP_001275853.1|  fatty acid hydroperoxide lyase                     336   4e-106   
gb|ABI64149.1|  fatty acid hydroperoxide lyase                          336   6e-106   
ref|XP_008455458.1|  PREDICTED: allene oxide synthase                   335   7e-106   
dbj|BAC55161.1|  hydroperoxide lyase                                    335   1e-105   
gb|ADF57569.1|  hydroperoxide lyase                                     335   1e-105   
ref|XP_008229987.1|  PREDICTED: allene oxide synthase, chloroplastic    334   3e-105   
emb|CAB54848.1|  hydroperoxide lyase                                    333   4e-105   
gb|AIR74675.1|  hydroperoxide lyase                                     332   4e-105   
gb|AAU12570.1|  13-hydroperoxide lyase                                  333   6e-105   
gb|AED99870.1|  cytochrome P450                                         332   1e-104   
ref|XP_002988160.1|  hypothetical protein SELMODRAFT_235463             330   3e-104   
emb|CAB54847.1|  hydroperoxide lyase                                    331   3e-104   
ref|XP_007049106.1|  Hydroperoxide lyase, putative isoform 1            332   3e-104   
emb|CAC91565.1|  hydroperoxide lyase                                    331   3e-104   
ref|XP_010434302.1|  PREDICTED: allene oxide synthase, chloroplas...    330   6e-104   
ref|XP_010248046.1|  PREDICTED: allene oxide synthase, chloroplastic    330   6e-104   
gb|AAK27265.1|  fatty acid hydroperoxide lyase                          330   8e-104   
ref|XP_009619723.1|  PREDICTED: allene oxide synthase                   330   1e-103   
emb|CAB54849.1|  hydroperoxide lyase                                    329   1e-103   
ref|XP_001764985.1|  predicted protein                                  330   2e-103   
ref|XP_009793535.1|  PREDICTED: allene oxide synthase-like              328   3e-103   
ref|XP_002321136.2|  hydroperoxide lyase family protein                 328   5e-103   
emb|CAB43022.1|  hydroperoxide lyase                                    327   6e-103   
ref|NP_001234420.1|  fatty acid hydroperoxide lyase                     327   1e-102   
ref|NP_001275329.1|  fatty acid hydroperoxide lyase                     327   1e-102   
ref|XP_010440306.1|  PREDICTED: allene oxide synthase 2-like isof...    327   2e-102   
ref|XP_003540282.1|  PREDICTED: allene oxide synthase, chloroplas...    326   2e-102   
emb|CDX90591.1|  BnaA03g41900D                                          326   4e-102   
ref|XP_009347137.1|  PREDICTED: allene oxide synthase, chloroplastic    325   4e-102   
emb|CAC44040.1|  fatty acid hydroperoxide lyase                         325   4e-102   
ref|XP_006283602.1|  hypothetical protein CARUB_v10004658mg             325   7e-102   
ref|XP_003596941.1|  Allene oxide synthase                              325   8e-102   
dbj|BAJ78217.1|  13-hydroperoxide lyase                                 325   9e-102   
ref|XP_004287964.1|  PREDICTED: allene oxide synthase, chloroplas...    324   2e-101   
gb|AAZ39884.1|  fatty acid hydroperoxide lyase                          324   3e-101   
ref|XP_007149992.1|  hypothetical protein PHAVU_005G116800g             322   5e-101   
ref|XP_009136694.1|  PREDICTED: allene oxide synthase 2                 324   7e-101   
gb|ABH03631.1|  allene oxide synthase                                   311   9e-101   
gb|ABC68414.1|  cytochrome P450 monooxygenase CYP74A3                   311   2e-100   
ref|XP_002964012.1|  hypothetical protein SELMODRAFT_81998              321   4e-100   
gb|AAA97465.1|  fatty acid hydroperoxide lyase                          319   9e-100   
ref|XP_002870238.1|  hydroperoxide lyase                                320   9e-100   
gb|AAK27266.1|  fatty acid hydroperoxide lyase                          319   1e-99    
ref|XP_002967910.1|  hypothetical protein SELMODRAFT_88954              319   2e-99    
ref|XP_006414509.1|  hypothetical protein EUTSA_v10025050mg             318   2e-99    
gb|ADO51747.1|  fatty acid hydroperoxide lyase                          318   4e-99    
ref|XP_011100266.1|  PREDICTED: allene oxide synthase, chloroplastic    317   5e-99    
gb|KDP30776.1|  hypothetical protein JCGZ_13719                         318   7e-99    
gb|KHG22992.1|  Allene oxide synthase, chloroplastic                    317   1e-98    
ref|XP_010035544.1|  PREDICTED: allene oxide synthase, chloroplastic    316   2e-98    
gb|KFK22624.1|  hypothetical protein AALP_AAs50448U000200               316   2e-98    
gb|AGV22362.1|  hydroperoxide lyase                                     317   2e-98    
gb|AAK15070.1|AF239670_1  fatty acid hydroperoxide lyase                316   3e-98    
sp|Q9ZSY9.1|C74B2_ARATH  RecName: Full=Linolenate hydroperoxide l...    316   3e-98    
ref|XP_003570794.1|  PREDICTED: allene oxide synthase, chloroplastic    313   2e-97    
ref|XP_010548890.1|  PREDICTED: allene oxide synthase, chloroplastic    313   5e-97    
gb|AIU98470.1|  hydroperoxide lyase                                     313   5e-97    
ref|XP_002529334.1|  cytochrome P450, putative                          312   7e-97    
gb|AIL29216.1|  fatty acid hydroperoxide lyase                          312   9e-97    
emb|CDP16234.1|  unnamed protein product                                312   1e-96    
ref|XP_010687458.1|  PREDICTED: allene oxide synthase, chloroplastic    311   1e-96    
ref|XP_004487430.1|  PREDICTED: allene oxide synthase, chloroplas...    310   2e-96    
gb|ADV29797.1|  fatty acid hydroperoxide lyase                          311   2e-96    
ref|XP_002981307.1|  hypothetical protein SELMODRAFT_114146             310   2e-96    
ref|XP_002972649.1|  hypothetical protein SELMODRAFT_413157             309   6e-96    
ref|XP_002969700.1|  hypothetical protein SELMODRAFT_92382              308   1e-95    
emb|CAB45989.1|  hydroperoxide lyase (HPOL) like protein                308   2e-95    
gb|KCW63866.1|  hypothetical protein EUGRSUZ_G01535                     303   2e-95    
ref|XP_004951223.1|  PREDICTED: allene oxide synthase, chloroplas...    306   3e-94    
dbj|BAK01117.1|  predicted protein                                      305   3e-94    
gb|ACD43482.1|  hydroperoxide lyase                                     305   4e-94    
gb|ACF87703.1|  unknown                                                 304   2e-93    
ref|NP_001105255.1|  hydroperoxide lyase1                               303   3e-93    
gb|EYU34033.1|  hypothetical protein MIMGU_mgv1a005509mg                302   5e-93    
emb|CAC82980.1|  fatty acid hydroperoxide lyase                         301   1e-92    
ref|XP_002972803.1|  hypothetical protein SELMODRAFT_98212              298   2e-91    
gb|ACJ84533.1|  unknown                                                 290   7e-91    
ref|XP_002984379.1|  hypothetical protein SELMODRAFT_120083             292   2e-89    
ref|XP_002988570.1|  hypothetical protein SELMODRAFT_183932             290   2e-88    
ref|XP_002979266.1|  hypothetical protein SELMODRAFT_177485             289   3e-88    
gb|ADP03054.2|  cytochrome P450 CYP74B16                                288   5e-88    
ref|XP_003636227.1|  Allene oxide synthase                              285   2e-87    
gb|AJD25175.1|  cytochrome P450 CYP74B21                                286   9e-87    
gb|EAY84158.1|  hypothetical protein OsI_05538                          284   4e-86    
ref|NP_001045648.1|  Os02g0110200                                       283   1e-85    
gb|AAQ16680.1|  hydroperoxide lyase                                     281   4e-85    
gb|EPS58389.1|  fatty acid hydroperoxide lyase                          281   6e-85    
ref|XP_002451367.1|  hypothetical protein SORBIDRAFT_04g000830          277   1e-83    
gb|EMT22522.1|  hypothetical protein F775_43122                         277   3e-82    
ref|NP_193279.1|  hydroperoxide lyase 1                                 267   1e-80    
ref|XP_010436573.1|  PREDICTED: allene oxide synthase, chloroplas...    268   1e-80    
emb|CDY09763.1|  BnaC07g32980D                                          265   6e-80    
ref|XP_007049107.1|  Hydroperoxide lyase isoform 2                      257   3e-77    
gb|ACN30682.1|  unknown                                                 254   2e-75    
ref|XP_009586914.1|  PREDICTED: 9-divinyl ether synthase-like           245   8e-75    
ref|XP_002984641.1|  hypothetical protein SELMODRAFT_446021             246   2e-72    
gb|ABC68407.1|  cytochrome P450 monooxygenase CYP74A2                   239   3e-72    
gb|ABI93820.1|  CYP74C4 protein                                         238   1e-71    
gb|EAZ22255.1|  hypothetical protein OsJ_05910                          247   1e-71    
gb|EYU42715.1|  hypothetical protein MIMGU_mgv1a020869mg                228   5e-69    
gb|AAL87304.1|  putative hydroperoxide lyase HPOL                       234   1e-68    
gb|AFK37541.1|  unknown                                                 226   4e-68    
ref|XP_007049109.1|  Hydroperoxide lyase 1 isoform 4                    232   6e-68    
ref|XP_010434982.1|  PREDICTED: allene oxide synthase, chloroplas...    231   1e-67    
ref|XP_004170380.1|  PREDICTED: LOW QUALITY PROTEIN: allene oxide...    229   2e-67    
gb|ADB98058.1|  allene oxide synthase                                   223   1e-66    
gb|KDO39713.1|  hypothetical protein CISIN_1g0437042mg                  228   2e-66    
ref|XP_007049108.1|  Hydroperoxide lyase 1 isoform 3                    231   2e-66    
gb|EYU34034.1|  hypothetical protein MIMGU_mgv1a009641mg                227   4e-66    
gb|ACF86392.1|  unknown                                                 219   7e-63    
ref|XP_008363458.1|  PREDICTED: allene oxide synthase-like isofor...    217   3e-62    
ref|XP_008363457.1|  PREDICTED: allene oxide synthase-like isofor...    218   4e-62    
ref|XP_008363459.1|  PREDICTED: allene oxide synthase-like isofor...    216   7e-62    
gb|AGH61342.1|  putative 9-allene oxide synthase                        206   5e-60    
ref|XP_011047270.1|  PREDICTED: allene oxide synthase, chloroplastic    213   2e-59    
gb|EMS46450.1|  Allene oxide synthase 4                                 209   8e-58    
gb|AIR76998.1|  hydroperoxide lyase                                     197   9e-55    
ref|XP_006648219.1|  PREDICTED: allene oxide synthase 3-like            191   5e-52    
dbj|BAJ78611.1|  allene oxide synthase                                  177   2e-49    
dbj|BAJ78610.1|  allene oxide synthase                                  177   3e-49    
gb|KHN21015.1|  Allene oxide synthase, chloroplastic                    175   3e-49    
gb|EMT24584.1|  Allene oxide synthase 1, chloroplastic                  174   6e-49    
gb|EMS48995.1|  Allene oxide synthase 1, chloroplastic                  173   2e-48    
gb|AAU21293.1|  AOS3                                                    177   3e-48    
gb|AFG54481.1|  hypothetical protein 2_4962_01                          173   6e-48    
gb|ABK55731.2|  allene oxide synthase                                   169   2e-47    
gb|AFG54480.1|  hypothetical protein 2_4962_01                          171   4e-47    
gb|AEW08273.1|  hypothetical protein 2_4962_01                          171   4e-47    
gb|ABI17938.1|  allene oxide synthase                                   171   4e-47    
ref|XP_006648457.1|  PREDICTED: allene oxide synthase 4-like            180   4e-46    
gb|ABA19228.1|  hydroperoxide lyase                                     164   2e-44    
gb|ABA19226.1|  hydroperoxide lyase                                     162   1e-43    
gb|AFG60400.1|  hypothetical protein 2_6507_01                          159   1e-42    
gb|ABA19227.1|  hydroperoxide lyase                                     159   1e-42    
gb|ACN30641.1|  unknown                                                 154   1e-40    
gb|EMT33852.1|  Allene oxide synthase, chloroplastic                    156   3e-39    
gb|EMS56407.1|  Allene oxide synthase, chloroplastic                    153   8e-38    
gb|AFK45615.1|  unknown                                                 147   4e-37    
emb|CDP22273.1|  unnamed protein product                                144   1e-36    
dbj|BAM71915.1|  allene oxide synthase                                  137   1e-35    
gb|EYU17824.1|  hypothetical protein MIMGU_mgv11b018238mg               136   7e-35    
emb|CDP19212.1|  unnamed protein product                                138   1e-34    
gb|AGP76298.1|  allene oxide synthase                                   126   1e-31    
gb|AGP76300.1|  allene oxide synthase                                   125   4e-31    
gb|AGP76294.1|  allene oxide synthase                                   124   7e-31    
gb|AGP76289.1|  allene oxide synthase                                   124   9e-31    
gb|AGP76299.1|  allene oxide synthase                                   124   9e-31    
gb|AGP76292.1|  allene oxide synthase                                   122   4e-30    
gb|KDO39714.1|  hypothetical protein CISIN_1g0437041mg                  110   3e-25    
gb|ACD69677.1|  hydroperoxide lyase                                     111   6e-25    
gb|ABL96613.1|  fatty acid hydroperoxide lyase                          100   3e-22    
gb|EEC72335.1|  hypothetical protein OsI_05544                          107   1e-21    
gb|AAM66137.1|AF081953_1  fatty acid hydroperoxide metabolizing e...  99.0    2e-21    
ref|XP_009399297.1|  PREDICTED: allene oxide synthase, chloroplas...  96.7    2e-20    
gb|EYU34035.1|  hypothetical protein MIMGU_mgv11b021062mg             96.3    5e-20    
gb|ADX53332.1|  divinyl ether synthase 1                              94.4    6e-20    
ref|XP_002109961.1|  expressed hypothetical protein                   99.4    5e-19    
ref|WP_015932840.1|  heme peroxidase                                  95.1    2e-17    
ref|WP_027061417.1|  hypothetical protein                             91.7    1e-16    
gb|ACD42778.1|  cytochrome P450 74A                                   88.6    1e-15    
ref|WP_012335549.1|  hypothetical protein                             88.2    2e-15    
ref|WP_018263767.1|  hypothetical protein                             88.2    2e-15    
ref|XP_002109963.1|  expressed hypothetical protein                   83.2    9e-14    
gb|ACD88492.1|  cytochrome P450 74 family protein                     83.6    1e-13    
ref|XP_002602690.1|  hypothetical protein BRAFLDRAFT_72948            80.1    1e-12    
ref|XP_002601390.1|  hypothetical protein BRAFLDRAFT_130398           79.3    2e-12    
dbj|BAE44116.1|  allen oxide synthase                                 71.2    5e-12    
ref|XP_002595052.1|  hypothetical protein BRAFLDRAFT_125761           77.0    2e-11    
ref|XP_002600655.1|  hypothetical protein BRAFLDRAFT_102436           74.3    6e-11    
gb|AFK39170.1|  unknown                                               65.9    6e-10    
ref|XP_002598866.1|  hypothetical protein BRAFLDRAFT_125747           70.9    7e-10    
ref|XP_001636360.1|  predicted protein                                67.4    1e-08    
ref|XP_002589887.1|  hypothetical protein BRAFLDRAFT_81984            66.6    2e-08    
gb|ACB21051.1|  fatty acid hydroperoxide lyase-like protein           65.5    2e-08    
ref|XP_004152576.1|  PREDICTED: cytochrome P450 71A1-like             66.2    2e-08    
ref|XP_002612872.1|  hypothetical protein BRAFLDRAFT_102192           62.8    3e-07    
ref|XP_006442828.1|  hypothetical protein CICLE_v10023617mg           61.2    1e-06    
ref|XP_003176974.1|  averantin oxidoreductase                         60.8    1e-06    
gb|KEY65445.1|  hypothetical protein S7711_08578                      60.8    1e-06    
gb|KFA73875.1|  hypothetical protein S40288_00867                     60.8    1e-06    
ref|XP_008197346.1|  PREDICTED: cytochrome P450 monooxygenase iso...  60.5    2e-06    
ref|XP_008197525.1|  PREDICTED: cytochrome P450 9e2-like              60.1    2e-06    
gb|ERL89341.1|  hypothetical protein D910_06712                       57.8    3e-06    
ref|XP_008239349.1|  PREDICTED: cytochrome P450 71A1-like             59.7    3e-06    
ref|XP_004303131.1|  PREDICTED: cytochrome P450 71A24-like            59.7    3e-06    
tpg|DAA55321.1|  TPA: putative cytochrome P450 superfamily protein    57.8    3e-06    
ref|XP_010278288.1|  PREDICTED: cytochrome P450 71A1-like             57.4    4e-06    
gb|ENN74070.1|  hypothetical protein YQE_09332                        58.5    5e-06    
ref|XP_004301517.1|  PREDICTED: cytochrome P450 71A8-like             57.8    7e-06    
ref|XP_003285013.1|  hypothetical protein DICPUDRAFT_28572            58.5    8e-06    
ref|XP_004236286.1|  PREDICTED: cytochrome P450 71A22-like            58.2    1e-05    
gb|AAS90058.1|  AvnA                                                  57.8    1e-05    
dbj|BAO73894.1|  cytochrome P450                                      55.5    1e-05    
ref|XP_008380498.1|  PREDICTED: cytochrome P450 71A3-like             57.4    2e-05    
ref|XP_010045518.1|  PREDICTED: cytochrome P450 71A3-like             57.4    2e-05    
gb|AGF69206.1|  cytochrome P450 CYP4BQ1v3                             57.4    2e-05    
gb|EAR86793.2|  cytochrome P450 family monooxygenase                  57.0    2e-05    
gb|EMS56274.1|  Cytochrome P450 71D11                                 57.4    2e-05    
gb|ABY59966.1|  cytochrome P450 monooxygenase CYP5005A8               57.4    2e-05    



>dbj|BAK52267.1| allene oxide synthase [Ipomoea nil]
Length=519

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/447 (79%), Positives = 391/447 (87%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGREEFFR R+QKY STVFRTNMPPGPFIS    VV LLDGKSFPTLFD   V
Sbjct  73    RLDYFYNQGREEFFRSRVQKYGSTVFRTNMPPGPFISFSPNVVVLLDGKSFPTLFDPGKV  132

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRD+FTGT+MPSTELTGGYRILSY+DPSEP HA+LK LMFFLLS RR H++PEFH ++ 
Sbjct  133   EKRDLFTGTFMPSTELTGGYRILSYLDPSEPKHAQLKQLMFFLLSSRRGHVIPEFHRSFT  192

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             EMF+ LE E+A  GK GLNAANDQAAFNFLARS +GVDP  TK+  D P L+GKWV+FNL
Sbjct  193   EMFEGLEKEVASKGKVGLNAANDQAAFNFLARSWFGVDPAGTKIGNDGPNLVGKWVVFNL  252

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L LGLPK +E+ LLHTFRLP ALVKKDYQRLYEFFY NST ILD  E LG+SREEAC
Sbjct  253   HPLLVLGLPKGLEEALLHTFRLPAALVKKDYQRLYEFFYANSTEILDEAENLGLSREEAC  312

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNM+KWIGR G  LH QLA+EIRSVVK+NGGK+TMAGMEQM
Sbjct  313   HNLLFATCFNSFGGMKIFFPNMIKWIGRGGAKLHAQLAREIRSVVKSNGGKVTMAGMEQM  372

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RIEPPVP QYGRAKRD V+ESHDA F+VKEGEMLFGFQPFATKDPKIFD
Sbjct  373   PLMKSVVYEALRIEPPVPAQYGRAKRDFVVESHDAVFEVKEGEMLFGFQPFATKDPKIFD  432

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+P RF GE    LL HVLWSNG ETE+PTVN+KQCAGKDFV+LVSRLM+VELFLR
Sbjct  433   RAEEFVPDRFTGENANELLSHVLWSNGPETESPTVNNKQCAGKDFVVLVSRLMVVELFLR  492

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEVG SPLGASVT+TSLKRA+F
Sbjct  493   YDSFDIEVGTSPLGASVTVTSLKRASF  519



>ref|XP_006366441.1| PREDICTED: allene oxide synthase, chloroplastic-like [Solanum 
tuberosum]
Length=530

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/447 (77%), Positives = 404/447 (90%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG+ EFF+ RIQK+QSTVFRTNMPPGPFIS +  VV LLDGKSFP LFDVS V
Sbjct  84    RLDYFYNQGKNEFFKSRIQKHQSTVFRTNMPPGPFISFNPNVVVLLDGKSFPILFDVSKV  143

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPST+LTGGYR+LSY+DPSEPNHAKLK LMF+LLS RR+ ++PEFHN+Y+
Sbjct  144   EKKDLFTGTFMPSTDLTGGYRVLSYLDPSEPNHAKLKKLMFYLLSSRRNEVIPEFHNSYS  203

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLENEL+  GKA LNAANDQAAFNFLARSLYG++P  TKL  D PKLIGKWVLF L
Sbjct  204   ELFETLENELSTKGKARLNAANDQAAFNFLARSLYGINPQDTKLGTDGPKLIGKWVLFQL  263

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L LGLPK +ED ++HTFRLPPALVKKDYQRLY FFYENST++LD  E +G+SREEAC
Sbjct  264   HPLLILGLPKVLEDLVMHTFRLPPALVKKDYQRLYNFFYENSTSVLDEAEKIGISREEAC  323

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGG+KIFFPNMLKWIGRAG  LH+QLA+EIRSV+ +N GK+TMA ME+M
Sbjct  324   HNLLFATCFNSFGGIKIFFPNMLKWIGRAGAKLHSQLAQEIRSVISSNSGKVTMAAMEKM  383

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYES RIEPPV +QYGRAK D+VIESHDA F++KEGE+L+GFQPFATKDPKIFD
Sbjct  384   PLMKSVVYESLRIEPPVASQYGRAKHDMVIESHDASFEIKEGELLYGFQPFATKDPKIFD  443

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R++EF+  RF+GE+G+ LLKHVLWSNG ETENP++N+KQCAGKDFV+LVSRL+LVELFLR
Sbjct  444   RSEEFVADRFIGEEGEKLLKHVLWSNGSETENPSINNKQCAGKDFVVLVSRLLLVELFLR  503

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG SPLGA++TLTSL+RA+F
Sbjct  504   YDSFEIEVGASPLGAAITLTSLRRASF  530



>emb|CAD29735.1| allene oxide synthase [Solanum tuberosum]
Length=530

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/447 (77%), Positives = 404/447 (90%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG+ EFF+ RIQK+QSTVFRTNMPPGPFIS +  VV LLDGKSFP LFDVS V
Sbjct  84    RLDYFYNQGKNEFFKSRIQKHQSTVFRTNMPPGPFISFNPNVVVLLDGKSFPILFDVSKV  143

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPST+LTGGYR+LSY+DPSEPNHAKLK LMF+LLS RR+ ++PEFHN+Y+
Sbjct  144   EKKDLFTGTFMPSTDLTGGYRVLSYLDPSEPNHAKLKKLMFYLLSSRRNEVIPEFHNSYS  203

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLENEL+  GKA LNAANDQAAFNFLARSLYG++P  TKL  D PKLIGKWVLF L
Sbjct  204   ELFETLENELSTKGKARLNAANDQAAFNFLARSLYGINPQDTKLGTDGPKLIGKWVLFQL  263

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L LGLPK +ED ++HTFRLPPALVKKDYQRLY FFYENST++LD  E +G+SREEAC
Sbjct  264   HPLLILGLPKVLEDLVMHTFRLPPALVKKDYQRLYNFFYENSTSVLDEAEKIGISREEAC  323

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGG+KIFFPNMLKWIGRAG  LH+QLA+EIRSV+ +N GK+TMA ME+M
Sbjct  324   HNLLFATCFNSFGGIKIFFPNMLKWIGRAGAKLHSQLAQEIRSVISSNSGKVTMAAMEKM  383

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYES RIEPPV +QYGRAK D+VIESHDA F++KEGE+L+GFQPFATKDPKIFD
Sbjct  384   PLMKSVVYESLRIEPPVASQYGRAKHDMVIESHDASFEIKEGELLYGFQPFATKDPKIFD  443

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R++EF+  RF+GE+G+ LLKHVLWSNG ETENP++N+KQCAGKDFV+LVSRL+LVELFLR
Sbjct  444   RSEEFVADRFIGEEGEKLLKHVLWSNGSETENPSINNKQCAGKDFVVLVSRLLLVELFLR  503

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG SPLGA++TLTSL+RA+F
Sbjct  504   YDSFEIEVGASPLGAAITLTSLRRASF  530



>ref|XP_009616015.1| PREDICTED: allene oxide synthase, chloroplastic [Nicotiana tomentosiformis]
Length=527

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/447 (78%), Positives = 407/447 (91%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D+FYNQGR+E+F+ RIQK+QSTVFRTNMPPGPFIS +  VV LLDGKSFPTLFD S V
Sbjct  81    RLDFFYNQGRDEYFKSRIQKHQSTVFRTNMPPGPFISFNPNVVVLLDGKSFPTLFDTSKV  140

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPSTELTGGYR+LSY+DPSEPNHAKLK L+F+LLS RR+ ++PEFHN+Y+
Sbjct  141   EKKDLFTGTFMPSTELTGGYRVLSYLDPSEPNHAKLKKLLFYLLSSRRNAVIPEFHNSYS  200

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLEN+LA  GKAGLNAANDQAAFNFLARSLYGV+P+ TKL  D PKLIGKWVLF L
Sbjct  201   ELFETLENDLATKGKAGLNAANDQAAFNFLARSLYGVNPIDTKLGTDGPKLIGKWVLFQL  260

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L LGLPK +ED ++HTFRLPPALVKKDYQRLY FFYENST+ILD  E  G+SREEAC
Sbjct  261   HPLLILGLPKVLEDLVIHTFRLPPALVKKDYQRLYNFFYENSTSILDEAERTGISREEAC  320

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNMLKWIGRAGV LHTQLA+EIRSV+K+NGGKITM  +E M
Sbjct  321   HNLLFATCFNSFGGMKIFFPNMLKWIGRAGVKLHTQLAQEIRSVIKSNGGKITMGAIENM  380

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             +LMKS VYES RIEPPV +QYGRAKRD+VIESHDA F++KEGE+L+GFQPFATKDPKIFD
Sbjct  381   QLMKSVVYESLRIEPPVASQYGRAKRDMVIESHDAAFEIKEGELLYGFQPFATKDPKIFD  440

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R++EF+  RF+GE+G+ LLKHVLWSNG E E+P++N+KQC GKDFV+LVSRL+LVELFLR
Sbjct  441   RSEEFVADRFIGEEGEKLLKHVLWSNGSENESPSINNKQCVGKDFVVLVSRLLLVELFLR  500

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG SPLGAS+TLTSLKRA+F
Sbjct  501   YDSFEIEVGASPLGASITLTSLKRASF  527



>ref|XP_011074474.1| PREDICTED: allene oxide synthase [Sesamum indicum]
Length=537

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/447 (76%), Positives = 389/447 (87%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR+EFF+ RI KYQSTVFRTNMPPGP IS +  VV LLDGKSFP LFD   V
Sbjct  91    RQDYFYNQGRDEFFKSRILKYQSTVFRTNMPPGPLISFNPNVVVLLDGKSFPALFDTDKV  150

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPST+LTGGYR LS++DPSEPNHAKLK LMFFLLSHRR H++PEFHN+Y 
Sbjct  151   EKKDLFTGTYMPSTDLTGGYRTLSFLDPSEPNHAKLKKLMFFLLSHRRDHVIPEFHNSYT  210

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+++E ELA  GKAG ++ANDQAAFNFLARS YG DP  T+L  D PKL+ KWVLF+L
Sbjct  211   ELFESMEKELATKGKAGFSSANDQAAFNFLARSFYGADPKDTRLGSDGPKLVSKWVLFHL  270

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L LGLP+ IED +LHTF LPP L+KKDYQRLY+FFY+NST +LD  E LG+SR+EAC
Sbjct  271   HPLLILGLPRPIEDGILHTFSLPPFLIKKDYQRLYDFFYQNSTPVLDQAEKLGISRDEAC  330

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNLVFATCFNSFGG+KIFFPNMLKW+GRAGV LHT+LA+EIRS +K+NGG +TMA ME M
Sbjct  331   HNLVFATCFNSFGGLKIFFPNMLKWVGRAGVKLHTELAQEIRSAIKSNGGNVTMAAMENM  390

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RIEPPVP+QY +AKRD VIESHDA FQ+KEGEML+GFQPFATKDPKIFD
Sbjct  391   PLMKSVVYEALRIEPPVPSQYAKAKRDFVIESHDAAFQIKEGEMLYGFQPFATKDPKIFD  450

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+P RFVGE+G+ LLKHVLWSNG E   PT+N+KQCAGKDFV+L SRL+LVELF R
Sbjct  451   RAEEFVPTRFVGEEGEKLLKHVLWSNGPENATPTLNNKQCAGKDFVVLASRLLLVELFRR  510

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEV  SPLGASVT+TSLKRA+F
Sbjct  511   YDSFDIEVAASPLGASVTITSLKRASF  537



>ref|XP_009778544.1| PREDICTED: allene oxide synthase, chloroplastic-like [Nicotiana 
sylvestris]
Length=527

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/447 (78%), Positives = 401/447 (90%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D+FYNQGR+EFF+ RIQK+QSTVFRTNMPPGPFIS +  VV LLDGKSFPTLFD S V
Sbjct  81    RLDFFYNQGRDEFFKSRIQKHQSTVFRTNMPPGPFISFNPNVVVLLDGKSFPTLFDTSKV  140

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPSTELTGGYR+LSY+DPSEPNHAKLK LMFFLLS RR+ ++PEFHN+Y+
Sbjct  141   EKKDLFTGTFMPSTELTGGYRVLSYLDPSEPNHAKLKKLMFFLLSSRRNEVIPEFHNSYS  200

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLEN+LA  GKAGLNAANDQAAFNFLARS YGV+P+ T L  D PKLIGKWVLF L
Sbjct  201   ELFETLENDLATKGKAGLNAANDQAAFNFLARSFYGVNPLDTNLGADGPKLIGKWVLFQL  260

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L LGLPK +ED +LHTFRLP ALVKKDYQRLY FFYENST+ILD  E  G+SREEAC
Sbjct  261   HPLLILGLPKVLEDLVLHTFRLPSALVKKDYQRLYNFFYENSTSILDEAERTGISREEAC  320

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNMLKWIGRAGV LHTQLA+EIRS +K+NGGKITM  ME M
Sbjct  321   HNLLFATCFNSFGGMKIFFPNMLKWIGRAGVKLHTQLAQEIRSGIKSNGGKITMGAMENM  380

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYES RIEPPV +QYGRAKRD+VIESHD  F++KEGE+L+GFQPFATKDPKIFD
Sbjct  381   PLMKSVVYESLRIEPPVASQYGRAKRDMVIESHDGAFEIKEGELLYGFQPFATKDPKIFD  440

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R++EF+  RF+GE+G+ LLKHVLWSNG E E+P++N+KQC GKDFV+LVSRL+LVELFLR
Sbjct  441   RSEEFVADRFIGEEGEKLLKHVLWSNGPENESPSINNKQCVGKDFVVLVSRLLLVELFLR  500

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG SPLGAS+TLTSLKRA+F
Sbjct  501   YDSFEIEVGASPLGASITLTSLKRASF  527



>ref|NP_001234833.1| allene oxide synthase [Solanum lycopersicum]
 emb|CAB88032.1| allene oxide synthase [Solanum lycopersicum]
Length=534

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/447 (76%), Positives = 402/447 (90%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG+ EFF+ RIQK+QSTVFRTNMPPGPFIS +  VV LLDGKSFP LFDVS V
Sbjct  88    RLDYFYNQGKNEFFKSRIQKHQSTVFRTNMPPGPFISFNPNVVVLLDGKSFPVLFDVSKV  147

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPST+LTGGYR+LSY+DPSEPNHAKLK LMF+LLS RR+ ++PEFHN+Y+
Sbjct  148   EKKDLFTGTFMPSTDLTGGYRVLSYLDPSEPNHAKLKKLMFYLLSSRRNEVIPEFHNSYS  207

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLENEL+  GKAGLNAANDQAA NFLARSLYG++P  T+L  D PKLIGKWVLF L
Sbjct  208   ELFETLENELSTKGKAGLNAANDQAAVNFLARSLYGINPQDTELGTDGPKLIGKWVLFQL  267

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L LGLPK +ED ++HTFRLPPALVKKDYQRLY FFYENST++LD  E +G+SREEAC
Sbjct  268   HPLLILGLPKVLEDLVMHTFRLPPALVKKDYQRLYNFFYENSTSVLDEAEKIGISREEAC  327

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGG+KIFFPNMLKWIGRAG  LH+QLA+EIRSV+ +N GK+TMA ME+M
Sbjct  328   HNLLFATCFNSFGGIKIFFPNMLKWIGRAGAKLHSQLAQEIRSVISSNSGKVTMAAMEKM  387

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYES RIEPPV +QYGRAK D+VIESHDA F++KEGE+L+G+QPFATKDPKIFD
Sbjct  388   PLMKSVVYESLRIEPPVASQYGRAKHDMVIESHDASFEIKEGELLYGYQPFATKDPKIFD  447

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R++EF+  RF GE+G+ LLKHVLWSNG ETEN ++N+KQCAGKDFV+LVSRL+LVELFLR
Sbjct  448   RSEEFVADRFKGEEGEKLLKHVLWSNGSETENASINNKQCAGKDFVVLVSRLLLVELFLR  507

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG SPLGA++TLTSL+RA+F
Sbjct  508   YDSFEIEVGASPLGAAITLTSLRRASF  534



>ref|XP_004291923.1| PREDICTED: allene oxide synthase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=525

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/447 (72%), Positives = 382/447 (85%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR EFF+ RIQKYQSTVFR NMPPGPF ++ S+V+ LLDGKSFP LFDVS V
Sbjct  79    RQDYFYNQGRNEFFKSRIQKYQSTVFRVNMPPGPFFTTKSQVIVLLDGKSFPVLFDVSKV  138

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPS ELTGGYR LSY+DPSEP H KLK LMF+LL      ++PEFH++Y+
Sbjct  139   EKKDLFTGTYMPSLELTGGYRTLSYLDPSEPKHDKLKRLMFYLLKSGIKSVIPEFHSSYS  198

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLE +LA  GKA  N ANDQAAFNFLARSLY   P  T+L  D PKL+ KWVLF L
Sbjct  199   ELFETLETKLADKGKASFNEANDQAAFNFLARSLYETSPSNTQLGTDGPKLVQKWVLFQL  258

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L+LGLPK IEDPL+H+F LPP LVKKDYQRLY+FFY++S  +LD  E LGVSR+EAC
Sbjct  259   SPILTLGLPKFIEDPLIHSFPLPPFLVKKDYQRLYDFFYQSSGHVLDEAERLGVSRDEAC  318

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKI FPNMLKWIGRAG  LH++LA+EIRSV+++NGG ITM+ +E+M
Sbjct  319   HNLIFATCFNSFGGMKILFPNMLKWIGRAGAKLHSELAQEIRSVIRSNGGNITMSALEKM  378

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+FRIEPPVP QYGRAK D+VIESHDA F+VKEGE+LFGFQPFATKDPKIF+
Sbjct  379   PLMKSVVYEAFRIEPPVPLQYGRAKTDLVIESHDAAFKVKEGEVLFGFQPFATKDPKIFE  438

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
              A+EF+P RFVGE+G+ LL+HVLWSNG +TE PTV +KQCAGKDFV+L SRL++VE FLR
Sbjct  439   NAEEFVPDRFVGEEGEKLLQHVLWSNGPQTEAPTVGNKQCAGKDFVVLASRLLVVEFFLR  498

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEV  SPLGA++T+TSLKRA+F
Sbjct  499   YDSFEIEVAASPLGAAITMTSLKRASF  525



>ref|XP_008220731.1| PREDICTED: allene oxide synthase [Prunus mume]
Length=528

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/447 (75%), Positives = 386/447 (86%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR EFF+ R+QKYQSTVFR NMPPGPFIS + +VV LLDGKSFP LFDVS V
Sbjct  82    RLDYFYNQGRNEFFKSRVQKYQSTVFRVNMPPGPFISKNPQVVVLLDGKSFPVLFDVSKV  141

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPS ELTGGYRILSY+DPSEP H KLK ++F+LL   R  +LPEFH++Y 
Sbjct  142   EKKDLFTGTYMPSLELTGGYRILSYLDPSEPKHDKLKRVIFYLLKSSRDSVLPEFHSSYT  201

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLE++LA  GKA    ANDQAAFNFLARSLY  +P  T L LD PKL+ KWVLFNL
Sbjct  202   ELFETLESKLADKGKANFVEANDQAAFNFLARSLYRANPADTPLGLDGPKLVSKWVLFNL  261

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L LGLPK IEDPLLHTFRLPP L+KKDYQRLY+FFY++S  +LD  E LGVSR+EAC
Sbjct  262   GPLLMLGLPKFIEDPLLHTFRLPPFLIKKDYQRLYDFFYQSSGHVLDEAERLGVSRDEAC  321

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKI FPNMLKWIGRAGV LHTQLA+EIRSVV++NGGKITM GMEQM
Sbjct  322   HNLLFATCFNSFGGMKILFPNMLKWIGRAGVKLHTQLAEEIRSVVRSNGGKITMGGMEQM  381

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RIEPPVP QYG+AK D+VIESHD+ F+VKEGEMLFGFQPFATKD KIF 
Sbjct  382   PLMKSVVYEALRIEPPVPLQYGKAKTDLVIESHDSAFKVKEGEMLFGFQPFATKDSKIFK  441

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RFVGE G+ LLKHVLWSNG ETE+PTV +KQCAGKDFV+L SRL++VE FLR
Sbjct  442   RAEEFVADRFVGEDGEKLLKHVLWSNGPETESPTVGNKQCAGKDFVVLASRLLVVEFFLR  501

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG SPLGA++T+TSLKRA+F
Sbjct  502   YDSFEIEVGSSPLGAAITVTSLKRASF  528



>gb|AFV68274.1| allene oxide synthase [Catharanthus roseus]
Length=545

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/446 (76%), Positives = 389/446 (87%), Gaps = 0/446 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQG+EE+F+ RIQKY STVFRTNMPPGPFIS +  V+ LLDGKSFP LFDVS V
Sbjct  98    RQDYFYNQGKEEYFKSRIQKYHSTVFRTNMPPGPFISFNPNVIVLLDGKSFPVLFDVSKV  157

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPSTELTGGYR+LSY+DPSEPNH KLK L+FF LS RR H++PEFHN+Y+
Sbjct  158   EKKDLFTGTFMPSTELTGGYRVLSYLDPSEPNHGKLKKLLFFHLSSRRDHVIPEFHNSYS  217

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FD LE++L+ NGKA  N  NDQAAFNFLAR LYGV+P  TKL LD PKLIGKWVLFNL
Sbjct  218   ELFDGLEDQLSTNGKANFNQGNDQAAFNFLARPLYGVNPADTKLGLDGPKLIGKWVLFNL  277

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HPVL LGLP  IED L+HTFRLPPALVKKDYQ LY FFYENS  +L+  E +G+SR+EAC
Sbjct  278   HPVLRLGLPNGIEDLLIHTFRLPPALVKKDYQSLYNFFYENSNFVLEEAERIGISRDEAC  337

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNLVFATCFNSFGGMKI FPNM+KWIGRAGV LHTQLA+EIRSV+K+   KITM  +E M
Sbjct  338   HNLVFATCFNSFGGMKILFPNMMKWIGRAGVKLHTQLAQEIRSVLKSFDNKITMRALENM  397

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RIEPPVP QYGRAK+D++IESHDA F+VKEGE++FGFQPFATKDPKIF 
Sbjct  398   PLMKSVVYEALRIEPPVPAQYGRAKKDLIIESHDAAFKVKEGELIFGFQPFATKDPKIFH  457

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R++EF+P RFVGE+G+ LLKHVLWSNG ETE+P V++KQCAGKDFV+LVSRL+LVE F R
Sbjct  458   RSEEFVPDRFVGEEGEKLLKHVLWSNGPETESPNVHNKQCAGKDFVVLVSRLLLVEFFQR  517

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRAT  1340
             YDSFDIEVG SPLGASVT+TSLKRAT
Sbjct  518   YDSFDIEVGASPLGASVTVTSLKRAT  543



>gb|AIU98471.1| chloroplast allene oxide synthase [Gossypium hirsutum]
Length=523

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/447 (74%), Positives = 384/447 (86%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+EFF+ +IQKY STVFRTNMPPGPFIS D KVV LLDGKSFP LFDV+ V
Sbjct  77    RLDYFYNQGRDEFFKSKIQKYNSTVFRTNMPPGPFISQDPKVVALLDGKSFPVLFDVTKV  136

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPST+LTGGYRILSY+DPSEP HA+LK L+FFLL  RR H++PEF  +Y 
Sbjct  137   EKKDLFTGTYMPSTDLTGGYRILSYLDPSEPKHARLKQLLFFLLKSRRDHVIPEFQASYN  196

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLE E+A  GK+    ANDQA FNFL R+ +G +P  TKL  D P LI KWVLF L
Sbjct  197   ELFETLEKEVAEKGKSSFQTANDQAGFNFLCRAFFGSNPPDTKLGTDGPSLISKWVLFQL  256

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              PVL LGLPK +E+ L+HTF LPPALVKKDYQRLY+FFYE+S +I D  E LG+SREEAC
Sbjct  257   GPVLKLGLPKYVEELLIHTFPLPPALVKKDYQRLYDFFYESSGSIQDEAEKLGISREEAC  316

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNMLKWIGRAGV LH +LA EIRS +++NGGK+TMA MEQM
Sbjct  317   HNLLFATCFNSFGGMKIFFPNMLKWIGRAGVKLHNRLATEIRSAIRSNGGKLTMAAMEQM  376

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RIEPPVP QYGRAK+DIVIESHDA FQVK+GEMLFGFQPFATKDPKIF+
Sbjct  377   PLMKSVVYEALRIEPPVPLQYGRAKKDIVIESHDAVFQVKQGEMLFGFQPFATKDPKIFE  436

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RF+GE+G+ LLKHV+WSNG ET+ PT+ +KQCAGKDFV+L+SRL++VELF R
Sbjct  437   RAEEFVGERFMGEEGEKLLKHVIWSNGPETQQPTLGNKQCAGKDFVVLMSRLLVVELFRR  496

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEVG S LGA+VT+TSLKRA+F
Sbjct  497   YDSFDIEVGKSALGAAVTVTSLKRASF  523



>gb|AGV22361.1| chloroplast allene oxide synthase 6 [Gossypium arboreum]
Length=523

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/447 (74%), Positives = 384/447 (86%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+EFF+ +IQKY STVFRTNMPPGPFIS D KVV LLDGKSFP LFDV+ V
Sbjct  77    RLDYFYNQGRDEFFKSKIQKYNSTVFRTNMPPGPFISQDPKVVALLDGKSFPVLFDVTKV  136

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPST+LTGGYRILSY+DPSEP HA+LK L+FFLL  RR H++PEF  +Y+
Sbjct  137   EKKDLFTGTYMPSTDLTGGYRILSYLDPSEPKHARLKQLLFFLLKSRRDHVIPEFQASYS  196

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLE E+A  GK+    ANDQA FNFL R+ +G +P  TKL  D P LI KWVLF L
Sbjct  197   ELFETLEKEVAEKGKSSFQTANDQAGFNFLCRAFFGSNPPDTKLGTDGPSLISKWVLFQL  256

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              PVL LGLPK +E+ L+HTF LPPALVKKDYQRLY+FFYE+S +I D  E L +SREEAC
Sbjct  257   GPVLKLGLPKYVEELLIHTFPLPPALVKKDYQRLYDFFYESSGSIQDEAEKLSISREEAC  316

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNMLKWIGRAGV LH +LA EIRS +++NGGK+TMA MEQM
Sbjct  317   HNLLFATCFNSFGGMKIFFPNMLKWIGRAGVKLHNRLATEIRSAIRSNGGKLTMAAMEQM  376

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RIEPPVP QYGRAK+DIVIESHDA FQVK+GEMLFGFQPFATKDPKIF+
Sbjct  377   PLMKSVVYEALRIEPPVPLQYGRAKKDIVIESHDAVFQVKQGEMLFGFQPFATKDPKIFE  436

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RF+GE+G+ LLKHV+WSNG ET+ PT+ +KQCAGKDFV+L+SRL++VELF R
Sbjct  437   RAEEFVGERFMGEEGEKLLKHVIWSNGPETQQPTLGNKQCAGKDFVVLMSRLLVVELFRR  496

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEVG S LGA+VT+TSLKRA+F
Sbjct  497   YDSFDIEVGKSALGAAVTVTSLKRASF  523



>ref|NP_001274390.1| allene oxide synthase [Cucumis sativus]
 ref|XP_004152717.1| PREDICTED: allene oxide synthase, chloroplastic-like isoform 
1 [Cucumis sativus]
 ref|XP_004152718.1| PREDICTED: allene oxide synthase, chloroplastic-like isoform 
2 [Cucumis sativus]
 ref|XP_004160018.1| PREDICTED: allene oxide synthase, chloroplastic-like [Cucumis 
sativus]
 gb|AGZ95026.1| allene oxide synthase [Cucumis sativus]
 gb|KGN62561.1| Allene oxide synthase [Cucumis sativus]
Length=532

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/447 (72%), Positives = 390/447 (87%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGREE+ + R+ +Y+STV+RTNMPPGPFI+SDS+VV LLDGKSFP LFD S V
Sbjct  87    RQDYFYNQGREEYLKSRMLRYESTVYRTNMPPGPFITSDSRVVVLLDGKSFPVLFDHSKV  146

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMP TELTGGYR+LSYIDPSEP+HAKLK L+FFLL HRR  ++PEFH+ ++
Sbjct  147   EKKDLFTGTYMPVTELTGGYRVLSYIDPSEPDHAKLKQLVFFLLKHRRDKIMPEFHSTFS  206

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLE +LA +G+A  NA  +QAAFNFLARSL+G DP+ +KL  DAPKLI KWVLF L
Sbjct  207   ELFETLEKDLAASGRAEYNAPGEQAAFNFLARSLFGADPVDSKLGRDAPKLIAKWVLFQL  266

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              PVLSLGLPK +E+ LL T RLPPAL+K DY+RLYEFFY++S A+ +  + LG+SREEAC
Sbjct  267   GPVLSLGLPKVVEELLLRTVRLPPALIKADYRRLYEFFYKSSEAVFEEADRLGISREEAC  326

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+F TCFNSFGGMKIFFPNM+KWIGRAGV+LHTQLA+EIR+ VKANGGKITM  MEQM
Sbjct  327   HNLLFTTCFNSFGGMKIFFPNMIKWIGRAGVNLHTQLAREIRTAVKANGGKITMGAMEQM  386

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+FRIEPPVP QYGRAK+D+V+ESHDA F++KEGEM+ G+QPFAT+DPKIFD
Sbjct  387   PLMKSVVYEAFRIEPPVPVQYGRAKKDLVVESHDAAFEIKEGEMICGYQPFATRDPKIFD  446

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA EF+P RF G+ G+ LLKHVLWSNG ET++P+V +KQCAGKDF++ +SRLM+VELFLR
Sbjct  447   RADEFVPDRFTGD-GEELLKHVLWSNGPETQSPSVQNKQCAGKDFIVFISRLMVVELFLR  505

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIE   +PLGA+VT+TSLK+A+F
Sbjct  506   YDSFDIEASNTPLGAAVTVTSLKKASF  532



>emb|CAC82911.1| allene oxide synthase [Nicotiana attenuata]
Length=519

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/445 (74%), Positives = 387/445 (87%), Gaps = 0/445 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQG+EEFFR RIQKY+STVF+TNMPPG FISS+  VV LLDGKSFPTLFDVS V
Sbjct  75    RQDYFYNQGKEEFFRSRIQKYKSTVFKTNMPPGNFISSNPNVVVLLDGKSFPTLFDVSKV  134

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPSTELTGGYR+LSY+DPSEP H KLK L+FFLLS RR +++P+FH +Y 
Sbjct  135   EKKDLFTGTFMPSTELTGGYRVLSYLDPSEPTHEKLKKLLFFLLSSRRDYIIPQFHESYT  194

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F TLE E+  NGKA LN+ANDQAAFNFLARSLYG +P+ TKL  D P LIGKWVLF L
Sbjct  195   ELFKTLEKEMEKNGKADLNSANDQAAFNFLARSLYGANPVETKLGTDGPTLIGKWVLFQL  254

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L+LGLPK ++D LLH FRLPPALVKKDYQRLY+FFYE+STA+L+     G+SR+EAC
Sbjct  255   HPLLTLGLPKVLDDFLLHNFRLPPALVKKDYQRLYDFFYESSTAVLNEAGNFGISRDEAC  314

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNMLKWI RAGV LH +LA EIRS VK+ GGKITM+ ME+M
Sbjct  315   HNLLFATCFNSFGGMKIFFPNMLKWIARAGVELHIRLANEIRSAVKSAGGKITMSAMEKM  374

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              +MKS VYE+ RI+PPV +QYGRAKRD++IESHD  F+VK+GEMLFG+QPFAT+DPKIFD
Sbjct  375   PVMKSVVYEALRIDPPVASQYGRAKRDLMIESHDGVFEVKKGEMLFGYQPFATRDPKIFD  434

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R  EF+P RFVGE+G+ LLKHVLWSNG ETE+PTV +KQCAGKDFV+LVSRL++ E FLR
Sbjct  435   RPDEFVPDRFVGEEGEKLLKHVLWSNGPETESPTVENKQCAGKDFVVLVSRLLVTEFFLR  494

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRA  1337
             YD+ DI+VG SPLGA +T+TSLKRA
Sbjct  495   YDTLDIDVGTSPLGAKITITSLKRA  519



>ref|XP_007222520.1| hypothetical protein PRUPE_ppa004133mg [Prunus persica]
 gb|EMJ23719.1| hypothetical protein PRUPE_ppa004133mg [Prunus persica]
Length=528

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/447 (75%), Positives = 385/447 (86%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D+FYNQGR EFF+ R+QKYQSTVFR NMPPGPFIS + +VV LLDGKSFP LFDVS V
Sbjct  82    RLDFFYNQGRNEFFKSRVQKYQSTVFRVNMPPGPFISKNPQVVVLLDGKSFPVLFDVSKV  141

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPS ELTGGYRILSY+DPSEP H KLK ++F+LL   R  +LPEFH++Y 
Sbjct  142   EKKDLFTGTYMPSLELTGGYRILSYLDPSEPKHDKLKRVIFYLLKSSRDSVLPEFHSSYT  201

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLE++LA  GKA    ANDQAAFNFLARSLY  +P  T L LD PKL+ KWVLFNL
Sbjct  202   ELFETLESKLADKGKADFVEANDQAAFNFLARSLYRANPADTPLGLDGPKLVSKWVLFNL  261

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L LGLPK IEDPLLHTFRLPP L+KKDYQRLY+FFY++S  +LD  E LGVSR+EAC
Sbjct  262   GPLLMLGLPKFIEDPLLHTFRLPPFLIKKDYQRLYDFFYQSSGHVLDEAERLGVSRDEAC  321

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKI FPNMLKWIGRAGV LHTQLA+EIRSVV++NGGKITM GMEQM
Sbjct  322   HNLLFATCFNSFGGMKILFPNMLKWIGRAGVKLHTQLAEEIRSVVRSNGGKITMGGMEQM  381

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+FRIEPPV  QYG+AK D++IESHDA F+VKEGEMLFGFQ FATKD KIF+
Sbjct  382   PLMKSVVYEAFRIEPPVQLQYGKAKTDLLIESHDAAFKVKEGEMLFGFQSFATKDSKIFE  441

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RFVGE G+ LLKHVLWSNG ETE+PTV +KQCAGKDFV+L SRL++VE FLR
Sbjct  442   RAEEFVADRFVGEDGEKLLKHVLWSNGPETESPTVGNKQCAGKDFVVLASRLLVVEFFLR  501

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG SPLG ++T+TSLKRA+F
Sbjct  502   YDSFEIEVGSSPLGPAITVTSLKRASF  528



>ref|XP_009773128.1| PREDICTED: allene oxide synthase, chloroplastic-like [Nicotiana 
sylvestris]
Length=525

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/443 (74%), Positives = 386/443 (87%), Gaps = 0/443 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQG+EEFFR RIQKY+STVF+TNMPPG FISS+  VV LLDGKSFPTLFD+S V
Sbjct  75    RQDYFYNQGKEEFFRSRIQKYKSTVFKTNMPPGNFISSNPNVVVLLDGKSFPTLFDISKV  134

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPSTELTGGYR+LSY+DPSEPNH KLK L+FFLL+ RR +++P+FH +Y 
Sbjct  135   EKKDLFTGTFMPSTELTGGYRVLSYLDPSEPNHEKLKKLLFFLLTSRRDYIIPQFHESYT  194

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F TLE E+  NGKA LN+ANDQAAFNFLA+SLYG +P+ TKL  D P LIGKWVLF L
Sbjct  195   ELFKTLEKEMEKNGKADLNSANDQAAFNFLAKSLYGANPVETKLGTDGPTLIGKWVLFQL  254

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L+LGLPK ++D LLH FRLPPALVKKDYQRLY+FFYE+ST +L+  E  G+SR+EAC
Sbjct  255   HPLLTLGLPKVLDDFLLHNFRLPPALVKKDYQRLYDFFYESSTTVLNEAENFGISRDEAC  314

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNMLKWI RAGV LH +LA EIRS VK+ GGKITM+ ME+M
Sbjct  315   HNLLFATCFNSFGGMKIFFPNMLKWIARAGVELHIRLANEIRSAVKSAGGKITMSAMEKM  374

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              +MKS VYE+ RI+PPV +QYGRAKRD++IESHDA F+VK+GE+LFG+QPFATKDPK FD
Sbjct  375   PVMKSVVYEALRIDPPVASQYGRAKRDLMIESHDAVFEVKKGELLFGYQPFATKDPKSFD  434

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R  EF+P RFVGE+G+ LLKHVLWSNG ETE+PTV +KQCAGKDFV+LVSRL++ E FLR
Sbjct  435   RPDEFVPDRFVGEEGEKLLKHVLWSNGPETESPTVENKQCAGKDFVVLVSRLLVTEFFLR  494

Query  1263  YDSFDIEVGMSPLGASVTLTSLK  1331
             YD+ DI+VG SPLGA +T+TSLK
Sbjct  495   YDTLDIDVGTSPLGAKITITSLK  517



>ref|XP_009364212.1| PREDICTED: allene oxide synthase, chloroplastic-like [Pyrus x 
bretschneideri]
Length=536

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/452 (72%), Positives = 383/452 (85%), Gaps = 5/452 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+EFF+ RIQKYQSTVFR NMPPGP I+  S+VV LLDGKSFP LFDVS V
Sbjct  85    RLDYFYNQGRDEFFKSRIQKYQSTVFRVNMPPGPTITYKSQVVALLDGKSFPVLFDVSKV  144

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPS-----EPNHAKLKNlmffllshrrhhllPEF  347
             EK+D+FTGTYMPS ELTGG RILSY+DPS     EP H KLK ++F+LL   R  +LPEF
Sbjct  145   EKKDLFTGTYMPSVELTGGDRILSYLDPSYLDPSEPKHDKLKRVLFYLLKSSRDSVLPEF  204

Query  348   HNAYAEMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKW  527
             H++Y E+F+TLE  LA  GKA   AANDQAAFNFLARSLYG +P  T L +D PKL+ KW
Sbjct  205   HSSYTELFETLEASLADKGKANFVAANDQAAFNFLARSLYGANPADTPLGVDGPKLVSKW  264

Query  528   VLFNLHPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVS  707
             VLFNL P+L LGLPK IE+P++H+FRLPP L+KKDYQRLY+FFY++S  +LD  E LGVS
Sbjct  265   VLFNLAPLLILGLPKFIEEPIIHSFRLPPFLIKKDYQRLYDFFYQSSGHVLDEAERLGVS  324

Query  708   REEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMA  887
             R+EACHNL+FATCFNSFGG+K  FPNM+KWIGRAGV LHT+LA+EIR+ V++NGGKITM 
Sbjct  325   RDEACHNLLFATCFNSFGGLKFQFPNMIKWIGRAGVGLHTRLAEEIRTAVRSNGGKITMG  384

Query  888   GMEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKD  1067
              MEQM LMKS VYE+FRIEPPVP Q+G+AK D+VIESHDA F+VK+GE+LFGFQPFATKD
Sbjct  385   AMEQMPLMKSVVYETFRIEPPVPLQFGKAKTDLVIESHDAAFKVKQGELLFGFQPFATKD  444

Query  1068  PKIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLV  1247
             P+IF+RA EF+P RFVGE G+ LLKHVLWSNG ETE+PTV +KQCAGKDF +L SRL++V
Sbjct  445   PRIFERADEFVPDRFVGEDGEKLLKHVLWSNGPETESPTVGNKQCAGKDFSVLASRLLVV  504

Query  1248  ELFLRYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             E FLRYDSF+IEV  SPLGA++T+TSLKRA+F
Sbjct  505   EFFLRYDSFEIEVAPSPLGAAITVTSLKRASF  536



>dbj|BAM76723.1| allene oxyde synthase [Nicotiana tabacum]
Length=522

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/445 (74%), Positives = 388/445 (87%), Gaps = 0/445 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQG+EEFFR R+QKY+STVF+TNMPPG FISS+  VV LLDGKSFP LFDVS V
Sbjct  78    RQDYFYNQGKEEFFRSRVQKYKSTVFKTNMPPGNFISSNPNVVVLLDGKSFPILFDVSKV  137

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPSTELTGGYR+LSY+DPSEPNH KLK L+FFLLS RR +++P+FH +Y 
Sbjct  138   EKKDLFTGTFMPSTELTGGYRVLSYLDPSEPNHEKLKKLLFFLLSSRRDYIIPQFHESYT  197

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLE E+  NGKA LN+ANDQAAFNFLA SLYG +P  T+L  D P LIGKWVLF L
Sbjct  198   ELFETLEKEMEKNGKADLNSANDQAAFNFLAGSLYGANPGETQLGTDGPTLIGKWVLFQL  257

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+++LGLPK ++D LLH FRLPPALVKKDYQRLY+FFYE+STA+L+  E  G+SREEAC
Sbjct  258   HPLVTLGLPKVLDDFLLHNFRLPPALVKKDYQRLYDFFYESSTAVLNEAETFGISREEAC  317

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNMLKWI +AG+ LHT+LA EIRS VK+ GGKITM  ME+M
Sbjct  318   HNLLFATCFNSFGGMKIFFPNMLKWIAKAGLELHTRLANEIRSAVKSAGGKITMLAMEKM  377

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RI+PPV +QYGRAKRD++IESHDA F+VK+GE+LFG+QPFATKDPKIFD
Sbjct  378   PLMKSVVYEALRIDPPVASQYGRAKRDLMIESHDAVFEVKKGELLFGYQPFATKDPKIFD  437

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R  EF+P RFVGE+G+ LLKHVLWSNG ETE+PTV +KQCAGKDFV+LVSRL + E+FLR
Sbjct  438   RPDEFVPDRFVGEEGEKLLKHVLWSNGPETESPTVENKQCAGKDFVVLVSRLFVTEVFLR  497

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRA  1337
             YD+ D++VG SPLGA +T+TSLKRA
Sbjct  498   YDTLDVDVGTSPLGAKITITSLKRA  522



>ref|XP_010106073.1| Allene oxide synthase [Morus notabilis]
 gb|EXC07343.1| Allene oxide synthase [Morus notabilis]
Length=525

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/447 (72%), Positives = 387/447 (87%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+E+F+ RIQKYQSTVFR N+PPGP I+S+ +V+ LLDGKSFP LFDV+ V
Sbjct  79    RLDYFYNQGRDEYFKSRIQKYQSTVFRANIPPGPLITSNPRVIVLLDGKSFPVLFDVTKV  138

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPST+LTGGYR+LSY+DPSEPNH K+K+L+FFLL  RR  ++PEFH++Y 
Sbjct  139   EKKDLFTGTFMPSTDLTGGYRVLSYLDPSEPNHGKIKSLIFFLLKSRRDKVIPEFHSSYT  198

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLE+ELA  GK+    ANDQAAFNFL+R+LYG +P  TKL  D P L+ KWV+F L
Sbjct  199   ELFETLESELAAKGKSNFGEANDQAAFNFLSRALYGTNPADTKLGNDGPGLVQKWVVFQL  258

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L LGLPK +E+  LH+FRLPP LVK DYQRLY+FFYE+S  +LD  E LG+SREEAC
Sbjct  259   SPILVLGLPKFVEELTLHSFRLPPFLVKSDYQRLYDFFYESSGHVLDEAERLGISREEAC  318

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKI FPNMLK IGRAGV LHT+LA+EIR+VV++NGGK+TMA MEQM
Sbjct  319   HNLLFATCFNSFGGMKILFPNMLKQIGRAGVKLHTELAREIRTVVRSNGGKVTMAAMEQM  378

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYES RIEPPV  Q+G+AKRD VIESHDA F++KEGEM+FG+QPFATKDPKIFD
Sbjct  379   PLMKSVVYESLRIEPPVSLQFGKAKRDFVIESHDAAFEIKEGEMIFGYQPFATKDPKIFD  438

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+P RFVGE+G+ LLKHVLWSNG ETE+PTV +KQCAGKD V+L SRL++VELFL 
Sbjct  439   RAEEFVPDRFVGEEGERLLKHVLWSNGPETESPTVGNKQCAGKDLVVLFSRLLVVELFLL  498

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG S LG++VT+TSLKRA+F
Sbjct  499   YDSFEIEVGTSALGSAVTVTSLKRASF  525



>ref|XP_009600537.1| PREDICTED: allene oxide synthase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=522

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/445 (74%), Positives = 388/445 (87%), Gaps = 0/445 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQG+EEFFR R+QKY+STVF+TNMPPG FISS+  VV LLDGKSFP LFDVS V
Sbjct  78    RQDYFYNQGKEEFFRSRVQKYKSTVFKTNMPPGNFISSNPNVVVLLDGKSFPILFDVSKV  137

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPSTELTGGYR+LSY+DPSEPNH KLK L+FFLLS RR +++P+FH +Y 
Sbjct  138   EKKDLFTGTFMPSTELTGGYRVLSYLDPSEPNHEKLKKLLFFLLSSRRDYIIPQFHESYT  197

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLE E+  NGKA LN+ANDQAAFNFLA SLYG +P  T+L  D P LIGKWVLF L
Sbjct  198   ELFETLEKEMEKNGKADLNSANDQAAFNFLAGSLYGANPGETQLGTDGPTLIGKWVLFQL  257

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+++LGLPK ++D LLH FRLPPALVKKDYQRLY+FFYE+STA+L+  E  G+SREEAC
Sbjct  258   HPLVTLGLPKVLDDFLLHNFRLPPALVKKDYQRLYDFFYESSTAVLNEAETFGISREEAC  317

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNMLKWI +AG+ LHT+LA EIRS VK+ GGKITM  ME+M
Sbjct  318   HNLLFATCFNSFGGMKIFFPNMLKWIAKAGLELHTRLANEIRSAVKSAGGKITMLAMEKM  377

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RI+PPV +QYGRAKRD++IESHDA F+VK+GE+LFG+QPFATKDPKIFD
Sbjct  378   PLMKSVVYEALRIDPPVASQYGRAKRDLMIESHDAVFEVKKGELLFGYQPFATKDPKIFD  437

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R  EF+P RFVGE+G+ LLKHVLWSNG ETE+PTV +KQCAGKDFV+LVSRL + E+FLR
Sbjct  438   RPDEFVPDRFVGEEGEKLLKHVLWSNGPETESPTVENKQCAGKDFVVLVSRLFVTEVFLR  497

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRA  1337
             YD+ D++VG SPLGA +T+TSLKRA
Sbjct  498   YDTLDVDVGTSPLGAKITITSLKRA  522



>gb|AJD25174.1| cytochrome P450 CYP74A1 [Salvia miltiorrhiza]
Length=519

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/447 (73%), Positives = 377/447 (84%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR+EFF+ RIQKYQSTV+RTNMPPGPFIS    VV LLDGKSFP LFD   V
Sbjct  74    RQDYFYNQGRDEFFKSRIQKYQSTVYRTNMPPGPFISFRPNVVALLDGKSFPALFDTDNV  133

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRD+FTGT+MPST+LTGGYR LSY+DPSEPNHAKLKNLMFF+LS RR H++PEFH  Y 
Sbjct  134   EKRDLFTGTFMPSTDLTGGYRTLSYLDPSEPNHAKLKNLMFFMLSSRRDHVIPEFHATYV  193

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             +MF  LE ELA  GKA   AAND AAFNFLARS YGV P  +KL  D P ++ KWVLF L
Sbjct  194   QMFQGLETELAAKGKASFGAANDVAAFNFLARSFYGVSPNESKLGPDGPSIVAKWVLFQL  253

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L LGLP+ +ED LLHTF LPP L+KKDY RLY+FFY+NS+ ILDH E LGV+R+EAC
Sbjct  254   HPLLRLGLPRPVEDGLLHTFTLPPFLIKKDYTRLYDFFYDNSSPILDHAETLGVARDEAC  313

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNLVFATCFN+FGGMKIFFPNMLKW+GRAG  LH  LA+EIRS VK++G  ++M  ME M
Sbjct  314   HNLVFATCFNTFGGMKIFFPNMLKWVGRAGARLHADLAREIRSAVKSSGA-VSMGAMESM  372

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RIEPPVP+QY +AKRD VIESH+A FQ++EGEML+GFQP ATKDPKIFD
Sbjct  373   PLMKSVVYEALRIEPPVPSQYAKAKRDFVIESHEAAFQIREGEMLYGFQPLATKDPKIFD  432

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RFVGE+G+ LLKHVLWSNG E E+PT+++KQCAGKDFV+L+SRL+LVE FLR
Sbjct  433   RAEEFVADRFVGEEGEKLLKHVLWSNGPENESPTLHNKQCAGKDFVVLISRLLLVEFFLR  492

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEV  SPLGA+VT+TSLKRATF
Sbjct  493   YDSFDIEVAASPLGAAVTVTSLKRATF  519



>gb|ABC17856.1| allene oxide synthase protein [Lonicera japonica]
Length=527

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/447 (72%), Positives = 385/447 (86%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+++F+ RIQKYQSTV+R N PPG FIS++  VV LLDGKSFP LFD+  V
Sbjct  81    RLDYFYNQGRDDYFKSRIQKYQSTVYRANTPPGSFISNNPNVVVLLDGKSFPVLFDLDKV  140

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGGYR+LS++DPSEPNH KLK L+FFLL  RR  ++PEFH ++ 
Sbjct  141   EKKDLFTGTYMPSTELTGGYRVLSFLDPSEPNHGKLKKLIFFLLQSRRQSVIPEFHTSFT  200

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F++LE+ELA +GKA  N  NDQAAFNFLARSL+G +P  T L  D PKLI KWVLF L
Sbjct  201   ELFESLESELASDGKANFNDPNDQAAFNFLARSLFGTNPAETNLGSDGPKLIRKWVLFQL  260

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L LGLPK +E+ ++HTFRLPP LVKKDYQRLY+FFY +ST +LD  E  G+SR+EAC
Sbjct  261   SPLLVLGLPKLVEELVIHTFRLPPFLVKKDYQRLYDFFYNSSTFVLDEAEKTGISRDEAC  320

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL++ATCFNSFGGMKI FPNM+KWIGRAGV LHT+LA+EIRSV+++NGGK+TMA MEQM
Sbjct  321   HNLLYATCFNSFGGMKILFPNMVKWIGRAGVKLHTELAQEIRSVIRSNGGKVTMAAMEQM  380

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYES RIEPPV  QYGRAK+D VIESHDA FQVKEGE+LFG+QPFATKDPKIF+
Sbjct  381   PLMKSAVYESLRIEPPVALQYGRAKQDFVIESHDAAFQVKEGELLFGYQPFATKDPKIFE  440

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R++EF+ +RFVGE+G+ +LKHVLWSNG ETE+P + +KQCAGKDFV+L SRL+LVELFLR
Sbjct  441   RSEEFVANRFVGEEGEMMLKHVLWSNGPETESPGIGNKQCAGKDFVVLASRLLLVELFLR  500

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEV   PLGASVTLTSLKRA+F
Sbjct  501   YDSFEIEVAKGPLGASVTLTSLKRASF  527



>gb|AHY03308.1| allene oxide synthase [Camellia sinensis]
Length=524

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/447 (74%), Positives = 390/447 (87%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+E+F+ R+QKYQSTVFR NMPPGPFI+S+  VV LLDGKSFP LFDV+ V
Sbjct  78    RLDYFYNQGRDEYFKSRVQKYQSTVFRANMPPGPFIASNPNVVVLLDGKSFPILFDVTKV  137

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +KRDVFTGTYMPSTELTGGYR+LSY+DPSEPNHAKLK LMFFLL   R  ++PEF  ++ 
Sbjct  138   KKRDVFTGTYMPSTELTGGYRVLSYLDPSEPNHAKLKQLMFFLLKSSRDRVIPEFQTSFT  197

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+ LE+EL   GKA  N ANDQAAFNFLARSLYG +P+ TKL +D PKL+ KWV+F L
Sbjct  198   ELFEMLESELGSEGKASFNEANDQAAFNFLARSLYGTNPVDTKLGIDGPKLVTKWVVFQL  257

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L LGLPK +E+ ++HTFRLPPALVKKDYQRLY+FFY++ST +LD  E +G+SREEAC
Sbjct  258   GPLLILGLPKFVEELVIHTFRLPPALVKKDYQRLYDFFYDSSTLVLDEAERIGISREEAC  317

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKI FPNM+K IGRAGV+LHTQLA+EIRS V++NGG++TMA MEQM
Sbjct  318   HNLIFATCFNSFGGMKILFPNMIKRIGRAGVNLHTQLAEEIRSAVRSNGGEVTMAAMEQM  377

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYES RIEPP+  QYGRAKRD+VIESHDA F+VKEGE+LFGFQPFATKDPKIF+
Sbjct  378   PLMKSVVYESLRIEPPISLQYGRAKRDLVIESHDAAFEVKEGELLFGFQPFATKDPKIFE  437

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R +EF+  RFVGE+G+ LL+HVLWSNG ETE+PTV +KQCAGKDFV+ VSRL++VELF R
Sbjct  438   RPEEFVADRFVGEEGERLLRHVLWSNGPETESPTVGNKQCAGKDFVVFVSRLLVVELFRR  497

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG SPLGA VT+TSLKRA+F
Sbjct  498   YDSFEIEVGQSPLGAKVTVTSLKRASF  524



>ref|XP_008444665.1| PREDICTED: allene oxide synthase [Cucumis melo]
Length=531

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/447 (71%), Positives = 389/447 (87%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGREE+ + R+ +Y+STV+RTNMPPGPFI+SDS+VV LLDGKSFP LFD S V
Sbjct  86    RHDYFYNQGREEYLKSRMLRYESTVYRTNMPPGPFITSDSRVVVLLDGKSFPVLFDHSKV  145

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMP TELTGGYR+LSYIDPSEP+HAKLK L+FFLL HRR  ++PEFH+ ++
Sbjct  146   EKKDLFTGTYMPVTELTGGYRVLSYIDPSEPDHAKLKQLIFFLLKHRRDKIMPEFHSTFS  205

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLE +LA  G+A  NA+ +QAAFNFLARSL+G DP+ +KL  DAPKLI KWVLF L
Sbjct  206   ELFETLEKDLAAAGRAEYNASGEQAAFNFLARSLFGADPVDSKLGRDAPKLIAKWVLFQL  265

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              PVLSLGLPK +E+ LL T RLPPAL+K DY+RLY+FFY++S A+ +  + LG+SREEAC
Sbjct  266   GPVLSLGLPKVVEELLLRTVRLPPALIKADYRRLYDFFYKSSEAVFEEADRLGISREEAC  325

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+F TCFNSFGGMKIFFPNM+KWIGRAGV+LHT+LA+EIR+ VKANGGKITM  MEQM
Sbjct  326   HNLLFTTCFNSFGGMKIFFPNMIKWIGRAGVNLHTRLAREIRTAVKANGGKITMGAMEQM  385

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RIEPPVP QYGRAK+D+V+ESHDA F++KEGE++ G+QPFAT+DPKIFD
Sbjct  386   PLMKSVVYEALRIEPPVPVQYGRAKKDLVVESHDAAFEIKEGEVICGYQPFATRDPKIFD  445

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA EF+P RF GE G+ LLKHV+WSNG ET++P+V +KQCAGKDF++ +SRL++VELFLR
Sbjct  446   RADEFVPDRFTGE-GEELLKHVIWSNGPETQSPSVQNKQCAGKDFIVFISRLLVVELFLR  504

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIE   +PLGA+VT+TSLK+A+F
Sbjct  505   YDSFDIEASNTPLGAAVTVTSLKKASF  531



>ref|XP_002283780.1| PREDICTED: allene oxide synthase [Vitis vinifera]
Length=520

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/447 (72%), Positives = 383/447 (86%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGREEFFR R QK+QSTVFR+NMPPGPFISS+SKV+ LLDGKSFP LFDVS V
Sbjct  75    RLDYFYNQGREEFFRSRAQKHQSTVFRSNMPPGPFISSNSKVIVLLDGKSFPVLFDVSKV  134

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+DVFTGT+MPSTE TGG+R+LSY+DPSEP+H KLK L+FFLL   R  ++PEFH+ ++
Sbjct  135   EKKDVFTGTFMPSTEFTGGFRVLSYLDPSEPDHTKLKRLLFFLLQSSRDRVIPEFHSCFS  194

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+ +TLE+ELA  GKA     NDQA+FNFLAR+LYG  P  TKL  D P LI  WV+F L
Sbjct  195   ELSETLESELAAKGKASFADPNDQASFNFLARALYGTKPADTKLGTDGPGLITTWVVFQL  254

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L+LGLPK IE+PL+HTF LP  L K  YQ+LY+FFY+ ST +LD GE +G+SREEAC
Sbjct  255   SPILTLGLPKFIEEPLIHTFPLPAFLAKSSYQKLYDFFYDASTHVLDEGEKMGISREEAC  314

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKI FP +LKW+GR GV LHTQLA+EIRSVVK+NGGK+TMA MEQM
Sbjct  315   HNLLFATCFNSFGGMKIIFPTILKWVGRGGVKLHTQLAQEIRSVVKSNGGKVTMASMEQM  374

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKSTVYE+FRIEPPV  QYG+AK+D+VIESHD+ F+VKEGEMLFG+QPFATKDPKIF+
Sbjct  375   PLMKSTVYEAFRIEPPVALQYGKAKQDLVIESHDSVFEVKEGEMLFGYQPFATKDPKIFE  434

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R++EF+P RFVGE G+ LLKHVLWSNG ETENPT+ +KQCAGKDFV+L +RL +VELFLR
Sbjct  435   RSEEFVPDRFVGE-GEKLLKHVLWSNGPETENPTLGNKQCAGKDFVVLAARLFVVELFLR  493

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEVG S LG+++ LTSLKRA+F
Sbjct  494   YDSFDIEVGTSLLGSAINLTSLKRASF  520



>ref|XP_006473410.1| PREDICTED: allene oxide synthase, chloroplastic [Citrus sinensis]
Length=532

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/447 (74%), Positives = 384/447 (86%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYN GR+EFF+ +IQKY STVFR NMPPGPFISS+  V+ LLDGKSFP LFDVS V
Sbjct  87    RQDYFYNLGRDEFFKSKIQKYGSTVFRANMPPGPFISSNPNVIVLLDGKSFPVLFDVSKV  146

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPST+LTGGYR+LSY+DPSEPNHAKLK L+FFLL +RR  ++PEFH+ Y 
Sbjct  147   EKKDLFTGTYMPSTDLTGGYRVLSYLDPSEPNHAKLKQLLFFLLMNRRDKVIPEFHSTYT  206

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E F+TLE +LA  GKA  + AN+QAAFNFLAR+ +G +P  T L  DAP LIGKW+LF L
Sbjct  207   EAFETLERDLAAKGKADFSGANEQAAFNFLARAWFGKNPADTTLGSDAPTLIGKWILFQL  266

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+LSLGLPK +E+PLL T  LPPALVKKDYQRLY+FF+E+S  +LD  E LGVSREEAC
Sbjct  267   APLLSLGLPKLVEEPLLRTRPLPPALVKKDYQRLYDFFHESSGFVLDEAEKLGVSREEAC  326

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNLVFATCFNSFGGMKI FPNM+KWIGR GV LH QLA+EIRSVV++NGGK+TMAGMEQM
Sbjct  327   HNLVFATCFNSFGGMKILFPNMVKWIGRGGVKLHMQLAEEIRSVVRSNGGKVTMAGMEQM  386

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE  R+EPPV  QYG+AKRD++I SH+A F+VKEGEMLFG+QPFATKDPKIF+
Sbjct  387   PLMKSVVYEVLRMEPPVALQYGKAKRDLIISSHEASFEVKEGEMLFGYQPFATKDPKIFE  446

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             +A+EF+  RFVGE G+ +LKHVLWSNG ETENPTV +KQCAGKDFV+L SRL+LVELFLR
Sbjct  447   QAEEFVADRFVGE-GEKMLKHVLWSNGPETENPTVGNKQCAGKDFVVLASRLLLVELFLR  505

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDI+VG S +G+SVTLTSLKRA+F
Sbjct  506   YDSFDIQVGKSAIGSSVTLTSLKRASF  532



>gb|ABS50433.1| allene oxidase synthase [Hyoscyamus niger]
Length=494

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/445 (72%), Positives = 385/445 (87%), Gaps = 3/445 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQG+ EFF+ RIQKY+STVFRTNMPPGPFISS+  V+ LLDGKSFPTLFDVS V
Sbjct  53    RFDYFYNQGKNEFFKSRIQKYKSTVFRTNMPPGPFISSNPNVIVLLDGKSFPTLFDVSKV  112

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPSTELTGGYR+LSY+DPSEPNH++LK L+F LLS RR H++P+FH  + 
Sbjct  113   EKKDLFTGTFMPSTELTGGYRVLSYLDPSEPNHSRLKKLLFMLLSSRRDHIIPKFHETFT  172

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TL+ E+A  GKA LN+ NDQA+FNFLA+SLYGV+P+ TKL  +AP LIGKWVLFNL
Sbjct  173   ELFETLDTEMAEKGKADLNSGNDQASFNFLAKSLYGVNPVETKLGKEAPTLIGKWVLFNL  232

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HPVL+LGLPK ++D +LHTFRLPP LVKKDYQ+LY+FFYENS  IL+  E LG+SR+EAC
Sbjct  233   HPVLTLGLPKVLDDLILHTFRLPPGLVKKDYQKLYDFFYENSGMILNEAEKLGISRDEAC  292

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNM+K I +AG  LHT+L  EIR+ VK+ GGKIT   ME+M
Sbjct  293   HNLLFATCFNSFGGMKIFFPNMMKSIAKAGSDLHTRLRNEIRTAVKSAGGKIT---MEKM  349

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RI+PPV +QYGRAK D+ IESHD  F+VK+GEML+G+QPFATKDPKIF 
Sbjct  350   PLMKSVVYEALRIDPPVASQYGRAKHDLTIESHDDVFEVKKGEMLYGYQPFATKDPKIFT  409

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R +EF+P RFVGE+G+ LLKHVLWSNG ETENPTV +KQCAGKDFV+LVSRL++ E FLR
Sbjct  410   RPEEFVPDRFVGEEGEKLLKHVLWSNGPETENPTVENKQCAGKDFVVLVSRLLVTEFFLR  469

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRA  1337
             YD+FD++VG SPLGA +T+TSLK+A
Sbjct  470   YDTFDVDVGTSPLGAKITITSLKKA  494



>ref|XP_006434896.1| hypothetical protein CICLE_v10000825mg [Citrus clementina]
 gb|ESR48136.1| hypothetical protein CICLE_v10000825mg [Citrus clementina]
Length=532

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/447 (73%), Positives = 383/447 (86%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DY YN GR+EFF+ +IQKY STVFR NMPPGPFISS+ KV+ LLDGKSFP LFDVS V
Sbjct  87    RQDYLYNLGRDEFFKSKIQKYGSTVFRANMPPGPFISSNPKVIVLLDGKSFPVLFDVSKV  146

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPST+LTGGYR+LSY+DPSEPNHAKLK L+FFLL +RR  ++PEFH+ Y 
Sbjct  147   EKKDLFTGTYMPSTDLTGGYRVLSYLDPSEPNHAKLKQLLFFLLMNRRDKVIPEFHSTYT  206

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E F+TLE +LA  GKA  + AN+QAAFNFLAR+ +G +P  T L  DAP LIGKW+LF L
Sbjct  207   EAFETLERDLAAKGKADFSGANEQAAFNFLARAWFGKNPADTTLGSDAPTLIGKWILFQL  266

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+LSLGLPK +E+PLL T  LPPALVKKDYQRLY+FF+E+S  +LD  E LGVSREEAC
Sbjct  267   APLLSLGLPKLVEEPLLRTRPLPPALVKKDYQRLYDFFHESSGFVLDEAEKLGVSREEAC  326

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNLVFATCFNSFGGMKI FPNM+KWIGR GV LH QLA+EIRSVV++NGGK+TMAGMEQM
Sbjct  327   HNLVFATCFNSFGGMKILFPNMVKWIGRGGVKLHMQLAEEIRSVVRSNGGKVTMAGMEQM  386

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
               MKS VYE  R+EPPV  QYG+AKRD++I +H+A F+VKEGEMLFG+QPFATKDPKIF+
Sbjct  387   PWMKSVVYEVLRMEPPVALQYGKAKRDLIISNHEASFEVKEGEMLFGYQPFATKDPKIFE  446

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RFVGE G+ +LKHVLWSNG ETENPTV +KQCAGKDFV+L SRL+LVELFLR
Sbjct  447   RAEEFVADRFVGE-GEKMLKHVLWSNGPETENPTVGNKQCAGKDFVVLASRLLLVELFLR  505

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDI+VG S +G+SVTLTSLKRA+F
Sbjct  506   YDSFDIQVGKSAIGSSVTLTSLKRASF  532



>ref|NP_001275835.1| allene oxide synthase [Citrus sinensis]
 gb|AAO72741.1| allene oxide synthase [Citrus sinensis]
Length=532

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/447 (73%), Positives = 383/447 (86%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYN GR+EFF+ +IQKY STVFR NMPPGPFISS+ KV+ LLDGKSFP LFDVS V
Sbjct  87    RQDYFYNLGRDEFFKSKIQKYGSTVFRANMPPGPFISSNPKVIVLLDGKSFPVLFDVSKV  146

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPST+LTGGYR+LSY+DPSEPNHAKLK L+FFLL +RR  ++PE H+ Y 
Sbjct  147   EKKDLFTGTYMPSTDLTGGYRVLSYLDPSEPNHAKLKQLLFFLLMNRRDKVIPELHSTYT  206

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E F+TLE +LA  GKA  + AN+QAAFNFLAR+ +G +P  T L  DAP LIGKW+LF L
Sbjct  207   EAFETLERDLAAKGKADFSGANEQAAFNFLARAWFGKNPADTTLGSDAPTLIGKWILFQL  266

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+LSLGLPK +E+PLL T  LPPALVKKDYQRLY+FF+E+S  +LD  E LGVSREEAC
Sbjct  267   APLLSLGLPKLVEEPLLRTRPLPPALVKKDYQRLYDFFHESSGFVLDEAEKLGVSREEAC  326

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNLVFATCFNSFGGMKI FPNM+KWIGR GV LH QLA+EIRSVV++NGGK+TMAGMEQM
Sbjct  327   HNLVFATCFNSFGGMKILFPNMVKWIGRGGVKLHMQLAEEIRSVVRSNGGKVTMAGMEQM  386

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE  R+EPPV  QYG+AKRD++I SH+A F+VKEGEMLFG+QPFATKDPKIF+
Sbjct  387   PLMKSVVYEVLRMEPPVALQYGKAKRDLIISSHEASFEVKEGEMLFGYQPFATKDPKIFE  446

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             +A+EF+  RFVGE G+ +LKHVLWSNG ETENP V +KQCAGKDFV+L SRL+LVELFLR
Sbjct  447   QAEEFVADRFVGE-GEKMLKHVLWSNGPETENPPVGNKQCAGKDFVVLASRLLLVELFLR  505

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDI+VG S +G+SVTLTSLKRA+F
Sbjct  506   YDSFDIQVGKSAIGSSVTLTSLKRASF  532



>ref|XP_004501049.1| PREDICTED: allene oxide synthase, chloroplastic-like [Cicer arietinum]
Length=540

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/448 (71%), Positives = 381/448 (85%), Gaps = 1/448 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYN GR++FFR R  KYQSTVFR NMPPGPFIS++  V+ LLDGKSFP LFD S V
Sbjct  93    RLDYFYNGGRDKFFRTRAHKYQSTVFRANMPPGPFISNNPNVIVLLDGKSFPVLFDTSKV  152

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRD+FTGT+MPSTELTGGYRILSY+DPSEP H +LK  +F+LL+ R  H +PEFH++YA
Sbjct  153   EKRDLFTGTFMPSTELTGGYRILSYLDPSEPKHDQLKRFLFYLLTSRISHFIPEFHSSYA  212

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++FDTLE +LA NGKA    ANDQAAFN+LA++LYGV+P  T L+ +APK+I KW L  L
Sbjct  213   KLFDTLEKQLAKNGKASFAEANDQAAFNYLAKALYGVNPSETDLKNEAPKIITKWTLLQL  272

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTA-ILDHGEILGVSREEA  719
              P+LSLGLPK IE+ + HTFRLPP LVKKDYQRLY+FFY+ ++  +L+    LGVS+EEA
Sbjct  273   SPILSLGLPKYIEEAVFHTFRLPPILVKKDYQRLYDFFYDAASGPVLEEAVRLGVSKEEA  332

Query  720   CHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQ  899
              HNL+FATCFNSFGGMKIFFPNMLKWIGRAGV+LH++LA+EIRS VK+NGGK+TMA MEQ
Sbjct  333   VHNLIFATCFNSFGGMKIFFPNMLKWIGRAGVNLHSKLAEEIRSAVKSNGGKVTMAAMEQ  392

Query  900   MELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF  1079
             M LMKS VYESFRIEPPVP QYG+AK D VIE+H+  FQVKEGEMLFGFQPFATKDPKIF
Sbjct  393   MPLMKSVVYESFRIEPPVPLQYGKAKHDFVIENHENSFQVKEGEMLFGFQPFATKDPKIF  452

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
             DR  EF+  RF+GE+G+ LLKHVLWSNG ETE PTV++KQCAGKDFV+L SRL++VE FL
Sbjct  453   DRPDEFVGERFIGEEGEKLLKHVLWSNGPETEQPTVSNKQCAGKDFVVLFSRLLVVEFFL  512

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             RYD+F I+VG SP+G+++T TSLK+ATF
Sbjct  513   RYDTFGIQVGKSPIGSAITFTSLKKATF  540



>gb|AAM66138.1|AF081954_1 allene oxide synthase [Cucumis melo]
Length=537

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/453 (70%), Positives = 388/453 (86%), Gaps = 7/453 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGREE+ + R+ +Y+STV+RTNMPPGPFI+SDS+VV LLDGKSFP LFD S V
Sbjct  86    RHDYFYNQGREEYLKSRMLRYESTVYRTNMPPGPFITSDSRVVVLLDGKSFPVLFDHSKV  145

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMP TELTGGYR+LSYIDPSEP+HAKLK L+FFLL HRR  ++PEFH+ ++
Sbjct  146   EKKDLFTGTYMPVTELTGGYRVLSYIDPSEPDHAKLKQLIFFLLKHRRDKIMPEFHSTFS  205

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLE +LA  G+A  NA+ +QAAFNFLARSL+G DP+ +KL  DAPKLI KWVLF L
Sbjct  206   ELFETLEKDLAAAGRAEYNASGEQAAFNFLARSLFGADPVDSKLGRDAPKLIAKWVLFQL  265

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              PVLSLGLPK +E+ LL T RLPPAL+K DY+RLY+FFY++S A+ +  + LG+SREEAC
Sbjct  266   GPVLSLGLPKVVEELLLRTVRLPPALIKADYRRLYDFFYKSSEAVFEEADRLGISREEAC  325

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+F TCFNSFGGMKIFFPNM+KWIGRAGV+LHT+LA+EIR+ VKANGGKITM  MEQM
Sbjct  326   HNLLFTTCFNSFGGMKIFFPNMIKWIGRAGVNLHTRLAREIRTAVKANGGKITMGAMEQM  385

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RIEPPVP QYGRAK+D+V+ESHDA F++KEGE++ G+QPFAT+DPKIFD
Sbjct  386   PLMKSVVYEALRIEPPVPVQYGRAKKDLVVESHDAAFEIKEGEVICGYQPFATRDPKIFD  445

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA E +P RF GE G+ LLKHV+WSNG ET++P+V +KQCAGKDF++ +SRL++VELFLR
Sbjct  446   RADELVPDRFTGE-GEELLKHVIWSNGPETQSPSVQNKQCAGKDFIVFISRLLVVELFLR  504

Query  1263  YDSFDIEVGMSPLG------ASVTLTSLKRATF  1343
             YDSFDIE   +PLG      A+VT+TSLK+A+F
Sbjct  505   YDSFDIEASNTPLGAAVTVSAAVTVTSLKKASF  537



>ref|XP_006340212.1| PREDICTED: allene oxide synthase, chloroplastic [Solanum tuberosum]
Length=510

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/445 (72%), Positives = 384/445 (86%), Gaps = 0/445 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG++EFF  R+ KY+ST+FRTNMPPGPFISS+ KV+ LLDGKSFP LFDVS V
Sbjct  66    RLDYFYNQGKDEFFESRVVKYKSTIFRTNMPPGPFISSNPKVIVLLDGKSFPVLFDVSKV  125

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGGYR+LSY+DPSEPNH KLK LMFFLLS RR H++P+FH  Y 
Sbjct  126   EKKDLFTGTYMPSTELTGGYRVLSYLDPSEPNHEKLKKLMFFLLSSRRDHVIPKFHETYT  185

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E F+TL+ E+A  G AGLN+ NDQAAFNFLARSL+GV+P+ TKL  D P LIGKWVL  L
Sbjct  186   EFFETLDKEMAEKGTAGLNSGNDQAAFNFLARSLFGVNPVETKLGTDGPTLIGKWVLLQL  245

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HPVL+LGLPK ++D +LHTFRLPP LVKKDYQRLY+FFY NS ++    E LG+S+EEAC
Sbjct  246   HPVLTLGLPKFLDDLILHTFRLPPFLVKKDYQRLYDFFYTNSASLFAEAEKLGISKEEAC  305

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNMLK I +AGV +HT+LA EIRS VK+ GGKITM+ ME+M
Sbjct  306   HNLLFATCFNSFGGMKIFFPNMLKSIAKAGVEVHTRLANEIRSEVKSAGGKITMSAMEKM  365

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ R++PPV +QYGRAK+D+ IESHDA F+VK+GEMLFG+QPFATKDPKIFD
Sbjct  366   PLMKSVVYEALRVDPPVASQYGRAKQDLKIESHDAVFEVKKGEMLFGYQPFATKDPKIFD  425

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R +EF+  RFVGE+G+ LLK+VLWSNG ETE+PTV +KQCAGKDFV++VSRL + E FLR
Sbjct  426   RPEEFVADRFVGEEGEKLLKYVLWSNGPETESPTVGNKQCAGKDFVVMVSRLFVTEFFLR  485

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRA  1337
             YD+F+++VG S LGAS+T+TSLK+A
Sbjct  486   YDTFNVDVGKSALGASITITSLKKA  510



>ref|XP_011031064.1| PREDICTED: allene oxide synthase, chloroplastic-like [Populus 
euphratica]
Length=526

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/447 (71%), Positives = 380/447 (85%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+ FF+ ++ KY STVFR NM PGPFI+ + +VV LLDGKSFP LFDV+ V
Sbjct  81    RMDYFYNQGRDNFFKSKVLKYGSTVFRANMGPGPFIAPNPQVVVLLDGKSFPILFDVTKV  140

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGGYRILSY+DPSEP HAKLK  MF+LL  RR H++PEF  +Y 
Sbjct  141   EKKDLFTGTYMPSTELTGGYRILSYLDPSEPMHAKLKKFMFYLLKSRRDHVIPEFKASYT  200

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F +LE +LA  GKA   AANDQAAFNFLAR+ +G +P +T L LD P L+ KWVLFNL
Sbjct  201   ELFTSLEKDLALKGKANFVAANDQAAFNFLARAWFGTEPAQTSLGLDGPGLVSKWVLFNL  260

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              PVLSLGLPK +ED  +H+FRLPPAL+KK+YQRLY+FFY +S+ +LD  E LG+SREEAC
Sbjct  261   GPVLSLGLPKYLEDLTIHSFRLPPALIKKNYQRLYDFFYASSSFLLDEAENLGISREEAC  320

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+F+TCFNSFGG+KI FPNM+KW+GRAG  LH QLA+EIRSVV++NGG +TM GMEQM
Sbjct  321   HNLLFSTCFNSFGGIKILFPNMMKWLGRAGTKLHAQLAEEIRSVVQSNGGNVTMRGMEQM  380

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RIEPPVP QYG+AKRD++IESHDA F+VKEGE+LFGFQPFATKDPKIF 
Sbjct  381   PLMKSAVYEALRIEPPVPLQYGKAKRDLIIESHDAAFEVKEGELLFGFQPFATKDPKIFT  440

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RF+GE G+ LLKHVLWSNG ETE PT+ +KQCAGKDFV+LV+RL +VELFLR
Sbjct  441   RAEEFVADRFIGE-GEELLKHVLWSNGPETEKPTLGNKQCAGKDFVVLVARLFVVELFLR  499

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG S LGA+VT+TSLKRA F
Sbjct  500   YDSFEIEVGKSSLGAAVTVTSLKRARF  526



>dbj|BAJ78216.1| allene oxide synthase [Lotus japonicus]
Length=528

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/447 (71%), Positives = 378/447 (85%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+EFF++RIQKYQSTVFRTN+PPGP I+ +  VV LLDGKSFPTLFD   V
Sbjct  82    RVDYFYNQGRDEFFKKRIQKYQSTVFRTNVPPGPLIAKNPNVVVLLDGKSFPTLFDTEKV  141

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +K DVFTGT+MPSTELTGGYR+LSY+DPSEP HA+LK LMFFLL  RR H++PEFH A+ 
Sbjct  142   DKTDVFTGTFMPSTELTGGYRVLSYLDPSEPKHAQLKRLMFFLLKSRREHVIPEFHIAFT  201

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F++LE EL+ NGK     ANDQAAFNFLARSL+G +P  T+L LD PKLI KW+LF L
Sbjct  202   ELFESLEKELSKNGKVSFGEANDQAAFNFLARSLFGANPAETELDLDGPKLIQKWILFQL  261

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              PVL LGLP  IED +L  FRLP +++KKDYQRLY FFY++S  I D  E LGVSREEAC
Sbjct  262   SPVLKLGLPSLIEDQILRNFRLPASIIKKDYQRLYNFFYQSSGFIFDEAERLGVSREEAC  321

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNS GGMK+FFPN+LKWIGR GV LH+ LA E+R+ V++ GGK+TMA ME M
Sbjct  322   HNLLFATCFNSLGGMKLFFPNVLKWIGRGGVKLHSDLATEVRTAVRSAGGKVTMAAMENM  381

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+FR++PPVP Q+GR ++D+VIESHD  F+VK+GEMLFG+QPFATKDPKIF+
Sbjct  382   PLMKSVVYEAFRVDPPVPLQFGRVRKDMVIESHDHAFRVKKGEMLFGYQPFATKDPKIFE  441

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RF+G +G+ LLKHVLWSNG ET  PTVNDKQCAGKDFV LVSRL++VELFLR
Sbjct  442   RAEEFVGDRFMGAEGEKLLKHVLWSNGPETATPTVNDKQCAGKDFVTLVSRLLVVELFLR  501

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+I+VG SPLG++VTLTSLKRA+F
Sbjct  502   YDSFEIQVGTSPLGSAVTLTSLKRASF  528



>ref|XP_002302453.1| allene oxide synthase family protein [Populus trichocarpa]
 gb|EEE81726.1| allene oxide synthase family protein [Populus trichocarpa]
Length=526

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/447 (71%), Positives = 378/447 (85%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+E+F+ +IQKYQSTVFR NMPPGPFI+ +  VV LLDGKSFP LFDV+ V
Sbjct  81    RMDYFYNQGRDEYFKSKIQKYQSTVFRANMPPGPFIAPNPHVVVLLDGKSFPVLFDVTKV  140

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPSTELTGGYR+LSY+DPSEP HAKLK LMF+LL  RR H++PEF+ +Y 
Sbjct  141   EKKDLFTGTFMPSTELTGGYRVLSYLDPSEPKHAKLKQLMFYLLKSRRDHVIPEFNASYT  200

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F +LE  LA  GKA    ANDQAAFNFLARS +G DP  T L LD P L+ KWVLFNL
Sbjct  201   ELFMSLEKNLALGGKASFGEANDQAAFNFLARSWFGTDPAETTLGLDGPGLVSKWVLFNL  260

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              PVL LGLPK +ED  +H+FRLPP+L+KK YQRLY+FFY +S  +LD  E LG+SREEAC
Sbjct  261   GPVLKLGLPKYLEDLTVHSFRLPPSLIKKSYQRLYDFFYASSGFLLDEAENLGISREEAC  320

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+F TCFNSFGGM+I FPNM+KW+GRAG  LH +LA+EIRSVV++N G ITM GME+M
Sbjct  321   HNLLFTTCFNSFGGMRILFPNMMKWLGRAGTKLHARLAEEIRSVVRSNDGSITMRGMEEM  380

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RIEPPV  Q+GRAKRD++IESHDA F+VKEGEMLFGFQPFATKDPKIF 
Sbjct  381   PLMKSVVYEALRIEPPVSLQFGRAKRDLIIESHDAAFEVKEGEMLFGFQPFATKDPKIFT  440

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             +A+EF+  RF+GE G+ +L+HVLWSNG ETE PT+ +KQCAGKDFV+LVSRL +VELFLR
Sbjct  441   QAEEFVADRFIGE-GEKMLEHVLWSNGPETEKPTLGNKQCAGKDFVVLVSRLFVVELFLR  499

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG SPLGA+VT+TSLKRA+F
Sbjct  500   YDSFEIEVGTSPLGAAVTVTSLKRASF  526



>ref|XP_008377365.1| PREDICTED: allene oxide synthase, chloroplastic-like [Malus domestica]
Length=550

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/445 (73%), Positives = 380/445 (85%), Gaps = 0/445 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+EFF+ RIQKYQSTVFR NMPPGP I+  SKVV LLDGKSFP LFDVS V
Sbjct  85    RLDYFYNQGRDEFFKSRIQKYQSTVFRVNMPPGPTITYKSKVVALLDGKSFPVLFDVSKV  144

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPS ELTGGYRILSY+DPSEP H KLK ++F+LL   R  ++PEFH++Y 
Sbjct  145   EKKDLFTGTYMPSVELTGGYRILSYLDPSEPKHDKLKRILFYLLKSSRDSVIPEFHSSYT  204

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLE  LA  GKA   AANDQAAFNFL RSLYG +P  T L +D PKL+ KWVLFNL
Sbjct  205   ELFETLEASLADKGKANFVAANDQAAFNFLTRSLYGANPADTPLGVDGPKLVSKWVLFNL  264

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L LGLPK IE+P++H+FRLPP L+KKDYQRLY+FFY++S  +LD  E LGVSR+EAC
Sbjct  265   GPLLILGLPKFIEEPIIHSFRLPPFLIKKDYQRLYDFFYQSSGHVLDEAERLGVSRDEAC  324

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMK  FPNM+KWIGRAGV LHT+LA+EIR+ V++N GKITM  MEQM
Sbjct  325   HNLLFATCFNSFGGMKFQFPNMIKWIGRAGVGLHTRLAEEIRTAVRSNDGKITMGAMEQM  384

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+FRIEPPV +Q+GRAK D+VIESHDA F+VKEGE+LFGFQPFATKDP+IF+
Sbjct  385   PLMKSVVYETFRIEPPVASQFGRAKTDLVIESHDAAFKVKEGELLFGFQPFATKDPRIFE  444

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA EF+P RFVG+ G+ LLKHVLWSNG ETE+PTV +KQCAGKDF +L SRL++VE FLR
Sbjct  445   RADEFVPDRFVGDDGEKLLKHVLWSNGPETESPTVGNKQCAGKDFSVLASRLLVVEFFLR  504

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRA  1337
             YDSF+IEV  SPLGA++T+TSLKRA
Sbjct  505   YDSFEIEVAPSPLGAAITVTSLKRA  529



>ref|XP_009365629.1| PREDICTED: allene oxide synthase, chloroplastic-like [Pyrus x 
bretschneideri]
Length=536

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/452 (74%), Positives = 390/452 (86%), Gaps = 5/452 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+EFF+ RIQKYQSTVFR NMPPGP I+  S+VV LLDGKSFP LFDVS V
Sbjct  85    RLDYFYNQGRDEFFKSRIQKYQSTVFRVNMPPGPTITYKSQVVALLDGKSFPVLFDVSKV  144

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPS ELTGGYRILSY+DPSEP H KLK ++F+LL   R  +LPEFH++Y 
Sbjct  145   EKKDLFTGTYMPSLELTGGYRILSYLDPSEPKHDKLKRVIFYLLKSSRDSVLPEFHSSYT  204

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FDTLE  LA  GKA   AANDQAAFNFLARSLY  +P  T L LD PKL+ KWVLFNL
Sbjct  205   ELFDTLETGLADKGKANFVAANDQAAFNFLARSLYQANPADTPLGLDGPKLVSKWVLFNL  264

Query  543   HPVLSLGLPKQIED-----PLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVS  707
              P+L LGLPK IE+     P++H+FRLPP L+KKDYQRLY+FFYE+S+ +LD  E LGVS
Sbjct  265   GPLLILGLPKFIEELFIEEPIIHSFRLPPFLIKKDYQRLYDFFYESSSHVLDEAERLGVS  324

Query  708   REEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMA  887
             R+EACHNL+FATCFNSFGGMKIFFPNM+KWIGRAGV LHT+LA EIR+VV++NGGKITM 
Sbjct  325   RDEACHNLLFATCFNSFGGMKIFFPNMIKWIGRAGVGLHTRLADEIRTVVRSNGGKITMG  384

Query  888   GMEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKD  1067
              MEQM LMKS VYE+FRIEPPVP QYGRAK+D+VIESHDA F+VK+GE+LFGFQPFATKD
Sbjct  385   AMEQMPLMKSVVYEAFRIEPPVPLQYGRAKKDLVIESHDAAFKVKKGELLFGFQPFATKD  444

Query  1068  PKIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLV  1247
             P+IF+RA EF+P RFVGE+G+ LLKHVLWSNG ETE+PTV +KQCAGKDFV+LVSRL++V
Sbjct  445   PRIFERADEFVPERFVGEEGEKLLKHVLWSNGPETESPTVGNKQCAGKDFVVLVSRLLVV  504

Query  1248  ELFLRYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             E FLRYDSF+IEV  SPLGA++T+TSLKRA+F
Sbjct  505   EFFLRYDSFEIEVAPSPLGAAITMTSLKRASF  536



>gb|ABD15175.1| allene oxide synthase 2 [Solanum tuberosum]
Length=510

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/445 (71%), Positives = 382/445 (86%), Gaps = 0/445 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG+ EFF  R+ KY+ST+FRTNMPPGPFISS+ KV+ LLDGKSFP LFDVS V
Sbjct  66    RLDYFYNQGKNEFFESRVVKYKSTIFRTNMPPGPFISSNPKVIVLLDGKSFPVLFDVSKV  125

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGGYR+LSY+DPSEPNH KLK LMFFLLS RR H++P+FH  Y 
Sbjct  126   EKKDLFTGTYMPSTELTGGYRVLSYLDPSEPNHEKLKKLMFFLLSSRRDHVIPKFHETYT  185

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TL+ E+A  G AGLN+ NDQAAFNFLARSL+GV+P+  KL  D P LIGKWVL  L
Sbjct  186   ELFETLDKEMAEKGTAGLNSGNDQAAFNFLARSLFGVNPVEAKLGTDGPTLIGKWVLLQL  245

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HPVL+LGLPK ++D +LHTFRLPP LVKKDYQRLY+FFY NS  +    E LG+S+EEAC
Sbjct  246   HPVLTLGLPKFLDDLILHTFRLPPFLVKKDYQRLYDFFYTNSANLFVEAEKLGISKEEAC  305

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNM+K I +AGV +HT+LA EIRS VK+ GGKITM+ ME+M
Sbjct  306   HNLLFATCFNSFGGMKIFFPNMMKSIAKAGVEVHTRLANEIRSEVKSAGGKITMSAMEKM  365

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ R++PPV +QYGRAK+D+ IESHDA F+VK+GEMLFG+QPFATKDPKIFD
Sbjct  366   PLMKSVVYEALRVDPPVASQYGRAKQDLKIESHDAVFEVKKGEMLFGYQPFATKDPKIFD  425

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R +E +  RFVGE+G+ LLK+VLWSNG ETE+PTV +KQCAGKDFV++VSRL +VE FLR
Sbjct  426   RPEELVADRFVGEEGEKLLKYVLWSNGPETESPTVGNKQCAGKDFVVMVSRLFVVEFFLR  485

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRA  1337
             YD+F+++VG S LGAS+T+TSLK+A
Sbjct  486   YDTFNVDVGTSALGASITITSLKKA  510



>ref|XP_008377370.1| PREDICTED: allene oxide synthase, chloroplastic-like [Malus domestica]
Length=531

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/447 (74%), Positives = 388/447 (87%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+EFF+ RIQKYQSTVFR NMPPGP I+  S+VV LLDGKSFP LFDVS V
Sbjct  85    RLDYFYNQGRDEFFKSRIQKYQSTVFRVNMPPGPTITYRSQVVALLDGKSFPVLFDVSKV  144

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPS ELTGGYRILSY+DPSEP H KLK ++F+LL   R  +LPEFH++Y 
Sbjct  145   EKKDIFTGTYMPSLELTGGYRILSYLDPSEPKHDKLKRVIFYLLKSSRDSVLPEFHSSYT  204

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLE  LA  GKA   AANDQAAFNFLARSL+  +P  T L LD PKL+ KWVLFNL
Sbjct  205   ELFETLETALADKGKANFVAANDQAAFNFLARSLHQANPADTPLGLDGPKLVSKWVLFNL  264

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L LGLPK IE+P++H+FRLPP L+KKDYQRLY+FFYE+S  +LD  E LGVSR+EAC
Sbjct  265   GPLLILGLPKFIEEPVIHSFRLPPFLIKKDYQRLYDFFYESSGHVLDEAERLGVSRDEAC  324

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNM+KWIGRAGV LHT+LA EIR+VV++NGGKITM  MEQM
Sbjct  325   HNLLFATCFNSFGGMKIFFPNMIKWIGRAGVGLHTRLADEIRTVVRSNGGKITMGAMEQM  384

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+FRIEPPVP QYG+AK+D+VIESHDA F+VK+GE LFGFQPFATKDP+IF+
Sbjct  385   PLMKSVVYEAFRIEPPVPLQYGKAKKDLVIESHDAAFKVKKGEFLFGFQPFATKDPRIFE  444

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA EF+P RFVGE+G+ LLKHVLWSNG ETE+PTV +KQCAGKDFV+LVSRL++VE FLR
Sbjct  445   RADEFVPERFVGEEGEKLLKHVLWSNGPETESPTVGNKQCAGKDFVVLVSRLLVVEFFLR  504

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEV  SPLGA++T+TSLKRA+F
Sbjct  505   YDSFEIEVAPSPLGAAITMTSLKRASF  531



>ref|XP_008364980.1| PREDICTED: allene oxide synthase, chloroplastic-like [Malus domestica]
Length=531

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/447 (74%), Positives = 388/447 (87%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+EFF+ RIQKYQSTVFR NMPPGP I+  S+VV LLDGKSFP LFDVS V
Sbjct  85    RLDYFYNQGRDEFFKSRIQKYQSTVFRVNMPPGPTITYRSQVVALLDGKSFPVLFDVSKV  144

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPS ELTGGYRILSY+DPSEP H KLK ++F+LL   R  +LP+FH++Y 
Sbjct  145   EKKDIFTGTYMPSLELTGGYRILSYLDPSEPKHDKLKRVIFYLLKSSRDSVLPZFHSSYT  204

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLE  LA  GKA   AANDQAAFNFLARSL+  +P  T L LD PKL+ KWVLFNL
Sbjct  205   ELFETLETALADKGKANFVAANDQAAFNFLARSLHQANPADTPLGLDGPKLVSKWVLFNL  264

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L LGLPK IE+P++H+FRLPP L+KKDYQRLY+FFYE+S  +LD  E LGVSR+EAC
Sbjct  265   GPLLILGLPKFIEEPVIHSFRLPPFLIKKDYQRLYDFFYESSGHVLDEAERLGVSRDEAC  324

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNM+KWIGRAGV LHT+LA EIR+VV++NGGKITM  MEQM
Sbjct  325   HNLLFATCFNSFGGMKIFFPNMIKWIGRAGVGLHTRLADEIRTVVRSNGGKITMGAMEQM  384

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+FRIEPPVP QYG+AK+D+VIESHDA F+VK+GE LFGFQPFATKDP+IF+
Sbjct  385   PLMKSVVYEAFRIEPPVPLQYGKAKKDLVIESHDAAFKVKKGEXLFGFQPFATKDPRIFE  444

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA EF+P RFVGE+G+ LLKHVLWSNG ETE+PTV +KQCAGKDFV+LVSRL++VE FLR
Sbjct  445   RADEFVPERFVGEEGEKLLKHVLWSNGPETESPTVGNKQCAGKDFVVLVSRLLVVEFFLR  504

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEV  SPLGA++T+TSLKRA+F
Sbjct  505   YDSFEIEVAPSPLGAAITMTSLKRASF  531



>gb|EYU45088.1| hypothetical protein MIMGU_mgv1a004427mg [Erythranthe guttata]
Length=527

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/447 (72%), Positives = 376/447 (84%), Gaps = 2/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR+EFFR RIQKY STVFRTNMPPGPFIS +  VV LLDG+SFP LFD   V
Sbjct  83    RQDYFYNQGRDEFFRSRIQKYSSTVFRTNMPPGPFISFNPNVVALLDGRSFPALFDTDKV  142

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPS +LTGGYR+LSY+DPSEPNHAKLK LMFFLLSHRR H++PEFH +Y+
Sbjct  143   EKKDLFTGTYMPSVDLTGGYRMLSYLDPSEPNHAKLKKLMFFLLSHRRQHVIPEFHVSYS  202

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+ LE+ELA  G A LNAAN+QAAFNFLARS +G  P  + L  D PKLI KWVLF L
Sbjct  203   ELFENLESELATKGSAALNAANEQAAFNFLARSFFGASPNDSGLGSDGPKLINKWVLFQL  262

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L LGLP+ +ED +LHTF LP  LVKKDY+RLY+FFY++S+ ILDH E LG+SR+EAC
Sbjct  263   HPLLKLGLPRPVEDGILHTFSLPAFLVKKDYRRLYDFFYQSSSPILDHAETLGISRDEAC  322

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HN++F TCFNSFGGMKIFFPNMLKW+ RAG  LH  LA+EIRS   A G  +TMA ME+M
Sbjct  323   HNILFTTCFNSFGGMKIFFPNMLKWVARAGAKLHHDLAREIRSA--AGGAAVTMAAMEKM  380

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYES RIEPPV +QYG+AKRD VIESHD  FQ+KEG+ML+G+QPFATKD +IFD
Sbjct  381   PLMKSVVYESLRIEPPVSSQYGKAKRDFVIESHDGAFQIKEGDMLYGYQPFATKDSRIFD  440

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA EF+P RFVGE+G+ +LKHVLWSNG E+  P+VN+KQCAGKDFV+L SRL+LVELF R
Sbjct  441   RADEFVPDRFVGEEGEEMLKHVLWSNGPESGAPSVNNKQCAGKDFVVLASRLLLVELFRR  500

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEV  SPLGA+VT+TSLKRA+F
Sbjct  501   YDSFDIEVAASPLGAAVTVTSLKRASF  527



>emb|CAD29736.2| allene oxide synthase [Solanum tuberosum]
Length=509

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/445 (72%), Positives = 383/445 (86%), Gaps = 1/445 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG++EFF  R+ KY+ST+FRTNMPPGPFISS+ KV+ LLDGKSFP LFDVS V
Sbjct  66    RLDYFYNQGKDEFFESRVVKYKSTIFRTNMPPGPFISSNPKVIVLLDGKSFPVLFDVSKV  125

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGGYR+LSY+DPSEPNH KLK LMFFLLS RR H++P+FH  Y 
Sbjct  126   EKKDLFTGTYMPSTELTGGYRVLSYLDPSEPNHEKLKKLMFFLLSSRRDHVIPKFHETYT  185

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E F+TL+ E+A  G AGLN+ NDQAAFNFLARSL+GV+P+ TKL  D P LIGKWVL  L
Sbjct  186   EFFETLDKEMAEKGTAGLNSGNDQAAFNFLARSLFGVNPVETKLGTDGPTLIGKWVLLQL  245

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HPVL+LGLPK ++D +LHTFRLPP LVKKDYQRLY+FFY NS ++    E LG+S+EEAC
Sbjct  246   HPVLTLGLPKFLDDLILHTFRLPPFLVKKDYQRLYDFFYTNSASLFAEAEKLGISKEEAC  305

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNMLK I +AGV +HT+LA EIRS VK+ GGKITM+ ME+M
Sbjct  306   HNLLFATCFNSFGGMKIFFPNMLKSIAKAGVEVHTRLANEIRSEVKSAGGKITMSAMEKM  365

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ R++PPV +QYGRAK+D+ IESHDA F+VK+GEMLFG+QPFATKDPKIFD
Sbjct  366   PLMKSVVYEALRVDPPVASQYGRAKQDLKIESHDAVFEVKKGEMLFGYQPFATKDPKIFD  425

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R +EF+  RFVGE G+ LLK+VLWSNG ETE+PTV +KQCAGKDFV++VSRL + E FLR
Sbjct  426   RPEEFVADRFVGE-GEKLLKYVLWSNGPETESPTVGNKQCAGKDFVVMVSRLFVTEFFLR  484

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRA  1337
             YD+F+++VG S LGAS+T+TSLK+A
Sbjct  485   YDTFNVDVGKSALGASITITSLKKA  509



>gb|ABD15173.1| allene oxide synthase 2 [Solanum tuberosum]
Length=509

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/445 (72%), Positives = 383/445 (86%), Gaps = 1/445 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG++EFF  R+ KY+ST+FRTNMPPGPFISS+ KV+ LLDGKSFP LFDVS V
Sbjct  66    RLDYFYNQGKDEFFESRVVKYKSTIFRTNMPPGPFISSNPKVIVLLDGKSFPVLFDVSKV  125

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGGYR+LSY+DPSEPNH KLK LMFFLLS RR H++P+FH  Y 
Sbjct  126   EKKDLFTGTYMPSTELTGGYRVLSYLDPSEPNHEKLKKLMFFLLSSRRDHVIPKFHETYT  185

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E F+TL+ E+A  G AGLN+ NDQAAFNFLARSL+GV+P+ TKL  D P LIGKWVL  L
Sbjct  186   EFFETLDKEMAEKGTAGLNSGNDQAAFNFLARSLFGVNPVETKLGTDGPTLIGKWVLLQL  245

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HPVL+LGLPK ++D +LHTFRLPP LVKKDYQRLY+FFY NS ++    E LG+S+EEAC
Sbjct  246   HPVLTLGLPKFLDDLILHTFRLPPFLVKKDYQRLYDFFYTNSASLFAEAEKLGISKEEAC  305

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNMLK I +AGV +HT+LA EIRS VK+ GGKITM+ ME+M
Sbjct  306   HNLLFATCFNSFGGMKIFFPNMLKSIAKAGVEVHTRLANEIRSEVKSAGGKITMSAMEKM  365

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ R++PPV +QYGRAK+D+ IESHDA F+VK+GEMLFG+QPFATKDPKIFD
Sbjct  366   PLMKSVVYEALRVDPPVASQYGRAKQDLKIESHDAVFEVKKGEMLFGYQPFATKDPKIFD  425

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R +EF+  RFVGE G+ LLK+VLWSNG ETE+PTV +KQCAGKDFV++VSRL + E FLR
Sbjct  426   RPEEFVADRFVGE-GEKLLKYVLWSNGPETESPTVGNKQCAGKDFVVMVSRLFVTEFFLR  484

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRA  1337
             YD+F+++VG S LGAS+T+TSLK+A
Sbjct  485   YDTFNVDVGKSALGASITITSLKKA  509



>gb|ABD15176.1| allene oxide synthase 2 [Solanum tuberosum]
Length=510

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/445 (71%), Positives = 382/445 (86%), Gaps = 0/445 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG+ EFF  R+ KY+ST+FRTNMPPGPFISS+ KV+ LLDGKSFP LFDVS V
Sbjct  66    RLDYFYNQGKNEFFESRVVKYKSTIFRTNMPPGPFISSNPKVIVLLDGKSFPVLFDVSKV  125

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGGYR+LSY+DPSEPNH KLK LMFFLLS RR H++P+FH  Y 
Sbjct  126   EKKDLFTGTYMPSTELTGGYRVLSYLDPSEPNHEKLKKLMFFLLSSRRDHVIPKFHETYT  185

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E F+TL+ E+A  GKAGLN+ NDQAAFNFLARSL+GV+P+ TKL +D P LIGKWVL  L
Sbjct  186   EFFETLDKEMAEKGKAGLNSGNDQAAFNFLARSLFGVNPVETKLGIDGPTLIGKWVLLQL  245

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HPVL+LGLPK ++D +LH FRLPP LVKKDYQRLY+FFY NS  +    E LG+S+EEAC
Sbjct  246   HPVLTLGLPKFLDDLILHAFRLPPLLVKKDYQRLYDFFYTNSANLFVEAEKLGISKEEAC  305

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNM+K I +AGV +HT+LA EIRS VK+ GGKITM+ ME+M
Sbjct  306   HNLLFATCFNSFGGMKIFFPNMMKSIAKAGVEVHTRLANEIRSEVKSAGGKITMSAMEKM  365

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ R++PPV +QYGRAK+D+ IESHDA F+VK+GEMLFG+QPFATKDPK FD
Sbjct  366   PLMKSVVYEALRVDPPVASQYGRAKQDLKIESHDAVFEVKKGEMLFGYQPFATKDPKFFD  425

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R +EF+  RFVGE+G+ LLK+VLWSNG ETE+PTV +KQCAGKDFV++VSRL + E FLR
Sbjct  426   RPEEFVADRFVGEEGEKLLKYVLWSNGPETESPTVGNKQCAGKDFVVMVSRLFVTEFFLR  485

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRA  1337
             YD+F+++VG S LGAS+T+TSLK+A
Sbjct  486   YDTFNVDVGTSALGASITITSLKKA  510



>gb|ABD15172.1| allene oxide synthase 2 [Solanum tuberosum]
Length=510

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/445 (72%), Positives = 383/445 (86%), Gaps = 0/445 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG+ EFF  R+ KY+ST+FRTNMPPGPFISS+ KV+ LLDGKSFP LFDVS V
Sbjct  66    RLDYFYNQGKNEFFESRVVKYKSTIFRTNMPPGPFISSNPKVIVLLDGKSFPVLFDVSKV  125

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGG+R+LSY+DPSEPNH KLK LMFFLLS RR H++P+FH  Y 
Sbjct  126   EKKDLFTGTYMPSTELTGGFRVLSYLDPSEPNHEKLKKLMFFLLSSRRDHVIPKFHETYT  185

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E F+TL+ E+A  GKAGLN+ NDQAAFNFLARSL+GV+P+ TKL  D P LIGKWVL  L
Sbjct  186   EFFETLDKEMAEKGKAGLNSGNDQAAFNFLARSLFGVNPVETKLGGDGPTLIGKWVLLQL  245

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HPVL+LGLPK ++D +LHTFRLPP LVKKDYQRLY+FFY NS  +    E LG+S+EEAC
Sbjct  246   HPVLTLGLPKFLDDLILHTFRLPPFLVKKDYQRLYDFFYTNSANLFVEAEKLGISKEEAC  305

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNM+K I +AGV +HT+LA EIRS VK+ GGKITM+ ME+M
Sbjct  306   HNLLFATCFNSFGGMKIFFPNMMKSIAKAGVEVHTRLANEIRSEVKSAGGKITMSAMEKM  365

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ R++PPV +QYGRAK+D+ IESHDA F+VK+GEMLFG+QPFATKDPKIFD
Sbjct  366   PLMKSVVYEALRVDPPVASQYGRAKQDLTIESHDAVFEVKKGEMLFGYQPFATKDPKIFD  425

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R +EF+  RFVGE+G+ LLK+VLWSNG ETE+PTV +KQCAGKDFV++VSRL + E FLR
Sbjct  426   RPEEFVADRFVGEEGEKLLKYVLWSNGPETESPTVGNKQCAGKDFVVMVSRLFVTEFFLR  485

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRA  1337
             YD+F+++VG S LGAS+T+TSLK+A
Sbjct  486   YDTFNVDVGTSALGASITITSLKKA  510



>gb|ABD15174.1| allene oxide synthase 2 [Solanum tuberosum]
Length=509

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/445 (72%), Positives = 383/445 (86%), Gaps = 1/445 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG++EFF  R+ KY+ST+FRTNMPPGPFISS+ KV+ LLDGKSFP LFDVS V
Sbjct  66    RLDYFYNQGKDEFFESRVVKYKSTIFRTNMPPGPFISSNPKVIVLLDGKSFPVLFDVSKV  125

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGGYR+LSY+DPSEPNH KLK LMFFLLS RR H++P+FH  Y 
Sbjct  126   EKKDLFTGTYMPSTELTGGYRVLSYLDPSEPNHEKLKKLMFFLLSSRRDHVIPKFHETYT  185

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E F+TL+ E+A  G AGLN+ NDQAAFNFLARSL+GV+P+ TKL  D P LIGKWVL  L
Sbjct  186   EFFETLDKEMADKGTAGLNSGNDQAAFNFLARSLFGVNPVETKLGTDGPTLIGKWVLLQL  245

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HPVL+LGLPK ++D +LHTFRLPP LVKKDYQRLY+FFY NS ++    E LG+S+EEAC
Sbjct  246   HPVLTLGLPKVLDDLILHTFRLPPFLVKKDYQRLYDFFYTNSASLFAEAEKLGISKEEAC  305

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNMLK I +AGV +HT+LA EIRS VK+ GGK+TM+ ME+M
Sbjct  306   HNLLFATCFNSFGGMKIFFPNMLKSIAKAGVEVHTRLANEIRSEVKSAGGKMTMSAMEKM  365

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ R++PPV +QYGRAK+D+ IESHDA F+VK+GEMLFG+QPFATKDPKIFD
Sbjct  366   PLMKSVVYEALRVDPPVASQYGRAKQDLKIESHDAVFEVKKGEMLFGYQPFATKDPKIFD  425

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R +EF+  RFVGE G+ LLK+VLWSNG ETE+PTV +KQCAGKDFV++VSRL + E FLR
Sbjct  426   RPEEFVADRFVGE-GEKLLKYVLWSNGPETESPTVGNKQCAGKDFVVMVSRLFVTEFFLR  484

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRA  1337
             YD+F+++VG S LGAS+T+TSLK+A
Sbjct  485   YDTFNVDVGKSALGASITITSLKKA  509



>ref|XP_007017426.1| Allene oxide synthase [Theobroma cacao]
 gb|EOY14651.1| Allene oxide synthase [Theobroma cacao]
Length=531

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/447 (73%), Positives = 385/447 (86%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+EFF+ RIQKYQSTVFRTNMPPGPFI+ + KVV LLDGKSFP LFDV+ V
Sbjct  85    RLDYFYNQGRDEFFKSRIQKYQSTVFRTNMPPGPFIAPNPKVVALLDGKSFPVLFDVNKV  144

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPST+LTGGYRILSY+DP+EP HAKLK L+FFLL  RR  ++PEF   Y 
Sbjct  145   EKKDLFTGTYMPSTDLTGGYRILSYLDPAEPEHAKLKQLLFFLLKSRRDKVIPEFEACYT  204

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLE ELA  GK+    ANDQA FNFLAR+L+G +P  TKL  D P LI KWVLF +
Sbjct  205   ELFETLEKELAEKGKSSFQTANDQAGFNFLARALFGSNPPDTKLGADGPSLIRKWVLFQV  264

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              PVLSLGLPK +E+ L+H+FRLPP+LVKKDYQRLYEFFYE+S  +LD  E LG+SREEAC
Sbjct  265   GPVLSLGLPKYVEELLIHSFRLPPSLVKKDYQRLYEFFYESSGFVLDEAEKLGISREEAC  324

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNS GGM IFFPNMLKWI RAGV LHT+LA+EIRS +++NGGK+TMA MEQM
Sbjct  325   HNLLFATCFNSLGGMNIFFPNMLKWIARAGVKLHTELAQEIRSAIRSNGGKLTMAAMEQM  384

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE  RIEPPVP Q+G+AK+D++IESHDA F+VK+GEMLFGFQPFATKDPKIF+
Sbjct  385   PLMKSVVYEGLRIEPPVPLQFGKAKKDLLIESHDAVFEVKKGEMLFGFQPFATKDPKIFE  444

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R++EF+P RFVG+ G+ LLKHVLWSNG ETENPT+ +KQCAGKDFV+LVSRL++V LF R
Sbjct  445   RSEEFVPDRFVGDDGEKLLKHVLWSNGPETENPTLGNKQCAGKDFVVLVSRLLVVNLFRR  504

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+I VG SPLGA+VT+TSLKRA+F
Sbjct  505   YDSFEIVVGKSPLGAAVTVTSLKRASF  531



>gb|AAN37417.1| allene oxide synthase [Solanum tuberosum]
Length=507

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/445 (71%), Positives = 382/445 (86%), Gaps = 0/445 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG++EFF  R  KY+ST+FRTNMPPGPFISS+ KV+ LLDGKSFP LFDVS V
Sbjct  63    RLDYFYNQGKDEFFESREVKYKSTIFRTNMPPGPFISSNPKVIVLLDGKSFPVLFDVSKV  122

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGGYR+LSY+DPSEPNH KLK LMFFLLS RR H++P+FH  Y 
Sbjct  123   EKKDLFTGTYMPSTELTGGYRVLSYLDPSEPNHEKLKKLMFFLLSSRRDHVIPKFHETYT  182

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E F+TL+ E+A  G AGLN+ NDQAAFNFLARSL+GV+P+ TKL  D P LIGKWVL  L
Sbjct  183   EFFETLDKEMAEKGTAGLNSGNDQAAFNFLARSLFGVNPVETKLGTDGPTLIGKWVLLQL  242

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HPVL+LGLPK ++D +LHTFRLPP LVKKDYQRLY+FFY NS ++    E LG+S+EEAC
Sbjct  243   HPVLTLGLPKFLDDLILHTFRLPPFLVKKDYQRLYDFFYTNSASLFAEAEKLGISKEEAC  302

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNMLK I +AGV +HT+LA EIRS VK+ GGKITM+ ME+M
Sbjct  303   HNLLFATCFNSFGGMKIFFPNMLKSIAKAGVEVHTRLANEIRSEVKSAGGKITMSAMEKM  362

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ R++PPV +QYGRAK+D+ IESHDA F+VK+GEMLFG+QPFATKDPKIFD
Sbjct  363   PLMKSVVYEALRVDPPVASQYGRAKQDLKIESHDAVFEVKKGEMLFGYQPFATKDPKIFD  422

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R +EF+  RFVGE+G+ LLK+VLWSNG ETE+PTV +KQCAG+DFV++VSRL + E FLR
Sbjct  423   RPEEFVADRFVGEEGEKLLKYVLWSNGPETESPTVGNKQCAGRDFVVMVSRLFVTEFFLR  482

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRA  1337
             YD+F+++V  S LGAS+T+TSLK+A
Sbjct  483   YDTFNVDVDKSALGASITITSLKKA  507



>gb|AAY27751.1| allene oxide synthase [Hevea brasiliensis]
Length=524

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/447 (69%), Positives = 382/447 (85%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY QG+EE+F+ R QKYQSTVFR NMPPGPFISS+  VV +LDGKSF  LFDV+ V
Sbjct  79    RLDYFYKQGKEEYFKSRAQKYQSTVFRANMPPGPFISSNPHVVVVLDGKSFSVLFDVTKV  138

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPSTELTGGYRILSY+DPSEP H +LKN +F+LL  RR H++PEF + Y 
Sbjct  139   EKKDLFTGTFMPSTELTGGYRILSYLDPSEPKHTQLKNFLFYLLKSRRDHVIPEFSSTYT  198

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +F++LEN+LA  GK   N   +QAAF+FL RS +GV+P+ TK+  D P LI KWVLF L
Sbjct  199   GLFESLENDLASKGKVNFNNPGEQAAFSFLGRSYFGVNPVDTKIGTDGPTLIAKWVLFQL  258

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L+LGLP  +E+P +HTFRLP  LVKKDY+RLY++FY ++ ++LD  E +G+SREEAC
Sbjct  259   APILTLGLPAFLEEPTIHTFRLPAFLVKKDYKRLYDYFYSSAGSLLDEAEKMGISREEAC  318

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HN++FATCFN+FGG+KIFFPN+LKWIGRAGV LHTQLA+EIRSV+K+NGG+ITMA +EQM
Sbjct  319   HNILFATCFNTFGGLKIFFPNILKWIGRAGVKLHTQLAQEIRSVIKSNGGEITMAALEQM  378

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+FRIEPPVP QYG+AKRD++IESHDA ++VKEGEM+FG+QPFATKDPKIFD
Sbjct  379   PLMKSAVYEAFRIEPPVPAQYGKAKRDLIIESHDAAYEVKEGEMIFGYQPFATKDPKIFD  438

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
                E++P RFVGE G+ LL+HVLWSNG ET++PT+ +KQCAGKDFV+L+SRL +VELF R
Sbjct  439   TPDEYVPDRFVGE-GEKLLQHVLWSNGPETDHPTMGNKQCAGKDFVVLISRLFVVELFRR  497

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG SPLG+S+T+TSLKRA+F
Sbjct  498   YDSFEIEVGSSPLGSSITITSLKRASF  524



>gb|ACU30142.1| allene oxide synthase [Camellia sinensis]
Length=523

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/447 (70%), Positives = 380/447 (85%), Gaps = 5/447 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG  EFF+ R +KY STVFR N+PPGPFISS+  VV LLDGKSFP LFDV+ V
Sbjct  82    RLDYFYNQGTVEFFKSRSEKYHSTVFRANIPPGPFISSNPNVVVLLDGKSFPVLFDVTKV  141

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MP+TELTGGYR+LSY+DPSEP HAKLK LMFFLL   R  ++PEFH+++ 
Sbjct  142   EKKDLFTGTFMPATELTGGYRVLSYLDPSEPKHAKLKQLMFFLLKSGRDKVIPEFHSSFT  201

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F+TLE ELA  GKA  + ANDQA+FNFLARS +G +P  TKL LD P LI  W+ F L
Sbjct  202   DLFETLEAELASKGKAAFSDANDQASFNFLARSPFGTNPADTKLGLDGPNLIAIWIFFQL  261

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+++LGLPK +E+ L+HTF LPP L+KKDYQRLY+FFY + T+ILD  E +G+SREEAC
Sbjct  262   APLITLGLPKLVEELLIHTFPLPPVLIKKDYQRLYDFFYNSPTSILDEAEKIGLSREEAC  321

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFP+M+KWIG AGV LHTQLA+EIRS V++NGGK+TMAGMEQM
Sbjct  322   HNLLFATCFNSFGGMKIFFPSMIKWIGHAGVKLHTQLAEEIRSAVRSNGGKVTMAGMEQM  381

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYES RI+PPVP+QYGRAKRD+VI SHDA F+VKEGEMLFG+QPFATKDPKIF+
Sbjct  382   PLMKSVVYESLRIDPPVPSQYGRAKRDMVIGSHDAAFEVKEGEMLFGYQPFATKDPKIFE  441

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R +EF+  RFVGE+G+ +L+HVLWSNG ETE+ TV +KQCAGKDFV++VSRL+LVELFLR
Sbjct  442   RPEEFVADRFVGEEGEKMLRHVLWSNGPETESTTVGNKQCAGKDFVVMVSRLLLVELFLR  501

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+ EV     G+SVT+TS+KRA+F
Sbjct  502   YDSFETEV-----GSSVTITSVKRASF  523



>gb|KDP38443.1| hypothetical protein JCGZ_04368 [Jatropha curcas]
Length=526

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/447 (68%), Positives = 381/447 (85%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQG+EEFF+ R QKYQSTVFR NMPPGPFI+S+ +VV +LDGKSFP LFDV+ V
Sbjct  81    RQDYFYNQGKEEFFKSRAQKYQSTVFRVNMPPGPFIASNPRVVVVLDGKSFPVLFDVTKV  140

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPST+LTGGYRILSY+DPSE  H +LKNL+F+LL  RR +++PEF + Y 
Sbjct  141   EKKDLFTGTFMPSTDLTGGYRILSYLDPSETKHTQLKNLLFYLLKSRRDYVIPEFSSTYN  200

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++FD LE +LA  GK   N   ++AAF+FL R  +GVDP+ TK+  D P LI KWVLF L
Sbjct  201   KLFDGLEKDLASKGKIAFNDPGEEAAFSFLGRCYFGVDPVDTKVGTDGPSLIAKWVLFQL  260

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L+LGLP  +E+PL+HTFRLP  L+KKDYQ+LY++FY ++ ++L+  E +G+S++EAC
Sbjct  261   APILTLGLPAFLEEPLIHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEEAEKMGISKDEAC  320

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HN++FATCFN+FGGMKIFFPN+LKWIGRAGV LHTQLA+EIRSV+K+NGGKITMA +EQM
Sbjct  321   HNILFATCFNTFGGMKIFFPNILKWIGRAGVKLHTQLAEEIRSVLKSNGGKITMAALEQM  380

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+FRIEPPVP QYG+AKRD++IESHDA F+VK+GEM+FGFQPFATKDPKIFD
Sbjct  381   PLMKSAVYEAFRIEPPVPAQYGKAKRDLIIESHDAAFEVKKGEMIFGFQPFATKDPKIFD  440

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R +E++P RF+GE G+ LL+HVLWSNG ETE PTV +KQCAGKDFV+ +SRL +VELF R
Sbjct  441   RPEEYVPDRFIGE-GEKLLQHVLWSNGPETEQPTVGNKQCAGKDFVVFISRLFVVELFRR  499

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEV  S LG+S+T+TSLKRA+F
Sbjct  500   YDSFEIEVSSSTLGSSITITSLKRASF  526



>ref|XP_011017270.1| PREDICTED: allene oxide synthase, chloroplastic [Populus euphratica]
Length=526

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/447 (70%), Positives = 378/447 (85%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+E+F+ +I+KY+STVFR NMPPGPFI+ +  VV LLDGKSFP LFDV+ V
Sbjct  81    RMDYFYNQGRDEYFKSKIKKYRSTVFRANMPPGPFIAPNPHVVVLLDGKSFPVLFDVTKV  140

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPSTELTGGYR+LSY+DPSEP HAKLK LMF+LL  RR H++PEF+ +Y 
Sbjct  141   EKKDLFTGTFMPSTELTGGYRVLSYLDPSEPKHAKLKQLMFYLLKSRRDHVIPEFNASYT  200

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F +LE  LA  GKA    ANDQAAFNFLARS +G DP  T L LD P L+ KWVLFNL
Sbjct  201   ELFMSLEKNLALGGKASFGEANDQAAFNFLARSWFGTDPAETTLGLDGPGLVAKWVLFNL  260

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              PVL LGLPK +ED  +H+FRLPP+L+KK YQRLY+FFY +S  +LD  E LG+SREEAC
Sbjct  261   GPVLKLGLPKYLEDLTVHSFRLPPSLIKKSYQRLYDFFYASSGFLLDEAENLGISREEAC  320

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+F TCFNSFGGM+I FPNM+KW+GRAG  L ++LA+EIRSVV++N G ITM GME+M
Sbjct  321   HNLLFTTCFNSFGGMRILFPNMMKWLGRAGTKLQSRLAEEIRSVVRSNDGSITMRGMEEM  380

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RIEPPV  Q+GRAKRD++IESHDA F+VK+GEMLFGFQPFATKDPKIF 
Sbjct  381   PLMKSVVYEALRIEPPVSLQFGRAKRDLIIESHDAAFEVKQGEMLFGFQPFATKDPKIFT  440

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             +A+EF+  RF+GE G+ +L+HVLWSNG ETE PT+ +KQCAGKDFV+LVSRL +VELFLR
Sbjct  441   QAEEFVADRFIGE-GEKMLEHVLWSNGPETEKPTLENKQCAGKDFVVLVSRLFVVELFLR  499

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG SPLGA+VT+TSLKRA+F
Sbjct  500   YDSFEIEVGTSPLGAAVTVTSLKRASF  526



>ref|XP_004499109.1| PREDICTED: allene oxide synthase, chloroplastic-like [Cicer arietinum]
Length=523

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/447 (69%), Positives = 379/447 (85%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+++F+ RIQKYQST+FRTN+PPGP I+ +  VV LLD KSFP LFDV+ +
Sbjct  77    RLDYFYNQGRDDYFKSRIQKYQSTIFRTNVPPGPLIAQNPNVVVLLDAKSFPILFDVTKI  136

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +K DVFTGTY PSTELTGGYR+LSY+DPSEP H +LKNLMFF L  R  H++PEF + Y 
Sbjct  137   DKTDVFTGTYTPSTELTGGYRVLSYLDPSEPKHEQLKNLMFFQLKSRSRHVIPEFRSCYK  196

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+ LE EL   GKA    ANDQAAFNFL RSLYGV+P+ T+L LD PK+I KWVLF L
Sbjct  197   ELFNALEKELGEKGKASFAEANDQAAFNFLTRSLYGVNPIETQLGLDGPKMIQKWVLFQL  256

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              PVL LGLPK +ED ++H FRLPP+L+KK+YQRLY+FFYE+S  +LD    LGVSREEAC
Sbjct  257   GPVLKLGLPKFLEDTMIHNFRLPPSLIKKEYQRLYDFFYESSGFVLDEAVRLGVSREEAC  316

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGG+K+FFPN++KWIGR GVSLH +LAKEIRS V++ GG+ITMA ME M
Sbjct  317   HNLLFATCFNSFGGIKLFFPNVMKWIGRGGVSLHMKLAKEIRSAVRSAGGEITMAAMENM  376

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+FRI+PPVP Q+GR K+D+VIE+H+  F VK+GE+LFG+QPFATKDPKIF+
Sbjct  377   PLMKSVVYEAFRIDPPVPLQFGRVKKDMVIENHENGFLVKKGELLFGYQPFATKDPKIFN  436

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RFVGE+G+ LLK+V+WSNG ETE+P+  +KQCAGKDFV LVSRL++VELF+R
Sbjct  437   RAEEFVGDRFVGEEGEKLLKYVVWSNGPETESPSAGNKQCAGKDFVTLVSRLLVVELFMR  496

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+I+VG SPLGAS+TLTSLKR++F
Sbjct  497   YDSFEIQVGTSPLGASITLTSLKRSSF  523



>ref|XP_010060886.1| PREDICTED: allene oxide synthase [Eucalyptus grandis]
 gb|KCW67773.1| hypothetical protein EUGRSUZ_F01505 [Eucalyptus grandis]
Length=540

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/447 (72%), Positives = 388/447 (87%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR+EFF+ R+QKY STV+R N+PPGPFIS + +VV LLDGKSFP LFDV+ V
Sbjct  94    RQDYFYNQGRDEFFKSRVQKYGSTVYRANLPPGPFISQNPRVVVLLDGKSFPVLFDVTKV  153

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRD+FTGT+MPSTELTGGYR+LSY+DPSEP HAKLK LMFFLL  RR H++P FH ++ 
Sbjct  154   EKRDLFTGTFMPSTELTGGYRVLSYLDPSEPAHAKLKKLMFFLLKSRRDHVIPAFHASFT  213

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLE +LA  GKAG   +NDQAAFNFLARSLYGV+P  TKL LD PKL+GKWV+F +
Sbjct  214   ELFETLEADLAAKGKAGFGDSNDQAAFNFLARSLYGVNPADTKLGLDGPKLVGKWVVFQI  273

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L LGLPK +ED ++HTFRLP +LVK+DY+RLY+FF+ +S  +LD  E +G+SREEAC
Sbjct  274   GPILVLGLPKLVEDLVIHTFRLPASLVKEDYKRLYDFFHSSSGPVLDEAERMGISREEAC  333

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNM+KWIGRAG  LHT LA+EIRS V+  GGK+TMA ME+M
Sbjct  334   HNLLFATCFNSFGGMKIFFPNMIKWIGRAGGKLHTDLAREIRSAVRDAGGKVTMAAMERM  393

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RI+PPVP QYG+AKRD+VIESHDA ++VKEGEM+FG+QPFATKDP+IF+
Sbjct  394   PLMKSAVYEALRIDPPVPQQYGKAKRDLVIESHDAAYEVKEGEMIFGYQPFATKDPRIFE  453

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RFVGE G+ALL+HVLWSNG ETE+PT+ +KQCAGKDFV+LVSRL+LVELFLR
Sbjct  454   RAEEFVADRFVGEDGEALLRHVLWSNGPETESPTLGNKQCAGKDFVVLVSRLLLVELFLR  513

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG S LG S+TLTSLKRATF
Sbjct  514   YDSFEIEVGTSALGVSLTLTSLKRATF  540



>ref|NP_001236445.1| allene oxide synthase [Glycine max]
 gb|ABB91777.1| allene oxide synthase [Glycine max]
 gb|ACA79943.1| chloroplast allene oxide synthase [Glycine max]
Length=519

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/447 (70%), Positives = 377/447 (84%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFY QGR+EFF+ RIQKYQSTVFRTNMPPGPF++ D  VV LLD KSFP LFD S V
Sbjct  73    RQDYFYKQGRDEFFKSRIQKYQSTVFRTNMPPGPFLAPDPNVVVLLDAKSFPVLFDNSKV  132

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+DVFTGT+MPSTELTGGYR+LSY+DPSEP HA LK LMFFLL  RR H++ EFH +Y 
Sbjct  133   EKKDVFTGTFMPSTELTGGYRVLSYLDPSEPKHALLKQLMFFLLKSRRAHVISEFHASYK  192

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F  LE  LA  GKA    ANDQAAFNFL+RSL+  +P  TKL LD PK++ KWVLF +
Sbjct  193   ELFHALEANLAEAGKASFGDANDQAAFNFLSRSLFNSNPADTKLGLDGPKIVQKWVLFQI  252

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L LGLP+ +E+  + TFRLP +L+KKDYQRLY+FFYE+S  +LD  E LG++R+EAC
Sbjct  253   GPILRLGLPQFLEESTIRTFRLPFSLIKKDYQRLYDFFYESSGLVLDEAERLGITRDEAC  312

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMK+FFPN+LKWIGRAGV LH +LA+EIRS V++ GG+I+MA ME+M
Sbjct  313   HNLLFATCFNSFGGMKLFFPNVLKWIGRAGVKLHARLAEEIRSAVRSGGGEISMAAMEKM  372

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+FRI+PPV  Q+GRAKRD++IESHD  FQVKEGEMLFG+QPFATKDP+IF+
Sbjct  373   PLMKSVVYEAFRIDPPVALQFGRAKRDLIIESHDHAFQVKEGEMLFGYQPFATKDPRIFE  432

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RFVGE+G+ LLKHVLWSNG ETE+PT+ +KQCAGKDFV LVSRL +VE FLR
Sbjct  433   RAEEFVGDRFVGEEGEKLLKHVLWSNGPETESPTLGNKQCAGKDFVTLVSRLFVVEFFLR  492

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+I+VG SPLG+SVT+TSLKRA+F
Sbjct  493   YDSFEIQVGTSPLGSSVTITSLKRASF  519



>gb|AGP25595.1| AOS1 [Aquilaria sinensis]
Length=524

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/447 (72%), Positives = 381/447 (85%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYN+GREEFF+ +IQKY+STVFRTN+PPGP I+ +  VV LLDGKSFP LFDV+ V
Sbjct  78    RFDYFYNKGREEFFKSKIQKYKSTVFRTNVPPGPPIAQNPNVVALLDGKSFPVLFDVNKV  137

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRD+FTGTYMPS ELTGGYR+LSY+D SEP+HAKLK LMFFLL   R  ++PEF  +YA
Sbjct  138   EKRDLFTGTYMPSLELTGGYRVLSYLDSSEPSHAKLKQLMFFLLKCGRDRVIPEFEASYA  197

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             EMF+TLENE+A  GKA     ++QAAFNFLARSL+G +P  TKL LD PKLIGKWVLF L
Sbjct  198   EMFETLENEIAAKGKASFQEPSEQAAFNFLARSLFGSNPADTKLGLDGPKLIGKWVLFQL  257

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L++GLP  +ED  LH+ RLPP LVK DY+RLY+FFY++S  +LD  E LG+SREEAC
Sbjct  258   APLLTIGLPPVLEDLALHSMRLPPKLVKSDYERLYDFFYQSSGVVLDEAEKLGISREEAC  317

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNLVFATCFNSFGGMK+FFPNM+KWIGR GV LHTQLA+EIRSV+ +NGGKITM  MEQM
Sbjct  318   HNLVFATCFNSFGGMKLFFPNMIKWIGRGGVKLHTQLAQEIRSVLSSNGGKITMRAMEQM  377

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ R+EPPVP QYGRA+ D++IESHDA F+VKEGE+LFGFQPFATKDPKIF 
Sbjct  378   PLMKSVVYEALRMEPPVPLQYGRARMDLLIESHDALFKVKEGEVLFGFQPFATKDPKIFS  437

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA EF+  RFVGE G+ LLKHVLWSNG ETE+P +N+KQCAGKDFV+LVSRL++VELF R
Sbjct  438   RANEFVADRFVGEDGERLLKHVLWSNGPETESPKLNNKQCAGKDFVVLVSRLLVVELFRR  497

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDI+VG SPLGA++T+TSLKRA+F
Sbjct  498   YDSFDIQVGKSPLGAAITVTSLKRASF  524



>ref|NP_001274707.1| allene oxide synthase [Solanum lycopersicum]
 gb|AAF67141.1| allene oxide synthase [Solanum lycopersicum]
Length=510

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/445 (69%), Positives = 376/445 (84%), Gaps = 0/445 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG+ +FF  RI KY+ST+FRTNMPPGPFI+S+ KV+ LLDGKSFP LFD S V
Sbjct  66    RLDYFYNQGKNDFFESRIAKYKSTIFRTNMPPGPFITSNPKVIVLLDGKSFPVLFDASKV  125

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT++PSTELTGGYRILSY+DPSEPNH KLK LMFFLLS RR H++PEFH  Y 
Sbjct  126   EKKDLFTGTFVPSTELTGGYRILSYLDPSEPNHEKLKKLMFFLLSSRRDHVIPEFHETYT  185

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TL+ E+   G  G N+ +DQAAFNFLARSL+GV+P+ TKL  D P LIGKW+L  L
Sbjct  186   ELFETLDKEMEEKGTVGFNSGSDQAAFNFLARSLFGVNPVETKLGTDGPALIGKWILLQL  245

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HPV++LGLPK ++D LLHTFRLPP LVKKDYQRLY+FFY NS  +    E LG+S++EAC
Sbjct  246   HPVITLGLPKFLDDVLLHTFRLPPILVKKDYQRLYDFFYTNSANLFIEAEKLGISKDEAC  305

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFPNMLK I +AGV +HT+LA EIRS VK+ GGKITM+ ME+M
Sbjct  306   HNLLFATCFNSFGGMKIFFPNMLKSIAKAGVEIHTRLANEIRSEVKSAGGKITMSAMEKM  365

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ R++PPV +QYGRAK+D+ IESHDA F+VK+GE+LFG+QPFATKDPKIFD
Sbjct  366   PLMKSVVYEALRVDPPVASQYGRAKQDLKIESHDAVFEVKKGEILFGYQPFATKDPKIFD  425

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R  EF+  RFVGE+G+ LLKHVLWSNG ETE+PTV +KQCAGKDFV++VSRL + E FLR
Sbjct  426   RPGEFVADRFVGEEGEKLLKHVLWSNGPETESPTVGNKQCAGKDFVVMVSRLFVTEFFLR  485

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRA  1337
             Y + +++VG S LG+S+T+TSLK+A
Sbjct  486   YGTLNVDVGTSALGSSITITSLKKA  510



>emb|CDP07588.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/447 (72%), Positives = 382/447 (85%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG++E+F+ R+QKY+STVF+TNMPPGPFISS+  V+ LLDGKSFP LFDVS V
Sbjct  76    RLDYFYNQGKDEYFKSRVQKYRSTVFKTNMPPGPFISSNPNVIVLLDGKSFPVLFDVSKV  135

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPSTELTGGYR+LSY+DPSEPNHAKLK LMFF LS RR H++PEF  +Y 
Sbjct  136   EKKDLFTGTFMPSTELTGGYRVLSYLDPSEPNHAKLKKLMFFHLSSRRDHVIPEFQRSYT  195

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FD LE ELA NG A  N ANDQAAFNFLARSLYG +P  ++L  D PKL+GKWV+F +
Sbjct  196   ELFDGLEEELATNGTAKFNEANDQAAFNFLARSLYGANPADSQLGRDGPKLVGKWVVFQI  255

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HPVL LGLP  +ED L+HTF LPPALVKK+YQ LY+FF  NST++LD  E  G+SREEAC
Sbjct  256   HPVLKLGLPNVLEDLLIHTFPLPPALVKKEYQLLYDFFRANSTSVLDEAERNGISREEAC  315

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMK+FF NMLKWIGRAGV LHTQLA+EIRS +K++ G++TM  +E M
Sbjct  316   HNLIFATCFNSFGGMKLFFTNMLKWIGRAGVKLHTQLAQEIRSALKSSDGRVTMRAIENM  375

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              L KS VYE+ RIEPPVP QYGRAK +  IESHD+ F+VK GEMLFG+QPFAT+DPKIF+
Sbjct  376   PLTKSVVYEALRIEPPVPAQYGRAKTNFTIESHDSAFEVKAGEMLFGYQPFATRDPKIFE  435

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R++EF+  RFVGEKG+ LLKHVLWSNG ETE+P VN+KQCAGKDFV+LVSRL+LVE F R
Sbjct  436   RSEEFVADRFVGEKGEKLLKHVLWSNGPETESPDVNNKQCAGKDFVVLVSRLLLVEFFRR  495

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG SPLGA+VT+TSLKRA+ 
Sbjct  496   YDSFEIEVGTSPLGAAVTVTSLKRASL  522



>gb|AED99866.1| cytochrome P450 [Panax notoginseng]
Length=522

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/446 (70%), Positives = 376/446 (84%), Gaps = 0/446 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D+FYNQG  EFF+ RIQKYQSTV R NMPPGPFISS+S VV LLDGKSFP LFD++ V
Sbjct  76    RLDFFYNQGPAEFFKSRIQKYQSTVLRANMPPGPFISSNSNVVVLLDGKSFPVLFDLNKV  135

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+++FTGTYMPST+LTGGYRILSY+DP+EPNH KLK L+FFLL  RR  ++PEFH +Y 
Sbjct  136   EKKNLFTGTYMPSTDLTGGYRILSYLDPAEPNHGKLKQLLFFLLKFRRDKVIPEFHASYT  195

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+ LE+E+A +GK+    AN+Q AFNFLARSLYG +P  T+L  D P LI KWVLFNL
Sbjct  196   ELFEKLESEIASSGKSSFTEANNQTAFNFLARSLYGSNPADTELGADGPNLITKWVLFNL  255

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L+LGLPK +E+ L+ TF LPP LV+ DY +LYEFFY +S ++L   E +G+ +EEAC
Sbjct  256   HPILTLGLPKLVEELLIRTFPLPPFLVQNDYNKLYEFFYNSSESMLKEAEKMGIPKEEAC  315

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNLVFATCFNS+GGMKI FPN++K IG+AG  L  +LA+EIRS +++NGGK+TMA MEQM
Sbjct  316   HNLVFATCFNSYGGMKILFPNIIKSIGQAGAKLQAELAEEIRSAIRSNGGKVTMAAMEQM  375

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKSTVYES R+EPPVP QYGRAKRD++IESHDA F+VKEGEMLFGFQPFAT DPKIF+
Sbjct  376   PLMKSTVYESLRMEPPVPLQYGRAKRDLIIESHDAAFEVKEGEMLFGFQPFATNDPKIFE  435

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R  EF+  RFVGE+ + LLKHVLWSNG ETE+PTV +KQCAGKDFV+L+SRL+LVELFLR
Sbjct  436   RPGEFVADRFVGEEREELLKHVLWSNGPETESPTVENKQCAGKDFVILMSRLLLVELFLR  495

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRAT  1340
             YDSF++EV  S LGASVT+TSLKRA+
Sbjct  496   YDSFEVEVAASSLGASVTITSLKRAS  521



>gb|KDO84382.1| hypothetical protein CISIN_1g039030mg [Citrus sinensis]
Length=523

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/447 (72%), Positives = 375/447 (84%), Gaps = 10/447 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DY YN GR+EFF+ +IQKY STVFR NMPP         V+ LLDGKSFP LFDVS V
Sbjct  87    RQDYLYNLGRDEFFKSKIQKYGSTVFRANMPP---------VIVLLDGKSFPVLFDVSKV  137

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPST+LTGGYR+LSY+DPSEPNHAKLK L+FFLL +RR  ++PEFH+ Y 
Sbjct  138   EKKDLFTGTYMPSTDLTGGYRVLSYLDPSEPNHAKLKQLLFFLLMNRRDKVIPEFHSTYT  197

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E F+TLE +LA  GKA  + AN+QAAFNFLAR+ +G +P  T L  DAP LIGKW+LF L
Sbjct  198   EAFETLERDLAAKGKADFSGANEQAAFNFLARAWFGKNPADTTLGSDAPTLIGKWILFQL  257

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+LSLGLPK +E+PLL T  LPPALVKKDYQRLY+FF+E+S  +LD  E LGVSREEAC
Sbjct  258   APLLSLGLPKLVEEPLLRTRPLPPALVKKDYQRLYDFFHESSGFVLDEAEKLGVSREEAC  317

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNLVFATCFNSFGGMKI FPNM+KWIGR GV LH QLA+EIRSVV++NGGK+TMAGMEQM
Sbjct  318   HNLVFATCFNSFGGMKILFPNMVKWIGRGGVKLHMQLAEEIRSVVRSNGGKVTMAGMEQM  377

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
               MKS VYE  R+EPPV  QYG+AKRD++I SH+A F+VKEGEMLFG+QPFATKDPKIF+
Sbjct  378   PWMKSVVYEVLRMEPPVALQYGKAKRDLIISSHEASFEVKEGEMLFGYQPFATKDPKIFE  437

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RFVGE G+ +LKHVLWSNG ETENPTV +KQCAGKDFV+L SRL+LVELFLR
Sbjct  438   RAEEFVADRFVGE-GEKMLKHVLWSNGPETENPTVGNKQCAGKDFVVLASRLLLVELFLR  496

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDI+VG S +G+SVTLTSLKRA+F
Sbjct  497   YDSFDIQVGKSAIGSSVTLTSLKRASF  523



>gb|ABC49700.1| latex allene oxide synthase [Hevea brasiliensis]
Length=524

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/447 (68%), Positives = 378/447 (85%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY QG+EE+F+ R QKYQSTVFR NMPPGPFISS+  VV +LDGKSF  LFDV+ V
Sbjct  79    RLDYFYKQGKEEYFKSRAQKYQSTVFRANMPPGPFISSNPHVVVVLDGKSFSVLFDVTKV  138

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPST+LTGGYRILSY+DPSE  H +LK L+F+LL  RR +++PEF + Y+
Sbjct  139   EKKDLFTGTFMPSTDLTGGYRILSYLDPSETKHGQLKQLLFYLLKSRRDYVIPEFSSTYS  198

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F++LE +LA  GK   N   +QAAF+FL R  +GV+P+ TK+  D P LI KWVLF L
Sbjct  199   QLFESLEKDLASKGKVSFNDPGEQAAFSFLGRCYFGVNPVDTKVGTDGPTLIAKWVLFQL  258

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L+LGLP  IE+P +HTFRLP  ++KKDYQRLY++FY +  ++LD  E +G++REEAC
Sbjct  259   APILTLGLPAFIEEPTIHTFRLPAFIIKKDYQRLYDYFYSSGGSVLDEAERMGLTREEAC  318

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HN++FATCFN+FGG+KIFFPN+LKWIGRAGV LHTQLA+EIRSV+K+NGG+ITMA +EQM
Sbjct  319   HNILFATCFNTFGGLKIFFPNVLKWIGRAGVKLHTQLAQEIRSVIKSNGGQITMAALEQM  378

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+FRIEPPVP QYGRAKRD++IESHDA F VKEG+M+FG+QPFATKDPKIFD
Sbjct  379   PLMKSAVYEAFRIEPPVPAQYGRAKRDLIIESHDAAFGVKEGQMIFGYQPFATKDPKIFD  438

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R +E++P RFVGE G+ LLKHVLWSNG ETE+PTV +KQ AG+DFV+ +SRL +VELF R
Sbjct  439   RPEEYVPDRFVGE-GEKLLKHVLWSNGPETEHPTVGNKQSAGRDFVVFISRLFVVELFRR  497

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG S LG+S+T+TSLKRA+F
Sbjct  498   YDSFEIEVGSSALGSSITITSLKRASF  524



>ref|NP_001236432.1| allene oxide synthase [Glycine max]
 gb|ABB91776.1| allene oxide synthase [Glycine max]
Length=524

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/447 (69%), Positives = 377/447 (84%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFY QGR+EFF+ RIQKYQSTVFRTNMPPGPF++ +  VV LLD K+FP LFD S V
Sbjct  78    RQDYFYKQGRDEFFKSRIQKYQSTVFRTNMPPGPFLAPNPNVVVLLDAKTFPILFDNSKV  137

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +KRDVFTGT+MPST+LTGGYR+LSY+DPSEP H+ LK LMFFLL  RR H++ EFH +Y 
Sbjct  138   DKRDVFTGTFMPSTQLTGGYRVLSYLDPSEPKHSLLKQLMFFLLKSRRAHVISEFHASYK  197

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F  LE  LA  GKA    ANDQAAFNFLARSL+  +P  TKL  D PK++ KWVLF L
Sbjct  198   DLFHELEANLAEAGKASFGDANDQAAFNFLARSLFNSNPADTKLGRDGPKIVQKWVLFQL  257

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L LGLP+ +E+  + +FRLP +L++KDYQRLY+FFY++S ++LD  E LG++R+EAC
Sbjct  258   GPILRLGLPQFLEESTIRSFRLPFSLIQKDYQRLYDFFYQSSGSVLDEAERLGITRDEAC  317

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMK+FFPN+LKWIGRAGV LH +LA+EIRS V+  GG+ITMA ME M
Sbjct  318   HNLLFATCFNSFGGMKLFFPNVLKWIGRAGVKLHARLAEEIRSAVRGAGGEITMAAMENM  377

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+FRI+PPVP Q+GRAKRD++IESHD  FQVKEGEMLFG+QPFATKDP+IF+
Sbjct  378   PLMKSVVYEAFRIDPPVPLQFGRAKRDLIIESHDHAFQVKEGEMLFGYQPFATKDPRIFE  437

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RFVGE+G+ LLKHVLWSNG ETE+PT+ +KQCAGKDFV LVSRL++VE FLR
Sbjct  438   RAEEFVGDRFVGEEGEKLLKHVLWSNGPETESPTIGNKQCAGKDFVTLVSRLLVVEFFLR  497

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+I+VG SPLG+SVT+TSLKRA+F
Sbjct  498   YDSFEIQVGTSPLGSSVTITSLKRASF  524



>ref|XP_002510320.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52507.1| cytochrome P450, putative [Ricinus communis]
Length=518

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/447 (68%), Positives = 378/447 (85%), Gaps = 3/447 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGREEFF+ R QKYQSTV+RTNMPPGPFIS +  VV +LDGKSFP LFDV+ V
Sbjct  75    RLDYFYNQGREEFFKSRSQKYQSTVYRTNMPPGPFISKNPHVVVVLDGKSFPVLFDVTKV  134

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPS +LTGGYR+LSY+DPSE  H +LK L+F+LL  RR H++PEF ++Y 
Sbjct  135   EKKDLFTGTYMPSVDLTGGYRVLSYLDPSEQKHTQLKQLLFYLLKSRRDHVIPEFASSYT  194

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FD LE +LA  GK   N   +QAAF+FL +  +G +P+ +K+  D P LI KWVLF L
Sbjct  195   ELFDGLEKDLASKGKVSFNDPGEQAAFSFLGKCYFGTNPVDSKVGTDGPSLIAKWVLFQL  254

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L+LGLP  +E+PL+HTFRLP  L+KKDY+RLY++F  ++ ++LD  E +G+SR+EAC
Sbjct  255   APILTLGLPAILEEPLIHTFRLPAFLIKKDYKRLYDYFNSSAGSLLDEAEKMGISRDEAC  314

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFN+FGGMKIFFPN+LKWIGRAGV+LHT+LAKEIRSV+  NGG++TM+ +EQM
Sbjct  315   HNLLFATCFNTFGGMKIFFPNILKWIGRAGVALHTELAKEIRSVL--NGGEVTMSALEQM  372

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+FRIEPPVP QYG+AKRDIVIESHDA ++VKEGEM+FG+QPFATKDPKIFD
Sbjct  373   PLMKSAVYEAFRIEPPVPAQYGKAKRDIVIESHDAAYEVKEGEMIFGYQPFATKDPKIFD  432

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R +E++P RFVGE G+ LL+HVLWSNG ETE+PT+ +KQCAGKDFV+ +SRL +VE+F R
Sbjct  433   RPEEYVPDRFVGE-GEKLLQHVLWSNGPETEHPTIGNKQCAGKDFVVFISRLFVVEIFRR  491

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEV  S LG+SVT+TSLKRATF
Sbjct  492   YDSFEIEVASSTLGSSVTITSLKRATF  518



>gb|KFK32912.1| hypothetical protein AALP_AA6G305300 [Arabis alpina]
Length=526

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/448 (69%), Positives = 376/448 (84%), Gaps = 1/448 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG +EFF+ RI+K+ ST+FR NMPPG FI+ + +VV LLDGKSFP LFDV  V
Sbjct  79    RLDYFYNQGSQEFFKSRIRKHNSTIFRVNMPPGGFIAENPQVVALLDGKSFPILFDVDKV  138

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+++FTGTYMPSTELTGGYR+LSY+DPSEPNH+KLKNL+FFLL + R  + PEF + Y 
Sbjct  139   EKKNLFTGTYMPSTELTGGYRVLSYLDPSEPNHSKLKNLIFFLLKNSRTRIFPEFQSTYT  198

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +F+ +E +LA NGKA  N   D AAF FLARS+YG +PM TKL  DAPKLI KWVLFNL
Sbjct  199   TLFEIIEKDLAANGKANFNTPGDAAAFEFLARSMYGKNPMDTKLGSDAPKLISKWVLFNL  258

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTA-ILDHGEILGVSREEA  719
             HP+L+LGLPK +ED LLHTFRLP +LVK DY RLYEFF E+S+  IL+  E LG+SREEA
Sbjct  259   HPLLTLGLPKLVEDSLLHTFRLPSSLVKSDYNRLYEFFLESSSGEILNEAERLGISREEA  318

Query  720   CHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQ  899
             CHNL+F TCFN++GGMKI F N++K IGR+G  +  +LA+EIRSV+K+NGG+ITM G+EQ
Sbjct  319   CHNLLFTTCFNTWGGMKILFSNLVKRIGRSGTKIQIRLAEEIRSVIKSNGGEITMRGIEQ  378

Query  900   MELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF  1079
             M+L KS VYE  RIEPPV +QYGRAK+D+VIESHDA F+VK GEML+G+QPFATKDPKIF
Sbjct  379   MDLTKSVVYECLRIEPPVASQYGRAKKDLVIESHDAAFKVKAGEMLYGYQPFATKDPKIF  438

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
             ++A+EF+  RFVGE+G+ LLK+V+WSNG ETENPTV +KQCAGKDFV+LV+RL +VE+F 
Sbjct  439   EKAEEFVAERFVGEEGEKLLKYVVWSNGPETENPTVENKQCAGKDFVVLVARLFVVEIFR  498

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             RYDSFDIEVG SPLG+SV  TSL++ATF
Sbjct  499   RYDSFDIEVGSSPLGSSVNFTSLRKATF  526



>ref|XP_002865507.1| hypothetical protein ARALYDRAFT_494777 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41766.1| hypothetical protein ARALYDRAFT_494777 [Arabidopsis lyrata subsp. 
lyrata]
Length=519

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/447 (69%), Positives = 373/447 (83%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFY+QG EEFF+ RI+KY STV+R NMPPG FI+ + +VV LLDGKSFP LFDV  V
Sbjct  73    RWDYFYDQGAEEFFKSRIRKYNSTVYRVNMPPGGFIAENPQVVALLDGKSFPVLFDVDKV  132

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPST+LTGGYRILSY+DPSEP H KLK+L+FFLL   R+ + PEF   Y+
Sbjct  133   EKKDLFTGTYMPSTDLTGGYRILSYLDPSEPKHEKLKSLLFFLLKSSRNRIFPEFQATYS  192

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FD+LE EL+  GKA    ++D  AFNFLAR+ YG +P+ TKL+ DAP LI KWVLFNL
Sbjct  193   ELFDSLEKELSLKGKADFGGSSDGTAFNFLARAFYGTNPVDTKLKADAPGLITKWVLFNL  252

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+LSLGLP+ IEDPLLHTF LPPALVK DYQRLYEFF+E++  IL   + LG+SREEA 
Sbjct  253   HPLLSLGLPRIIEDPLLHTFSLPPALVKSDYQRLYEFFFESAGEILVEADKLGISREEAT  312

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFN++GGMKI FPNM+K IGRAG  +H QLA+EIRSV+K+NGG++TM G+E+M
Sbjct  313   HNLLFATCFNTWGGMKILFPNMVKRIGRAGHKVHNQLAEEIRSVIKSNGGELTMGGIEKM  372

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL KS VYE  R EPPVP QYGRAK+D+VIESHDA F+VK GEML+G+QP AT+DPKIFD
Sbjct  373   ELTKSVVYECLRFEPPVPAQYGRAKKDLVIESHDAAFKVKAGEMLYGYQPLATRDPKIFD  432

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA EF+P RFVGE+G+ LL+H+LWSNG ETE PTV +KQCAGKDFV+LV+RL ++E+F R
Sbjct  433   RADEFVPERFVGEEGEKLLRHILWSNGPETETPTVGNKQCAGKDFVVLVARLFVIEIFRR  492

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEV  SPLG+SV  TSL++A+F
Sbjct  493   YDSFDIEVAKSPLGSSVNFTSLRKASF  519



>ref|XP_003523882.2| PREDICTED: allene oxide synthase, chloroplastic-like [Glycine 
max]
Length=521

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/447 (70%), Positives = 374/447 (84%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D+FYNQGR++FF+ R QKY STVFR NMPPGPFI+S+  V+ LLD KSFP LFDVS V
Sbjct  76    RLDFFYNQGRDKFFQSRAQKYNSTVFRANMPPGPFIASNPNVIVLLDAKSFPVLFDVSKV  135

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRDVFTGT+MPST+LTGGYRILSY+DPSEP H +LK L+FFLL  R  H++PEFH++Y 
Sbjct  136   EKRDVFTGTFMPSTQLTGGYRILSYLDPSEPRHEQLKRLLFFLLKSRSSHVIPEFHSSYT  195

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +F+TLENELA  GKA    ANDQAAFNFLAR+LYG +P  T L  D P +I  W+LF L
Sbjct  196   TLFETLENELAKEGKASFQTANDQAAFNFLARALYGTNPSDTNLGRDGPSIIQTWLLFQL  255

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+++LGLPK +EDP LHTFR+PP L+KKDY+RLY+FFYE+S   LD    LGV REEAC
Sbjct  256   GPIMTLGLPKFLEDPTLHTFRIPPFLIKKDYKRLYDFFYESSGFALDEAVRLGVPREEAC  315

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKIFFP +LKW+GRAGV LH +LA+E+R+ VK+NGGK+TMA ME+M
Sbjct  316   HNLLFATCFNSFGGMKIFFPTILKWVGRAGVKLHARLAEEVRAAVKSNGGKVTMASMEEM  375

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+FRIEPPVP QYGRAK+++VIESH+  F VKEGEMLFGFQPFATKDPKIF+
Sbjct  376   PLMKSVVYEAFRIEPPVPLQYGRAKKELVIESHENAFVVKEGEMLFGFQPFATKDPKIFE  435

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
              A+EF+  RFVGE G+ LLKHVLWSNG ETE PT+ +KQCAGKDFV+L SRL++VE FL 
Sbjct  436   NAEEFVADRFVGE-GEKLLKHVLWSNGPETEGPTLGNKQCAGKDFVVLFSRLLVVEFFLH  494

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFD++VG S LG+S+T TSLK+A++
Sbjct  495   YDSFDVQVGNSSLGSSLTFTSLKKASY  521



>emb|CDY02409.1| BnaA02g23180D [Brassica napus]
Length=529

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/447 (69%), Positives = 368/447 (82%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYF+ Q  EEFF+ RI+KY STVFR NMPPG FI+ + +VV LLDGKSFP LFDV  V
Sbjct  83    RNDYFHKQKPEEFFKSRIRKYNSTVFRVNMPPGGFIADNPQVVALLDGKSFPVLFDVDKV  142

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGGYRILSY+DPSEPNHAKLK+L+F LL   R+ + PEF   Y+
Sbjct  143   EKKDLFTGTYMPSTELTGGYRILSYLDPSEPNHAKLKSLLFHLLKSSRNRIFPEFKATYS  202

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FD++E ELA NGKA      D AAFNFLAR++YG DP  TKL  DAP LI KWV FNL
Sbjct  203   ELFDSIEKELAANGKADFGGPGDAAAFNFLARAMYGKDPADTKLGSDAPSLITKWVFFNL  262

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L+LGLP  IEDPLLHTFRLP ALVK DYQRLYEFF E+S  IL   E LG+SREEA 
Sbjct  263   HPLLTLGLPSIIEDPLLHTFRLPSALVKSDYQRLYEFFLESSGEILVEAEKLGISREEAA  322

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFN++GGMKI F N++K +GRAG  L  +LA+EIRSV+K+NGG++TM G+EQM
Sbjct  323   HNLLFATCFNTWGGMKILFSNLVKRVGRAGTKLQIRLAEEIRSVIKSNGGELTMGGIEQM  382

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL KS V+E  R EPPVP QY RAK+D VIESHDA F+VK GEML+G+QP AT+DPKIF+
Sbjct  383   ELTKSVVFECLRFEPPVPAQYARAKKDFVIESHDAAFRVKAGEMLYGYQPLATRDPKIFE  442

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+P RF+GE+G+ LL+HV+WSNG +TENPTV +KQCAGKDFV+LV+RL L+E+F R
Sbjct  443   RAEEFVPERFLGEEGERLLQHVVWSNGPQTENPTVGNKQCAGKDFVVLVARLFLIEIFRR  502

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEVG SPLG+SVT TSL++A+F
Sbjct  503   YDSFDIEVGSSPLGSSVTFTSLRKASF  529



>ref|XP_007160802.1| hypothetical protein PHAVU_001G017800g [Phaseolus vulgaris]
 gb|ESW32796.1| hypothetical protein PHAVU_001G017800g [Phaseolus vulgaris]
Length=518

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/447 (71%), Positives = 381/447 (85%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFY QGR+EFF+ RIQKYQSTVFRTNMPPGPFI+    VV LLDGKSFP LFD S V
Sbjct  72    RQDYFYKQGRDEFFKSRIQKYQSTVFRTNMPPGPFITFKPNVVVLLDGKSFPVLFDTSKV  131

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+DVFTGTYMPST+LTGG+R+LSY+DPSEP HA LK L+FFLL  R  H++PEFH +Y 
Sbjct  132   EKKDVFTGTYMPSTDLTGGHRVLSYLDPSEPKHALLKQLIFFLLKSRSRHVIPEFHASYR  191

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F  LE+ LA  GKA    ANDQAAFNFLARSL+  +P  TKL LD PK++ KWVLF L
Sbjct  192   DLFLQLESNLAETGKASFGDANDQAAFNFLARSLFAANPADTKLGLDGPKIVQKWVLFQL  251

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L LGLP+ +E+  + TFRLPP+L+KKDYQRLY+FFY +ST++LD  E LG++R+EAC
Sbjct  252   GPLLRLGLPQFLEESTIRTFRLPPSLIKKDYQRLYDFFYSSSTSVLDEAERLGITRDEAC  311

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMK+FFPN++KWIGRAGV+LH +LA+EIRS V+  GG+ITMA ME+M
Sbjct  312   HNLLFATCFNSFGGMKLFFPNVMKWIGRAGVTLHARLAEEIRSAVRDAGGEITMAAMEKM  371

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+FRI+PPVP Q+GRAKRD+VIESHD  F+VKEG++LFG+QPFATKD +IF+
Sbjct  372   PLMKSVVYEAFRIDPPVPLQFGRAKRDLVIESHDHAFEVKEGDLLFGYQPFATKDHRIFE  431

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RFVGE+G+ LLKHVLWSNG ETE+PTV +KQCAGKDFV LVSRL+LVE FLR
Sbjct  432   RAEEFVGDRFVGEEGEKLLKHVLWSNGPETESPTVGNKQCAGKDFVTLVSRLLLVEFFLR  491

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDI+VG SPLG+SVT+TSLKR++F
Sbjct  492   YDSFDIQVGTSPLGSSVTITSLKRSSF  518



>ref|XP_009123690.1| PREDICTED: allene oxide synthase, chloroplastic [Brassica rapa]
Length=529

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/447 (69%), Positives = 367/447 (82%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYF+ Q  EEFF+ RI+KY STVFR NMPPG FI+ + +VV LLDGKSFP LFDV  V
Sbjct  83    RNDYFHKQKPEEFFKSRIRKYNSTVFRVNMPPGGFIADNPQVVALLDGKSFPVLFDVDKV  142

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTE TGGYRILSY+DPSEPNHAKLK+L+F LL   R+ + PEF   Y+
Sbjct  143   EKKDIFTGTYMPSTERTGGYRILSYLDPSEPNHAKLKSLLFHLLKSSRNRIFPEFKATYS  202

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FD++E ELA NGKA      D AAFNFLAR++YG DP  TKL  DAP LI KWV FNL
Sbjct  203   ELFDSIEKELAANGKADFGGPGDAAAFNFLARAMYGKDPADTKLGSDAPSLITKWVFFNL  262

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L+LGLP  IEDPLLHTFRLP ALVK DYQRLYEFF E+S  IL   E LG+SREEA 
Sbjct  263   HPLLTLGLPSIIEDPLLHTFRLPSALVKSDYQRLYEFFLESSGEILVEAEKLGISREEAA  322

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFN++GGMKI F N++K +GRAG  L  +LA+EIRSV+K+NGG++TM G+EQM
Sbjct  323   HNLLFATCFNTWGGMKILFSNLVKRVGRAGTKLQIRLAEEIRSVIKSNGGELTMGGIEQM  382

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL KS V+E  R EPPVP QY RAK+D VIESHDA F+VK GEML+G+QP AT+DPKIF+
Sbjct  383   ELTKSVVFECLRFEPPVPAQYARAKKDFVIESHDAAFRVKAGEMLYGYQPLATRDPKIFE  442

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+P RF+GE+G+ LL+HV+WSNG +TENPTV +KQCAGKDFV+LV+RL L+E+F R
Sbjct  443   RAEEFVPERFLGEEGERLLQHVVWSNGPQTENPTVGNKQCAGKDFVVLVARLFLIEIFRR  502

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEVG SPLG+SVT TSL++A+F
Sbjct  503   YDSFDIEVGSSPLGSSVTFTSLRKASF  529



>ref|XP_006375037.1| hypothetical protein POPTR_0014s03820g [Populus trichocarpa]
 gb|ERP52834.1| hypothetical protein POPTR_0014s03820g [Populus trichocarpa]
Length=526

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/447 (71%), Positives = 381/447 (85%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+ FF+ ++ KY STVFR NM PGPFI+ + +VV LLDGKSFP LFDV+ V
Sbjct  81    RMDYFYNQGRDNFFKSKVLKYGSTVFRANMGPGPFIAPNPQVVVLLDGKSFPVLFDVTKV  140

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGGYRILSY+DPSEP HAKLK  MF+LL  RR H++PEF  +Y 
Sbjct  141   EKKDLFTGTYMPSTELTGGYRILSYLDPSEPMHAKLKKFMFYLLKSRRDHVIPEFKASYT  200

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F +LE +LA  GKA   AANDQAAFNFLAR+ +G +P +T L LD P L+ KWVLFNL
Sbjct  201   ELFTSLEKDLALKGKANFVAANDQAAFNFLARAWFGTEPAQTSLGLDGPGLVSKWVLFNL  260

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              PVLSLGLPK +ED  +H+FRLPP+++KK+YQRLY+FFY +S+ +LD  E LG+SREEAC
Sbjct  261   GPVLSLGLPKYLEDLTIHSFRLPPSMIKKNYQRLYDFFYASSSFLLDEAENLGISREEAC  320

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+F+TCFNSFGGMKI FPNM+KW+GRAG  LH QLA+EIRSVV+++GG +TM GMEQM
Sbjct  321   HNLLFSTCFNSFGGMKILFPNMMKWLGRAGAKLHAQLAEEIRSVVQSDGGNVTMRGMEQM  380

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RIEPPVP QYG+AKRD++IESHDA F+VKEGE+LFGFQPFATKDPKIF 
Sbjct  381   PLMKSAVYEALRIEPPVPLQYGKAKRDLIIESHDAAFEVKEGELLFGFQPFATKDPKIFT  440

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RF+GE G+ LLKHVLWSNG ETE PT+ +KQCAGKDFV+LV+RL++VELFLR
Sbjct  441   RAEEFVADRFIGE-GEELLKHVLWSNGPETEKPTLGNKQCAGKDFVVLVARLLVVELFLR  499

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG S LGA+VT+TSLKRA F
Sbjct  500   YDSFEIEVGKSSLGAAVTVTSLKRARF  526



>emb|CAC86897.1| allene oxide synthase [Medicago truncatula]
 gb|KEH40077.1| cytochrome P450 family fatty acid hydroperoxide lyase [Medicago 
truncatula]
Length=524

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/447 (68%), Positives = 373/447 (83%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+E+F+ RIQKYQST+FRTN+PPGPFI+ +  VV LLDGKSFP LFD S +
Sbjct  78    RLDYFYNQGRDEYFKSRIQKYQSTIFRTNVPPGPFIAQNPNVVVLLDGKSFPVLFDASKI  137

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +K DVFTGTY PSTELTGGYR+LSY+DPSEP H +LK LMFFLL  R  H++PEF + Y 
Sbjct  138   DKTDVFTGTYTPSTELTGGYRVLSYLDPSEPKHEQLKKLMFFLLKSRSRHVIPEFQSCYR  197

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E F+ LEN+LA NG A     NDQAAFNFL R+L+GV+P+ T+L LD PK++ KWVLF L
Sbjct  198   EFFNALENQLAENGHASFADNNDQAAFNFLNRALFGVNPVDTELGLDGPKMVQKWVLFQL  257

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              PVL LGLPK +ED ++H FRLP  L+KKDYQRLY+FFY +S   L+  E L VS+EEAC
Sbjct  258   GPVLKLGLPKFVEDSMIHNFRLPFRLIKKDYQRLYDFFYASSGFALEEAERLDVSKEEAC  317

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMK+FFPN++KWIGR GV LHT+LA EIR  V++ GG+ITMA ME M
Sbjct  318   HNLLFATCFNSFGGMKLFFPNLMKWIGRGGVRLHTKLATEIREAVRSAGGEITMAAMENM  377

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+FRI+PPVP Q+GRAKRD+VIE+H+  F VK+GE+L G+QPFATKDPKIF+
Sbjct  378   PLMKSVVYEAFRIDPPVPLQFGRAKRDMVIENHENGFLVKKGELLLGYQPFATKDPKIFE  437

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RFVG++G+ LLKHVLWSNG E+++PTV +KQCAGKDF  L+SRL++VELFLR
Sbjct  438   RAEEFVADRFVGDEGEKLLKHVLWSNGPESQSPTVGNKQCAGKDFTTLISRLLVVELFLR  497

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+I+VG SPLG S+TLTSLKR++F
Sbjct  498   YDSFEIQVGNSPLGPSITLTSLKRSSF  524



>gb|KEH36125.1| cytochrome P450 family fatty acid hydroperoxide lyase [Medicago 
truncatula]
Length=559

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/449 (69%), Positives = 374/449 (83%), Gaps = 2/449 (0%)
 Frame = +3

Query  3     RIDYFYNQG-REEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSV  179
             R++YFYN+G R+++FR ++ KY+ST+FR NMPPGPFISS+  V+ LLDGKSFP LFD S 
Sbjct  111   RLEYFYNEGGRDKYFRSKMHKYKSTIFRANMPPGPFISSNPNVIVLLDGKSFPVLFDNSK  170

Query  180   VEKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAY  359
             VEKRD+FTGT+MPSTELTGGYRILSY+DP+EP H +LK L+FFLL  R  H +PEFH++Y
Sbjct  171   VEKRDLFTGTFMPSTELTGGYRILSYLDPTEPKHDQLKRLLFFLLKSRSSHFIPEFHSSY  230

Query  360   AEMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
               +F+TLE ELA  G A    ANDQAAFN+LA++ +G +P  T L+ D PK++ KW L  
Sbjct  231   TNLFNTLEKELAKTGNAIFADANDQAAFNYLAKAFFGTNPTETNLKSDGPKIVTKWTLMQ  290

Query  540   LHPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTA-ILDHGEILGVSREE  716
             L P+L+LGLPK IE+P LHTFRLPP LVKKDYQ+LY+FFYE+ST  +LD    LGVS+EE
Sbjct  291   LSPILTLGLPKWIEEPALHTFRLPPFLVKKDYQKLYDFFYESSTGPVLDEAVRLGVSKEE  350

Query  717   ACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGME  896
             A HNL+FATCFNSFGGMKIFFPN+LKWIGR GV+LH +LA+EIRSVVK+NGG++TMAGME
Sbjct  351   AVHNLLFATCFNSFGGMKIFFPNLLKWIGRGGVNLHRKLAEEIRSVVKSNGGRVTMAGME  410

Query  897   QMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKI  1076
              M LMKS VYE+FRIEPPVP QYG+AK D VIE+H+  FQVKEGEMLFGFQPFATKDPKI
Sbjct  411   NMPLMKSVVYEAFRIEPPVPLQYGKAKHDFVIENHENAFQVKEGEMLFGFQPFATKDPKI  470

Query  1077  FDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELF  1256
             FD A EF+  RF+GE+G+ LL+HV WSNGRETE PT  +KQC GKDFV+L SRL++VELF
Sbjct  471   FDSADEFVGDRFMGEEGEKLLEHVFWSNGRETEQPTAGNKQCPGKDFVVLFSRLLVVELF  530

Query  1257  LRYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             LRYD+F I+VG SP+G++VT TSLK+A F
Sbjct  531   LRYDTFGIQVGKSPIGSAVTFTSLKKAKF  559



>ref|XP_010694121.1| PREDICTED: allene oxide synthase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=514

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/447 (71%), Positives = 386/447 (86%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQG+E+FF+ R+QKY+STVFR NMPPGPFISS+  VV LLDGKSFPTLFDVS V
Sbjct  68    RQDYFYNQGKEDFFKSRVQKYKSTVFRVNMPPGPFISSNPNVVVLLDGKSFPTLFDVSKV  127

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+ PS ELTGGYR+LSY+DPSEP H  LK LMF L+S  RH ++PEF ++++
Sbjct  128   EKKDLFTGTFSPSLELTGGYRVLSYLDPSEPTHELLKKLMFKLVSSTRHRVIPEFRSSFS  187

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FD LENELA NGKA  N ANDQA+FNFL+R+ YGV+P  ++L L+ P +I KWVLF L
Sbjct  188   ELFDELENELATNGKAKFNDANDQASFNFLSRAWYGVNPADSELGLNGPSIISKWVLFQL  247

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L+LGLPK IE+  +HTFRLP +L+KKDYQ+LY FFY+NST +L     +G+SR+EAC
Sbjct  248   GPILTLGLPKFIEESTIHTFRLPFSLIKKDYQKLYNFFYQNSTTLLQEASEVGISRDEAC  307

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+F TCFNSFGGMKIFFPNM+K IGRAGV+LH +LA+EIR+ V++NGG+ITM+ ME+M
Sbjct  308   HNLIFTTCFNSFGGMKIFFPNMVKQIGRAGVNLHRRLAEEIRTAVRSNGGEITMSAMEEM  367

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYES RIEPPV +QYGRAK+DI+IESHDA F+VK+GEMLFGFQPFATKDPKIF+
Sbjct  368   TLMKSVVYESLRIEPPVSSQYGRAKKDIIIESHDAAFEVKKGEMLFGFQPFATKDPKIFE  427

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA EF+P RFVGE+G+ LLK+V+WSNG E E+PTV +KQCAGKDFV+LVSRL+LVELFLR
Sbjct  428   RADEFVPDRFVGEEGEKLLKYVVWSNGPENESPTVKNKQCAGKDFVVLVSRLLLVELFLR  487

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+I+VG SPLGA VT+TSLKRATF
Sbjct  488   YDSFEIDVGTSPLGAKVTVTSLKRATF  514



>ref|XP_006403367.1| hypothetical protein EUTSA_v10003180mg [Eutrema salsugineum]
 gb|ESQ44820.1| hypothetical protein EUTSA_v10003180mg [Eutrema salsugineum]
Length=529

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/447 (68%), Positives = 368/447 (82%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQ  EEFF+ RI+KY STVFR NMPPG FI+ + +VV LLDGKSFP LFDV  V
Sbjct  83    RHDYFYNQKPEEFFKSRIRKYNSTVFRVNMPPGGFIAENPQVVALLDGKSFPILFDVDKV  142

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGGYRILSY+DPSEPNH+KLK+L+F LL   R+ + PEF   Y+
Sbjct  143   EKKDLFTGTYMPSTELTGGYRILSYLDPSEPNHSKLKSLLFHLLKSSRNRIFPEFRATYS  202

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FD++E ELA NGKA      D AAF+FLAR++YG  P  TKL  DAPKLI KWV FNL
Sbjct  203   ELFDSIEKELAANGKADFGGPGDAAAFDFLARAMYGKTPADTKLGSDAPKLITKWVFFNL  262

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L+LGLPK +EDPLLHTFRLP +LVK DY+RLYEFF E+S  IL   E LG+SREEA 
Sbjct  263   HPLLTLGLPKLVEDPLLHTFRLPSSLVKSDYRRLYEFFLESSGEILVEAEKLGISREEAA  322

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFN++GGMKI F N++K +GRAG  L  +LA+EIRS +K+N G++TM G+E+M
Sbjct  323   HNLLFATCFNTWGGMKILFSNLVKRVGRAGTKLQIRLAEEIRSTIKSNDGELTMGGIEKM  382

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL KS V+E  R EPPVP QY RAK+D VIESHDA F+VK GEML+G+QPFATKDPKIFD
Sbjct  383   ELTKSVVFECLRFEPPVPAQYARAKKDFVIESHDAAFKVKAGEMLYGYQPFATKDPKIFD  442

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+P RFVGE+G+ LL+HV+WSNG ETENPTV +KQCAGKDFV+LV+RL L+E+F R
Sbjct  443   RAEEFVPERFVGEEGERLLRHVVWSNGPETENPTVGNKQCAGKDFVVLVARLFLIEIFRR  502

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDI+VG SPLG+SV  TSL++A+F
Sbjct  503   YDSFDIDVGSSPLGSSVKFTSLRKASF  529



>pdb|2RCH|A Chain A, Crystal Structure Of Arabidopsis Thaliana Allene Oxide 
Synthase (aos, Cytochrome P450 74a, Cyp74a) Complexed With 
13(s)-hod At 1.85 A Resolution
 pdb|2RCH|B Chain B, Crystal Structure Of Arabidopsis Thaliana Allene Oxide 
Synthase (aos, Cytochrome P450 74a, Cyp74a) Complexed With 
13(s)-hod At 1.85 A Resolution
 pdb|2RCL|A Chain A, Crystal Structure Of Arabidopsis Thaliana Allene Oxide 
Synthase (aos, Cytochrome P450 74a, Cyp74a) Complexed With 
12r,13s-vernolic Acid At 2.4 A Resolution
 pdb|2RCL|B Chain B, Crystal Structure Of Arabidopsis Thaliana Allene Oxide 
Synthase (aos, Cytochrome P450 74a, Cyp74a) Complexed With 
12r,13s-vernolic Acid At 2.4 A Resolution
 pdb|3CLI|A Chain A, Crystal Structure Of Arabidopsis Thaliana Allene Oxide 
Synthase (Aos, Cytochrome P450 74a, Cyp74a) At 1.80 A Resolution
 pdb|3CLI|B Chain B, Crystal Structure Of Arabidopsis Thaliana Allene Oxide 
Synthase (Aos, Cytochrome P450 74a, Cyp74a) At 1.80 A Resolution
 pdb|3DSI|A Chain A, Crystal Structure Of Arabidopsis Thaliana Allene Oxide 
Synthase (Aos, Cytochrome P450 74a, Cyp74a) Complexed With 
13(S)-Hot At 1.60 A Resolution
 pdb|3DSI|B Chain B, Crystal Structure Of Arabidopsis Thaliana Allene Oxide 
Synthase (Aos, Cytochrome P450 74a, Cyp74a) Complexed With 
13(S)-Hot At 1.60 A Resolution
Length=495

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/447 (68%), Positives = 370/447 (83%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFY+QG EEFF+ RI+KY STV+R NMPPG FI+ + +VV LLDGKSFP LFDV  V
Sbjct  45    RWDYFYDQGAEEFFKSRIRKYNSTVYRVNMPPGAFIAENPQVVALLDGKSFPVLFDVDKV  104

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGGYRILSY+DPSEP H KLKNL+FFLL   R+ + PEF   Y+
Sbjct  105   EKKDLFTGTYMPSTELTGGYRILSYLDPSEPKHEKLKNLLFFLLKSSRNRIFPEFQATYS  164

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FD+LE EL+  GKA    ++D  AFNFLAR+ YG +P  TKL+ DAP LI KWVLFNL
Sbjct  165   ELFDSLEKELSLKGKADFGGSSDGTAFNFLARAFYGTNPADTKLKADAPGLITKWVLFNL  224

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+LS+GLP+ IE+PL+HTF LPPALVK DYQRLYEFF E++  IL   + LG+SREEA 
Sbjct  225   HPLLSIGLPRVIEEPLIHTFSLPPALVKSDYQRLYEFFLESAGEILVEADKLGISREEAT  284

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFN++GGMKI FPNM+K IGRAG  +H +LA+EIRSV+K+NGG++TM  +E+M
Sbjct  285   HNLLFATCFNTWGGMKILFPNMVKRIGRAGHQVHNRLAEEIRSVIKSNGGELTMGAIEKM  344

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL KS VYE  R EPPV  QYGRAK+D+VIESHDA F+VK GEML+G+QP AT+DPKIFD
Sbjct  345   ELTKSVVYECLRFEPPVTAQYGRAKKDLVIESHDAAFKVKAGEMLYGYQPLATRDPKIFD  404

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA EF+P RFVGE+G+ LL+HVLWSNG ETE PTV +KQCAGKDFV+LV+RL ++E+F R
Sbjct  405   RADEFVPERFVGEEGEKLLRHVLWSNGPETETPTVGNKQCAGKDFVVLVARLFVIEIFRR  464

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEVG SPLG+SV  +SL++A+F
Sbjct  465   YDSFDIEVGTSPLGSSVNFSSLRKASF  491



>gb|AGB34186.1| allene oxide synthase [Brassica oleracea]
 emb|CDY23912.1| BnaC02g29610D [Brassica napus]
Length=529

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/447 (68%), Positives = 367/447 (82%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYF+ Q  EEFF+ RI+ Y STVFR NMPPG FI+ + +VV LLDGKSFP LFDV  V
Sbjct  83    RNDYFHKQKPEEFFKSRIRTYNSTVFRVNMPPGGFIADNPQVVALLDGKSFPVLFDVDKV  142

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGGYRILSY+DPSEPNHAKLK+L+F LL   R+ + PEF   Y+
Sbjct  143   EKKDLFTGTYMPSTELTGGYRILSYLDPSEPNHAKLKSLLFHLLKSSRNRIFPEFKATYS  202

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FD++E ELA NGKA      D AAFNFLAR++YG +P  TKL  DAP LI KWV FNL
Sbjct  203   ELFDSIEKELAVNGKADFGGPGDAAAFNFLARAMYGKNPADTKLGSDAPSLITKWVFFNL  262

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L+LGLP  IEDPLLHTFRLP AL+K DYQRLYEFF E+S  IL   E LG+SREEA 
Sbjct  263   HPLLTLGLPSIIEDPLLHTFRLPSALIKSDYQRLYEFFLESSGEILIEAEKLGISREEAA  322

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFN++GGMKI F N++K +GRAG  L  +LA+EIRSV+K+NGG++TM G+EQM
Sbjct  323   HNLLFATCFNTWGGMKILFSNLVKRVGRAGTKLQIRLAEEIRSVIKSNGGELTMGGIEQM  382

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL KS V+E  R EPPVP QY RAK+D VIESHDA F+VK GEML+G+QP AT+DPKIF+
Sbjct  383   ELTKSVVFECLRFEPPVPAQYARAKKDFVIESHDAAFRVKAGEMLYGYQPLATRDPKIFE  442

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+P RF+GE+G+ LL+HV+WSNG +TENPTV +KQCAGKDFV+LV+RL L+E+F R
Sbjct  443   RAEEFVPERFLGEEGERLLQHVVWSNGPQTENPTVGNKQCAGKDFVVLVARLFLIEIFRR  502

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEVG SPLG+SVT TSL++A+F
Sbjct  503   YDSFDIEVGSSPLGSSVTFTSLRKASF  529



>ref|XP_010442141.1| PREDICTED: allene oxide synthase, chloroplastic-like [Camelina 
sativa]
Length=516

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/447 (69%), Positives = 368/447 (82%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQG EEFF+ RI+KY STV+R NMPPG FI+ + +VV LLDGKSF  LFDV  V
Sbjct  70    RWDYFYNQGPEEFFKSRIRKYDSTVYRVNMPPGAFIAENPQVVALLDGKSFQVLFDVDKV  129

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPSTELTGGYRILSY+DPSEP HAKLK L+FFLL   R+ + PEF   Y+
Sbjct  130   EKKDLFTGTFMPSTELTGGYRILSYLDPSEPKHAKLKTLLFFLLKSARNRIFPEFRATYS  189

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FD+LE EL+  GKA    ++D AAFNFLA++ YG +P  TKL+ DAP LI KWVLFNL
Sbjct  190   ELFDSLEKELSLKGKAEFGGSSDAAAFNFLAKAFYGTNPADTKLKADAPGLITKWVLFNL  249

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L+ GLP+ IE+PLLHTF LPPALVK DY RLYEFFYE++  IL   + LG+SREEA 
Sbjct  250   HPLLTAGLPRVIEEPLLHTFSLPPALVKSDYNRLYEFFYESAGEILVEADNLGISREEAT  309

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFN++GGMKI FPNM+K IGRAG  +H +LA+EIRSV+K+NGG++TM  +E+M
Sbjct  310   HNLLFATCFNTWGGMKILFPNMVKRIGRAGQKVHIRLAEEIRSVIKSNGGELTMGAIEKM  369

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL KS VYE  R EPPVP QY RAKRD+VIESHDA F+VK GEML+G+QP ATKDPKIFD
Sbjct  370   ELTKSVVYECLRFEPPVPAQYARAKRDMVIESHDAAFKVKAGEMLYGYQPLATKDPKIFD  429

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA EF+P RFVGE+G+ LL+HVLWSNG ETE PTV +KQCAGKDFV+LV+RL ++ELF R
Sbjct  430   RADEFVPERFVGEEGEKLLRHVLWSNGPETETPTVGNKQCAGKDFVVLVARLFVIELFRR  489

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEVG S LG+SV  +SLK+A+F
Sbjct  490   YDSFDIEVGKSALGSSVNFSSLKKASF  516



>ref|XP_010481971.1| PREDICTED: allene oxide synthase, chloroplastic [Camelina sativa]
Length=516

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/447 (68%), Positives = 368/447 (82%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQG EEFF+ RI+KY STV+R NMPPG FI+ + +VV LLDGKSF  LFDV  V
Sbjct  70    RWDYFYNQGPEEFFKSRIRKYNSTVYRVNMPPGAFIAENPQVVALLDGKSFQVLFDVDKV  129

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPSTELTGGYRILSY+DPSEP HAKLK L+FFLL   R+ + PEF   Y+
Sbjct  130   EKKDLFTGTFMPSTELTGGYRILSYLDPSEPKHAKLKTLLFFLLKSARNRIFPEFRATYS  189

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FD+LE EL+  GKA    ++D AAFNFLA++ YG +P  TKL+ DAP LI KWVLFNL
Sbjct  190   ELFDSLEKELSLKGKAEFGGSSDAAAFNFLAKAFYGTNPADTKLKADAPGLITKWVLFNL  249

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L+ GLP+ IE+PLLHTF LPPALVK DY RLYEFFYE++  IL   + LG+SREEA 
Sbjct  250   HPLLTAGLPRVIEEPLLHTFSLPPALVKSDYNRLYEFFYESAGEILVEADNLGISREEAT  309

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFN++GGMKI FPNM+K IGRAG  +H +LA+EIRSV+K+NGG++TM  +E+M
Sbjct  310   HNLLFATCFNTWGGMKILFPNMVKRIGRAGQKVHIRLAEEIRSVIKSNGGELTMGAIEKM  369

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL KS VYE  R EPPVP QY RAKRD+VIESHDA F+VK GEML+G+QP ATKDPKIFD
Sbjct  370   ELTKSVVYECLRFEPPVPAQYARAKRDMVIESHDAAFKVKAGEMLYGYQPLATKDPKIFD  429

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA EF+P RFVGE+G+ LL+HVLWSNG ETE PTV +KQCAGKDFV+LV+RL ++ELF R
Sbjct  430   RADEFVPERFVGEEGEKLLRHVLWSNGPETETPTVGNKQCAGKDFVVLVARLFVIELFRR  489

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEVG S LG+SV  +SL++A+F
Sbjct  490   YDSFDIEVGKSALGSSVNFSSLRKASF  516



>ref|NP_199079.1| allene oxide synthase [Arabidopsis thaliana]
 sp|Q96242.3|CP74A_ARATH RecName: Full=Allene oxide synthase, chloroplastic; AltName: 
Full=Cytochrome P450 74A; AltName: Full=Hydroperoxide dehydrase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF00225.1|AF172727_1 allene oxide synthase [Arabidopsis thaliana]
 emb|CAA73184.1| allene oxide synthase [Arabidopsis thaliana]
 dbj|BAB10621.1| allene oxide synthase [Arabidopsis thaliana]
 gb|AAL32906.1| allene oxide synthase [Arabidopsis thaliana]
 gb|AAL38265.1| allene oxide synthase [Arabidopsis thaliana]
 gb|AAM91133.1| allene oxide synthase [Arabidopsis thaliana]
 gb|AAM91155.1| allene oxide synthase [Arabidopsis thaliana]
 gb|AED94842.1| allene oxide synthase [Arabidopsis thaliana]
Length=518

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/447 (68%), Positives = 370/447 (83%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFY+QG EEFF+ RI+KY STV+R NMPPG FI+ + +VV LLDGKSFP LFDV  V
Sbjct  72    RWDYFYDQGAEEFFKSRIRKYNSTVYRVNMPPGAFIAENPQVVALLDGKSFPVLFDVDKV  131

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGGYRILSY+DPSEP H KLKNL+FFLL   R+ + PEF   Y+
Sbjct  132   EKKDLFTGTYMPSTELTGGYRILSYLDPSEPKHEKLKNLLFFLLKSSRNRIFPEFQATYS  191

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FD+LE EL+  GKA    ++D  AFNFLAR+ YG +P  TKL+ DAP LI KWVLFNL
Sbjct  192   ELFDSLEKELSLKGKADFGGSSDGTAFNFLARAFYGTNPADTKLKADAPGLITKWVLFNL  251

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+LS+GLP+ IE+PL+HTF LPPALVK DYQRLYEFF E++  IL   + LG+SREEA 
Sbjct  252   HPLLSIGLPRVIEEPLIHTFSLPPALVKSDYQRLYEFFLESAGEILVEADKLGISREEAT  311

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFN++GGMKI FPNM+K IGRAG  +H +LA+EIRSV+K+NGG++TM  +E+M
Sbjct  312   HNLLFATCFNTWGGMKILFPNMVKRIGRAGHQVHNRLAEEIRSVIKSNGGELTMGAIEKM  371

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL KS VYE  R EPPV  QYGRAK+D+VIESHDA F+VK GEML+G+QP AT+DPKIFD
Sbjct  372   ELTKSVVYECLRFEPPVTAQYGRAKKDLVIESHDAAFKVKAGEMLYGYQPLATRDPKIFD  431

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA EF+P RFVGE+G+ LL+HVLWSNG ETE PTV +KQCAGKDFV+LV+RL ++E+F R
Sbjct  432   RADEFVPERFVGEEGEKLLRHVLWSNGPETETPTVGNKQCAGKDFVVLVARLFVIEIFRR  491

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEVG SPLG+SV  +SL++A+F
Sbjct  492   YDSFDIEVGTSPLGSSVNFSSLRKASF  518



>ref|XP_010494202.1| PREDICTED: allene oxide synthase, chloroplastic-like [Camelina 
sativa]
Length=516

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/447 (68%), Positives = 368/447 (82%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQG EEFF+ RI+KY STV+R NMPPG FI+ + +VV LLDGKSF  LFDV  V
Sbjct  70    RWDYFYNQGPEEFFKSRIRKYNSTVYRVNMPPGAFIAENPQVVALLDGKSFQVLFDVDKV  129

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGT+MPSTELTGGYRILSY+DPSEP HAKLK L+FFLL   R+ + PEF   Y+
Sbjct  130   EKKDLFTGTFMPSTELTGGYRILSYLDPSEPKHAKLKTLLFFLLKSARNRIFPEFRATYS  189

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FD+LE EL+  GKA    ++D AAFNFLA++ YG +P  TKL+ DAP LI KWVLFNL
Sbjct  190   ELFDSLEKELSLKGKAEFGGSSDAAAFNFLAKAFYGTNPADTKLKADAPGLITKWVLFNL  249

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L+ GLP+ IE+PLLH+F LPPALVK DY RLYEFFYE++  IL   + LG+SREEA 
Sbjct  250   HPLLTAGLPRVIEEPLLHSFSLPPALVKSDYNRLYEFFYESAGEILVEADNLGISREEAT  309

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFN++GGMKI FPNM+K IGRAG  +H +LA+EIRSV+K+NGG++TM  +E+M
Sbjct  310   HNLLFATCFNTWGGMKILFPNMVKRIGRAGQKVHIRLAEEIRSVIKSNGGELTMGAIEKM  369

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL KS VYE  R EPPVP QY RAKRD+VIESHDA F+VK GEML+G+QP ATKDPKIFD
Sbjct  370   ELTKSVVYECLRFEPPVPAQYARAKRDMVIESHDAAFKVKAGEMLYGYQPLATKDPKIFD  429

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA EF+P RFVGE+G+ LL+HVLWSNG ETE PTV +KQCAGKDFV+LV+RL ++ELF R
Sbjct  430   RADEFVPERFVGEEGEKLLRHVLWSNGPETETPTVGNKQCAGKDFVVLVARLFVIELFRR  489

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEVG S LG+SV  +SL++A+F
Sbjct  490   YDSFDIEVGKSALGSSVNFSSLRKASF  516



>pdb|2RCM|A Chain A, Crystal Structure Of Arabidopsis Thaliana Allene Oxide 
Synthase Variant (F137l) (At-Aos(F137l), Cytochrome P450 
74a) At 1.73 A Resolution
 pdb|2RCM|B Chain B, Crystal Structure Of Arabidopsis Thaliana Allene Oxide 
Synthase Variant (F137l) (At-Aos(F137l), Cytochrome P450 
74a) At 1.73 A Resolution
 pdb|3DSJ|A Chain A, Crystal Structure Of Arabidopsis Thaliana Allene Oxide 
Synthase Variant (F137l) (At-Aos(F137l), Cytochrome P450 
74a, Cyp74a) Complexed With 13(S)-Hod At 1.60 A Resolution
 pdb|3DSJ|B Chain B, Crystal Structure Of Arabidopsis Thaliana Allene Oxide 
Synthase Variant (F137l) (At-Aos(F137l), Cytochrome P450 
74a, Cyp74a) Complexed With 13(S)-Hod At 1.60 A Resolution
 pdb|3DSK|A Chain A, Crystal Structure Of Arabidopsis Thaliana Allene Oxide 
Synthase Variant (F137l) (At-Aos(F137l), Cytochrome P450 
74a, Cyp74a) Complexed With 12r,13s-Vernolic Acid At 1.55 A 
Resolution
 pdb|3DSK|B Chain B, Crystal Structure Of Arabidopsis Thaliana Allene Oxide 
Synthase Variant (F137l) (At-Aos(F137l), Cytochrome P450 
74a, Cyp74a) Complexed With 12r,13s-Vernolic Acid At 1.55 A 
Resolution
Length=495

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/447 (68%), Positives = 369/447 (83%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFY+QG EEFF+ RI+KY STV+R NMPPG FI+ + +VV LLDGKSFP LFDV  V
Sbjct  45    RWDYFYDQGAEEFFKSRIRKYNSTVYRVNMPPGAFIAENPQVVALLDGKSFPVLFDVDKV  104

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+ TGTYMPSTELTGGYRILSY+DPSEP H KLKNL+FFLL   R+ + PEF   Y+
Sbjct  105   EKKDLLTGTYMPSTELTGGYRILSYLDPSEPKHEKLKNLLFFLLKSSRNRIFPEFQATYS  164

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FD+LE EL+  GKA    ++D  AFNFLAR+ YG +P  TKL+ DAP LI KWVLFNL
Sbjct  165   ELFDSLEKELSLKGKADFGGSSDGTAFNFLARAFYGTNPADTKLKADAPGLITKWVLFNL  224

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+LS+GLP+ IE+PL+HTF LPPALVK DYQRLYEFF E++  IL   + LG+SREEA 
Sbjct  225   HPLLSIGLPRVIEEPLIHTFSLPPALVKSDYQRLYEFFLESAGEILVEADKLGISREEAT  284

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFN++GGMKI FPNM+K IGRAG  +H +LA+EIRSV+K+NGG++TM  +E+M
Sbjct  285   HNLLFATCFNTWGGMKILFPNMVKRIGRAGHQVHNRLAEEIRSVIKSNGGELTMGAIEKM  344

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL KS VYE  R EPPV  QYGRAK+D+VIESHDA F+VK GEML+G+QP AT+DPKIFD
Sbjct  345   ELTKSVVYECLRFEPPVTAQYGRAKKDLVIESHDAAFKVKAGEMLYGYQPLATRDPKIFD  404

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA EF+P RFVGE+G+ LL+HVLWSNG ETE PTV +KQCAGKDFV+LV+RL ++E+F R
Sbjct  405   RADEFVPERFVGEEGEKLLRHVLWSNGPETETPTVGNKQCAGKDFVVLVARLFVIEIFRR  464

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEVG SPLG+SV  +SL++A+F
Sbjct  465   YDSFDIEVGTSPLGSSVNFSSLRKASF  491



>gb|EYU36275.1| hypothetical protein MIMGU_mgv1a004508mg [Erythranthe guttata]
Length=523

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/448 (70%), Positives = 363/448 (81%), Gaps = 12/448 (3%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQG+EEFF+ RIQ+Y STVFRTNMPPGPFIS +  VV LLDGKSFP LFD   V
Sbjct  87    RQDYFYNQGKEEFFKSRIQRYNSTVFRTNMPPGPFISVNPNVVVLLDGKSFPVLFDTDKV  146

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGGYR LS++DPSEPNHA LK LMFFLLS+RR H++PEF N Y 
Sbjct  147   EKKDLFTGTYMPSTELTGGYRTLSFLDPSEPNHAVLKKLMFFLLSYRRDHVIPEFRNCYG  206

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F +LE +++  GKA   +AN+QAAFNFLARS YG DP  TKL  D PKLI KWVLF+L
Sbjct  207   ELFRSLEEDISAKGKADFGSANEQAAFNFLARSFYGADPNETKLGPDGPKLISKWVLFHL  266

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L LGLP+ IED LLHTF LPP L+KKDY RLY+FFYE+S A+LD  E LG+SR+EAC
Sbjct  267   HPLLVLGLPRPIEDGLLHTFSLPPFLIKKDYWRLYDFFYESSGAVLDQAEKLGLSRDEAC  326

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKI-TMAGMEQ  899
             HNLVF TCFNSFGGMKI FPNMLKWIGRAG  LH +LA EIRS + ++GG   TMA ME 
Sbjct  327   HNLVFTTCFNSFGGMKILFPNMLKWIGRAGAKLHAELAGEIRSALGSDGGGAPTMAAMEN  386

Query  900   MELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF  1079
             M LMKS VYE+ RIEPPV +QYGRA+RD+V+ESH+A F+            FAT+DPKIF
Sbjct  387   MPLMKSVVYEALRIEPPVASQYGRARRDLVVESHEAAFRA-----------FATRDPKIF  435

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
             DRA EF+P RFVG +G+ LLKHV+WSNG E+E  TV +KQCAGKDFV+L SRL+LVELF 
Sbjct  436   DRADEFVPDRFVGAEGERLLKHVVWSNGPESEAATVANKQCAGKDFVVLASRLLLVELFR  495

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             RYDSFD+EV  SPLGASVT+TSLKRATF
Sbjct  496   RYDSFDVEVAPSPLGASVTVTSLKRATF  523



>sp|P48417.1|CP74_LINUS RecName: Full=Allene oxide synthase, chloroplastic; AltName: 
Full=Cytochrome P450 74A; AltName: Full=Hydroperoxide dehydrase; 
Flags: Precursor [Linum usitatissimum]
 gb|AAA03353.1| allene oxide synthase [Linum usitatissimum]
Length=536

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/448 (65%), Positives = 372/448 (83%), Gaps = 2/448 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGREEFF+ R+QKY+STV+R NMPPGPFI+S+ +V+ LLD KSFP LFD+S V
Sbjct  90    RLDYFYNQGREEFFKSRLQKYKSTVYRANMPPGPFIASNPRVIVLLDAKSFPVLFDMSKV  149

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGGYRILSY+DPSEPNH KLK L+F L+ +RR +++PEF +++ 
Sbjct  150   EKKDLFTGTYMPSTELTGGYRILSYLDPSEPNHTKLKQLLFNLIKNRRDYVIPEFSSSFT  209

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++ + +E +LA  GKA  N   +QAAFNFL+R+ +GV P+ T L  DAP LI KWVLFNL
Sbjct  210   DLCEVVEYDLATKGKAAFNDPAEQAAFNFLSRAFFGVKPIDTPLGKDAPSLISKWVLFNL  269

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+LS+GLPK++E+  LH+ RLPP LV+ DY RLYEFF   + ++LD  E  G+SR+EAC
Sbjct  270   APILSVGLPKEVEEATLHSVRLPPLLVQNDYHRLYEFFTSAAGSVLDEAEQSGISRDEAC  329

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKAN-GGKITMAGMEQ  899
             HN++FA CFNS+GG KI FP+++KWIGRAG+ LHT+LA+EIRS +++  GGK+TMA MEQ
Sbjct  330   HNILFAVCFNSWGGFKILFPSLMKWIGRAGLELHTKLAQEIRSAIQSTGGGKVTMAAMEQ  389

Query  900   MELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF  1079
             M LMKS VYE+ RIEPPV  QYG+AK+D ++ESH+A +QVKEGEMLFG+QPFATKDPKIF
Sbjct  390   MPLMKSVVYETLRIEPPVALQYGKAKKDFILESHEAAYQVKEGEMLFGYQPFATKDPKIF  449

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
             DR +EF+  RFVGE G  L+++V+WSNG ETE P+V +KQCAGKDFV++ +RL +VELF 
Sbjct  450   DRPEEFVADRFVGE-GVKLMEYVMWSNGPETETPSVANKQCAGKDFVVMAARLFVVELFK  508

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             RYDSFDIEVG S LGAS+TLTSLKR+TF
Sbjct  509   RYDSFDIEVGTSSLGASITLTSLKRSTF  536



>ref|XP_010255032.1| PREDICTED: allene oxide synthase-like [Nelumbo nucifera]
Length=544

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/447 (71%), Positives = 378/447 (85%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGRE++FR RIQKY+STVFR NMPPG FI+S+ +V+ LLDG+SFP LFDVS V
Sbjct  99    RLDYFYNQGREDYFRSRIQKYRSTVFRANMPPGHFIASNPRVIVLLDGQSFPVLFDVSKV  158

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRD+FTGT+MPST+LTGGYR+LSY+DPSEPNHAKLK L+FFLL   R  ++PEFH  + 
Sbjct  159   EKRDLFTGTFMPSTQLTGGYRVLSYLDPSEPNHAKLKQLIFFLLQSSRQRIIPEFHATFT  218

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLE+ELA  GKA     NDQA FNFLAR+ YG +P  +KL  D P L+ KWVL  L
Sbjct  219   ELFETLESELAAKGKADFGGPNDQACFNFLARAFYGANPSESKLGHDGPNLVAKWVLLQL  278

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L+LGLP  +ED LLHTFRLPP LVK DYQRLY+FFY+ S  ILD GE +G+ REEAC
Sbjct  279   GPLLTLGLPSLVEDLLLHTFRLPPVLVKSDYQRLYDFFYQVSGRILDEGEKMGIKREEAC  338

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKI FPN+LK+ GRAG  LH QLA+EIRS V++NGGK+TMA MEQM
Sbjct  339   HNLLFATCFNSFGGMKILFPNLLKFTGRAGPKLHRQLAEEIRSAVRSNGGKVTMAAMEQM  398

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RIEPPV  QYG+AKRD+VIESHDA F+VKEGEMLFG+QPFAT+DPKIF+
Sbjct  399   PLMKSVVYEALRIEPPVALQYGKAKRDLVIESHDAAFEVKEGEMLFGYQPFATRDPKIFE  458

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+P RFVGE G+ LLKHVLWSNG E E+PTV +KQCAGKDFV+LVSRL++VE+F R
Sbjct  459   RAEEFVPDRFVGE-GEKLLKHVLWSNGPEAESPTVENKQCAGKDFVVLVSRLLVVEMFQR  517

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG S LGA++TLTS+KRA+F
Sbjct  518   YDSFEIEVGKSALGAAITLTSVKRASF  544



>ref|XP_010910500.1| PREDICTED: allene oxide synthase 1, chloroplastic-like [Elaeis 
guineensis]
Length=520

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/447 (66%), Positives = 370/447 (83%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R++YFY +GR++FF+ RI++++STVFR NMPPGPF++ D +VV LLD  SFP LFD S+V
Sbjct  74    RLNYFYFEGRDKFFKSRIRQHRSTVFRVNMPPGPFLAPDPRVVALLDAASFPVLFDTSLV  133

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRD+FTGT+MPST+LTGG+RILSY+DPSEPNHA LK L+FFLLS+RR  ++PEF   + 
Sbjct  134   EKRDLFTGTFMPSTDLTGGFRILSYLDPSEPNHASLKKLLFFLLSYRRQSIVPEFRRTFG  193

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +FDTLE ELA  GKA    AND+AAF+FLARSL G DP+ T L LD PKLI KWV+F +
Sbjct  194   SLFDTLEAELAKKGKANFGEANDRAAFDFLARSLLGKDPVETNLGLDGPKLITKWVVFQV  253

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L+LGLP  +ED LLH+FRLPPALV+ DY RL +FF E++  +L   E LG+SREEA 
Sbjct  254   GPLLTLGLPNYLEDFLLHSFRLPPALVRADYNRLADFFRESAGPVLGEAERLGISREEAV  313

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HN++FATCFN+FGGM I FP+++KW+GRAG  LH +LA+EIRS V+ANGG+++M  ME M
Sbjct  314   HNILFATCFNAFGGMNILFPSLIKWVGRAGARLHGRLAQEIRSAVRANGGEVSMRAMEAM  373

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ R EPPVP QYGRAKRD+V+ESHDARF+V+ GEMLFG+QPFATKDPK+FD
Sbjct  374   PLMKSVVYETLRSEPPVPLQYGRAKRDLVVESHDARFEVRAGEMLFGYQPFATKDPKVFD  433

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RFVGE G+ +L+HVLWSNG ET  PT  +KQCAGKDFV+LV+R+++VELFLR
Sbjct  434   RAEEFVAERFVGEVGERMLRHVLWSNGPETAAPTTENKQCAGKDFVVLVARMLVVELFLR  493

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IE G S LG+SV LTSLKRATF
Sbjct  494   YDSFEIEAGSSALGSSVKLTSLKRATF  520



>ref|XP_010525633.1| PREDICTED: allene oxide synthase, chloroplastic [Tarenaya hassleriana]
Length=530

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/447 (66%), Positives = 359/447 (80%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG EEFF+ R++K+ STVFR NMPPG FI+ +  VV LLDGKSFP LFD   V
Sbjct  84    RLDYFYNQGAEEFFKSRMRKHNSTVFRVNMPPGSFIAENPNVVALLDGKSFPVLFDTDKV  143

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+++FTGTYMPSTELTGGYR+LSY+DPSEP HA LKNL+FF+L   RH + PEF   Y+
Sbjct  144   EKKNLFTGTYMPSTELTGGYRVLSYLDPSEPKHAMLKNLIFFVLKSSRHRIFPEFRATYS  203

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +FD LE ELAG GKA  +   + AAF FLAR++YG +P  T L +DAP LI KWV FNL
Sbjct  204   NLFDELEKELAGKGKADFSGTGETAAFEFLARAMYGKNPKETSLGVDAPGLISKWVFFNL  263

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+LS+GLPK +ED LLH+FRLPP+LVK DYQRLY+FF + S  IL   E LG+SR+EA 
Sbjct  264   HPLLSIGLPKLLEDSLLHSFRLPPSLVKSDYQRLYDFFAQYSGEILAEAEKLGISRDEAI  323

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFN++GGMKI F N++K IGRAG  L T+LA EIRS + +NGG +TMA +E+M
Sbjct  324   HNLLFATCFNTWGGMKILFSNLMKQIGRAGTRLQTRLASEIRSEIASNGGDLTMAMIERM  383

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL KS VYE  RIEPPV  QYGRAKRD+V+ESHD  F+V+ GEMLFG+QPFATKDP+IFD
Sbjct  384   ELTKSVVYECLRIEPPVSAQYGRAKRDLVVESHDGAFRVRAGEMLFGYQPFATKDPRIFD  443

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+P RFVG +G+ LL+HV+WSNG ETE  T  +KQCAGKDFV+LV+RL L+E F R
Sbjct  444   RAEEFVPERFVGPEGERLLRHVVWSNGPETEAATAENKQCAGKDFVVLVARLFLIEFFRR  503

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEVG S +G S+T+TSL++A+F
Sbjct  504   YDSFDIEVGSSAIGNSITVTSLRKASF  530



>ref|XP_010530372.1| PREDICTED: allene oxide synthase, chloroplastic-like [Tarenaya 
hassleriana]
Length=525

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/447 (66%), Positives = 363/447 (81%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQG EEFF+ RI+KY STVFR NMPPG FI+ +  VV LLDGKSF  LFD   V
Sbjct  79    RFDYFYNQGAEEFFKSRIRKYNSTVFRVNMPPGSFIAENPNVVALLDGKSFSVLFDNDKV  138

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK++VFTGTYMPSTELTGGYR+LSY+D SEPNHAKLKNL+FF+L   RH +LPEF   Y+
Sbjct  139   EKKNVFTGTYMPSTELTGGYRVLSYLDTSEPNHAKLKNLIFFVLKSSRHRILPEFRATYS  198

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FD LE ELA  GKA  + A ++AAF FLAR++YG +P  T L +DAP LI KWV FNL
Sbjct  199   ELFDDLEKELAVKGKADFSGAGERAAFEFLARAMYGKNPKETSLGVDAPSLISKWVFFNL  258

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+LS+GLPK +ED LLHTFRLPP+LVK DYQRLY+FF E S   L   E LG+SREEA 
Sbjct  259   HPLLSIGLPKLLEDSLLHTFRLPPSLVKSDYQRLYDFFAEYSGEYLAEAEKLGISREEAT  318

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFN++GGMKI F N++K +GRAG  L TQLA+EIRS +++NGG++ MA +E+M
Sbjct  319   HNLLFATCFNTWGGMKILFSNLMKRVGRAGTRLQTQLAEEIRSEIRSNGGELKMAAIERM  378

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             +L +S VYE  RIEPPVP QYGRA++D+V+ESHD  F+V+ GE+LFG+QPFATKD +IFD
Sbjct  379   KLTRSVVYECLRIEPPVPAQYGRARQDLVVESHDGAFRVRAGEILFGYQPFATKDSRIFD  438

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA++F+P RF+GE+G+ LL+HV+WSNG ET   T  +KQCAGKDFV+LV+ L LVE+F R
Sbjct  439   RAEDFVPDRFIGEEGEKLLRHVVWSNGPETAAATTENKQCAGKDFVVLVATLFLVEVFRR  498

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEVG S +G+S+T+TSL++A+F
Sbjct  499   YDSFDIEVGSSAIGSSITVTSLRKASF  525



>gb|ABU62577.1| chloroplast allene oxide synthase [Passiflora edulis]
Length=504

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/445 (65%), Positives = 363/445 (82%), Gaps = 1/445 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R D+FYNQG  EFF+ R +KYQSTVF+ NMPPGPFI+SDS+V+ LLDGKSFP LFDV+ V
Sbjct  57    RRDFFYNQGPNEFFKSRSEKYQSTVFKANMPPGPFIASDSRVIVLLDGKSFPVLFDVTKV  116

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+DVFTGTYMPST+LTGGYRILSY+DPSEP H KLK  +F+LL  R  H++PEF  +++
Sbjct  117   EKKDVFTGTYMPSTKLTGGYRILSYLDPSEPKHEKLKQPLFYLLKTRSDHIVPEFSKSFS  176

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+ LE E+A  G A  N ANDQA FNFL R+ +G +P  TKL    PKLI  WVLFNL
Sbjct  177   ELFNGLEKEIAEKGIAPYNDANDQAVFNFLGRAWFGKNPADTKLGTSGPKLISLWVLFNL  236

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L+LGLP+ IE+   H+FRLP  L+K  Y++LY+FFY ++  + +  E LG+S++EAC
Sbjct  237   GPILTLGLPRIIEELTFHSFRLPACLIKSSYRKLYDFFYSSAGFVFEEAERLGISKDEAC  296

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             +NLVFATCFNSFGG KI FP++L+W+G AG  +H+QLA+EIRS +K  GGKITM  MEQM
Sbjct  297   NNLVFATCFNSFGGFKIIFPSLLRWLGSAGEEVHSQLAQEIRSAIKKAGGKITMGAMEQM  356

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE  R+EPPVP QYG+AKRD+VIESHDA F++K+GEMLFGFQPFATKDPKIFD
Sbjct  357   PLMKSVVYEVLRLEPPVPHQYGKAKRDLVIESHDASFEIKQGEMLFGFQPFATKDPKIFD  416

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             +A+EF+P RFVGE G+ LL+HVLWSNG ETE+PTV++KQCAGK+FV+  SRL +V+LFLR
Sbjct  417   KAEEFVPDRFVGE-GEKLLQHVLWSNGPETESPTVSNKQCAGKNFVVFASRLFVVDLFLR  475

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRA  1337
             YD+F IE+G S LG ++++TSLK+A
Sbjct  476   YDTFTIEIGSSALGTAISITSLKKA  500



>ref|XP_008801805.1| PREDICTED: LOW QUALITY PROTEIN: allene oxide synthase 1, chloroplastic-like, 
partial [Phoenix dactylifera]
Length=517

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/447 (67%), Positives = 374/447 (84%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R++YFY +GR+EFF+ RIQ++QSTVFR NMPPGPF++ D +VV LLD  SFP LFD S+V
Sbjct  71    RLNYFYFEGRDEFFKSRIQQHQSTVFRVNMPPGPFVAPDPRVVALLDAASFPVLFDTSLV  130

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRD+FTGT+MPST LTGG+R+LSY+DPSEPNHA LK L+FFLLS RRH ++PEF   + 
Sbjct  131   EKRDLFTGTFMPSTNLTGGFRVLSYLDPSEPNHAPLKKLLFFLLSSRRHAIIPEFRRTFG  190

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +FDTLE ELA  GKA    AND+AAF+FLARSL G DP+ TKL L+ PKLI KWVLF L
Sbjct  191   SLFDTLEAELAKKGKADFGEANDRAAFDFLARSLLGKDPVETKLGLEGPKLITKWVLFQL  250

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L+LGLP  +ED  LH+FRLPPALV+ DY RL +FF+E++   LD  + LG+SREEA 
Sbjct  251   GPLLTLGLPNYLEDFFLHSFRLPPALVRGDYNRLADFFWESAGPALDEADRLGISREEAV  310

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HN++FATCFN+FGGMKI FP+++KW+GRAG  LH +LA EIRS V+ANGG+++M  ME M
Sbjct  311   HNILFATCFNAFGGMKILFPSLIKWVGRAGARLHGRLANEIRSAVRANGGEVSMRAMESM  370

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RIEPPVP Q+GRAKR++V+ESHDARF+V+ GEMLFG+QPFATKDP++FD
Sbjct  371   PLMKSVVYETLRIEPPVPLQHGRAKRNLVVESHDARFEVRAGEMLFGYQPFATKDPRVFD  430

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RFVG+ G+A+L+HVLWSNG ETE PT  +KQCAGKDFV+LV+R+++VELFLR
Sbjct  431   RAEEFVAERFVGDAGEAMLRHVLWSNGPETEAPTTENKQCAGKDFVVLVARMLVVELFLR  490

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG S LG+SV +TSLKRATF
Sbjct  491   YDSFEIEVGSSALGSSVKMTSLKRATF  517



>ref|XP_006282285.1| hypothetical protein CARUB_v10028569mg [Capsella rubella]
 gb|EOA15183.1| hypothetical protein CARUB_v10028569mg [Capsella rubella]
Length=529

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/428 (68%), Positives = 355/428 (83%), Gaps = 0/428 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQG EEFF+ RI+KY STVFR NMPPG FI+ + +VV LLDGKSFP LFDV  V
Sbjct  73    RWDYFYNQGPEEFFKSRIRKYDSTVFRVNMPPGAFIAENPRVVALLDGKSFPVLFDVDKV  132

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGG+RILSY+DPSEP HAKLK L+FFLL   R+ + PEF   Y+
Sbjct  133   EKKDIFTGTYMPSTELTGGFRILSYLDPSEPKHAKLKTLLFFLLKSARNRIFPEFRATYS  192

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FD+LE EL+  GKA    ++D AAFNFLA++ YG +P  TKL+ DAP LI KWVLFNL
Sbjct  193   ELFDSLEKELSLKGKAEFGGSSDAAAFNFLAKAFYGTNPADTKLKADAPGLITKWVLFNL  252

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L+ GLP+ IE+PLLHTF LPPALVK DYQRLY+FF++++  IL   + LG+SREEA 
Sbjct  253   HPLLTAGLPRIIEEPLLHTFSLPPALVKSDYQRLYDFFFDSAGEILVEADKLGISREEAT  312

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFN++GGMKI FPNM+K IGRAG  +H +LA+EIRSV+K+NGG++TM  +E+M
Sbjct  313   HNLLFATCFNTWGGMKILFPNMVKRIGRAGQKVHIRLAEEIRSVIKSNGGELTMGSIEKM  372

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL KS VYE  R EPPVP QYG+AK+D+VIESHDA F+VK GE+L+G+QP AT+DPKIFD
Sbjct  373   ELTKSVVYECLRFEPPVPAQYGKAKKDLVIESHDAAFKVKAGEVLYGYQPLATRDPKIFD  432

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             +A EF+P RFVGE+G+ LL +V WSNGRETE PTV +KQCAGKDFV+LV+RL ++ELF R
Sbjct  433   KADEFVPERFVGEEGEKLLGNVFWSNGRETETPTVGNKQCAGKDFVVLVARLFVIELFRR  492

Query  1263  YDSFDIEV  1286
             YDSFDIEV
Sbjct  493   YDSFDIEV  500



>ref|XP_010263820.1| PREDICTED: allene oxide synthase-like [Nelumbo nucifera]
Length=567

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/447 (68%), Positives = 372/447 (83%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+++F  R+  YQSTVFR NMPP  FI+S+  V+ LLDGKSFP LFDVS V
Sbjct  121   RLDYFYNQGRDKYFSSRVLNYQSTVFRANMPPAYFIASNPNVIVLLDGKSFPVLFDVSKV  180

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPST+LTGGYRILSY+DPSEP HAKLK L+FFLL   R+ ++PEFH A+ 
Sbjct  181   EKKDLFTGTYMPSTQLTGGYRILSYLDPSEPKHAKLKQLLFFLLQSSRYRVIPEFHTAFT  240

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+TLE+++A  GK G    NDQA FNFLAR+ Y  +P  +KL  D P L+ KWV+F+L
Sbjct  241   ELFETLESQIAAKGKEGFGDINDQACFNFLARAFYEANPPESKLGTDGPSLVAKWVIFHL  300

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L+LGLPK +E+ LLHTF LPP L+K DYQRLY+FF+  S  ILD  + +G+ REEAC
Sbjct  301   GPILTLGLPKLLEELLLHTFSLPPILIKSDYQRLYDFFHGASGRILDEAKKMGIEREEAC  360

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKI FP+++K+IG AG +LH +LA+E+RS +++NGGK+TMA MEQM
Sbjct  361   HNLLFATCFNSFGGMKILFPSLVKYIGGAGSALHEKLAEEVRSAIRSNGGKVTMAAMEQM  420

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RI+PPVP QYGRAKRD+VIESHDA F+VK+GEMLFGFQPFATKDP+IFD
Sbjct  421   PLMKSVVYEALRIDPPVPFQYGRAKRDLVIESHDATFEVKKGEMLFGFQPFATKDPEIFD  480

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R +EF+P RFVGE G+ LLKHV+WSNG ETE+PTV +KQCAGKDFV+ VSRL +VELF R
Sbjct  481   RPEEFVPDRFVGE-GEKLLKHVIWSNGPETESPTVENKQCAGKDFVVWVSRLFVVELFQR  539

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG S LG+SVT TS+K+A+F
Sbjct  540   YDSFEIEVGTSALGSSVTFTSVKKASF  566



>gb|ADN92996.2| allene oxide synthase AOS [Ipomoea nil]
Length=376

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/376 (79%), Positives = 330/376 (88%), Gaps = 0/376 (0%)
 Frame = +3

Query  216   PSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYAEMFDTLEnela  395
             PSTELTGGYRILSY+DPSEP HA+LK LMFFLLS RR H++PEFH ++ EMF+ LE E+A
Sbjct  1     PSTELTGGYRILSYLDPSEPKHAQLKQLMFFLLSSRRGHVIPEFHRSFTEMFEGLEKEVA  60

Query  396   gngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNLHPVLSLGLPKQ  575
               GK GLNAANDQAAFNFLARS +GVDP  TK+  D P L+GKWV+FNLHP+L LGLPK 
Sbjct  61    SKGKVGLNAANDQAAFNFLARSWFGVDPAGTKIGNDGPNLVGKWVVFNLHPLLVLGLPKG  120

Query  576   IEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEACHNLVFATCFNS  755
             +E+ LLHTFRLP ALVKKDYQRLYEFFY NST ILD  E LG+SREEACHNL+FATCFNS
Sbjct  121   LEEALLHTFRLPAALVKKDYQRLYEFFYANSTEILDEAENLGLSREEACHNLLFATCFNS  180

Query  756   FGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQMELMKSTVYESF  935
             FGGMKIFFPNM+KWIGR G  LH QLA+EIRSVVK+NGGK+TMAGMEQM LMKS VYE+ 
Sbjct  181   FGGMKIFFPNMIKWIGRGGAKLHAQLAREIRSVVKSNGGKVTMAGMEQMPLMKSVVYEAL  240

Query  936   RIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFDRAQEFIPHRFV  1115
             RIEPPVP QYGRAKRD V+ESHDA F+VKEGEMLFGFQPFATKDPKIFDRA+EF+P RF 
Sbjct  241   RIEPPVPAQYGRAKRDFVVESHDAVFEVKEGEMLFGFQPFATKDPKIFDRAEEFVPDRFT  300

Query  1116  GEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLRYDSFDIEVGMS  1295
             GE    LL HVLWSNG ETE+PTVN+KQCAGKDFV+LVSRLM+VELFLRYDSFDIEVG S
Sbjct  301   GENANELLSHVLWSNGPETESPTVNNKQCAGKDFVVLVSRLMVVELFLRYDSFDIEVGTS  360

Query  1296  PLGASVTLTSLKRATF  1343
             PLGASVT+TSLKRA+F
Sbjct  361   PLGASVTVTSLKRASF  376



>gb|AGV22360.1| allene oxide synthase 2, partial [Gossypium arboreum]
Length=418

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/418 (70%), Positives = 345/418 (83%), Gaps = 0/418 (0%)
 Frame = +3

Query  90    MPPGPFISSDSKVVCLLDGKSFPTLFDVSVVEKRDVFTGTYMPSTELTGGYRILSYIDPS  269
             MPPGPFIS D KVV LLDGKSFP LFDV+ VEK+D+FTGTYMPST+LTGGYRILSY+DPS
Sbjct  1     MPPGPFISQDPKVVALLDGKSFPVLFDVTKVEKKDLFTGTYMPSTDLTGGYRILSYLDPS  60

Query  270   EPNHAKLKNlmffllshrrhhllPEFHNAYAEMFDTLEnelagngkaglnaanDQAAFNF  449
             EP HA+ K L+ FLL  RR H++PEF  +Y+E+F+TLE E+A  GK+    ANDQA FNF
Sbjct  61    EPKHARPKQLLLFLLKSRRDHVIPEFQASYSELFETLEKEVAEKGKSSFQTANDQAGFNF  120

Query  450   LARSLYGVDPMRTKLRLDAPKLIGKWVLFNLHPVLSLGLPKQIEDPLLHTFRLPPALVKK  629
             L R+ +G +P  TKL  D P LI KWVLF L PVLSLGLP  +E+ ++ TF LPP LVKK
Sbjct  121   LCRAFFGSNPPDTKLGDDGPSLISKWVLFQLGPVLSLGLPTYVEELVIRTFPLPPFLVKK  180

Query  630   DYQRLYEFFYENSTAILDHGEILGVSREEACHNLVFATCFNSFGGMKIFFPNMLKWIGRA  809
             DY+RLY+FFY +S  + D  E LG+SREE CHNL+FATCFN+FGGMKIFFPNMLKWI RA
Sbjct  181   DYRRLYDFFYHSSGFVQDEAEKLGISREEVCHNLLFATCFNTFGGMKIFFPNMLKWISRA  240

Query  810   GVSLHTQLAKEIRSVVKANGGKITMAGMEQMELMKSTVYESFRIEPPVPTQYGRAKRDIV  989
             G  LHT LA+EIRS +++NGGK+TMA MEQM LM S VYE  RIEPPVP+QYGRAK+D++
Sbjct  241   GAKLHTDLAQEIRSAIRSNGGKLTMAAMEQMPLMTSVVYEGLRIEPPVPSQYGRAKKDLL  300

Query  990   IESHDARFQVKEGEMLFGFQPFATKDPKIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRE  1169
             IESHDA +QVK GEML+G+QPFATKDPKIF+  +EF+P RF+G+ G  LLKHVLWSNG E
Sbjct  301   IESHDAVYQVKAGEMLYGYQPFATKDPKIFENPEEFVPDRFMGDDGGRLLKHVLWSNGPE  360

Query  1170  TENPTVNDKQCAGKDFVMLVSRLMLVELFLRYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             TE+PT  +KQCAGKDFV+LVSRL +VELF RYDSF+IEVG SPLGA+VT+TSLKRA+F
Sbjct  361   TEDPTTANKQCAGKDFVVLVSRLFVVELFRRYDSFEIEVGKSPLGAAVTVTSLKRASF  418



>ref|XP_009388934.1| PREDICTED: allene oxide synthase 1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=485

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/448 (64%), Positives = 364/448 (81%), Gaps = 1/448 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+ YFY +GR+ FF+ R+++Y STVFR NMPPGPF++SD +V+ LLD  SFP LFD S+V
Sbjct  38    RLAYFYFEGRDAFFKSRMRRYNSTVFRANMPPGPFLASDPRVIVLLDAASFPLLFDTSLV  97

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRD+FTGT+MPST+LTGG+R+LSY+DPSEPNHA LK L+FFLLS+RR  ++PEF + Y 
Sbjct  98    EKRDLFTGTFMPSTQLTGGFRVLSYLDPSEPNHAPLKRLLFFLLSNRRQAVIPEFRHTYG  157

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +F+T+E E+A  GKA   AAND+AAF+FLARS +G +P  ++L LD P LI KW+LF +
Sbjct  158   ALFETMEAEIAAKGKADFGAANDRAAFDFLARSFFGRNPKDSELGLDGPGLITKWMLFQV  217

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L+LGLP  +ED LLH+FRLPPALV+ DY RL  FF E++  +LD  E LG+SREEA 
Sbjct  218   GPLLTLGLPTYLEDLLLHSFRLPPALVRSDYDRLAAFFRESAGPVLDEAERLGISREEAL  277

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKA-NGGKITMAGMEQ  899
             HN++FATCFNSFGGMKI FPN++KWIGRAG  LH +LA+E+R+ V+   GG++TM  +E 
Sbjct  278   HNILFATCFNSFGGMKILFPNLIKWIGRAGAPLHGRLAEEVRTAVQEIGGGEVTMRAIEA  337

Query  900   MELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF  1079
             M L  S  YE+ RIEPPVP QYGRAKRD+V+ SHDA FQV+ GEMLFG+QPFAT+DP++F
Sbjct  338   MPLTASAAYEALRIEPPVPLQYGRAKRDMVVASHDAAFQVRAGEMLFGYQPFATRDPRVF  397

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
             +RA+EF+  RFVGE G  LL+HV+WSNG ETE PT  +KQCAGKDFV++V+RL+LVELFL
Sbjct  398   ERAEEFVADRFVGEGGAPLLRHVVWSNGPETEAPTAENKQCAGKDFVVMVARLLLVELFL  457

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             RYDSF+IEVG S LG+SV  TSLK+ATF
Sbjct  458   RYDSFEIEVGTSALGSSVKFTSLKKATF  485



>ref|XP_010941897.1| PREDICTED: allene oxide synthase 1, chloroplastic-like [Elaeis 
guineensis]
Length=519

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/447 (68%), Positives = 367/447 (82%), Gaps = 0/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R++YFY +GR+EFF  RI+++ STVFR NMPPGP ++ D +VV LLD  SFP LFD  +V
Sbjct  73    RLNYFYFEGRDEFFNSRIRQHGSTVFRVNMPPGPLVAPDPRVVALLDAVSFPVLFDTGLV  132

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRD+FTGT+MPSTELTGGYR+LSY+DPSEPNHA LK L+FFLLS RRH ++PEF   + 
Sbjct  133   EKRDLFTGTFMPSTELTGGYRVLSYLDPSEPNHAPLKKLLFFLLSSRRHAIIPEFRRTFG  192

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +FDTLE ELA  GKA    ANDQAAF+FLARSL G DP+ TKL LD PKLI KWVLF L
Sbjct  193   SLFDTLEAELAKKGKADFGEANDQAAFDFLARSLLGKDPVETKLGLDGPKLITKWVLFQL  252

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L+LGLP  +ED  LH+FRLPPALV+ DY RL +FF E +   LD  E LG+SR EA 
Sbjct  253   GPLLTLGLPNYLEDFFLHSFRLPPALVRADYNRLADFFREFAGPALDEAERLGISRAEAV  312

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HN++FAT FN+FGGMKI FP+++KW+GRAG  LH +LA EIRS V+ANGG+++M  ME M
Sbjct  313   HNILFATSFNAFGGMKILFPSLIKWVGRAGARLHGRLADEIRSAVRANGGEVSMRAMEAM  372

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RIEPPVP QYGRAKRD+V+ESHD+RF+V+ GEMLFG+QPFATKDP++FD
Sbjct  373   PLMKSVVYETLRIEPPVPLQYGRAKRDLVVESHDSRFEVRAGEMLFGYQPFATKDPRVFD  432

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RFVGE G+A+L+HVLWSNG ETE PT  +KQCAGKDFV+LV+R+++VELFLR
Sbjct  433   RAEEFVAERFVGEAGEAMLRHVLWSNGPETEAPTTENKQCAGKDFVVLVARMLVVELFLR  492

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEVG S LG+SV LTSLKRA+F
Sbjct  493   YDSFEIEVGSSALGSSVKLTSLKRASF  519



>gb|AIU98468.1| allene oxide synthase [Gossypium hirsutum]
Length=418

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/418 (69%), Positives = 340/418 (81%), Gaps = 0/418 (0%)
 Frame = +3

Query  90    MPPGPFISSDSKVVCLLDGKSFPTLFDVSVVEKRDVFTGTYMPSTELTGGYRILSYIDPS  269
             MPPGPFIS D KV+ LLDGKSFP LFDVS +EK+DVFTGTYMPST+LTGGYRILSY+DPS
Sbjct  1     MPPGPFISPDPKVIALLDGKSFPVLFDVSKIEKKDVFTGTYMPSTDLTGGYRILSYLDPS  60

Query  270   EPNHAKLKNlmffllshrrhhllPEFHNAYAEMFDTLEnelagngkaglnaanDQAAFNF  449
             EP HAKLK L+FFLL      ++PEF   Y E++D L+ ELA  GK+     NDQA FNF
Sbjct  61    EPKHAKLKQLIFFLLKSSAKRVIPEFEACYTELYDLLDKELAEKGKSSFQTVNDQAGFNF  120

Query  450   LARSLYGVDPMRTKLRLDAPKLIGKWVLFNLHPVLSLGLPKQIEDPLLHTFRLPPALVKK  629
             L R+ +G +P  TKL  D P LI KWVLF L PVLSLGLP  +E+ ++ T  LPP LVKK
Sbjct  121   LCRAFFGSNPPDTKLGDDGPSLISKWVLFQLGPVLSLGLPTYVEELVIRTLPLPPFLVKK  180

Query  630   DYQRLYEFFYENSTAILDHGEILGVSREEACHNLVFATCFNSFGGMKIFFPNMLKWIGRA  809
             DY+RLY+FFY +S  + D  E LG+SREE CHNL+FATCFN+FGGMKIFFP+MLKWI RA
Sbjct  181   DYRRLYDFFYHSSGFVQDEAEKLGISREEVCHNLLFATCFNTFGGMKIFFPSMLKWISRA  240

Query  810   GVSLHTQLAKEIRSVVKANGGKITMAGMEQMELMKSTVYESFRIEPPVPTQYGRAKRDIV  989
             GV LHT LA+EIRS +++NGGK+TMA MEQM LMKS VYE  RIEPPVP+QYGRAK+D++
Sbjct  241   GVKLHTDLAQEIRSAIRSNGGKLTMAAMEQMPLMKSVVYEGLRIEPPVPSQYGRAKKDLL  300

Query  990   IESHDARFQVKEGEMLFGFQPFATKDPKIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRE  1169
             IESHDA + VK GEML+G+QPFATKDPKIF+  +EF+P RF+G+ G  LLKHVLWSNG E
Sbjct  301   IESHDAVYLVKAGEMLYGYQPFATKDPKIFENPEEFVPDRFMGDDGGRLLKHVLWSNGPE  360

Query  1170  TENPTVNDKQCAGKDFVMLVSRLMLVELFLRYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             TE+PT  +KQCAGKDFV+LVSRL +VELF RYDSF+IEVG SPLGA+VT+TSLKRA+F
Sbjct  361   TEDPTTANKQCAGKDFVVLVSRLFVVELFRRYDSFEIEVGKSPLGAAVTVTSLKRASF  418



>ref|XP_010547834.1| PREDICTED: allene oxide synthase, chloroplastic-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010547835.1| PREDICTED: allene oxide synthase, chloroplastic-like isoform 
X2 [Tarenaya hassleriana]
Length=522

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/446 (63%), Positives = 351/446 (79%), Gaps = 0/446 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFY QG  EFFR R++KY STVFR N+PPGPFI+ +   V LLDGKSFP LFD S V
Sbjct  76    RFDYFYFQGNMEFFRSRVEKYGSTVFRVNLPPGPFIAENPNAVVLLDGKSFPVLFDTSKV  135

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+++FTGT+MPST+LTGG+R+LSY+DPSE NH KLKNL+FF+L   R  ++PEF   YA
Sbjct  136   EKKNLFTGTFMPSTKLTGGHRVLSYLDPSELNHGKLKNLLFFILKSSRDRVIPEFQAVYA  195

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F  LE EL   GKA    A + AAFNFL+RSL G +P+ T L  +APKLIGKWVL NL
Sbjct  196   ELFKKLETELDSTGKAEFVEAGEIAAFNFLSRSLLGANPVHTNLGNEAPKLIGKWVLLNL  255

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HPV+SLGLP  +ED LLH FRLP +LVK +Y RLY FF E+S   LD  E LG+SR+EAC
Sbjct  256   HPVISLGLPMILEDLLLHNFRLPSSLVKSEYSRLYNFFNESSAKFLDEAEKLGISRDEAC  315

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HN++F+ CFNSFGG KI FPN+LK IG AG  LHTQLA+EIRS +K+NGG +T+  ++QM
Sbjct  316   HNILFSICFNSFGGFKILFPNVLKHIGEAGEQLHTQLAREIRSAIKSNGGHLTIGALDQM  375

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              L KS VYES R EPPV +QYGRAKRD+V+ESHDA ++++ GEML+GFQPFAT+DP+IFD
Sbjct  376   PLTKSVVYESLRFEPPVQSQYGRAKRDLVVESHDAAYRIRSGEMLYGFQPFATRDPRIFD  435

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
              A +FI  RFVGEKG+ LLKHV+WSNG ETE+PT  +KQCAGKDFV++ +RL +VELF R
Sbjct  436   EADKFIADRFVGEKGEKLLKHVVWSNGPETEDPTPENKQCAGKDFVVMAARLFVVELFRR  495

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRAT  1340
             YDSF++ V  + +G+ VTLT+L +A+
Sbjct  496   YDSFEVVVKKAAIGSFVTLTALTKAS  521



>emb|CAA63266.1| allene oxide synthase [Arabidopsis thaliana]
Length=517

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/447 (65%), Positives = 351/447 (79%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFY+QG EEFF+ RI+KY STV+R NMPPG FI+ + +VV LLDGKSFP LFDV  V
Sbjct  72    RWDYFYDQGAEEFFKSRIRKYNSTVYRVNMPPGAFIAENPQVVALLDGKSFPVLFDVDKV  131

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPSTELTGGYRILSY+DPSEP H KLKNL+FFLL   R+ + PEF   Y+
Sbjct  132   EKKDLFTGTYMPSTELTGGYRILSYLDPSEPKHEKLKNLLFFLLKSSRNRIFPEFQATYS  191

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FD+LE E     ++G      +    FL  S    +  R KL+ DAP LI KWVLFNL
Sbjct  192   ELFDSLEKEAFPLRESGFRRFQRRNRLLFLGSSFLRDESRRYKLKADAPGLITKWVLFNL  251

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+LS+GLP+ IE+PL+HTF LPPALVK DYQRLYEF       IL   + LG+SREEA 
Sbjct  252   HPLLSIGLPRVIEEPLIHTFSLPPALVKSDYQRLYEFLRIRG-EILVEADKLGISREEAT  310

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FAT FN++GGMKI FPNM+K IG  G  +H +LA+EIRSV+K+NGG++TM  +E+M
Sbjct  311   HNLLFATSFNTWGGMKILFPNMVKRIGPGGHQVHNRLAEEIRSVIKSNGGELTMGAIEKM  370

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL KS VYE  R EPPV  QYGRAK+D+VIESHDA F+VK GEML+G+QP AT+DPKIFD
Sbjct  371   ELTKSVVYECLRFEPPVTAQYGRAKKDLVIESHDAAFKVKAGEMLYGYQPLATRDPKIFD  430

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA EF+P RFVGE+G+ LL+HVLWSNG ETE PTV +KQCAGKDFV+LV+RL ++E+F R
Sbjct  431   RADEFVPERFVGEEGEKLLRHVLWSNGPETETPTVGNKQCAGKDFVVLVARLFVIEIFRR  490

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEVG SPLG+SV  +SL++A+F
Sbjct  491   YDSFDIEVGTSPLGSSVNFSSLRKASF  517



>sp|Q40778.2|C74A2_PARAR RecName: Full=Allene oxide synthase; AltName: Full=Cytochrome 
P450 74A2; AltName: Full=Rubber particle protein; Short=RPP 
[Parthenium argentatum]
 pdb|3DAM|A Chain A, Crystal Structure Of Allene Oxide Synthase
 pdb|3DAN|A Chain A, Crystal Structure Of Allene Oxide Synthase
 pdb|3DBM|A Chain A, Crystal Structure Of Allene Oxide Synthase
 emb|CAA55025.2| rubber particle protein [Parthenium argentatum]
Length=473

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/448 (63%), Positives = 358/448 (80%), Gaps = 3/448 (1%)
 Frame = +3

Query  3     RIDYFYNQG-REEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSV  179
             R++YFY  G R+E+FR R+QKYQSTVFR NMPPGPF+SS+ KV+ LLD KSFP LFDVS 
Sbjct  26    RLEYFYGTGGRDEYFRSRMQKYQSTVFRANMPPGPFVSSNPKVIVLLDAKSFPILFDVSK  85

Query  180   VEKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAY  359
             VEK+D+FTGTYMPST+LTGGYR+LSY+DPSEP HA+LKNL+FF+L +  + ++P+F   Y
Sbjct  86    VEKKDLFTGTYMPSTKLTGGYRVLSYLDPSEPRHAQLKNLLFFMLKNSSNRVIPQFETTY  145

Query  360   AEMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
              E+F+ LE ELA NGKA  N   +QAAF FL R+ +  +P  TKL   AP LI  WVLFN
Sbjct  146   TELFEGLEAELAKNGKAAFNDVGEQAAFRFLGRAYFNSNPEETKLGTSAPTLISSWVLFN  205

Query  540   LHPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEA  719
             L P L LGLP  +++PLLHTFRLP  L+K  Y +LY++F   +T +++  E LGV ++EA
Sbjct  206   LAPTLDLGLPWFLQEPLLHTFRLPAFLIKSTYNKLYDYFQSVATPVMEQAEKLGVPKDEA  265

Query  720   CHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANG-GKITMAGME  896
              HN++FA CFN+FGG+KI FPN LKWIG AG +LHTQLA+EIR  +K+ G G +T+  +E
Sbjct  266   VHNILFAVCFNTFGGVKILFPNTLKWIGLAGENLHTQLAEEIRGAIKSYGDGNVTLEAIE  325

Query  897   QMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKI  1076
             QM L KS VYES RIEPPVP QYG+AK +  IESHDA F+VK+GEMLFG+QPFATKDPK+
Sbjct  326   QMPLTKSVVYESLRIEPPVPPQYGKAKSNFTIESHDATFEVKKGEMLFGYQPFATKDPKV  385

Query  1077  FDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELF  1256
             FDR +E++P RFVG+ G+ALLK+V WSNG ETE+PTV +KQCAGKDFV+L++RL ++ELF
Sbjct  386   FDRPEEYVPDRFVGD-GEALLKYVWWSNGPETESPTVENKQCAGKDFVVLITRLFVIELF  444

Query  1257  LRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              RYDSF+IE+G SPLGA+VTLT LKRA+
Sbjct  445   RRYDSFEIELGESPLGAAVTLTFLKRAS  472



>ref|XP_008792619.1| PREDICTED: allene oxide synthase 1, chloroplastic-like [Phoenix 
dactylifera]
Length=516

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/447 (66%), Positives = 369/447 (83%), Gaps = 5/447 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R++YFY +G +EFF+ RI++++STVFR NMPPGPF++ D +VV LLD  SFP LFD S+V
Sbjct  75    RLNYFYFEGPDEFFKSRIRRHRSTVFRVNMPPGPFLAPDPRVVALLDAASFPVLFDTSLV  134

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRD+FTGT+MPST+ TGG+RILSY+DPSEPNHA LK L+FFLLS RRH ++PEF   + 
Sbjct  135   EKRDLFTGTFMPSTDFTGGFRILSYLDPSEPNHAPLKKLLFFLLSSRRHSIIPEFRRTFG  194

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +FDTLE ELA  GKA  N AND+AAF+FLARSL G DP+ TKL LD PKLI KW++F L
Sbjct  195   SLFDTLETELAEKGKADFNEANDRAAFDFLARSLLGKDPVETKLGLDGPKLITKWLVFQL  254

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L+LGLP  +ED LLH+FRLPPALV+ DY RL +FF E++   LD  E LG+SREEA 
Sbjct  255   GPLLTLGLPNYLEDFLLHSFRLPPALVRDDYNRLADFFRESAGPALDEAERLGISREEAV  314

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HN++FATCFN+FGGM+  FP+ +KW+GRAG  LH +LA+EIRS V+ANGG+++M  ME M
Sbjct  315   HNILFATCFNAFGGMRFLFPSFIKWVGRAGARLHGRLAQEIRSAVRANGGEVSMRAMEAM  374

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKS VYE+ RIEPPVP QYGRAKRD+V+E+HDARF+V+ GEMLFG+QPFATKDP++FD
Sbjct  375   PLMKSVVYETLRIEPPVPPQYGRAKRDMVLETHDARFEVRAGEMLFGYQPFATKDPRVFD  434

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             RA+EF+  RFVGE G+A+L+HVLWSNG ET  PT  +KQCAGKDFV+LV+R+++VELFLR
Sbjct  435   RAEEFVAERFVGEAGEAMLRHVLWSNGPETAVPTTENKQCAGKDFVVLVARMLMVELFLR  494

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSF+IEV     G+SV LTSLKRATF
Sbjct  495   YDSFEIEV-----GSSVKLTSLKRATF  516



>gb|ADZ24000.1| allene oxide synthase [Artemisia annua]
Length=526

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/447 (66%), Positives = 358/447 (80%), Gaps = 3/447 (1%)
 Frame = +3

Query  3     RIDYFYNQG-REEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSV  179
             R +YFY  G R+EFF+ R+QK+QSTVFRTNMPPGPFIS +  VV LLD KSFPTLFDV+ 
Sbjct  79    RFEYFYGPGGRDEFFKTRVQKHQSTVFRTNMPPGPFISKNPNVVVLLDAKSFPTLFDVTK  138

Query  180   VEKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAY  359
             VEK+D+FTGTYMPSTELTGG+R+LSY+DPSEP +A LKN++FF+L +    ++PEF   Y
Sbjct  139   VEKKDLFTGTYMPSTELTGGHRVLSYLDPSEPKYAPLKNMVFFMLKNSIKKIIPEFQKTY  198

Query  360   AEMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
              E+FD LE EL+  GKA  N   +Q AF FL R+    +P  TK+  D PKLIG WVLFN
Sbjct  199   NELFDELEAELSNKGKAFFNDVGEQTAFRFLGRAYLNTNPEETKIGKDGPKLIGTWVLFN  258

Query  540   LHPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEA  719
             L P+L LGLP  +E+PLLHTFRLP ALVKK+Y +LY+FF   S  I++H + LG+ ++EA
Sbjct  259   LGPLLRLGLPWFVEEPLLHTFRLPAALVKKNYNKLYDFFESCSGEIIEHAKSLGLEKDEA  318

Query  720   CHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKAN-GGKITMAGME  896
              HN++F  CFN+FGG+KI FPN LKW+GRAG +LHTQLA+EIR+ +K + GGK+TMA ME
Sbjct  319   VHNILFTLCFNTFGGIKILFPNTLKWLGRAGTNLHTQLAEEIRNAIKVHGGGKVTMAAME  378

Query  897   QMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKI  1076
             QM LMKS VYES RIEPPV  QYG+AK+D+ IESHDA F+VKEGEMLFG+QPFATKDPKI
Sbjct  379   QMPLMKSVVYESLRIEPPVALQYGKAKKDMTIESHDAVFKVKEGEMLFGYQPFATKDPKI  438

Query  1077  FDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELF  1256
             FDR +E +P RFVGE G+ LLK+V WSNG ETE PT  +KQCAGKDFV+L++RL ++ELF
Sbjct  439   FDRPEESVPDRFVGE-GEKLLKYVTWSNGPETETPTAGNKQCAGKDFVVLITRLFVIELF  497

Query  1257  LRYDSFDIEVGMSPLGASVTLTSLKRA  1337
              RYDSFDIEVG SPLGA +TLTSLKRA
Sbjct  498   RRYDSFDIEVGASPLGAKITLTSLKRA  524



>emb|CDP07587.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/447 (63%), Positives = 360/447 (81%), Gaps = 4/447 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG  +FF  R QKY+STVFR+NMPPGPFISS+SKV+ +LDG SFP LFD+S V
Sbjct  93    RLDYFYNQGEVQFFSTRAQKYKSTVFRSNMPPGPFISSNSKVIVMLDGNSFPVLFDISKV  152

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+++FTGTYMPST+LTGGYRILSY+DPSEP H KLKNL+FFLLS+R+ H++PEFH +Y 
Sbjct  153   EKKNLFTGTYMPSTKLTGGYRILSYLDPSEPKHTKLKNLLFFLLSNRKDHVIPEFHKSYT  212

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+FD+++ E+A  G+   +   D AAF FL R+ YG DP  + L  D P LI KWVLF+L
Sbjct  213   ELFDSIDKEIAAKGRVTFDQ--DGAAFRFLGRAYYGADPADSSLGQDGPTLINKWVLFSL  270

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+ SLGLPK IEDPLLHTF  PP  V+KDY++LY+F   NST +LD  E  G+ R+EA 
Sbjct  271   HPIASLGLPKFIEDPLLHTFPFPPCFVQKDYRKLYDFINANSTFVLDEAERNGIPRDEAA  330

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNLVFATCFN+FGG+K+ FPN++KWIG+AGV LH +L +EIRS +++ GG +T   +E M
Sbjct  331   HNLVFATCFNTFGGIKVLFPNLMKWIGQAGVELHKKLVQEIRSAIESAGGTLTTQALENM  390

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              L KS VYE+ RIEPPVP QYG+AK D+ IESHDARF+VK+GEMLFG+QPFAT+DP+IF+
Sbjct  391   PLTKSVVYETLRIEPPVPYQYGKAKIDLTIESHDARFEVKKGEMLFGYQPFATRDPEIFE  450

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R +EF+P RFVG  G+ LLK+VLWSNG ETE+PTVN+KQC GKDF+  +SRL +VE+F R
Sbjct  451   RPEEFVPDRFVG-GGEELLKYVLWSNGPETESPTVNNKQCPGKDFIGFISRLFVVEIFRR  509

Query  1263  YDSFDIE-VGMSPLGASVTLTSLKRAT  1340
             YD+F+IE V ++ LG+++ +TSL  A+
Sbjct  510   YDTFEIEVVKVTALGSTIDITSLTEAS  536



>gb|EPS63834.1| allene oxide synthase protein [Genlisea aurea]
Length=506

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/445 (62%), Positives = 350/445 (79%), Gaps = 11/445 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFY QGREEFF+ R+ KYQSTVFR NMPPGPFIS DS+VV LLDGKSFP LFD   V
Sbjct  71    RQDYFYKQGREEFFKSRMLKYQSTVFRANMPPGPFISGDSRVVVLLDGKSFPVLFDADKV  130

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+DVFTGT+ PSTELTGGYR+LSY+DPSEPNH +LK L+FF+LS RR H++PEF   + 
Sbjct  131   EKKDVFTGTFSPSTELTGGYRVLSYLDPSEPNHERLKRLVFFMLSRRRDHVIPEFRRCFG  190

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++  TLE E++ +GKA  N+ N+Q+AFNF++ + +G DP++T L  D P LI +WVLF L
Sbjct  191   DLLRTLEKEVSTSGKADFNSLNEQSAFNFVSGAFFGADPLKTDLGSDGPGLINRWVLFQL  250

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HPVL+LGLP+ IEDP+LHTFRLPP L K DY+RL++F   NS+ IL+  + LG+SREEA 
Sbjct  251   HPVLALGLPRLIEDPILHTFRLPPFLAKNDYRRLHDFVSRNSSPILEEADRLGISREEAS  310

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNLVFATCFN++GG+KI FPN+LKW+GR G  LH +LA EIR+ ++           ++ 
Sbjct  311   HNLVFATCFNAWGGLKILFPNILKWVGRGGAKLHARLAAEIRTSIQ-----------KRR  359

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              L +S VYE+ RIEPPV  QYGRA+RD VIESHD  F+++EGEML+G+QP AT+DP+IFD
Sbjct  360   PLTESVVYEALRIEPPVSHQYGRARRDFVIESHDGAFRIREGEMLYGYQPMATRDPRIFD  419

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             R +EF+P RFVGE G+ LL+H+LWSNG ET+ PT  DKQCAGKDF +L  RL++ E+F  
Sbjct  420   RPEEFVPDRFVGEGGQRLLEHLLWSNGPETKTPTAGDKQCAGKDFAVLAGRLLVAEIFRT  479

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRA  1337
             +DSFD+EV   PLGASVT+TSLKRA
Sbjct  480   FDSFDVEVSDGPLGASVTVTSLKRA  504



>ref|XP_003558850.1| PREDICTED: allene oxide synthase 1, chloroplastic [Brachypodium 
distachyon]
Length=511

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/449 (61%), Positives = 358/449 (80%), Gaps = 2/449 (0%)
 Frame = +3

Query  3     RIDYFYN-QGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSV  179
             R++YFY   GR+ FF  R++ ++STV R NMPPGPF++ D +VV LLD  SFP LFD S+
Sbjct  63    RLEYFYGPGGRDGFFASRVRAHRSTVVRLNMPPGPFVAKDPRVVALLDAASFPVLFDTSL  122

Query  180   VEKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAY  359
             V+K D+FTGT+MPS +LTGGYR+LSY+DP+EPNHA LK+L+F LL+HRR H++  F   Y
Sbjct  123   VDKTDLFTGTFMPSVDLTGGYRVLSYVDPAEPNHAPLKSLLFHLLTHRREHVIATFREVY  182

Query  360   AEMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
              E+F  +E ELA  GKA     ND AAF FL R+L G DP  + LR +APKLI KWVLF 
Sbjct  183   GELFALMEGELARAGKADFGERNDDAAFGFLCRALLGQDPADSPLRDEAPKLITKWVLFQ  242

Query  540   LHPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEI-LGVSREE  716
             + P+L+LGLPK +ED LLH+FRLPPAL++KDY RL +FF +   A++D GE  LGV+REE
Sbjct  243   ISPLLNLGLPKLVEDGLLHSFRLPPALIRKDYTRLADFFRDAGRAVIDEGERRLGVAREE  302

Query  717   ACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGME  896
             A HN++FA CFNSFGGMKI FP+++KW+GRAG  +H +LA E+R+ V+ NGG++TM  + 
Sbjct  303   AVHNILFAMCFNSFGGMKILFPSLIKWLGRAGGRIHGRLATEVRNAVRGNGGEVTMQALA  362

Query  897   QMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKI  1076
             +M L+KS VYE+ RIEPPV  QYGRAK+D+V+ESHD  ++V+EGE+LFG+QP ATKDP++
Sbjct  363   EMPLVKSAVYEALRIEPPVAMQYGRAKKDMVVESHDYGYEVREGELLFGYQPMATKDPRV  422

Query  1077  FDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELF  1256
             F RA+E++P RF+GE G  LL+HV+WSNG ET +PT+ DKQCAGKDFV+L++RL++ ELF
Sbjct  423   FARAEEYVPDRFLGEDGARLLRHVVWSNGPETASPTLQDKQCAGKDFVVLIARLLVAELF  482

Query  1257  LRYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             LRYDSFD++VG S LG+SVT+TSLK+ATF
Sbjct  483   LRYDSFDVQVGSSALGSSVTITSLKKATF  511



>dbj|BAJ97490.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=510

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/448 (60%), Positives = 359/448 (80%), Gaps = 1/448 (0%)
 Frame = +3

Query  3     RIDYFYN-QGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSV  179
             R++YFY   GR+ FF  R++ ++STV R NMPPGPF++ D +VV LLD  SFP LFD S+
Sbjct  63    RLEYFYGPGGRDGFFAARVRAHRSTVVRLNMPPGPFVAKDPRVVALLDAASFPVLFDTSL  122

Query  180   VEKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAY  359
             V+K D+FTGT+MPST+LTGGYR+LSY+DP+E NHA LK+L+F LL+HRR H++P F   Y
Sbjct  123   VDKTDLFTGTFMPSTDLTGGYRVLSYVDPAEANHAPLKSLLFHLLTHRRQHVIPTFREVY  182

Query  360   AEMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
              ++F  +E +LA  GKA     ND AAF FL ++L G DP+ + LR   PKLI KWVLF 
Sbjct  183   GDLFGRMETDLARVGKADFGNYNDAAAFGFLCQALLGRDPVDSPLRDQGPKLITKWVLFQ  242

Query  540   LHPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEA  719
             + P+L+LGLP  +ED LLHTFRLPPALVKKDY RL +FF +   A++D G+ LG++REEA
Sbjct  243   ISPLLNLGLPTLVEDGLLHTFRLPPALVKKDYGRLADFFRDAGKAVIDEGQRLGIAREEA  302

Query  720   CHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQ  899
              HN++FA CFNSFGGMKI FP+++KW+GRAG  +H +LA E+R+ V+ANGG++TM  + +
Sbjct  303   VHNILFAMCFNSFGGMKILFPSLVKWLGRAGGRVHGRLATEVRAAVRANGGEVTMQALAE  362

Query  900   MELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF  1079
             M L+KS VYE+ RIEPPV  QYGRAK+D+V+ESHD  ++V+EGE++FG+QP ATKDP++F
Sbjct  363   MPLVKSAVYEALRIEPPVAMQYGRAKKDMVVESHDYGYEVREGELMFGYQPMATKDPRVF  422

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
              RA+E++P RF+GE G+ LL++V+WSNG E+  PT+ DKQCAGKDFV+L++RL++ E+FL
Sbjct  423   QRAEEYVPDRFMGEDGERLLRYVVWSNGPESATPTLQDKQCAGKDFVVLIARLLVAEIFL  482

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             RYDSFD++VG SPLG+SVT+TSLK+ATF
Sbjct  483   RYDSFDVQVGSSPLGSSVTITSLKKATF  510



>emb|CBI19616.3| unnamed protein product [Vitis vinifera]
Length=473

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/447 (64%), Positives = 338/447 (76%), Gaps = 48/447 (11%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGREEFFR R QK+QSTVFR+NMPPGPFISS+SKV+ LLDGKSFP LFDVS V
Sbjct  75    RLDYFYNQGREEFFRSRAQKHQSTVFRSNMPPGPFISSNSKVIVLLDGKSFPVLFDVSKV  134

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+DVFTGT+MPSTE TGG+R+LSY+DPSEP+H KLK L+FFLL   R  ++PEFH+ ++
Sbjct  135   EKKDVFTGTFMPSTEFTGGFRVLSYLDPSEPDHTKLKRLLFFLLQSSRDRVIPEFHSCFS  194

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+ +TLE+ELA  GKA     NDQA+FNFLAR+LYG  P  TKL  D P LI  WV+F L
Sbjct  195   ELSETLESELAAKGKASFADPNDQASFNFLARALYGTKPADTKLGTDGPGLITTWVVFQL  254

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L+LGLPK IE+PL+HTF LP  L K  YQ+LY+FFY+ ST +LD GE +G+SREEAC
Sbjct  255   SPILTLGLPKFIEEPLIHTFPLPAFLAKSSYQKLYDFFYDASTHVLDEGEKMGISREEAC  314

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FATCFNSFGGMKI FP +LKW+GR GV LHTQLA+EIRSVVK+NGGK+TMA MEQM
Sbjct  315   HNLLFATCFNSFGGMKIIFPTILKWVGRGGVKLHTQLAQEIRSVVKSNGGKVTMASMEQM  374

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              LMKSTVYE+FRIEPPV  QYG+AK+D+                                
Sbjct  375   PLMKSTVYEAFRIEPPVALQYGKAKQDL--------------------------------  402

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
                              LLKHVLWSNG ETENPT+ +KQCAGKDFV+L +RL +VELFLR
Sbjct  403   ----------------KLLKHVLWSNGPETENPTLGNKQCAGKDFVVLAARLFVVELFLR  446

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YDSFDIEVG S LG+++ LTSLKRA+F
Sbjct  447   YDSFDIEVGTSLLGSAINLTSLKRASF  473



>ref|XP_009397307.1| PREDICTED: allene oxide synthase 1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=519

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/448 (63%), Positives = 360/448 (80%), Gaps = 1/448 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+ YFY +GR+EFF+ R+++Y STVFR NMPPGPF++SD +V+ LLD  SFP LFD S+V
Sbjct  72    RLAYFYWEGRDEFFKTRVRRYGSTVFRANMPPGPFLASDPRVIVLLDAASFPVLFDTSLV  131

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRDVFTGT+MPSTELTGG+R+LSY+DPSEPNHA LK L+FFLLSHRR  ++PEF   + 
Sbjct  132   EKRDVFTGTFMPSTELTGGFRVLSYLDPSEPNHAPLKRLLFFLLSHRRQAVIPEFRRTFG  191

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +F+T+E E+A  GKA    AND+A+F+FLAR+ +  DP  T+L LD P LI KWVLF L
Sbjct  192   TLFETMEAEIAAKGKADFGDANDRASFDFLARAFFERDPKDTELGLDGPGLITKWVLFQL  251

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L+LGLP  +ED  LH+FRLPPAL++ DY RL  FF E++  +LD  E +G+SREEA 
Sbjct  252   GPLLTLGLPSYLEDLFLHSFRLPPALIRGDYDRLVAFFRESAGPVLDEAERMGISREEAV  311

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVK-ANGGKITMAGMEQ  899
             HN++FATCFN+FGGMKI FP ++K +GRAG  LH +LA+EIR+ V+   GG++TM  +E 
Sbjct  312   HNILFATCFNTFGGMKILFPGLVKLVGRAGAQLHGRLAQEIRAAVRDVGGGEVTMRAIEA  371

Query  900   MELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF  1079
             M L  S  YE+ RIEPPVP QYGRAKRD+V+ SHDA F+V+ GEMLFG+QPFATKD ++F
Sbjct  372   MPLTASAAYEALRIEPPVPMQYGRAKRDMVVTSHDAAFEVRAGEMLFGYQPFATKDARVF  431

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
             DR QEF+  RFVG +G +LL++V+WSNG ETE+P+  +KQCAGKDFV+L++RL+LVELFL
Sbjct  432   DRPQEFVADRFVGAEGASLLRYVVWSNGPETESPSTENKQCAGKDFVVLMARLLLVELFL  491

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             RYDSF++EVG S LG+SV LTSLK+ATF
Sbjct  492   RYDSFEVEVGASALGSSVKLTSLKKATF  519



>gb|AGT16483.1| cytochrome P450 [Saccharum hybrid cultivar R570]
Length=511

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/448 (63%), Positives = 359/448 (80%), Gaps = 1/448 (0%)
 Frame = +3

Query  3     RIDYFYN-QGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSV  179
             R +YFY   GR+ FF  R++ + STV R NMPPGPF++ D +VV LLD  SFP LFD S+
Sbjct  64    RFEYFYGPGGRDGFFTSRVRAHGSTVVRLNMPPGPFVARDPRVVALLDAASFPVLFDTSL  123

Query  180   VEKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAY  359
             V+K D+FTGT+MPST+LTGGYR+LSY+DPSEPNH  LK L+F+LLSHRR H++P+F   Y
Sbjct  124   VDKTDLFTGTFMPSTDLTGGYRVLSYLDPSEPNHGPLKTLLFYLLSHRRQHVIPKFREVY  183

Query  360   AEMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
              E+F  +ENELA  GKA     ND AAF+FL ++L G DP  + L+ D PKLI KWVLF 
Sbjct  184   GELFGVMENELARVGKADFGHHNDAAAFSFLCQALLGRDPAESALQGDGPKLITKWVLFQ  243

Query  540   LHPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEA  719
             L P+LSLGLPK +ED LLH+FRLPPALVKKDY RL +FF + + +++D GE LG++REEA
Sbjct  244   LSPLLSLGLPKHVEDSLLHSFRLPPALVKKDYDRLADFFRDAARSVIDEGERLGIAREEA  303

Query  720   CHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQ  899
              HN++FA CFNSFGGMKI FP+++KW+GRAG   H +LA E+R  V+A+GG++TM  + +
Sbjct  304   VHNILFAMCFNSFGGMKILFPSLVKWLGRAGARTHGRLATEVRDAVRAHGGEVTMKALAE  363

Query  900   MELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF  1079
             M L+KS VYE+ RIEPPV  QYGRAKRD+V+ESHD  F+V+EGEMLFG+QP ATKDP++F
Sbjct  364   MPLVKSAVYEALRIEPPVAMQYGRAKRDMVVESHDYGFEVREGEMLFGYQPMATKDPRVF  423

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
              RA+E++P RF+GE G  LL+HV+WSNG ET +PT+ DKQCAGKDFV+L++RL++ ELFL
Sbjct  424   ARAEEYVPDRFLGEDGAHLLRHVVWSNGPETASPTLQDKQCAGKDFVVLIARLLVAELFL  483

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             RYDSFD++VG S LG+SVT+TSLK+ATF
Sbjct  484   RYDSFDVQVGASALGSSVTITSLKKATF  511



>ref|XP_009412514.1| PREDICTED: allene oxide synthase 1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=509

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/449 (62%), Positives = 361/449 (80%), Gaps = 2/449 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+ YFY +GR++FFR RI++Y STVFR N+PPGPF++ D +VV LLD  SFP LFD S+V
Sbjct  61    RLAYFYFEGRDQFFRSRIRRYGSTVFRVNVPPGPFVAPDPRVVALLDAASFPVLFDTSLV  120

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRD+FTGT+MPSTELTGG+R+L Y+DP+EPNHA+LK L+FFLL  RRH ++PEF  ++ 
Sbjct  121   EKRDLFTGTFMPSTELTGGFRVLPYLDPAEPNHAQLKRLLFFLLGSRRHAVVPEFRRSFG  180

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +F+ +E E+A  GKA  +AAND+AAF+FL R  +G DP  ++L LD P LI KWVLF L
Sbjct  181   FLFEAMEAEIAREGKADFSAANDRAAFDFLVRCFFGTDPAGSRLDLDGPGLINKWVLFQL  240

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+L LGLP  +ED LLH+FRLPPALV+ DY RL +FF E++   LD  +  GVSREEA 
Sbjct  241   GPLLKLGLPPYLEDFLLHSFRLPPALVRADYDRLTDFFRESAGPFLDEAKRFGVSREEAL  300

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANG-GKITMAGME-  896
             HN++FATCFN+F GMK+ FP+++KWIGRAG  LH ++A+E+RS V+  G G++T+  +E 
Sbjct  301   HNVMFATCFNAFSGMKVLFPSLIKWIGRAGARLHGRIAEEVRSAVRGTGNGEVTVRAVEA  360

Query  897   QMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKI  1076
              M L +S VYE+ R+EPP+P QYGRAKRD+V+ SHD RF+V+ GE+LFG+QPFAT+DP++
Sbjct  361   AMPLTRSVVYEALRVEPPMPLQYGRAKRDMVVASHDGRFEVRAGEVLFGYQPFATRDPRV  420

Query  1077  FDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELF  1256
             F+RA+EF+  RFVG +G ALL+HVLWSNG ETE PT  +KQCAGKDFV+ V+RL++VELF
Sbjct  421   FERAEEFVAARFVGAEGAALLRHVLWSNGPETEGPTTENKQCAGKDFVVTVARLLVVELF  480

Query  1257  LRYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             LRYDSF+IEVG SPLG+ V LTSLKRATF
Sbjct  481   LRYDSFEIEVGASPLGSLVKLTSLKRATF  509



>ref|XP_002463829.1| hypothetical protein SORBIDRAFT_01g007000 [Sorghum bicolor]
 gb|EER90827.1| hypothetical protein SORBIDRAFT_01g007000 [Sorghum bicolor]
Length=512

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/448 (62%), Positives = 358/448 (80%), Gaps = 1/448 (0%)
 Frame = +3

Query  3     RIDYFYN-QGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSV  179
             R +YFY   GR+ FF  R++ + STV R NMPPGPF++ D +VV LLD  SFP LFD S+
Sbjct  65    RFEYFYGPGGRDGFFTSRVRAHGSTVVRLNMPPGPFVARDPRVVALLDAASFPVLFDTSL  124

Query  180   VEKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAY  359
             V+K D+FTGT+MPST+LTGGYR+LSY+DPSEPNH  LK L+F+LLSHRR H++P+F   Y
Sbjct  125   VDKTDLFTGTFMPSTDLTGGYRVLSYLDPSEPNHGPLKTLLFYLLSHRRQHVIPKFREVY  184

Query  360   AEMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
              ++F  +ENELA  GKA     ND AAF+FL ++L G DP  + L+ D PKLI KWVLF 
Sbjct  185   GDLFGHMENELARVGKADFGHYNDAAAFSFLCQALLGRDPAESALQGDGPKLITKWVLFQ  244

Query  540   LHPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEA  719
             L P+LSLGLPK +ED LLH+FRLPPALVKKDY RL +FF +   +++D GE LG++REEA
Sbjct  245   LSPLLSLGLPKHVEDSLLHSFRLPPALVKKDYDRLADFFRDAGRSVVDEGERLGIAREEA  304

Query  720   CHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQ  899
              HN++FA CFNSFGGMKI FP+++KW+GRAG   H +LA E+R  V+A+GG++TM  + +
Sbjct  305   VHNILFAMCFNSFGGMKILFPSLVKWLGRAGARTHGRLATEVRDAVRAHGGEVTMKALAE  364

Query  900   MELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF  1079
             M L+KS VYE+ RIEPPV  QYGRAKRD+V+ESHD  F+V+EGEMLFG+QP ATKDP++F
Sbjct  365   MPLVKSAVYEALRIEPPVAMQYGRAKRDMVVESHDYGFEVREGEMLFGYQPMATKDPRVF  424

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
              RA+E++P RF+GE G  LL+HV+WSNG ET +PT+ DKQCAGKDFV+L++RL++ ELFL
Sbjct  425   ARAEEYVPDRFLGEDGAQLLRHVVWSNGPETVSPTLQDKQCAGKDFVVLIARLLVAELFL  484

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             RYDSFD++VG S LG+SVT+TSLK+ATF
Sbjct  485   RYDSFDVQVGASALGSSVTITSLKKATF  512



>ref|XP_008644470.1| PREDICTED: allene oxide synthase 1, chloroplastic [Zea mays]
 gb|AFW67510.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=511

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/448 (62%), Positives = 358/448 (80%), Gaps = 1/448 (0%)
 Frame = +3

Query  3     RIDYFYN-QGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSV  179
             R +YFY   GR+ FF  R++ + STV R NMPPGPF++ D +VV LLD  SFP LFD S+
Sbjct  64    RFEYFYGPGGRDGFFTSRVRAHGSTVVRLNMPPGPFVARDPRVVALLDAASFPVLFDTSL  123

Query  180   VEKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAY  359
             V+K D+FTGT+MPSTELTGGYR+LSY+DP+EPNH  LK L+F+LLSHRR H++P+F   Y
Sbjct  124   VDKTDLFTGTFMPSTELTGGYRVLSYLDPAEPNHGPLKTLLFYLLSHRRQHVIPKFREVY  183

Query  360   AEMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
              ++F  +ENELA  GKA     ND AAF+FL ++L G DP  + L+ D PKLI KWVLF 
Sbjct  184   GDLFGLMENELARVGKADFGHYNDAAAFSFLCQALLGRDPAESALQGDGPKLITKWVLFQ  243

Query  540   LHPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEA  719
             L P+LSLGLPK +ED LLH+FRLPPALVKKDY RL +FF + +  ++D GE LGV+REEA
Sbjct  244   LSPLLSLGLPKHVEDSLLHSFRLPPALVKKDYDRLADFFRDAARRVVDEGERLGVAREEA  303

Query  720   CHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQ  899
              HN++FA CFNSFGGMKI FP+++KW+GRAG   H +LA E+R  V+A+GG++TM  + +
Sbjct  304   VHNILFAMCFNSFGGMKILFPSLVKWLGRAGGRAHGRLATEVRDAVRAHGGEVTMKALAE  363

Query  900   MELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF  1079
             M L+KS VYE+ RIEPPV  QYGRAK+D+V+ESHD  F+V+EGEMLFG+QP ATKDP++F
Sbjct  364   MPLVKSAVYEALRIEPPVAMQYGRAKQDMVVESHDYGFEVREGEMLFGYQPMATKDPRVF  423

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
              RA+E++P RF+GE G  LL+HV+WSNG ET +PT+ DKQCAGKDFV+L++RL++ ELFL
Sbjct  424   ARAEEYVPDRFLGEDGAQLLRHVVWSNGPETASPTLQDKQCAGKDFVVLIARLLVAELFL  483

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             RYDSFD++VG S LG+SVT+TSLK+ATF
Sbjct  484   RYDSFDVQVGASALGSSVTITSLKKATF  511



>gb|AAS86334.1| allene oxide synthase [Hevea brasiliensis]
Length=457

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/405 (66%), Positives = 336/405 (83%), Gaps = 4/405 (1%)
 Frame = +3

Query  132   CLLDGKSFPTLFDVSVVEKRDVF-TGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmff  308
             CL+ G++F   F   +  KR +F TGTYMPSTELTGGYRILSY+DPSEP H +LKN +F+
Sbjct  56    CLM-GRAF-LFFSTYLRSKRKIFFTGTYMPSTELTGGYRILSYLDPSEPKHTQLKNFLFY  113

Query  309   llshrrhhllPEFHNAYAEMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRT  488
             LL  RR H++PEF + Y  +F++LEN+LA  GK   N   +QAAF+FL RS +GV+P+ T
Sbjct  114   LLKSRRDHVIPEFSSTYTGLFESLENDLASKGKVSFNNPGEQAAFSFLGRSYFGVNPVDT  173

Query  489   KLRLDAPKLIGKWVLFNLHPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENS  668
             K+  D P LI KWVLF L P+L+LGLP  +E+P +HTFRLP  LVKKDY+RLY++FY ++
Sbjct  174   KIGTDGPTLIAKWVLFQLAPILTLGLPAFLEEPTIHTFRLPAFLVKKDYKRLYDYFYSSA  233

Query  669   TAILDHGEILGVSREEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIR  848
              ++LD  E +G+SREEACHN++FATCFN+FGG+KIFFPN+LKWIGRAGV LHTQLA+EIR
Sbjct  234   GSLLDEAEKMGISREEACHNILFATCFNTFGGLKIFFPNILKWIGRAGVKLHTQLAQEIR  293

Query  849   SVVKANGGKITMAGMEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEG  1028
             SV+K+NGG+ITMA +EQM LMKS VYE+FRIEPPVP QYG+AKRD++IESHDA + VKEG
Sbjct  294   SVIKSNGGEITMAALEQMPLMKSAVYEAFRIEPPVPAQYGKAKRDLIIESHDAAYDVKEG  353

Query  1029  EMLFGFQPFATKDPKIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAG  1208
             EM+FG+QPFATKDPKIFD   E++P RFVGE G+ LL+HVLWSNG ETE+PTV +KQCAG
Sbjct  354   EMIFGYQPFATKDPKIFDTPDEYVPDRFVGE-GEKLLQHVLWSNGPETEHPTVGNKQCAG  412

Query  1209  KDFVMLVSRLMLVELFLRYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             KDFV+ +SRL +VELF RYDSF+IEVG S LG+S+T+TSLKRA+F
Sbjct  413   KDFVVFISRLFVVELFRRYDSFEIEVGSSALGSSITITSLKRASF  457



>ref|XP_008665482.1| PREDICTED: allene oxide synthase 1, chloroplastic-like [Zea mays]
 tpg|DAA51612.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=519

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/448 (61%), Positives = 359/448 (80%), Gaps = 1/448 (0%)
 Frame = +3

Query  3     RIDYFYN-QGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSV  179
             R +YFY   GR+ FF  R++ + STV R NMPPGPF++ D +VV LLD  SFP LFD S+
Sbjct  72    RFEYFYGPGGRDGFFASRVRAHGSTVVRLNMPPGPFVARDPRVVALLDAASFPVLFDTSL  131

Query  180   VEKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAY  359
             V+K D+FTGT+MPST+LTGGYR+LSY+DP+EP+H  LK L+F+LLSHRR H++P+F   Y
Sbjct  132   VDKTDLFTGTFMPSTDLTGGYRVLSYLDPAEPSHGPLKALLFYLLSHRRQHVIPKFREVY  191

Query  360   AEMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
              ++F  +ENELA  GKA     ND AAF+FL ++L G DP  + L+ D PKLI KWVLF 
Sbjct  192   GDLFGVVENELARVGKADFGHHNDAAAFSFLCQALLGRDPAESALQGDGPKLITKWVLFQ  251

Query  540   LHPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEA  719
             L P+LSLGLPK +ED LLH+FRLPPALV+KDY RL +FF + + +++D GE LG++REEA
Sbjct  252   LSPLLSLGLPKHLEDSLLHSFRLPPALVRKDYGRLADFFRDAARSVVDEGERLGIAREEA  311

Query  720   CHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQ  899
              HN++FATCFNSFGGMKI FP+++KW+GRAG   H +LA E+R  V+A+ G++TM  + +
Sbjct  312   VHNILFATCFNSFGGMKILFPSLVKWLGRAGARAHGRLATEVRDAVRAHAGEVTMKALAE  371

Query  900   MELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF  1079
             M L++S VYE+ RIEPPV  QYGRAKRD+V+ESHD  F+V+EGEMLFG+QP ATKDP++F
Sbjct  372   MPLVESAVYEALRIEPPVAMQYGRAKRDMVVESHDYGFEVREGEMLFGYQPMATKDPRVF  431

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
              RA+E++P RF+GE G  LL+HV+WSNG ET +PT+ DKQCAGKDFV+L++RL++ ELFL
Sbjct  432   ARAEEYVPDRFLGEDGAQLLRHVVWSNGPETASPTLQDKQCAGKDFVVLIARLLVAELFL  491

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             RYDSFD++VG S LG+SVT+TSLK+ATF
Sbjct  492   RYDSFDVQVGASALGSSVTITSLKKATF  519



>gb|AEO13838.1| allene oxide synthase [Gladiolus hybrid cultivar]
Length=510

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/448 (60%), Positives = 348/448 (78%), Gaps = 1/448 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R  YFY QGR E+ R RI +++STV R N+PPGP I+ D  V+ LLD  SFP LFD  ++
Sbjct  63    RFAYFYTQGRGEYLRSRINRHRSTVLRLNVPPGPPIARDPAVIALLDAVSFPVLFDADLI  122

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+++FTGT+MPS  LTGGYR LSYID +EP HA LK L+FFLLSHRR H++PEF + + 
Sbjct  123   EKKNLFTGTFMPSLHLTGGYRTLSYIDTTEPEHAPLKKLLFFLLSHRRTHVVPEFRSTFG  182

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +FD+LE+++A  G A  +  NDQAAFNFL RSL+G DP  ++L  D P ++ KWVLF L
Sbjct  183   NLFDSLESDVASAGTADFSEGNDQAAFNFLIRSLFGKDPAESELGTDGPNIVKKWVLFQL  242

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENST-AILDHGEILGVSREEA  719
              P+L+LGLP  +ED  LH+ RLP  L+KKDY RL +FF ++S  +ILD    LG+S+EEA
Sbjct  243   GPILTLGLPSLLEDLTLHSIRLPSFLIKKDYDRLVKFFLDSSAGSILDEAYRLGLSKEEA  302

Query  720   CHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQ  899
              HN++F+TCFN++GGM I FPN+LKW+GRAG  +  +LA+EIR+ VKA GG++TM  ME 
Sbjct  303   VHNILFSTCFNAYGGMTILFPNVLKWVGRAGSRVQAELAEEIRAAVKAEGGEVTMKAMES  362

Query  900   MELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF  1079
             M LMKS +YE  RIEPPV  QYGRA++D ++ SH+A F+++ GE+LFG+QPFATKDP++F
Sbjct  363   MPLMKSVIYECLRIEPPVSLQYGRARKDFIVNSHEAAFEIRAGELLFGYQPFATKDPRVF  422

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
             DRA+EF+  RFVGE+ + LL HVLWSNG E  +PTV DKQCAGKDFV+LV+R++LVELFL
Sbjct  423   DRAEEFVADRFVGEEKEKLLSHVLWSNGPENVSPTVGDKQCAGKDFVVLVARMLLVELFL  482

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             RYDSFD+EVG S LG+SV LTSLK A+F
Sbjct  483   RYDSFDVEVGASALGSSVKLTSLKPASF  510



>ref|XP_008665483.1| PREDICTED: allene oxide synthase 1, chloroplastic-like [Zea mays]
 gb|ACG40251.1| cytochrome P450 CYP74A18 [Zea mays]
 tpg|DAA51610.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=516

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/448 (62%), Positives = 357/448 (80%), Gaps = 1/448 (0%)
 Frame = +3

Query  3     RIDYFYN-QGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSV  179
             R +YFY   GR+ FF  R++ + STV R NMPPGPF++ D +VV LLD  SFP LFD S+
Sbjct  69    RFEYFYGPGGRDGFFASRVRAHGSTVVRLNMPPGPFVARDPRVVALLDAASFPVLFDTSL  128

Query  180   VEKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAY  359
             V+K D+FTGT+MPST+LTGGYR+LSYIDP+EP+H  LK L+F+LLSHRR H++P+F   Y
Sbjct  129   VDKTDLFTGTFMPSTDLTGGYRMLSYIDPAEPSHGPLKALLFYLLSHRRQHVIPKFREVY  188

Query  360   AEMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
              ++F  +ENELA  GKA     ND AAF+FL ++L G DP  + L  D PKLI KWVLF 
Sbjct  189   GDLFGVVENELARVGKADFGHHNDAAAFSFLCQALLGRDPAESALHGDGPKLITKWVLFQ  248

Query  540   LHPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEA  719
             L P+LSLGLPK +ED LLH+FRLPPALV+KDY RL +FF + +  ++D GE LG++REEA
Sbjct  249   LSPLLSLGLPKHLEDSLLHSFRLPPALVRKDYGRLADFFRDAARTVVDEGERLGIAREEA  308

Query  720   CHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQ  899
              HN++FATCFNSFGGMKI FP+++KW+GRAG   H +LA E+R  V+A+ G++TM  + +
Sbjct  309   VHNILFATCFNSFGGMKILFPSLVKWLGRAGARAHGRLATEVRDAVRAHAGEVTMKALAE  368

Query  900   MELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF  1079
             M L++S VYE+ RIEPPV  QYGRAKRD+V+ESHD  F+V+EGEMLFG+QP ATKDP++F
Sbjct  369   MPLVESAVYEALRIEPPVAMQYGRAKRDMVVESHDYGFEVREGEMLFGYQPMATKDPRVF  428

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
              RA+E++P RF+GE G  LL+HV+WSNG ET +PT+ DKQCAGKDFV+L++RL++ ELFL
Sbjct  429   ARAEEYVPDRFLGEDGAQLLRHVVWSNGPETASPTLQDKQCAGKDFVVLIARLLVAELFL  488

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             RYDSFD++VG S LG+SVT+TSLK+ATF
Sbjct  489   RYDSFDVQVGASALGSSVTITSLKKATF  516



>ref|XP_002281190.1| PREDICTED: allene oxide synthase, chloroplastic [Vitis vinifera]
Length=483

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/450 (58%), Positives = 340/450 (76%), Gaps = 5/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQG++EFF+ R+QKY STVFR NMPPGPFISSDSKVV LLD  SFP LFD S V
Sbjct  35    RFDYFYNQGQDEFFKTRMQKYHSTVFRANMPPGPFISSDSKVVVLLDTVSFPVLFDSSKV  94

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR+VF GT+MPST+LTGGYR+L Y+DPSEP H  LK   F LL+ R    +P F +   
Sbjct  95    EKRNVFVGTFMPSTDLTGGYRVLPYLDPSEPKHDLLKRFSFSLLASRHRDFIPVFRSGLP  154

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F T+E++++  GKA  N   D   FNF+ R + G DP   K+R + P +  KW+   L
Sbjct  155   DLFSTIEDDVSRKGKANFNDIADDMYFNFVFRLICGKDPSDAKIRSEGPNIFLKWLFLQL  214

Query  543   HPVLSLG---LPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+L+LG   LP  I+D LLHTF  PP LVK DY +LY+ FYE+++++LD GE +G+ R+
Sbjct  215   SPLLTLGLSILPNFIDDLLLHTFPFPPFLVKSDYNKLYKAFYESASSVLDEGERMGIKRD  274

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNLVF   FNSFGGMK+FFP ++KW+G AG  LH +LA EIR+V+KA GG +T A +
Sbjct  275   EACHNLVFLAGFNSFGGMKVFFPALIKWVGLAGEKLHRELADEIRTVIKAEGG-VTFAAL  333

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             ++M L KS VYE+ RIEPPVP QYG+A+ D+VI SHDA F++K+GEM+FG+QPFATKDPK
Sbjct  334   DKMALTKSMVYEALRIEPPVPFQYGKAREDMVIHSHDAAFEIKKGEMIFGYQPFATKDPK  393

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             +F+  +EF+ HRF+GE G+ LLK+V WSNGRET+NPT  +KQC+GKD V+L+SRLMLVE+
Sbjct  394   VFENPEEFVAHRFMGE-GEKLLKYVYWSNGRETDNPTAENKQCSGKDLVVLISRLMLVEI  452

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             FLRYD+F++E G   LG+S+   SL + ++
Sbjct  453   FLRYDTFEVESGTMLLGSSLLFKSLTKTSY  482



>ref|XP_010255030.1| PREDICTED: allene oxide synthase-like [Nelumbo nucifera]
Length=497

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/448 (60%), Positives = 345/448 (77%), Gaps = 5/448 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+EFF+ R+QKY STVFR NMPPGPF++S+  VV LLD  SFP LFDVS V
Sbjct  47    RLDYFYNQGRDEFFKTRMQKYGSTVFRANMPPGPFMASNPNVVVLLDAVSFPVLFDVSKV  106

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRD+FTGTYMPST LTGGYR+ +Y+DPSEPNH KLK L+F LLS R    +PEFH +++
Sbjct  107   EKRDLFTGTYMPSTALTGGYRVCAYLDPSEPNHTKLKRLIFLLLSSRHSKYIPEFHKSFS  166

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +FD LE E+   G+A  N  ND+ +F++L ++ +  DP  TK+       + KW+ F L
Sbjct  167   VLFDNLETEIKNKGEANFNNLNDKTSFDYLLKAYFDKDPAETKIESKGSNYVTKWLFFQL  226

Query  543   HPVLSLGLPKQ---IEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+++LGLPK    +ED LLHTF LPP LVK DY +LY+ FY ++ A+LD  E +G++R+
Sbjct  227   CPLITLGLPKLVSFVEDILLHTFPLPPFLVKSDYMKLYDVFYTSAAALLDEAEKMGLNRK  286

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNL+F TCFN++GGMKI FP ++KW+G AG  LH QLA EIR+ VKA GG +T+  +
Sbjct  287   EACHNLLFVTCFNAYGGMKILFPALMKWVGLAGEELHKQLADEIRAAVKAEGG-VTLNAI  345

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             E+M L KS VYE+ RIEPPV  QYG+AK+D+VIESHDA ++VK+GEM+FGFQPFATKDPK
Sbjct  346   EKMPLTKSAVYEALRIEPPVMFQYGKAKKDLVIESHDAAYEVKKGEMIFGFQPFATKDPK  405

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             IFD+A+E+I  RFVGE G+ LLK+V WSNGRETENPT  +KQC GKDFV+LV+RL+LVE 
Sbjct  406   IFDKAEEYIASRFVGE-GEKLLKYVFWSNGRETENPTEENKQCPGKDFVVLVARLLLVEF  464

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRA  1337
             FLR+D+F +EV    LG SV + SL  A
Sbjct  465   FLRFDTFTVEVSTILLGPSVKVKSLTTA  492



>ref|NP_001051386.1| Os03g0767000 [Oryza sativa Japonica Group]
 sp|Q7Y0C8.1|C74A1_ORYSJ RecName: Full=Allene oxide synthase 1, chloroplastic; AltName: 
Full=Cytochrome P450 74A1; AltName: Full=Hydroperoxide dehydrase 
1; Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAP50956.1| putative allene oxide synthase [Oryza sativa Japonica Group]
 gb|AAR87328.1| putative allene oxide synthase [Oryza sativa Japonica Group]
 dbj|BAD08330.1| allene oxide synthase [Oryza sativa Japonica Group]
 gb|ABF99059.1| Cytochrome P450 74A1, chloroplast precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13300.1| Os03g0767000 [Oryza sativa Japonica Group]
 gb|EAY91979.1| hypothetical protein OsI_13668 [Oryza sativa Indica Group]
 gb|ABV03554.1| AOS [Oryza sativa Japonica Group]
 gb|ABV45433.1| AOS [Oryza sativa Japonica Group]
 dbj|BAG90995.1| unnamed protein product [Oryza sativa Japonica Group]
Length=512

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/448 (62%), Positives = 355/448 (79%), Gaps = 1/448 (0%)
 Frame = +3

Query  3     RIDYFYN-QGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSV  179
             R +YFY   GR+ FF  R++ ++STV R NMPPGPF++ D +VV LLD  SFP LFD S+
Sbjct  65    RYEYFYGPGGRDGFFAARVRAHRSTVVRLNMPPGPFVARDPRVVALLDAASFPVLFDTSL  124

Query  180   VEKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAY  359
             V+K D+FTGT+MPST+LTGGYR+LSY+DPSEPNHA LK L+F+LLSHRR  ++P+F   Y
Sbjct  125   VDKTDLFTGTFMPSTDLTGGYRVLSYLDPSEPNHAPLKTLLFYLLSHRRQQVIPKFREVY  184

Query  360   AEMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
              ++F  +EN+LA  GKA     ND AAF FL + L G DP ++ L  D PKLI KWVLF 
Sbjct  185   GDLFGLMENDLARVGKADFGVHNDAAAFGFLCQGLLGRDPAKSALGRDGPKLITKWVLFQ  244

Query  540   LHPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEA  719
             L P+LSLGLP  +ED LLH+ RLPPALVKKDY RL +FF + + A++D GE LG++REEA
Sbjct  245   LSPLLSLGLPTLVEDTLLHSLRLPPALVKKDYDRLADFFRDAAKAVVDEGERLGIAREEA  304

Query  720   CHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQ  899
              HN++FA CFNSFGGMKI FP ++KW+GRAG  +H +LA E+R  V+ NGG++TM  + +
Sbjct  305   VHNILFALCFNSFGGMKILFPTLVKWLGRAGARVHGRLATEVRGAVRDNGGEVTMKALAE  364

Query  900   MELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF  1079
             M L+KS VYE+ RIEPPV  QYGRAKRD+V+ESHD  ++V+EGEMLFG+QP ATKDP++F
Sbjct  365   MPLVKSAVYEALRIEPPVAMQYGRAKRDMVVESHDYGYEVREGEMLFGYQPMATKDPRVF  424

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
              R +E++P RF+GE G  LL+HV+WSNG ET  PT++DKQCAGKDFV+LV+RL+LVELFL
Sbjct  425   ARPEEYVPDRFLGEDGARLLRHVVWSNGPETAAPTLHDKQCAGKDFVVLVARLLLVELFL  484

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             RYDSFD+EVG S LG+SVT+TSLK+ATF
Sbjct  485   RYDSFDVEVGTSTLGSSVTVTSLKKATF  512



>ref|XP_002281159.1| PREDICTED: allene oxide synthase, chloroplastic [Vitis vinifera]
Length=483

 Score =   526 bits (1354),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 255/450 (57%), Positives = 341/450 (76%), Gaps = 5/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQG++EFF+ R+QKY STVFR NMPPGPFISSDSKVV LLD  SFP LFD S V
Sbjct  35    RFDYFYNQGQDEFFKTRMQKYHSTVFRANMPPGPFISSDSKVVVLLDAVSFPVLFDSSKV  94

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR+V  GT+MPST+LTGGYR+L+++DPSEP H  LK   F LL+ R    +P F +   
Sbjct  95    EKRNVLDGTFMPSTDLTGGYRVLAFLDPSEPKHDLLKRFSFSLLASRHRDFIPVFRSGLP  154

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F T+E++++  GKA  N   D   FNF+ R + G DP   K+R + P +  KW+   L
Sbjct  155   DLFTTIEDDVSSKGKANFNNIADGMYFNFVFRLICGKDPSDAKIRSEGPNIFSKWLFLQL  214

Query  543   HPVLSLG---LPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+++LG   LP  IED LLHTF LPP LVK DY +LY+ FYE+++++LD GE +G++R+
Sbjct  215   SPLMTLGLSMLPNFIEDLLLHTFPLPPFLVKSDYNKLYKAFYESASSVLDEGERMGINRD  274

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNLVF   F++FGGMK+ FP ++KW+G AG  LH +LA EIR+VVKA GG +T A +
Sbjct  275   EACHNLVFLAGFSTFGGMKVLFPPLIKWVGLAGEKLHRELADEIRTVVKAEGG-VTFAAL  333

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             ++M L KS VYE+ RI PPVP QYG+A+ D+VI SHDA F++K+GEM+FG+QPFATKDPK
Sbjct  334   DKMALTKSVVYEALRIGPPVPFQYGKAREDMVIHSHDAAFEIKKGEMIFGYQPFATKDPK  393

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             +F+  ++F+ HRF+GE G+ LLK+V WSNGRET+NPT  +KQC+GKD V+L+S+LMLVE+
Sbjct  394   VFENPEDFVAHRFMGE-GEKLLKYVYWSNGRETDNPTAENKQCSGKDLVVLISKLMLVEI  452

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             FLRYD+F++E G   LG++V   SL ++++
Sbjct  453   FLRYDTFEVESGTMVLGSAVLFKSLTKSSY  482



>ref|XP_006856192.1| hypothetical protein AMTR_s00059p00186400 [Amborella trichopoda]
 gb|ERN17659.1| hypothetical protein AMTR_s00059p00186400 [Amborella trichopoda]
Length=520

 Score =   522 bits (1344),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 259/454 (57%), Positives = 348/454 (77%), Gaps = 9/454 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYF  +GR+EFF+ R+Q+YQSTV+RTNMPPGP I+SD + + LLDG SFP LFD   V
Sbjct  69    RLDYF--KGRDEFFKSRMQRYQSTVYRTNMPPGPPIASDPRCIVLLDGVSFPVLFDNEKV  126

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPS ELTGGYR+LSY+D  EP+H++LK  +F +L   R+ ++PEF  A  
Sbjct  127   EKKDLFTGTYMPSVELTGGYRVLSYLDVREPSHSRLKRFLFGVLEASRNRIVPEFSTAMT  186

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMR---TKLRLDAPKLIGKWVL  533
             E+F  +E++L+ +GKA  N+ N QA FNFLAR+L G DP      KL  DAP LI KWV 
Sbjct  187   ELFSEVEDKLSADGKADFNSPNQQACFNFLARALLGHDPAEPGPDKLGKDAPTLIQKWVA  246

Query  534   FNLHPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
             F L+P+LSLGLP  IE+ LL T  LP  LVK DY+RL++FF  + T  L+  + LG+ R 
Sbjct  247   FQLYPILSLGLPTPIEEVLLRTTGLPTFLVKNDYERLFKFFNSSKTKPLEIADELGIDRV  306

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKA----NGGKIT  881
             EA HNL+FATCFN++GG+ I  P ++KW+GRAG +LH +LA+E+R+ V+A    +   ++
Sbjct  307   EASHNLLFATCFNTWGGLIIVLPGLMKWVGRAGATLHRELAQEVRAAVQATSQHSSSGLS  366

Query  882   MAGMEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFAT  1061
              A + QM L+KS VYE+ RIEPPVPTQYGRA++D++I+SH + F+V+ GEML G+QPFAT
Sbjct  367   PAALAQMPLVKSCVYEALRIEPPVPTQYGRARKDLIIDSHISSFRVRAGEMLCGYQPFAT  426

Query  1062  KDPKIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLM  1241
             +DP IFDR +EF+  RF+GE+G+ +L ++LWSNG+ETE+ T N+KQCAGKDFV++V+RL 
Sbjct  427   RDPLIFDRPEEFVAKRFMGEEGEKMLNYLLWSNGKETEDTTENNKQCAGKDFVVMVARLF  486

Query  1242  LVELFLRYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             L ELFLRYDSFD+E+  + LG++V +TSLKRATF
Sbjct  487   LAELFLRYDSFDVEISSAKLGSAVAITSLKRATF  520



>ref|XP_002281226.1| PREDICTED: allene oxide synthase, chloroplastic [Vitis vinifera]
Length=487

 Score =   517 bits (1332),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 254/449 (57%), Positives = 333/449 (74%), Gaps = 5/449 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY QGREEFF  R+ KYQSTVFR NMPPGPF++S+  V+ LLD  SFP LFD S V
Sbjct  39    RLDYFYKQGREEFFNARMHKYQSTVFRANMPPGPFMASNPNVIVLLDSISFPILFDTSKV  98

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR+V  GTYMPST  TGGYR+ +Y+DPSE NHA LK L    L+ R H+ +P F ++ +
Sbjct  99    EKRNVLDGTYMPSTAFTGGYRVCAYLDPSETNHALLKRLFMSALAARHHNFIPLFRSSLS  158

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F +LE++++  G+A  N  +D  +FNF+ R      P  T L    P ++ KW+ F L
Sbjct  159   ELFTSLEDDISSKGEADFNDISDNMSFNFVFRLFCDKYPSETALGSQGPSIVTKWLFFQL  218

Query  543   HPVLSLG---LPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+++LG   LP  +ED LLHTF LP   VK DY++LY  FY ++++ILD  E +G+ R+
Sbjct  219   APLITLGLSLLPNFVEDLLLHTFPLPSIFVKSDYKKLYRAFYASASSILDEAESMGIKRD  278

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNLVF   FN++GGMK  FP+++KW+G AG  LH +LA EIR+VVKA GG ++ A +
Sbjct  279   EACHNLVFLAGFNAYGGMKALFPSLIKWVGSAGEKLHRELADEIRTVVKAEGG-VSFAAL  337

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             E+M L KS VYE+ RI+PPVP QYG+AK D+VI SHDA F++K+GEM+FG+QPFATKDPK
Sbjct  338   EKMSLTKSVVYEALRIDPPVPFQYGKAKEDMVIHSHDAAFEIKKGEMIFGYQPFATKDPK  397

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             +FD  +EF+ +RF+GE G+ LLK+V WSNGRE+ NPTV +KQCAGKD V+L+SR+MLVE 
Sbjct  398   VFDNPEEFMGNRFMGE-GERLLKYVYWSNGRESGNPTVENKQCAGKDLVLLLSRVMLVEF  456

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             FLRYD+FDIE G   LG+SVT  S+ +AT
Sbjct  457   FLRYDTFDIESGTLLLGSSVTFKSITKAT  485



>ref|XP_008778307.1| PREDICTED: allene oxide synthase 2-like [Phoenix dactylifera]
Length=495

 Score =   512 bits (1318),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 249/446 (56%), Positives = 332/446 (74%), Gaps = 0/446 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D++Y QG++ +F+ R+ KY STV R N+PPGPF++SD KVV +LD KSF  LFDVS V
Sbjct  47    RLDFYYFQGQDAYFQSRVDKYGSTVVRLNVPPGPFMASDPKVVAVLDAKSFQVLFDVSKV  106

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK++VFTGTYMPST LTGG+R+ SY+DPSEPNHAK+K L+F LL+ R+ H++P F   +A
Sbjct  107   EKKNVFTGTYMPSTALTGGFRVCSYLDPSEPNHAKVKQLLFNLLASRKSHVIPAFRTNFA  166

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +F+T+E ++   GKA  N  ND  +F F+  + +GV P  + L    P    KW+LF L
Sbjct  167   TLFETMEAQIDAYGKADFNKLNDDTSFEFIGEAYFGVLPSASGLGTTGPAKATKWLLFQL  226

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+ S+GLPK +E+  LHTF LPP L K DY+ LYE+F   +  +LD    LG+S+ EAC
Sbjct  227   APLTSVGLPKIVEEVFLHTFPLPPCLAKSDYKALYEYFSTAAKPVLDAAVTLGLSKGEAC  286

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FAT FNS+GGMK+  P +L+W+  A  SLH +LA+EIRS V A GGK+T++ +E+M
Sbjct  287   HNLLFATVFNSYGGMKVMLPGILRWLATADPSLHARLAQEIRSAVAAAGGKVTLSAVEEM  346

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL KS VYE+ R++PPV  QYG+AK+D++IESHDA +QVK GEMLFG+QP AT+D ++F 
Sbjct  347   ELTKSVVYEALRMDPPVKFQYGKAKKDLIIESHDAAYQVKRGEMLFGYQPLATRDERVFA  406

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
              A EF+  RFVG++GK LLK+V+WSNG ETE+ +V +KQCAGKD V+LV RLMLVELFLR
Sbjct  407   NAGEFVADRFVGKEGKKLLKYVVWSNGPETESTSVWNKQCAGKDLVVLVGRLMLVELFLR  466

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRAT  1340
             YD+F  EVG   LG  V  TSL +++
Sbjct  467   YDTFTAEVGTQLLGIQVNFTSLTKSS  492



>ref|XP_002281201.1| PREDICTED: allene oxide synthase-like [Vitis vinifera]
Length=498

 Score =   510 bits (1314),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 253/451 (56%), Positives = 331/451 (73%), Gaps = 6/451 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYN+GR++FFR R+QKYQSTVFR NMPPGP ++S+  VV LLD  SFP LFD S +
Sbjct  41    RFDYFYNEGRDQFFRTRMQKYQSTVFRANMPPGPSMASNPNVVVLLDAISFPILFDTSRI  100

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR+V  GTYMPST  TGGYR+ +Y+DPSEPNHA LK L    L+ R H+ +  F +   
Sbjct  101   EKRNVLDGTYMPSTAFTGGYRVCAYLDPSEPNHALLKRLFMSSLAARHHNFISVFRSCLT  160

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F TLE++ +  GKA  N  +D  +FNF+ +      P  TKL  + P L+ KW+   L
Sbjct  161   ELFITLEDDASRKGKADFNGISDNMSFNFVFKLFCDKHPSETKLGSNGPNLVTKWLFLQL  220

Query  543   HPVLSLG---LPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+++LG   LP  +ED LLHTF LP   VK DY+ LY  FY ++++ILD  E +G+ R+
Sbjct  221   APLITLGLSMLPNVVEDLLLHTFPLPSLFVKSDYKNLYHAFYASASSILDEAESMGIKRD  280

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNLVF   FN++GGMK  FP ++KW+G AG  LH QLA EIRS+VKA GG +T A +
Sbjct  281   EACHNLVFLAGFNAYGGMKTLFPALIKWVGLAGEKLHGQLADEIRSIVKAEGG-VTFAAL  339

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             ++M L KS VYE+ RIEPPVP QYG+AK D+VI SHDA F++K+GEM+FG+QPFATKDPK
Sbjct  340   DKMALTKSVVYEALRIEPPVPFQYGKAKEDMVIHSHDAAFEIKKGEMIFGYQPFATKDPK  399

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             +FD  +EF+ HRF+G+ G+ +L++V WSNGRE+++PTV +KQC GKD V+L+SR+M+VE 
Sbjct  400   VFDNPEEFVAHRFMGD-GEKMLEYVYWSNGRESDDPTVENKQCPGKDLVVLLSRVMMVEF  458

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSL-KRATF  1343
             FLRYD+F+IE G   LG+SVT  SL K+ TF
Sbjct  459   FLRYDTFNIECGTLLLGSSVTFKSLTKQPTF  489



>ref|XP_011037601.1| PREDICTED: allene oxide synthase-like [Populus euphratica]
Length=480

 Score =   507 bits (1305),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 246/449 (55%), Positives = 328/449 (73%), Gaps = 5/449 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY+QG++EFF+ RIQK+ STV +TNMPPGPFI+ + KV+ +LD  SFP LFD S V
Sbjct  32    RLDYFYDQGKDEFFKTRIQKHNSTVIKTNMPPGPFIAKNPKVIAVLDAISFPILFDTSKV  91

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK +V  GT++PS   +GGYR+ +Y+DPSE  H  LK+    +L+ + +  +P F    +
Sbjct  92    EKYNVLDGTFLPSLSYSGGYRVCAYLDPSETKHTALKSYFMSVLASKHNEFIPLFRTCLS  151

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F ++E+ +A   KA  N      +FN++ R   G DP  T +    P +  KW+   L
Sbjct  152   QLFISIEDGIASQKKANFNNLGQVMSFNYIFRLFCGKDPSETAIGSKGPAIADKWLALQL  211

Query  543   HPVLSLGLP---KQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+ +LGLP   K ++D LLHTFRLP  LVK DY +LY+ FY +S  ILD  E  GV+RE
Sbjct  212   GPLFTLGLPKFLKYVDDLLLHTFRLPFFLVKSDYYKLYDVFYASSGPILDKAESFGVTRE  271

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNLVF  CF+++GG+K++FP ++KW+G AG  LH QLA EIR+VVK  GG IT+  M
Sbjct  272   EACHNLVFLACFSTYGGLKVWFPALIKWVGLAGEKLHRQLADEIRTVVKEEGG-ITIQAM  330

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             ++M L KS VYE+FRIEPPVP QY +AK DIV+ESH A +++K+GEM+FG+QPFATKDP+
Sbjct  331   DKMVLTKSVVYEAFRIEPPVPFQYAKAKEDIVVESHHAAYKIKKGEMIFGYQPFATKDPE  390

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             +FD A+EF+ HRFVGE G+ LLK+V WSNGRET +PTV DKQC GKD V+L+SRLMLVEL
Sbjct  391   VFDDAEEFVGHRFVGE-GEKLLKYVYWSNGRETVDPTVEDKQCPGKDMVVLLSRLMLVEL  449

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             FLRYD+F +E  + P+G+SVT TSL +AT
Sbjct  450   FLRYDTFTVETAVLPIGSSVTFTSLGKAT  478



>ref|NP_001268148.1| fatty acid hydroperoxide lyase 2 [Vitis vinifera]
 gb|ADP88811.1| fatty acid hydroperoxide lyase 2 [Vitis vinifera]
Length=498

 Score =   507 bits (1306),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 255/451 (57%), Positives = 328/451 (73%), Gaps = 6/451 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYN+GR+ FFR R+QKYQSTVFR NMPPGPF++ +  VV LLD  SFP LFD S +
Sbjct  41    RFDYFYNEGRDPFFRTRMQKYQSTVFRANMPPGPFMALNPNVVVLLDAISFPILFDTSRI  100

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR+V  GTYMPST  TGGYR+ +Y+DPSEPNHA LK L    L+ R H+ +P F +   
Sbjct  101   EKRNVLDGTYMPSTAFTGGYRVCAYLDPSEPNHALLKRLFTSSLAARHHNFIPVFRSCLT  160

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F TLE++++  GKA  N  +D  +FNF+ +      P  TKL  + P L+ KW+   L
Sbjct  161   ELFTTLEDDVSRKGKADFNGISDNMSFNFVFKLFCDKHPSETKLGSNGPNLVTKWLFLQL  220

Query  543   HPVLSLG---LPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P ++LG   LP  +ED LLHTF LP   VK DY++LY  FY ++++ILD  E +G+ R+
Sbjct  221   APFITLGLSMLPNVVEDLLLHTFPLPSLFVKSDYKKLYHAFYASASSILDEAESMGIKRD  280

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNLVF   FN+ GGMK  FP ++KW+G AG  LH QLA EIRS+VKA GG +T A +
Sbjct  281   EACHNLVFLAGFNACGGMKTLFPALIKWVGLAGEKLHRQLADEIRSIVKAEGG-VTFAAL  339

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             ++M L KS VYE+ RIEPPVP QYG+AK D+VI SHDA F +K+GEM+FG+QPFATKDPK
Sbjct  340   DKMALTKSVVYEALRIEPPVPFQYGKAKEDMVIHSHDAAFVIKKGEMIFGYQPFATKDPK  399

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             +FD  +EF+ HRF+G+ G+ LL++V WSNGRE+++ TV +KQC GKD V+L+SR+MLVE 
Sbjct  400   VFDNPEEFVAHRFMGD-GEKLLEYVYWSNGRESDDATVENKQCPGKDLVVLLSRVMLVEF  458

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSL-KRATF  1343
             FL YD+FDIE G   LG+SVT  SL K+ TF
Sbjct  459   FLHYDTFDIEYGTLLLGSSVTFKSLTKQPTF  489



>ref|XP_002468237.1| hypothetical protein SORBIDRAFT_01g042270 [Sorghum bicolor]
 gb|EER95235.1| hypothetical protein SORBIDRAFT_01g042270 [Sorghum bicolor]
Length=483

 Score =   506 bits (1303),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 246/448 (55%), Positives = 334/448 (75%), Gaps = 2/448 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D++Y QG++++F  R+++Y STV R N+PPGPF++ D +VV +LD KSFP LFD+  V
Sbjct  30    RLDFYYFQGQDKYFESRVERYGSTVVRINVPPGPFMARDPRVVAVLDAKSFPVLFDMDKV  89

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPST LTGGYR+ SY++PSEP H K+K ++F LL  R+  ++P F + ++
Sbjct  90    EKKDLFTGTYMPSTSLTGGYRVCSYLEPSEPTHTKVKQMLFSLLLSRKDDVIPTFRSNFS  149

Query  363   EMFDTLEnelagngkagl-naanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
              +  T+E++LA +G     N  ND  +F+F+  + +GV P  T L    P    KW+++ 
Sbjct  150   ALLATVESQLAKSGGKADFNKLNDVTSFDFIGEAYFGVRPSATDLGSGGPTKAAKWLIWQ  209

Query  540   LHPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEA  719
             LHP+++LGLP  +E+PLLHTF LPP LVK DY+ LY++F   +   LD  E LG+SREEA
Sbjct  210   LHPLVTLGLPMVLEEPLLHTFHLPPFLVKGDYRALYKYFSTAAKQALDTAEGLGLSREEA  269

Query  720   CHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQ  899
             CHNL+FAT FNS+GG+K+ FP +L  +  AG  LH +L  EIR  V   GGK+T+A +E+
Sbjct  270   CHNLLFATTFNSYGGLKVLFPGLLANVANAGEKLHEKLVAEIRGAVAEAGGKVTLAAVEK  329

Query  900   MELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF  1079
             MEL KS V+ES R++PPV  QYG AK+D++IESHDA FQVK+GEMLFG+QP ATKDP++F
Sbjct  330   MELAKSVVWESLRLDPPVKFQYGHAKKDLLIESHDAVFQVKKGEMLFGYQPCATKDPRVF  389

Query  1080  -DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELF  1256
              D A+EF+P RFVGE+G  LL++V WSNGRETENP+V++KQC GK+FV+LV RL LVELF
Sbjct  390   GDTAKEFVPDRFVGEEGSKLLQYVYWSNGRETENPSVDNKQCPGKNFVVLVGRLFLVELF  449

Query  1257  LRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             LRYD+F  EV    LGASV  T++ +AT
Sbjct  450   LRYDTFTAEVATELLGASVVFTAVTKAT  477



>gb|ACG28578.1| cytochrome P450 CYP74A19 [Zea mays]
Length=483

 Score =   503 bits (1294),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 246/447 (55%), Positives = 335/447 (75%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D++Y QG++++F  R+++Y STV R N+PPGPF++ D +VV +LD KSFP LFD+  V
Sbjct  31    RLDFYYFQGQDKYFESRVERYGSTVVRMNVPPGPFMARDPRVVAVLDAKSFPVLFDMDKV  90

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPST LTGG+R+ +Y+DPSEP HAK+K L+F LL  R+  ++P F + ++
Sbjct  91    EKKDLFTGTYMPSTSLTGGHRVCAYLDPSEPTHAKVKQLLFSLLLSRKDDVIPVFRSNFS  150

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +  T+E++LA  GKA  N  ND  +F+F+  + +GV P  T L    P    KW+++ L
Sbjct  151   SLLATVESDLAQGGKAEFNKLNDVTSFDFIGEAYFGVRPSATDLGKGGPTKAAKWLIWQL  210

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L+LGLP  +E+PLLHTF LPP LVK DY  LY++F   +   LD  E LG+SREEAC
Sbjct  211   HPLLTLGLPMVLEEPLLHTFHLPPFLVKGDYGALYKYFSTVAKQALDTAEGLGLSREEAC  270

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FAT FNS+GG+K+ FP +L  +  AG  LH +L  EIR  V   GGK+T+A +E+M
Sbjct  271   HNLLFATTFNSYGGLKVLFPGILANVASAGEKLHERLVAEIRGAVAEAGGKVTLAAVEKM  330

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL+KS V+ES R++PPV  QYG AK+D+ ++SHDA FQVK+GEMLFG+QP ATKDP++F 
Sbjct  331   ELVKSVVWESLRLDPPVKFQYGHAKKDLQVQSHDAVFQVKKGEMLFGYQPCATKDPRVFG  390

Query  1083  -RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
               A+EF+P RF+GE+G  LL++V WSNGRETENPTV++KQC GK+FV+LV RL LVELFL
Sbjct  391   ATAKEFVPGRFLGEEGSKLLQYVYWSNGRETENPTVDNKQCPGKNFVVLVGRLFLVELFL  450

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             RYD+F  ++G   LG+SV  TS+ +AT
Sbjct  451   RYDTFTADIGKDLLGSSVVFTSVTKAT  477



>ref|XP_009412306.1| PREDICTED: allene oxide synthase 2-like [Musa acuminata subsp. 
malaccensis]
Length=484

 Score =   503 bits (1294),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 246/445 (55%), Positives = 338/445 (76%), Gaps = 0/445 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D++Y QG+++FF+ R+ KY STV R N+PPGPF+++D +V+ +LD  SFP LFDVS V
Sbjct  33    RLDFYYFQGQDKFFQTRVDKYHSTVVRLNVPPGPFMANDPRVIAVLDANSFPILFDVSKV  92

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+DVFTGTYMPST LTGGYR+ SY+DPSEPNHAK+K L+F +L+ R+  ++P F   + 
Sbjct  93    EKKDVFTGTYMPSTSLTGGYRVCSYLDPSEPNHAKVKQLLFNILASRKDAVIPAFRTNFT  152

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +F+T+E+++   GK+  N  ND  +F+FL  + +GV P  T L    P    KW+   L
Sbjct  153   ALFETMESQVTAAGKSDFNKLNDNTSFDFLGEAYFGVRPSSTALGSTGPTKSTKWLFLQL  212

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+++LGLPK +E+ LLHTF LPP + K DY+ LY++F   + + LD  E LG+ R+EAC
Sbjct  213   CPLMTLGLPKILEELLLHTFPLPPLIAKCDYKALYKYFSSVAGSALDSAEKLGLKRDEAC  272

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FAT FNS+GGMK+  P +L W+ +A  SLH +LAKEIRS V   GGK+T+  +E+M
Sbjct  273   HNLLFATVFNSYGGMKVLLPGILGWLAKADKSLHVRLAKEIRSAVLFEGGKVTLNAVEKM  332

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             +L +S VYE+ R++PPV  QYG+AK+D+VIESHDA F+VK+GEMLFG+QPFAT+DPK+FD
Sbjct  333   DLTRSVVYEALRMDPPVKYQYGKAKQDLVIESHDAAFKVKKGEMLFGYQPFATRDPKVFD  392

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
              A  FI  RF+G++GK L+K+V+WSNG ETE+PTV++KQC GKDFV+LV RL++VE FLR
Sbjct  393   DADRFIGDRFLGDEGKKLIKYVVWSNGPETESPTVSNKQCPGKDFVVLVGRLLVVEFFLR  452

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRA  1337
             YD+F  +VG   LG+ VT+TSL +A
Sbjct  453   YDTFTADVGTVLLGSQVTVTSLTKA  477



>tpg|DAA44175.1| TPA: putative cytochrome P450 superfamily protein isoform 1 [Zea 
mays]
 tpg|DAA44176.1| TPA: putative cytochrome P450 superfamily protein isoform 2 [Zea 
mays]
Length=482

 Score =   502 bits (1292),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 246/447 (55%), Positives = 333/447 (74%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D++Y QG++++F  R+++Y STV R N+PPGPF++ D +VV +LD KSFP LFD+  V
Sbjct  30    RLDFYYFQGQDKYFESRVERYGSTVVRMNVPPGPFMARDPRVVAVLDAKSFPVLFDMDKV  89

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRD+FTGTYMPST LTGG+R+ +Y+DPSEP HAK+K L+F LL  R+  ++P F + ++
Sbjct  90    EKRDLFTGTYMPSTSLTGGHRVCAYLDPSEPTHAKVKQLLFSLLLSRKDDVIPVFRSNFS  149

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +  T+E++LA  GKA  N  ND  +F+F+  + +GV P  T L    P    KW+++ L
Sbjct  150   SLLATVESDLAEGGKAEFNKLNDVTSFDFIGEAYFGVRPSATDLGKGGPTKAAKWLIWQL  209

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+L+LGLP  +E+PLLHTF LPP  VK DY  LY++F   +   LD  E LG+SREEAC
Sbjct  210   HPLLTLGLPMVLEEPLLHTFHLPPFFVKGDYGALYKYFSTVAKQALDTAEGLGLSREEAC  269

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FAT FNS+GG+K+ FP +L  +  AG  LH +L  EIR  V   GGK+T+A +E+M
Sbjct  270   HNLLFATTFNSYGGLKVLFPGILANVASAGEKLHERLVAEIRGAVAEAGGKVTLAAVEKM  329

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL KS V+ES R++PPV  QYG AK+D+ ++SHDA FQVK+GEMLFG+QP ATKDP++F 
Sbjct  330   ELAKSVVWESLRLDPPVKFQYGHAKKDLQVQSHDAVFQVKKGEMLFGYQPCATKDPRVFG  389

Query  1083  -RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
               A+EF+P RF+GE+G  LL++V WSNGRETENPTV++KQC GK+FV+LV RL LVELFL
Sbjct  390   ATAKEFVPGRFLGEEGSKLLQYVYWSNGRETENPTVDNKQCPGKNFVVLVGRLFLVELFL  449

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             RYD+F  ++G   LG+SV  TS+ +AT
Sbjct  450   RYDTFTADIGKDLLGSSVVFTSVTKAT  476



>emb|CAG17875.1| allene oxide synthase [Prunus persica]
Length=345

 Score =   494 bits (1272),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 259/345 (75%), Positives = 294/345 (85%), Gaps = 0/345 (0%)
 Frame = +3

Query  138   LDGKSFPTLFDVSVVEKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmfflls  317
             LDGKSFP LFDVS VEK+D+FTGTYMPS ELTGGYRILSY+DPSEP H KLK ++F+LL 
Sbjct  1     LDGKSFPVLFDVSKVEKKDLFTGTYMPSLELTGGYRILSYLDPSEPKHDKLKRVIFYLLK  60

Query  318   hrrhhllPEFHNAYAEMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLR  497
               R  +LPEFH++Y E+F+TLE++LA  GKA    ANDQAAFNFLARSLY  +P  T L 
Sbjct  61    SSRDSVLPEFHSSYTELFETLESKLADKGKADFVEANDQAAFNFLARSLYRANPADTPLG  120

Query  498   LDAPKLIGKWVLFNLHPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAI  677
             LD PKL+ KWVLFNL P+L LGLPK IEDPLLHTFRLPP L+KKDYQRLY+FFY++S  +
Sbjct  121   LDGPKLVSKWVLFNLGPLLMLGLPKFIEDPLLHTFRLPPFLIKKDYQRLYDFFYQSSGHV  180

Query  678   LDHGEILGVSREEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVV  857
             LD  E LGVSR+EACHNL+FATCFNSFGGMKI FPNMLKWIGRAGV LHTQLA+EIRSVV
Sbjct  181   LDEAERLGVSRDEACHNLLFATCFNSFGGMKILFPNMLKWIGRAGVKLHTQLAEEIRSVV  240

Query  858   KANGGKITMAGMEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEML  1037
             ++NGGKITM GMEQM LMKS VYE+FRIEPPV  QYG+AK D++IESHDA F+VKEGEML
Sbjct  241   RSNGGKITMGGMEQMPLMKSVVYEAFRIEPPVQLQYGKAKTDLLIESHDAAFKVKEGEML  300

Query  1038  FGFQPFATKDPKIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRET  1172
             FGFQ FATKD KIF+RA+EF+  RFVGE G+ LLKHVLWSNG ET
Sbjct  301   FGFQSFATKDSKIFERAEEFVADRFVGEDGEKLLKHVLWSNGPET  345



>gb|KCW63868.1| hypothetical protein EUGRSUZ_G01537, partial [Eucalyptus grandis]
Length=465

 Score =   495 bits (1275),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 243/450 (54%), Positives = 324/450 (72%), Gaps = 5/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY++G +EFFR R+QKYQSTVFR+NM PGPF++ + KVV LLD  SFP LFD S V
Sbjct  15    RLDYFYHEGTDEFFRTRMQKYQSTVFRSNMVPGPFMARNPKVVVLLDAVSFPILFDTSKV  74

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+DVF  TYMPS   TGGYR+ +Y+DPSEP HA LK L    L+ R    +P + ++ +
Sbjct  75    EKKDVFVATYMPSINFTGGYRVCAYLDPSEPKHAILKGLFLSTLATRHDKFIPLYRSSLS  134

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLD-APKLIGKWVLFN  539
             ++F  LE+E +  GK   N   ++ +FNFLA      +P  T L  D   K    W+ F 
Sbjct  135   QLFIELEDEFSSKGKVYFNDYCNKMSFNFLANLFCDRNPSSTILATDKVTKFFNSWLFFQ  194

Query  540   LHPVLSLGLPKQI---EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+++LGLPK +   ED +LHTF LP  L+K DY++ YE F E + +ILD  E LG+ R
Sbjct  195   LAPLMTLGLPKILNFLEDIVLHTFPLPSLLLKCDYKKFYEVFNEYAKSILDEAESLGIKR  254

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF  CFNS+GGMK   P ++KW+G AG  LH +L  EIR+VV++ GG +TMA 
Sbjct  255   DEACHNLVFLVCFNSYGGMKTTLPALIKWVGLAGEELHRRLVDEIRTVVRSEGG-VTMAA  313

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L KS  +E+ RIEPPV  QYG AK D++I +H+A F++K+GEM+FG+QPFATKDP
Sbjct  314   LEKMSLTKSVAWEALRIEPPVAFQYGHAKEDLMIHNHEAAFEIKKGEMIFGYQPFATKDP  373

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             +IF+R +EF+  RFVGE+G+ LLK+V WSNGRE ++PTV +KQC  K+ V+L+SR+MLVE
Sbjct  374   RIFERPEEFVGDRFVGEEGEKLLKYVYWSNGREIDDPTVGNKQCPAKNLVVLLSRVMLVE  433

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F IE G  PLG++VT TS+ +AT
Sbjct  434   FFLRYDTFTIEAGTLPLGSTVTFTSMSKAT  463



>ref|XP_009393009.1| PREDICTED: allene oxide synthase 2-like [Musa acuminata subsp. 
malaccensis]
Length=484

 Score =   495 bits (1275),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 242/439 (55%), Positives = 334/439 (76%), Gaps = 0/439 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D++Y QG +++F+ R+ KY STV R N+PPGPF++SD +VV +LD KSFP LFDVS V
Sbjct  28    RLDFYYFQGADKYFQSRVDKYHSTVIRLNVPPGPFMASDPRVVAVLDAKSFPVLFDVSKV  87

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+DVFTGTYMPST LTGGYR+ SY+DPSEP+HAK+K L+F +L+ R+  ++P F   + 
Sbjct  88    EKKDVFTGTYMPSTSLTGGYRVCSYLDPSEPSHAKVKQLLFNVLASRKDAVVPAFRTNFT  147

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +F T+E++LA  GK+  N  ND  +F FL  + +GV P  T+L    P    KW+   L
Sbjct  148   ALFQTMESQLASAGKSDFNKLNDNTSFEFLGEAYFGVRPSSTELGATGPTKSTKWLFLQL  207

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+++LGLPK +E+ LLHTF LPP + K DY+ LY++F + + + LD  E LG+SREEAC
Sbjct  208   CPLMTLGLPKILEELLLHTFPLPPLIAKGDYKALYKYFSDAAGSALDSAEKLGLSREEAC  267

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FAT FNS+GGMK+  P +L W+ +A  SLH +LAKEIR+ V   GGK+T+  +E+M
Sbjct  268   HNLLFATVFNSYGGMKVLLPGILGWLAKAEESLHARLAKEIRAAVAGEGGKVTLNAVEKM  327

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL +S VYE+ R++PPV  QYG+AK+D+VIESHDA +QVK+GEM+FG+QP AT+DPK+FD
Sbjct  328   ELTRSVVYEALRMDPPVKYQYGKAKQDLVIESHDAAYQVKKGEMIFGYQPLATRDPKVFD  387

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
             +A++FI  RF+G++GK L+K+V+WSNG ETE P+V +KQC GK+ V+LV RL++VE FLR
Sbjct  388   KAEQFIGDRFLGDEGKKLIKYVVWSNGPETETPSVANKQCPGKELVVLVGRLLVVEFFLR  447

Query  1263  YDSFDIEVGMSPLGASVTL  1319
             YD+F  +VG   LG+ VT+
Sbjct  448   YDTFTADVGTILLGSQVTV  466



>ref|XP_010065434.1| PREDICTED: allene oxide synthase-like [Eucalyptus grandis]
 gb|KCW62915.1| hypothetical protein EUGRSUZ_G00507 [Eucalyptus grandis]
Length=479

 Score =   495 bits (1274),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 243/450 (54%), Positives = 326/450 (72%), Gaps = 5/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY++GR+EFFR R+QKYQSTVFR+NM PGPF++ + KVV LLD  SFP LFD S V
Sbjct  29    RLDYFYHEGRDEFFRTRMQKYQSTVFRSNMVPGPFMARNPKVVVLLDAISFPILFDTSKV  88

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+DVF  TYMPS   TGGYR+ +Y+DPSEP HA  K L    L+ R +  +P + ++ +
Sbjct  89    EKKDVFVATYMPSINFTGGYRVCAYLDPSEPKHAIFKGLFLSTLATRHNKFIPLYRSSLS  148

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLD-APKLIGKWVLFN  539
             ++F  LE+E +  GK   N   ++ +F+FLA      +P  T L  D   K    W+LF 
Sbjct  149   QLFIELEDEFSSKGKVYFNDYCNKMSFSFLANLFCDRNPSSTILATDKVTKFFDSWLLFQ  208

Query  540   LHPVLSLGLPKQI---EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+++LGLPK +   ED +LHTF LP  L+K DY++ YE F E + +ILD  E LG+ R
Sbjct  209   LAPLMTLGLPKILNFLEDIVLHTFPLPSLLLKYDYKKFYEVFNEYAKSILDEAESLGIKR  268

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF  CFNS+GGMK   P ++KW+G AG  L  +LA+EIR+VV++ GG +TMA 
Sbjct  269   DEACHNLVFLVCFNSYGGMKTTLPALIKWVGLAGEELQRRLAEEIRTVVRSEGG-VTMAA  327

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L KS  +E+ RIEPPV  QYG AK D+VI +HDA F++K+GEM+FG+QPFATKDP
Sbjct  328   LEKMSLTKSVAWEALRIEPPVAFQYGHAKEDLVIHNHDAAFEIKKGEMIFGYQPFATKDP  387

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             +IF+R +EF+  RFVGE+G+ LLK+V WSNGRE ++PTV +KQC  K+ V+L+SR+MLVE
Sbjct  388   RIFERPEEFVGDRFVGEEGEKLLKYVYWSNGREIDDPTVGNKQCPAKNLVVLLSRVMLVE  447

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F IE G  P+G++ T TS+ +AT
Sbjct  448   FFLRYDTFTIEAGTLPIGSTATFTSMSKAT  477



>ref|XP_010913749.1| PREDICTED: allene oxide synthase 2-like [Elaeis guineensis]
Length=491

 Score =   494 bits (1273),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 246/444 (55%), Positives = 333/444 (75%), Gaps = 0/444 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R++++Y +G++ +F+ R+ +Y+STV R N+PPGPF++S  KVV +LD  SF  LFDVS V
Sbjct  43    RLEFYYTKGQDGYFQSRVDEYESTVVRLNVPPGPFMASSPKVVAVLDANSFQVLFDVSKV  102

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK++VFTGTYMPST LTGG+R+ SY+DPSEP HAK+K L+F LL+ R+  ++P F   +A
Sbjct  103   EKKNVFTGTYMPSTALTGGFRVCSYLDPSEPTHAKVKQLLFNLLASRKSQVIPTFRTNFA  162

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +F+T+E ++  +GKA  N  ND  +F  +    +GV P  + L    P    KW+LF L
Sbjct  163   TLFETMEAQIDADGKADFNKLNDNTSFECIGEVYFGVRPSASNLGTTGPTKAVKWLLFQL  222

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+ SLGLPK +E+  LHTF LPP L K DY+ LY++F   +  +LD    LG+SREEAC
Sbjct  223   APLTSLGLPKILEEIFLHTFPLPPCLAKSDYKALYKYFSTAAEPVLDAAVTLGLSREEAC  282

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FAT FNS+GGMK+ FP +L+W+ +A   LH QLAKEIRS V A GGK+T+A +E+M
Sbjct  283   HNLLFATVFNSYGGMKVMFPGILRWLAKADSDLHAQLAKEIRSAVAAEGGKVTLAAVEKM  342

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             ELMKS VYE+ R++PPV  QYG+AK+D++IESHDA ++VK+GEMLFG+QP AT+D ++F 
Sbjct  343   ELMKSVVYEALRMDPPVKFQYGKAKKDLIIESHDAAYEVKKGEMLFGYQPLATRDERVFA  402

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
              A EF+  RFVGEKGK LLK+V+WSNG ETE+P++++KQCAGK+ V+L+ RL+LVELFLR
Sbjct  403   NAGEFVADRFVGEKGKKLLKYVVWSNGPETESPSLSNKQCAGKELVVLLGRLLLVELFLR  462

Query  1263  YDSFDIEVGMSPLGASVTLTSLKR  1334
             YD+F  EVG   LG  VT TSL +
Sbjct  463   YDTFTAEVGTDALGIQVTFTSLTK  486



>ref|XP_010068499.1| PREDICTED: allene oxide synthase-like, partial [Eucalyptus grandis]
Length=487

 Score =   493 bits (1270),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 243/450 (54%), Positives = 327/450 (73%), Gaps = 5/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY++GR+EFFR R+QKYQSTVFR+NM PGPF++ + KVV LLD  SFP LFD S V
Sbjct  37    RLDYFYHEGRDEFFRTRMQKYQSTVFRSNMVPGPFMARNPKVVVLLDAISFPILFDTSKV  96

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+DVF  TYMPS   TGGYR+ +Y+DPSEP HA  K L    L+ R +  +P + ++ +
Sbjct  97    EKKDVFVATYMPSINFTGGYRVCAYLDPSEPKHAIFKGLFLSTLATRHNKFIPLYRSSLS  156

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLD-APKLIGKWVLFN  539
             ++F  LE+E +  GK   N   ++ +F+FLA      +P  T L  D   K    W+LF 
Sbjct  157   QLFIELEDEFSSKGKVYFNDYCNKMSFSFLANLFCDRNPSSTILATDKVTKFFDSWLLFQ  216

Query  540   LHPVLSLGLPKQI---EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+++LGLPK +   ED +LHTF LP  L+K DY++ YE F E + +ILD  E LG+ R
Sbjct  217   LAPLMTLGLPKILNFLEDIVLHTFPLPSLLLKYDYKKFYEVFNEYAKSILDEAESLGIKR  276

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF  CFNS+GGMK   P ++KW+G AG  L  +LA+EIR+VV++ GG +TMA 
Sbjct  277   DEACHNLVFLVCFNSYGGMKTTLPALIKWVGLAGEELQRRLAEEIRTVVRSEGG-VTMAA  335

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L KS  +E+ RIEPPV  QYG AK D++I +H+A F++K+GEM+FG+QPFATKDP
Sbjct  336   LEKMSLTKSVAWEALRIEPPVAFQYGHAKEDLMIHNHEAAFEIKKGEMIFGYQPFATKDP  395

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             +IF+R +EF+  RFVGE+G+ LLK+V WSNGRE ++PTV +KQC  K+ V+L+SR+MLVE
Sbjct  396   RIFERPEEFVGDRFVGEEGEKLLKYVYWSNGREIDDPTVGNKQCPAKNLVVLLSRVMLVE  455

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F IE G  PLG++VT TS+ +AT
Sbjct  456   FFLRYDTFTIEAGTLPLGSTVTFTSMSKAT  485



>ref|XP_004985140.1| PREDICTED: allene oxide synthase 2-like [Setaria italica]
Length=482

 Score =   492 bits (1267),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 240/447 (54%), Positives = 327/447 (73%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D++Y QG++++F  R+++Y STV R N+PPGPF++ D +VV +LD KSFP LFD+  V
Sbjct  30    RLDFYYFQGQDKYFESRVERYGSTVVRINVPPGPFMAKDPRVVAVLDAKSFPVLFDMDKV  89

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+++FTGTYM ST LTGGYR+ SY+DPSEP H K+K ++F LL  R+  ++P F + ++
Sbjct  90    EKKNLFTGTYMSSTSLTGGYRVCSYLDPSEPTHTKVKQMLFNLLLSRKDEVIPTFRSNFS  149

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +  T+E+ELA +GKA  N  ND  +F+F+  + +GV P  T L    P    KW+++ L
Sbjct  150   SLLATVESELAKSGKAAFNKLNDVTSFDFIGEAYFGVRPSATNLGSSGPTKAAKWLIWQL  209

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+++LGLP  +E+PLLHTF LPP L+K DY+ LY ++       LD  E LG+SREEAC
Sbjct  210   HPLVTLGLPMVLEEPLLHTFHLPPFLIKGDYKALYNYYSTAGKQALDMAETLGLSREEAC  269

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FAT FNS+GG+K+ FP +L  I  AG  LH +L  EIR  V   GGK+T+A +E+M
Sbjct  270   HNLLFATTFNSYGGLKVLFPGLLANIANAGEKLHERLVAEIRGAVAEAGGKVTLAALEKM  329

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF-  1079
             EL KS V+ES R++PPV  QYG AK+D+ I SHD  FQVK+GEMLFG+QP ATKD ++F 
Sbjct  330   ELTKSVVWESLRLDPPVKFQYGHAKKDLEIASHDGVFQVKKGEMLFGYQPCATKDARVFG  389

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
               A+EF+P RFVG++G  LL++V WSNGRETE+P+V++KQC GK+FV+LV RL +VELFL
Sbjct  390   STAREFVPDRFVGDEGSKLLQYVYWSNGRETESPSVDNKQCPGKNFVVLVGRLFVVELFL  449

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             RYD+F   V    LGASV  TS+ +AT
Sbjct  450   RYDTFTATVSTELLGASVNFTSVTKAT  476



>ref|XP_011037602.1| PREDICTED: allene oxide synthase-like [Populus euphratica]
Length=476

 Score =   491 bits (1264),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 248/449 (55%), Positives = 328/449 (73%), Gaps = 5/449 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG++EFF  R++KYQSTVFRTNMPPGPFI+ + KV+ +LD  SFP LFD S +
Sbjct  28    RLDYFYNQGKDEFFSSRVEKYQSTVFRTNMPPGPFIAQNPKVIAVLDAISFPILFDTSKI  87

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK +V  GTY+PS   TGGYR+ +Y+DPSEPNH  LK+    +L+ +    +P F    +
Sbjct  88    EKFNVLDGTYLPSLSFTGGYRVCAYLDPSEPNHTSLKSFFMSVLASKHKDFVPLFRTCLS  147

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             +MF  +E+E++    A  N +ND  +FNF+ R     DP  TKL  + P ++ KWV   L
Sbjct  148   QMFIDIEDEMSSKRTANFNDSNDAMSFNFVFRLFCEKDPSETKLGSEGPAIVDKWVGLQL  207

Query  543   HPVLSLGLP---KQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+ ++GLP   K  ED L+HTF +P  LVK DY++LY+ FY +S++ LD  E  G+ R+
Sbjct  208   APLATIGLPKFLKYFEDLLMHTFPIPFFLVKSDYKKLYDAFYASSSSFLDKAESFGIDRD  267

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNLVF   FN++GGMK +FP ++KW+G+AG  LH+QLA EIR+ VK  GG +T   +
Sbjct  268   EACHNLVFVAGFNAYGGMKAWFPTLIKWVGKAGEKLHSQLANEIRTAVKEEGG-VTFQAL  326

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             E+M L KS V+E+ RIEP VP QYG AK DIVI SHDA +++K+GEM+FG+QPFATKDPK
Sbjct  327   EKMALTKSVVFEALRIEPGVPFQYGMAKEDIVINSHDAAYEIKKGEMIFGYQPFATKDPK  386

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             IFD  +EF+ HRFVGE G+ LLK+V WSNGRETE+PT  +KQC GKD V+L+SRL++VEL
Sbjct  387   IFDHPEEFVGHRFVGE-GENLLKYVYWSNGRETEDPTAGNKQCPGKDLVVLLSRLLVVEL  445

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             FLRYD+F +E  + P G+SVTLTSL +AT
Sbjct  446   FLRYDTFTVETAVLPFGSSVTLTSLIKAT  474



>ref|XP_002305404.2| hypothetical protein POPTR_0004s15590g [Populus trichocarpa]
 gb|EEE85915.2| hypothetical protein POPTR_0004s15590g [Populus trichocarpa]
Length=476

 Score =   490 bits (1262),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 246/449 (55%), Positives = 328/449 (73%), Gaps = 5/449 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG++EFF  R++KYQSTVF+TNMPPGPFI+ + KV+ +LD  SFP LFD S +
Sbjct  28    RLDYFYNQGKDEFFSSRVEKYQSTVFKTNMPPGPFIAQNPKVIAVLDAISFPILFDTSKI  87

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK +V  GTY+PS   TGGYR+ +Y+DPSEPNH  LK+    +L+ +    +P F    +
Sbjct  88    EKFNVLDGTYLPSLSFTGGYRVCAYLDPSEPNHTSLKSFFMSVLASKHKDFVPLFRTCLS  147

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             +MF  +E+E+     A  N ++D  +FNF+ R     DP  TKL  + P ++ KWV   L
Sbjct  148   QMFIDIEDEMGSKRTANFNDSSDAMSFNFVFRLFCEKDPSETKLGSEGPAIVDKWVGLQL  207

Query  543   HPVLSLGLP---KQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+ ++G P   K  ED L+HTF +P  LVK DY++LY+ FY +S+++LD  E  G+ R+
Sbjct  208   APLATIGFPKFLKHFEDLLMHTFPIPFFLVKSDYKKLYDAFYASSSSVLDKAESFGIDRD  267

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNLVF   FN++GGMK +FP ++KW+G+AG  LH QLA EIR+VVK  GG +T   +
Sbjct  268   EACHNLVFVAGFNAYGGMKAWFPTLIKWVGKAGEKLHRQLANEIRTVVKEEGG-VTFQAL  326

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             E+M L KS V+E+ RIEP VP QYG+AK DIVI SHDA +++K+GEM+FG+QPFATKDPK
Sbjct  327   EKMTLTKSVVFEALRIEPGVPFQYGKAKEDIVINSHDAAYEIKKGEMIFGYQPFATKDPK  386

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             IF   +EF+ HRFVGE G+ LLK+V WSNGRETE+PTV +KQC GKD V+L+SRL++VEL
Sbjct  387   IFYHPEEFVGHRFVGE-GENLLKYVYWSNGRETEDPTVGNKQCPGKDLVVLLSRLLVVEL  445

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             FLRYD+F +E  + P G+SVTLTSL +AT
Sbjct  446   FLRYDTFTVETAVLPFGSSVTLTSLIKAT  474



>ref|XP_010065432.1| PREDICTED: allene oxide synthase-like [Eucalyptus grandis]
Length=479

 Score =   490 bits (1262),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 242/450 (54%), Positives = 324/450 (72%), Gaps = 5/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY++G +EFFR R+QKYQSTVFR+NM PGPF++ + KVV LLD  SFP LFD S V
Sbjct  29    RLDYFYHEGTDEFFRTRMQKYQSTVFRSNMVPGPFMARNPKVVVLLDAISFPILFDTSKV  88

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+DVF  TYMPS   TGGYR+ +Y+DPSEP HA  K L    L+ R +  +P + ++ +
Sbjct  89    EKKDVFVATYMPSINFTGGYRMCAYLDPSEPKHAIFKGLFLSTLATRHNKFIPLYRSSLS  148

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLD-APKLIGKWVLFN  539
             ++F  LE+E +  GK   N   ++ +F+FLA      +P  T L  D   K    W+LF 
Sbjct  149   QLFIELEDEFSSKGKVYFNDYCNKMSFSFLANLFCDRNPSSTILATDKVTKFFDSWLLFQ  208

Query  540   LHPVLSLGLPKQI---EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+++LGLPK +   ED +LHTF LP  L+K DY++ YE F E + +ILD  E LG+ R
Sbjct  209   LAPLMTLGLPKILNFLEDIVLHTFPLPSLLLKCDYKKFYEVFNEYAKSILDEAESLGIKR  268

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF  CFNS+GGMK   P ++KW+G AG  L  +L +EIR+VV++ GG +TMA 
Sbjct  269   DEACHNLVFLVCFNSYGGMKTTLPALIKWVGLAGEELQRRLTEEIRTVVRSEGG-VTMAA  327

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L KS  +E+ RIEPPVP QYG AK D+VI +HDA F++K+GEM+ G+QPFATKDP
Sbjct  328   LEKMSLTKSVAWEALRIEPPVPFQYGHAKEDLVIHNHDAAFEIKKGEMICGYQPFATKDP  387

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             +IF+R +EF+  RFVGE+G+ LLK+V WSNGRE ++PTV +KQC  K+ V+L+SR+MLVE
Sbjct  388   RIFERPEEFVGDRFVGEEGEKLLKYVYWSNGREIDDPTVGNKQCPAKNLVVLLSRVMLVE  447

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F IE G  PLG++ T TS+ +AT
Sbjct  448   FFLRYDTFTIEAGTLPLGSTATFTSMSKAT  477



>ref|XP_010096244.1| Allene oxide synthase [Morus notabilis]
 gb|EXB63639.1| Allene oxide synthase [Morus notabilis]
Length=482

 Score =   490 bits (1261),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 246/452 (54%), Positives = 326/452 (72%), Gaps = 8/452 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFY+QG++EFFR RI KY STVFRTNMPPGPFI+S+ KV+ +LD  SF  L D S V
Sbjct  30    RHDYFYSQGQDEFFRTRINKYNSTVFRTNMPPGPFIASNPKVIAVLDAVSFAVLLDNSKV  89

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR V  GT+MPST  TGG+R+ +Y+DPSEPNHAKLK+    LL+ ++ + +P F  + +
Sbjct  90    EKRGVLDGTFMPSTAYTGGHRVCAYLDPSEPNHAKLKSFFLSLLASKKDNFIPLFRASLS  149

Query  363   EMFDTLEnelagngkagln---aanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVL  533
             E+F  LE+++    K       A ND+ +FNF+ +  +   P  + L    P    KW+ 
Sbjct  150   ELFTNLEDQVHDKSKKNTADFNAQNDEMSFNFIFQLFFDRKPSESGLGSKGPAHFDKWLF  209

Query  534   FNLHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGV  704
             F L P+++LGL K    +ED LLH F LP  LVK DY++LY+ FY ++ ++LD  E  G+
Sbjct  210   FQLAPLITLGLSKFLNCLEDLLLHVFPLPWFLVKSDYKKLYDEFYSSAGSVLDEAERFGI  269

Query  705   SREEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITM  884
              R+EACHNLVF   FN++GGMK +FP ++KW+G AG SLH QLA EIR+VVK  GG I  
Sbjct  270   ERKEACHNLVFLAGFNAYGGMKAWFPGLIKWVGSAGESLHHQLADEIRTVVKEEGG-IGF  328

Query  885   AGMEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATK  1064
               +E+M L KS VYE+ RIEPPVP QYG+AK D+V+ SHDA F++K+GEM+FG+QPFATK
Sbjct  329   GALERMSLTKSVVYEALRIEPPVPFQYGKAKEDMVVYSHDAGFKIKKGEMIFGYQPFATK  388

Query  1065  DPKIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLML  1244
             DPK+F+  +EF+ HRFVGE G+ LLK+V WSNGRETE+PTV++KQC  +D V+L+SR+ L
Sbjct  389   DPKVFENPEEFVGHRFVGE-GEKLLKYVYWSNGRETEDPTVDNKQCPARDLVVLLSRVFL  447

Query  1245  VELFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             VELFLRYD+F IE G   LG+SV + SL +A+
Sbjct  448   VELFLRYDTFTIEAGRLLLGSSVKIKSLTKAS  479



>ref|XP_010065433.1| PREDICTED: allene oxide synthase-like [Eucalyptus grandis]
 gb|KCW62909.1| hypothetical protein EUGRSUZ_G00501 [Eucalyptus grandis]
Length=479

 Score =   488 bits (1255),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 240/450 (53%), Positives = 324/450 (72%), Gaps = 5/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY++GR+EFFR R+QKYQSTVFR+NM PGPF++ + KVV LLD  SFP LFD S V
Sbjct  29    RLDYFYHEGRDEFFRTRMQKYQSTVFRSNMVPGPFMARNPKVVVLLDAISFPILFDTSKV  88

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+DVF  TYMPS   TGGYR+ +Y+DPSEP HA  K L    L+ R +  +P + ++ +
Sbjct  89    EKKDVFVTTYMPSINFTGGYRVCAYLDPSEPKHAIFKGLFLSTLATRHNKFIPLYRSSLS  148

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLD-APKLIGKWVLFN  539
             ++F  LE+E +  GK   N   ++ +F+FLA      +P  T L  D   K    W+ F 
Sbjct  149   QLFIELEDEFSSKGKVYFNDYCNKMSFSFLANLFCDRNPSSTILATDKVTKFFDSWLFFQ  208

Query  540   LHPVLSLGLPKQI---EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+++LGLPK +   ED +LHTF LP  L+K DY++ YE F E + +ILD  E LG+ R
Sbjct  209   LAPLMTLGLPKILNFLEDIVLHTFPLPSLLLKCDYKKFYEVFNEYAKSILDEAESLGIKR  268

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             EEACHNLVF  CFNS+GGMK   P ++KW+G AG  L  +LA+EIR+VV++ G ++TMA 
Sbjct  269   EEACHNLVFLVCFNSYGGMKTTLPALIKWVGLAGEELQRRLAEEIRTVVRSEG-RVTMAA  327

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L KS  +E+ RIEPPV  Q G AK D+VI +HDA F++K+GEM+FG+QPFATKDP
Sbjct  328   LEKMSLTKSVAWEALRIEPPVAFQCGHAKEDLVIHNHDAAFEIKKGEMIFGYQPFATKDP  387

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             +IF+R +EF+  RFVGE+G+ +LK+V WSNGRE ++PTV +KQC  K+ V+L+SR+MLVE
Sbjct  388   RIFERPEEFVGDRFVGEEGEKMLKYVYWSNGREIDDPTVGNKQCPAKNLVVLLSRVMLVE  447

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F IE G  P+G++ T TS+ +AT
Sbjct  448   FFLRYDTFTIEAGTLPIGSTATFTSMSKAT  477



>ref|XP_002305405.1| allene oxide synthase family protein [Populus trichocarpa]
 gb|EEE85916.1| allene oxide synthase family protein [Populus trichocarpa]
Length=481

 Score =   487 bits (1254),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 243/449 (54%), Positives = 327/449 (73%), Gaps = 5/449 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG++EFF+ RIQK+ STV +TNMPPGPFI+ + KV+ +LD  SFP LFD S V
Sbjct  33    RLDYFYNQGKDEFFKTRIQKHNSTVIKTNMPPGPFIAKNPKVIAVLDAISFPILFDTSKV  92

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK +V  GT++PS   +GGYR+ +Y+DPSE  H  LK+    +L+ +    +P F    +
Sbjct  93    EKYNVLDGTFLPSLSYSGGYRVCAYLDPSETKHTALKSYFMSVLASKHSEFIPLFRTCLS  152

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F ++E+ +A   KA  N      +FN++ R   G DP  T +    P +  KW+   L
Sbjct  153   QLFISIEDGIASQKKANFNNVCQVMSFNYIFRLFCGKDPSETAIGSKGPAIADKWLALQL  212

Query  543   HPVLSLGLP---KQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+ +LGLP   K ++D LLHTF+LP  LVK DY +LY+ FY +S  ILD  E  GV+RE
Sbjct  213   GPLFTLGLPKFLKYVDDLLLHTFKLPFFLVKSDYYKLYDVFYASSGPILDKAESFGVTRE  272

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNLVF  CF+++GG+K++FP ++KW+G +G  LH QLA EIR+VVK  GG +T+  M
Sbjct  273   EACHNLVFLACFSTYGGLKVWFPALIKWVGLSGEKLHRQLADEIRTVVKEEGG-VTIQAM  331

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             ++M L KS VYE+FRIEPPVP QY +AK DIV+ESH A +++K+GEM+FG+QPFATKDP+
Sbjct  332   DKMVLTKSVVYEAFRIEPPVPFQYAKAKEDIVVESHHAAYKIKKGEMIFGYQPFATKDPE  391

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             +FD A+EF+ HRFVGE G+ LLK+V WSNGRET +PTV DKQC GKD V+L+SRL+LVE 
Sbjct  392   VFDDAEEFVGHRFVGE-GEKLLKYVYWSNGRETVDPTVEDKQCPGKDMVVLLSRLLLVEF  450

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             FLRYD+F +E  + P+G+SVTLTSL +AT
Sbjct  451   FLRYDTFTVETAVLPIGSSVTLTSLGKAT  479



>ref|XP_010066073.1| PREDICTED: allene oxide synthase, chloroplastic-like [Eucalyptus 
grandis]
Length=475

 Score =   486 bits (1252),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 244/450 (54%), Positives = 325/450 (72%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY QGR+EFFR R++KY+STVFR NMPPGPFISS+  VV LLD  SFP LFD S V
Sbjct  26    RLDYFYFQGRDEFFRHRMRKYRSTVFRVNMPPGPFISSNPNVVVLLDAISFPVLFDTSKV  85

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR+V  GTYMPST  TGG+R  +++DPSEP HA +K+    LL+ RR+  +P   +  +
Sbjct  86    EKRNVLDGTYMPSTAFTGGHRACAFLDPSEPKHATIKHWFLSLLAARRNVFIPTLRSCLS  145

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F  LE+EL+  GKA  N+ ND+ +FNF+ + L    P  T L      +   W+L  L
Sbjct  146   DLFVDLEDELSSKGKASFNSLNDKMSFNFVFKLLCDQKPSSTILGTKGAAMFNLWILLQL  205

Query  543   HPVLSLGLPKQI----EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
              P+LSLG   ++    ED +LHTF LPP L+K  Y++LY+ F E++++ILD  E LG+ R
Sbjct  206   APILSLGFNNKVLNFLEDVILHTFPLPPLLIKSSYKKLYDTFSEHASSILDEAEKLGIDR  265

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF   FN++GGMK   P ++KW+G  G  LH QLA+EIRS V + GG +T+A 
Sbjct  266   DEACHNLVFLAGFNAYGGMKATLPILIKWVGSGGEDLHRQLAREIRSTVASEGG-VTLAA  324

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L KS VYE  RI PPV  QYG+A+RD+V+ SHDA FQ+K+GEM+FG+QPFATKDP
Sbjct  325   LDKMSLTKSVVYEVLRINPPVQFQYGKARRDMVVRSHDAAFQIKKGEMIFGYQPFATKDP  384

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             +IFD  ++F+  RFVGE G+ LLK+V WSNGRE ++PTV +KQC GKD V+L+ R+MLVE
Sbjct  385   RIFDDPEDFVGDRFVGE-GEKLLKYVYWSNGREIDDPTVGNKQCPGKDLVLLMCRVMLVE  443

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             +FLRYD+  +E G  P+G+SVT  SL +AT
Sbjct  444   MFLRYDTLGLECGSLPVGSSVTFKSLTKAT  473



>gb|ABK93995.1| unknown [Populus trichocarpa]
Length=481

 Score =   486 bits (1251),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 242/449 (54%), Positives = 327/449 (73%), Gaps = 5/449 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG++EFF+ RIQK+ STV +TNMPPGPFI+ + KV+ +LD  SFP LFD S V
Sbjct  33    RLDYFYNQGKDEFFKTRIQKHNSTVIKTNMPPGPFIAKNPKVIAVLDAISFPILFDTSKV  92

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK +V  GT++PS   +GGYR+ +Y+DPSE  H  LK+    +L+ +    +P F    +
Sbjct  93    EKYNVLDGTFLPSLSYSGGYRVCAYLDPSETKHTALKSYFMSVLASKHSEFIPLFRTCLS  152

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F ++E+ +A   KA  N      +FN++ R   G DP  T +    P +  KW+   L
Sbjct  153   QLFISIEDGIASQKKANFNNVCQVMSFNYIFRLFCGKDPSETAIGSKGPAIADKWLALQL  212

Query  543   HPVLSLGLP---KQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+ +LGLP   K ++D LLHTF+LP  LVK DY +LY+ FY +S  ILD  E  GV+RE
Sbjct  213   GPLFTLGLPKFLKYVDDLLLHTFKLPFFLVKSDYYKLYDVFYASSGPILDKAESFGVTRE  272

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNLVF  CF+++GG+K++FP ++KW+G +G  LH QLA EIR+VVK  GG +T+  M
Sbjct  273   EACHNLVFLACFSTYGGLKVWFPALIKWVGLSGEKLHRQLADEIRTVVKEEGG-VTIQAM  331

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             ++M L KS VYE+FRIEPPVP QY +AK DI++ESH A +++K+GEM+FG+QPFATKDP+
Sbjct  332   DKMVLTKSVVYEAFRIEPPVPFQYAKAKEDILVESHHAAYKIKKGEMIFGYQPFATKDPE  391

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             +FD A+EF+ HRFVGE G+ LLK+V WSNGRET +PTV DKQC GKD V+L+SRL+LVE 
Sbjct  392   VFDDAEEFVGHRFVGE-GEKLLKYVYWSNGRETVDPTVEDKQCPGKDMVVLLSRLLLVEF  450

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             FLRYD+F +E  + P+G+SVTLTSL +AT
Sbjct  451   FLRYDTFTVETAVLPIGSSVTLTSLGKAT  479



>gb|EYU37739.1| hypothetical protein MIMGU_mgv1a005707mg [Erythranthe guttata]
Length=474

 Score =   484 bits (1245),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 249/449 (55%), Positives = 316/449 (70%), Gaps = 6/449 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY  G  EFF+ R+ KYQSTVFR NMPPGPFIS  S VVCLLD  SF TLFD S V
Sbjct  28    RLDYFYGSGELEFFKTRMLKYQSTVFRCNMPPGPFISRSSAVVCLLDAVSFRTLFDNSKV  87

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR++  GTYMP+T  TGG+R  +++DPSEPNH  LK+    LLS ++   +P F  A A
Sbjct  88    EKRNLLDGTYMPTTAYTGGFRTCAFLDPSEPNHGLLKSFFLSLLSKKKDKFIPIFRQAMA  147

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F  L+ E+A NG +  N  ND  +F F+ R L   +P  T +  + PK++  W+ F L
Sbjct  148   DLFSGLDEEIASNGSSYFNDLNDTMSFQFVFRLLCDKNPSETGIGPNGPKIVDLWIFFQL  207

Query  543   HPVLSLG---LPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+LSLG   LP  +ED LLHT  LP  LVK  Y++LY+  YE++  ILD  E LG+ R+
Sbjct  208   APLLSLGLKFLPNFLEDLLLHTVPLPSFLVKSKYKKLYDAVYESAAPILDEAEKLGLQRD  267

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNLVF   FN++GGMK  FP+++KWI  AG  LH +LA EIRS VK NG  +T+A +
Sbjct  268   EACHNLVFFAGFNAYGGMKALFPSLIKWIAAAGGDLHRRLAGEIRSAVKENG--VTLAAV  325

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
               M L KS VYE+ RIEPPV  QYG+AK D  I +HD+ F +K GEMLFGFQP ATKDPK
Sbjct  326   NAMALTKSVVYEALRIEPPVSYQYGKAKHDFEIHNHDSTFSIKRGEMLFGFQPIATKDPK  385

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             +FD   EF+P RFVGE G+ L+++V WSNGRET+ PT  DKQCAGKD V+L+ RLM+VE 
Sbjct  386   VFDNPDEFVPERFVGE-GEKLIEYVYWSNGRETDEPTAGDKQCAGKDMVVLLCRLMVVEF  444

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             FLRYD+F +++G  P+G+SVT TSL +AT
Sbjct  445   FLRYDTFKVQIGKLPVGSSVTFTSLTKAT  473



>ref|XP_010068502.1| PREDICTED: allene oxide synthase, chloroplastic-like, partial 
[Eucalyptus grandis]
Length=457

 Score =   483 bits (1242),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 241/450 (54%), Positives = 326/450 (72%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY QGR+EFFR R++KY+STVFR NMPPGPFISS+  VV LLD  SFP LFD S V
Sbjct  4     RLDYFYFQGRDEFFRHRMRKYRSTVFRVNMPPGPFISSNPNVVVLLDAISFPVLFDTSKV  63

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR+V  GTYMPST  TGG+R  +++DPSEP HA +K+    LL+ RR+  +P   +  +
Sbjct  64    EKRNVLDGTYMPSTAFTGGHRACAFLDPSEPKHATIKHWFLSLLAARRNVFIPTLRSCLS  123

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F  LE+EL+  GKA  N+ ND+ +FNF+ + L   +P  T L      +   W+L  L
Sbjct  124   DLFVDLEDELSSKGKASFNSLNDKMSFNFVFKLLSDQNPSSTILGAKGAAMFDLWILLQL  183

Query  543   HPVLSLGLPKQI----EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
              P+ SLG    +    ED + HTF LPP L+K  Y++LY+ F E+++++LD  E LG+ R
Sbjct  184   APISSLGFNNMVLNFLEDVIFHTFPLPPLLIKSSYKKLYDAFSEHASSVLDEAERLGIDR  243

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF   FN++GGMK   P ++KW+G  G  LH +LA+EIRS + A+ G++T+A 
Sbjct  244   DEACHNLVFLAGFNAYGGMKATLPILIKWVGSGGEDLHRRLAREIRSTI-ASEGEVTLAT  302

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L KS VYE+ RI+PPV  QYG+AKRD+V+ SHDA FQ+K+GEM+FG+QPFATKDP
Sbjct  303   LDKMNLTKSVVYEALRIDPPVQFQYGKAKRDMVVRSHDAAFQIKKGEMVFGYQPFATKDP  362

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             ++FD  ++F+  RFVGE G+ LLK+V WSNGRE ++PTV +KQC GKD V+L  R+MLVE
Sbjct  363   RVFDDPEDFVGDRFVGE-GEKLLKYVYWSNGREIDDPTVGNKQCPGKDLVLLTCRVMLVE  421

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             LFLRYD+F +E G  P+G+SVT  SL +AT
Sbjct  422   LFLRYDTFGMECGSLPVGSSVTFKSLTKAT  451



>emb|CDO97108.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   483 bits (1243),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 247/453 (55%), Positives = 327/453 (72%), Gaps = 10/453 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DY+Y QG +EFFR R++KY+STVFR NMPPGPF++ +SKVV +LD  SFP LFD S V
Sbjct  38    RSDYYYKQGADEFFRSRVEKYKSTVFRCNMPPGPFMAHNSKVVTVLDAVSFPILFDNSRV  97

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+DV  GTYMPST  TGGYR  +Y+D  EP+HA++K L    L+   +  +P F ++ +
Sbjct  98    EKKDVLDGTYMPSTTFTGGYRACAYLDTDEPSHAEIKGLFLSQLAKLHNRFIPMFQSSLS  157

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYG----VDPMRTKLRLDAPKLIGKWV  530
             E+F  L+++++ +GKA  N  +DQA+F+F+ R L       DP  TK+  D P    KW+
Sbjct  158   ELFVKLDDDMSKDGKANFNDLSDQASFDFVFRLLCDNKSPADP-DTKIGSDGPTSFDKWL  216

Query  531   LFNLHPVLSLG---LPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILG  701
              F L P++SLG   +P  +ED LLHTF LP  LVK  YQ+LY+ FY+  + ILD     G
Sbjct  217   FFQLAPLVSLGNKFIPHFLEDLLLHTFGLPFFLVKPGYQKLYDAFYKYGSTILDEAVKRG  276

Query  702   VSREEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKIT  881
             + R+EACHNLVF   FN++GGMKI FP ++KW+G AG  LH +LA+EIR+VVK  GG +T
Sbjct  277   IKRDEACHNLVFLAGFNAYGGMKILFPALIKWVGAAGEKLHRRLAEEIRTVVKEEGG-VT  335

Query  882   MAGMEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFAT  1061
             ++G+ +M L+KS  YE+ RIEPPVP QYG+A+ DIVI SHD+ F +K+GEM+FG+QPFAT
Sbjct  336   LSGLNRMSLVKSVAYEALRIEPPVPFQYGKAREDIVINSHDSSFLIKKGEMIFGYQPFAT  395

Query  1062  KDPKIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLM  1241
             KDPKIF  A+EF+  RFVGE G+ LL++V WSNGRET+NP+ NDKQC  KD V+L+SRL 
Sbjct  396   KDPKIFANAEEFVGDRFVGE-GEKLLEYVYWSNGRETDNPSQNDKQCPAKDLVVLLSRLT  454

Query  1242  LVELFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             LVE FL+YD+F ++     LG SVT+TSL  AT
Sbjct  455   LVEFFLKYDTFTVDAATVLLGPSVTVTSLTTAT  487



>ref|NP_001105244.1| allene oxide synthase1 [Zea mays]
 gb|AAR33048.1| allene oxide synthase [Zea mays]
Length=482

 Score =   483 bits (1242),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 246/447 (55%), Positives = 333/447 (74%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D++Y QG++++F  R+++Y STV R N+PPGPF++ D +VV +LD KSFP LFD+  V
Sbjct  30    RLDFYYFQGQDKYFESRVERYGSTVVRMNVPPGPFMARDPRVVAVLDAKSFPVLFDMDKV  89

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPST LTGGYR+ SY+DPSEP H K+K L+F LL  R+  ++P F + ++
Sbjct  90    EKKDLFTGTYMPSTSLTGGYRVCSYLDPSEPTHTKVKQLLFSLLLSRKDDVIPTFRSNFS  149

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +  T+E ELA  GKA  N  ND  +F+F+  + +GV P  T+L    P    KW+++ L
Sbjct  150   SLLATVEAELAKGGKAEFNKLNDVTSFDFIGEAYFGVRPSATELGKGGPTKAAKWLIWQL  209

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+++LGLP  +E+PLLHTF LPP LVK DY+ LY++F   +   LD  E LG+SREEAC
Sbjct  210   HPLVTLGLPMVLEEPLLHTFHLPPFLVKGDYRALYKYFSTVAKQALDTAEGLGLSREEAC  269

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FAT FNS+GG+K+ FP +L  +   G  LH +L  EIR  V   GGK+T+A +E+M
Sbjct  270   HNLLFATTFNSYGGLKVLFPGLLANVASGGEKLHERLVAEIRGAVADAGGKVTLAAVERM  329

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF-  1079
             EL KS V+ES R++PPV  QYG AK+D+++ESHDA FQV++GEMLFG+QP ATKDP++F 
Sbjct  330   ELAKSVVWESLRLDPPVKFQYGHAKKDLLVESHDAVFQVRKGEMLFGYQPCATKDPRVFG  389

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
             D A +F+P RF+GE+G  LL++V WSNGRETENP+V++KQC GK+FV+LV RL+LVELFL
Sbjct  390   DTAGDFVPDRFLGEEGSKLLQYVYWSNGRETENPSVDNKQCPGKNFVVLVGRLLLVELFL  449

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             RYD+F  EVG   LG SV  T + +AT
Sbjct  450   RYDTFTAEVGKELLGTSVIFTGVTKAT  476



>ref|XP_010068135.1| PREDICTED: allene oxide synthase-like [Eucalyptus grandis]
 gb|KCW62905.1| hypothetical protein EUGRSUZ_G00497 [Eucalyptus grandis]
Length=479

 Score =   482 bits (1240),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 242/450 (54%), Positives = 324/450 (72%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY QGR+EFFR R++KY+STVFR NMPPGPFISS+  VV LLD  SFP LFD S V
Sbjct  26    RLDYFYFQGRDEFFRHRMRKYRSTVFRVNMPPGPFISSNPNVVVLLDAISFPVLFDTSKV  85

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR+V  GTYMPST  TGG+R  +++DPSEP HA +K+    LL+ RR+  +P   +  +
Sbjct  86    EKRNVLDGTYMPSTAFTGGHRACAFLDPSEPKHATIKHWFLSLLAARRNVFIPTLRSCLS  145

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F  LE+EL+  GKA  N+ ND+ +FNF+ + L    P  T        +   W+L  L
Sbjct  146   DLFVDLEDELSSKGKASFNSLNDKMSFNFVFKLLCDQKPSSTIPGAKGAAMFDLWILLQL  205

Query  543   HPVLSLGLPKQI----EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
              P+ SLG    +    ED + HTF LPP L+K  Y++LY+ F E+++++LD  E LG+ R
Sbjct  206   APISSLGFNNMVLNFLEDVIFHTFPLPPLLIKSSYKKLYDAFSEHASSVLDEAERLGIDR  265

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF   FN++GGMK   P ++KW+G  G  LH +LA+EIRS V + GG +T+A 
Sbjct  266   DEACHNLVFLAGFNAYGGMKATLPILIKWVGSGGEDLHRRLAREIRSTVASEGG-VTLAT  324

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L KS VYE+ RI+PPVP QYG+AKRD+V+ SHDA FQ+K+GEM+FG+QPFATKDP
Sbjct  325   LDKMNLTKSVVYEALRIDPPVPFQYGKAKRDMVVRSHDAAFQIKKGEMVFGYQPFATKDP  384

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             ++FD  ++F+  RFVGE G+ LLK+V WSNGRE ++PTV +KQC GKD V+L  R+MLVE
Sbjct  385   RVFDDPEDFVGDRFVGE-GEKLLKYVYWSNGREIDDPTVGNKQCPGKDLVLLTCRVMLVE  443

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             LFLRYD+F +E G  P+G+SVT  SL +AT
Sbjct  444   LFLRYDTFGMECGSLPVGSSVTFKSLTKAT  473



>ref|XP_008236725.1| PREDICTED: allene oxide synthase-like [Prunus mume]
Length=481

 Score =   482 bits (1240),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 243/451 (54%), Positives = 321/451 (71%), Gaps = 6/451 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR +FF+ RI+KYQSTVFRTNMPPG  I S+ KV+ LLD KSFP +FD + V
Sbjct  32    RYDYFYNQGRYDFFKTRIEKYQSTVFRTNMPPGILIPSNPKVIALLDAKSFPIIFDNTKV  91

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
              +RDV  GTYMPST  TGGYR+ +Y+DPSEPNHA LK+    LL+ +    +P F ++ +
Sbjct  92    LRRDVLDGTYMPSTAYTGGYRVCAYLDPSEPNHATLKSYFAALLASQHTKFIPLFQSSAS  151

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             +MF  LE +L+ +GKA  N  +D  +FNF+     G  P  TKL    P L+  W+   L
Sbjct  152   DMFLKLEAQLSKDGKAYFNTLSDDMSFNFVFELFCGQSPSNTKLGSKGPSLVTLWLFPQL  211

Query  543   HPVLSLGLPKQ---IEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGE-ILGVSR  710
              P ++ G+PK    +ED LLHTF  P  LVK  Y++LY+ FYE++ + LD  E   G+SR
Sbjct  212   APQITFGVPKFLGFVEDFLLHTFSYPAFLVKSPYKKLYDAFYESAASALDLAEGKFGLSR  271

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             EEACHNL+F   FN+FGGMK+ FP ++KW+   G  LH +L  EIR+V+K + G++T A 
Sbjct  272   EEACHNLLFVAGFNAFGGMKLLFPALIKWVASGGEELHRELRNEIRTVLKESEGEVTFAA  331

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L KS VYE+ RIEPPVP QYG+AK DIVI+SHDA F++K+GEM+FG Q F  KDP
Sbjct  332   LEKMTLTKSVVYEALRIEPPVPYQYGKAKEDIVIQSHDATFEIKKGEMIFGNQNFVGKDP  391

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETEN-PTVNDKQCAGKDFVMLVSRLMLV  1247
             K+F+  +EF+PHRFVGE G+ LLK++ WSNGR+ ++ PT  +KQC GKD V+L+SRLMLV
Sbjct  392   KVFENPEEFVPHRFVGE-GEKLLKYLYWSNGRQMDDHPTAENKQCPGKDLVVLISRLMLV  450

Query  1248  ELFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             E FLRYD+F ++ G   LG+SVT  SL +A+
Sbjct  451   EFFLRYDTFTVDAGTVLLGSSVTFKSLTKAS  481



>gb|KDP46195.1| hypothetical protein JCGZ_10035 [Jatropha curcas]
Length=483

 Score =   482 bits (1240),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 239/451 (53%), Positives = 317/451 (70%), Gaps = 7/451 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQG ++FF+ RIQK+ ST+ +TNMPPGPFI+ + KV+ LLD  SFP LFD S V
Sbjct  33    RLDYFYNQGTDDFFKTRIQKHNSTIIKTNMPPGPFIAKNPKVIALLDAISFPLLFDTSKV  92

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK++V  GT+ PS   TGGYR+ +Y+DPSEPNH KLK+    +LS + +  +P F     
Sbjct  93    EKKNVLDGTFFPSVSFTGGYRVCAYLDPSEPNHTKLKSFFLSILSSKHNIFIPLFTTCLR  152

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F  +E E++   KA  N+ +D  +FNF+ R     DP+ TK+    P ++ KW+   L
Sbjct  153   QLFIDIEEEMSSKNKAYFNSLSDSMSFNFVFRLFCDKDPLNTKIGSKGPSVLDKWLALQL  212

Query  543   HPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+ +L LPK     ED LLHTF LP  LVK DY +LYE FYE+S ++LD  E  G+ R+
Sbjct  213   APLATLNLPKFFKYFEDFLLHTFPLPFFLVKSDYGKLYESFYEHSGSVLDKAESFGIKRD  272

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNLVF   FN++GGMK+FFP M+KW+ +AG  LHTQLA EIR+V K +G  IT   +
Sbjct  273   EACHNLVFLAGFNAYGGMKVFFPTMIKWVAQAGEKLHTQLAHEIRTVRK-DGSVITFQAL  331

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             ++M L KS V E+ RIEPPVP QYG+AK DI++ SHDA +Q+K+GEM+FG+QP ATKDPK
Sbjct  332   DKMPLTKSVVCEALRIEPPVPFQYGKAKEDIIVHSHDAAYQIKKGEMIFGYQPLATKDPK  391

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             +F    EF+ HRFVGE+G+ LLK++ WSN RE  NPT  +KQC GKD V+L+  +MLVE 
Sbjct  392   VFHNPHEFVGHRFVGEEGEKLLKYLYWSNDREMVNPTAENKQCPGKDLVVLLGMVMLVEF  451

Query  1254  FLRYDSFDIEV--GMSPLGASVTLTSLKRAT  1340
             FLRYD+  +E   G+  L +SVT TSL +AT
Sbjct  452   FLRYDTCTVETKKGLG-LASSVTFTSLTKAT  481



>ref|XP_008454884.1| PREDICTED: allene oxide synthase, chloroplastic-like [Cucumis 
melo]
Length=479

 Score =   481 bits (1239),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 245/448 (55%), Positives = 315/448 (70%), Gaps = 5/448 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R  YFY QGRE FFR R+ KY STVFRTNMPPGPFISS+SKV+ LLD  SFP LFD + V
Sbjct  34    RYHYFYIQGRETFFRSRMAKYNSTVFRTNMPPGPFISSNSKVIVLLDALSFPILFDTTKV  93

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR+V  GTYMPS   TGG R  +++DPSE  H+ LK      L+ R H  +P F  + +
Sbjct  94    EKRNVLDGTYMPSLAFTGGIRTCAFLDPSETEHSVLKRHFLNFLASRHHQFIPLFRTSIS  153

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             EMFD LE EL  N  A  N  +D A+F+F+ R L    P +  +  + P L+ +W+   L
Sbjct  154   EMFDKLEKELKNNNVANFNPVSDSASFDFIFRLLSDRSPNKNFIS-EGPGLVDRWLTMQL  212

Query  543   HPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+ +LGLPK     ED ++HTFRLP ALVK  Y++LYE FYE+S   LD  E  G++RE
Sbjct  213   APLATLGLPKIFSCFEDLIIHTFRLPFALVKSAYRKLYESFYESSGTFLDEAEKQGINRE  272

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             +ACHNLVF   FN++ GMK+ FP +L W+G AG  LH +L  EIR+ VK + G +T   +
Sbjct  273   KACHNLVFLAGFNAYAGMKVLFPILLNWVGSAGEELHRKLVSEIRAAVKKDEG-VTFGAL  331

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             E+M L+KS VYE  RI+PPVP QY RAK+DIVIE+HD+ F++K+GEM+FG+QP ATKDPK
Sbjct  332   EKMSLLKSVVYEVLRIDPPVPYQYARAKQDIVIENHDSAFKIKKGEMIFGYQPIATKDPK  391

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             +F+ A+EF+  RFVGEKG+ LLK+V WSNGRETE PT  +KQC  +D V+L+SR++LVEL
Sbjct  392   VFENAEEFVGDRFVGEKGEKLLKYVYWSNGRETEEPTAENKQCPARDLVVLMSRVVLVEL  451

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRA  1337
             FLRYD+F +E   S LG SV + SL +A
Sbjct  452   FLRYDTFAVEGTRSSLGWSVKVKSLTKA  479



>gb|ACN27878.1| unknown [Zea mays]
 gb|AFW89128.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=482

 Score =   481 bits (1239),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 245/447 (55%), Positives = 333/447 (74%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D++Y QG++++F  R+++Y STV R N+PPGPF++ D +VV +LD KSFP LFD+  V
Sbjct  30    RLDFYYFQGQDKYFESRVERYGSTVVRMNVPPGPFMARDPRVVAVLDAKSFPVLFDMDKV  89

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPST LTGGYR+ SY+DPSEP H K+K L+F LL  R+  ++P F + ++
Sbjct  90    EKKDLFTGTYMPSTSLTGGYRVCSYLDPSEPTHTKVKQLLFSLLLSRKDDVIPTFRSNFS  149

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +  T+E ELA  GKA  N  ND  +F+F+  + +GV P  T+L    P    KW+++ L
Sbjct  150   SLLATVEAELAKGGKAEFNKLNDVTSFDFIGEAYFGVRPSATELGKGGPSKAAKWLIWQL  209

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+++LGLP  +E+PLLHTF LPP LVK DY+ LY++F   +   LD  E LG+SREEAC
Sbjct  210   HPLVTLGLPMVLEEPLLHTFHLPPFLVKGDYRALYKYFSTVAKQALDTAEGLGLSREEAC  269

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FAT FNS+GG+K+ FP +L  +   G  LH +L  EIR  V   GGK+T+A +E+M
Sbjct  270   HNLLFATTFNSYGGLKVLFPGLLANVASGGEKLHERLVAEIRGAVADAGGKVTLAAVERM  329

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF-  1079
             EL KS V+ES R++PPV  QYG AK+D+++ESHDA FQV++GEMLFG+QP ATKDP++F 
Sbjct  330   ELAKSVVWESLRLDPPVKFQYGHAKKDLLVESHDAVFQVRKGEMLFGYQPCATKDPRVFG  389

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
             D A +F+P RF+GE+G  LL++V WSNGRET+NP+V++KQC GK+FV+LV RL+LVELFL
Sbjct  390   DTAGDFVPDRFLGEEGSKLLQYVYWSNGRETDNPSVDNKQCPGKNFVVLVGRLLLVELFL  449

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             RYD+F  EVG   LG SV  T + +AT
Sbjct  450   RYDTFTAEVGKELLGTSVIFTGVTKAT  476



>emb|CAE18065.1| cytochrome P450 [Prunus dulcis]
 gb|AGT02045.1| hydroperoxide lyase [synthetic construct]
Length=483

 Score =   481 bits (1239),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 243/451 (54%), Positives = 320/451 (71%), Gaps = 6/451 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR +FF+ RI+KYQSTVFRTNMPPG  I+S+ KV+ LLD KSFP +FD + V
Sbjct  34    RYDYFYNQGRYDFFKTRIEKYQSTVFRTNMPPGILIASNPKVIALLDAKSFPIIFDNTKV  93

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
              +RDV  GTYMPST  TGGYR+ +Y+DPSEPNHA LK+    LL+ +    +P F ++ +
Sbjct  94    LRRDVLDGTYMPSTAYTGGYRVCAYLDPSEPNHATLKSYFAALLASQHTKFIPLFQSSTS  153

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             +MF  LE +L+ +GKA  N  +D  +FNF      G  P  TKL    P L+  W+   L
Sbjct  154   DMFLNLEAQLSKDGKAYFNTLSDDMSFNFAFELFCGQSPSNTKLGSKGPSLVTLWLFPQL  213

Query  543   HPVLSLGLPKQI---EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGE-ILGVSR  710
              P ++ GLPK +   ED LLHTF  P  LVK  Y++LY+ FYE++ + LD  E   G+SR
Sbjct  214   APQITFGLPKFLALAEDFLLHTFSYPAFLVKSPYKKLYDAFYESAASALDLAEGKFGLSR  273

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             EEACHNL+F   FN+FGGMK+ FP ++KW+   G  LH +L  EIR+V+K + G++T A 
Sbjct  274   EEACHNLLFVAGFNAFGGMKLLFPALIKWVASGGEELHRELRNEIRAVLKESEGEVTFAA  333

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L KS VYE+ RIEPPVP QYG+AK DIVI+SHDA F++K+GEM+FG Q F  KDP
Sbjct  334   LEKMTLTKSVVYEALRIEPPVPYQYGKAKEDIVIQSHDATFEIKKGEMIFGNQNFVGKDP  393

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETEN-PTVNDKQCAGKDFVMLVSRLMLV  1247
             K+F+  +EF+ HRFVGE G+ LLK++ WSNGR+ ++ PT  +KQC GKD V+L+SRLMLV
Sbjct  394   KVFENPEEFVAHRFVGE-GEKLLKYLYWSNGRQMDDHPTAENKQCPGKDLVVLISRLMLV  452

Query  1248  ELFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             E FLRYD+F ++ G   LG+SVT  SL +A+
Sbjct  453   EFFLRYDTFTVDAGTVLLGSSVTFKSLTKAS  483



>ref|XP_010065431.1| PREDICTED: allene oxide synthase-like [Eucalyptus grandis]
Length=475

 Score =   481 bits (1237),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 241/450 (54%), Positives = 325/450 (72%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY QGR+EFFR R++KY+STVFR NMPPGPFISS+ KVV LLD  SFP LFD S V
Sbjct  26    RLDYFYFQGRDEFFRHRMRKYRSTVFRVNMPPGPFISSNPKVVVLLDAISFPVLFDTSKV  85

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR+   GTYMPST  TGG+R  +++DPSEP HA +K+    LL+ RR+  +P   +  +
Sbjct  86    EKRNALDGTYMPSTAFTGGHRACAFLDPSEPKHASIKHWFMSLLAARRNVFIPTLRSCLS  145

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F  LE+EL+  GKA  N+ ND+ +FNF+ + L    P  T L      +   W+L  L
Sbjct  146   DLFVDLEDELSNKGKASFNSLNDKMSFNFVFKLLCYQKPSSTILGTKGAAMFNLWILLQL  205

Query  543   HPVLSLGLPKQI----EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
              P+LSLG   ++    ED +LHTF LPP L+K  Y++LY+ F E++++ILD  E LG+ R
Sbjct  206   APILSLGFDNKVLNFLEDVILHTFPLPPLLIKSSYKKLYDAFSEHASSILDEAEKLGIDR  265

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF   FN++GGMK   P ++KW+G  G  LH +L +EIRS V + GG +T+  
Sbjct  266   DEACHNLVFLAGFNAYGGMKATLPILIKWVGWGGEDLHRRLTREIRSTVASEGG-VTLTA  324

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L KS VYE+ RI+PPV  QYG+A+RD+V+ S+DA FQ+K+GEM+FG+QPFATKDP
Sbjct  325   LDKMSLTKSVVYEALRIDPPVKFQYGKARRDMVVRSYDAAFQIKKGEMIFGYQPFATKDP  384

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             +IFD  ++F+  RFVGE G+ LLK+V WSNGRE ++PTV +KQC GKD V+L+ R+MLVE
Sbjct  385   RIFDDPEDFVGDRFVGE-GEKLLKYVYWSNGREIDDPTVGNKQCPGKDLVLLMCRVMLVE  443

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             +FLRYD+F +E G  P G+SVT  SL +AT
Sbjct  444   MFLRYDTFGLECGSLPAGSSVTFRSLTKAT  473



>ref|XP_004137005.1| PREDICTED: allene oxide synthase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN43980.1| Fatty acid 9-hydroperoxide lyase [Cucumis sativus]
Length=478

 Score =   479 bits (1234),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 244/448 (54%), Positives = 314/448 (70%), Gaps = 5/448 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R  YFY QGRE FFR R+ KY STVFRTNMPPGPFISS+SKV+ LLD  +FP LFD + V
Sbjct  33    RYHYFYIQGRETFFRSRMAKYNSTVFRTNMPPGPFISSNSKVIVLLDALTFPILFDTTKV  92

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR+V  GTYMPS   TGG R  +++DPSE  H+ LK      L+ R H  +P F  + +
Sbjct  93    EKRNVLDGTYMPSLAFTGGIRTCAFLDPSETEHSVLKRHFLKFLASRHHQFIPLFRTSIS  152

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             EMFD LE EL  N  A  N  +D A+F+F+ R L    P +     + P L+ +W+   L
Sbjct  153   EMFDKLEKELQNNNVANFNPISDYASFDFIFRLLSDRSPDKN-FSSEGPGLVDRWLTMQL  211

Query  543   HPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+ +LGLPK     ED ++HTFRLP ALVK  Y++LYE FYE+S + LD  E  G++RE
Sbjct  212   APLATLGLPKIFSCFEDLIIHTFRLPFALVKSAYRKLYESFYESSGSFLDEAEKQGINRE  271

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             +ACHNLVF   FN++ GMK+  P +L W+G AG  LH +L  EIR+ VK +GG IT   +
Sbjct  272   KACHNLVFLAGFNAYAGMKVLLPILLNWVGSAGEELHRKLVGEIRAAVKIDGG-ITFGAL  330

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             E+M L+KS VYE  RI+PPVP QY +AK+DIVIESHD+ F++K+GEM+FG+QP ATKDPK
Sbjct  331   EKMSLLKSVVYEVLRIDPPVPYQYAKAKQDIVIESHDSAFEIKKGEMIFGYQPIATKDPK  390

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             +F+ A+EF+  RFVGEKG+ LLK+V WSNGRETE PT  +KQC  +D V+L+ R++LVEL
Sbjct  391   VFENAEEFVGERFVGEKGEKLLKYVYWSNGRETEEPTAENKQCPARDLVVLMCRVVLVEL  450

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRA  1337
             FLRYD+F +E   S LG SV + SL +A
Sbjct  451   FLRYDTFTVEGTRSSLGWSVKVKSLTKA  478



>ref|NP_001145914.1| uncharacterized protein LOC100279433 [Zea mays]
 gb|ACL52841.1| unknown [Zea mays]
Length=468

 Score =   479 bits (1233),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 238/430 (55%), Positives = 318/430 (74%), Gaps = 1/430 (0%)
 Frame = +3

Query  54    IQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVVEKRDVFTGTYMPSTELT  233
             +++Y STV R N+PPGPF++ D +VV +LD KSFP LFD+  VEKRD+ TGTYMPST LT
Sbjct  33    VERYGSTVVRMNVPPGPFMARDPRVVAVLDAKSFPVLFDMDKVEKRDLLTGTYMPSTSLT  92

Query  234   GGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYAEMFDTLEnelagngkag  413
             GG+R+ +Y+DPSEP HAK+K L+F LL  R+  ++P F + ++ +  T+E++LA  GKA 
Sbjct  93    GGHRVCAYLDPSEPTHAKVKQLLFSLLLSRKDDVIPVFRSNFSSLLATVESDLAEGGKAE  152

Query  414   lnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNLHPVLSLGLPKQIEDPLL  593
              N  ND  +F+F+  + +GV P  T L    P    KW+++ LHP+L+LGLP  +E+PLL
Sbjct  153   FNKLNDVTSFDFIGEAYFGVRPSATDLGKGGPTKAAKWLIWQLHPLLTLGLPMVLEEPLL  212

Query  594   HTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEACHNLVFATCFNSFGGMKI  773
             HTF LPP  VK DY  LY++F   +   LD  E LG+SREEACHNL+FAT FNS+GG+K+
Sbjct  213   HTFHLPPFFVKGDYGALYKYFSTVAKQALDTAEGLGLSREEACHNLLFATTFNSYGGLKV  272

Query  774   FFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQMELMKSTVYESFRIEPPV  953
              FP +L  +  AG  LH +L  EIR  V   GGK+T+A +E+MEL KS V+ES R++PPV
Sbjct  273   LFPGILANVASAGEKLHERLVAEIRGAVAEAGGKVTLAAVEKMELAKSVVWESLRLDPPV  332

Query  954   PTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD-RAQEFIPHRFVGEKGK  1130
               QYG AK+D+ ++SHDA FQVK+GEMLFG+QP ATKDP++F   A+EF+P RF+GE+G 
Sbjct  333   KFQYGHAKKDLQVQSHDAVFQVKKGEMLFGYQPCATKDPRVFGATAKEFVPGRFLGEEGS  392

Query  1131  ALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLRYDSFDIEVGMSPLGAS  1310
              LL++V WSNGRETENPTV++KQC GK+FV+LV RL LVELFLRYD+F  ++G   LG+S
Sbjct  393   KLLQYVYWSNGRETENPTVDNKQCPGKNFVVLVGRLFLVELFLRYDTFTADIGKDLLGSS  452

Query  1311  VTLTSLKRAT  1340
             V  TS+ +AT
Sbjct  453   VVFTSVTKAT  462



>ref|XP_004166204.1| PREDICTED: allene oxide synthase, chloroplastic-like [Cucumis 
sativus]
Length=478

 Score =   478 bits (1230),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 243/448 (54%), Positives = 314/448 (70%), Gaps = 5/448 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R  YFY QGRE FFR R+ KY STVFRTNMPPGPFISS+SKV+ LLD  +FP LFD + V
Sbjct  33    RYHYFYIQGRETFFRSRMAKYNSTVFRTNMPPGPFISSNSKVIVLLDALTFPILFDTTKV  92

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR+V  GTYMPS   TGG R  +++DPSE  H+ LK      L+ R H  +P F  + +
Sbjct  93    EKRNVLDGTYMPSLAFTGGIRTCAFLDPSETEHSVLKRHFLKFLASRHHQFIPLFRTSIS  152

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             EMFD LE EL  N  A  N  +D A+F+F+ R L    P +     + P L+ +W+   L
Sbjct  153   EMFDKLEKELQNNNVANFNPISDYASFDFIFRLLSDRSPDKN-FSSEGPGLVDRWLTMQL  211

Query  543   HPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+ +LGLPK     ED ++HTFRLP ALVK  Y++LYE FYE+S + LD  E  G++RE
Sbjct  212   APLATLGLPKIFSCFEDLIIHTFRLPFALVKSAYRKLYESFYESSGSFLDEAEKQGINRE  271

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             +ACHNLVF   FN++ GMK+  P +L W+G AG  LH +L  EIR+ VK +GG IT   +
Sbjct  272   KACHNLVFLAGFNAYAGMKVLLPILLNWVGSAGEELHRKLVGEIRAAVKIDGG-ITFGAL  330

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             E+M L+KS VYE  RI+PPVP QY +AK+DIVIESHD+ F++K+GEM+FG+QP ATKDPK
Sbjct  331   EKMSLLKSVVYEVLRIDPPVPYQYAKAKQDIVIESHDSAFEIKKGEMIFGYQPIATKDPK  390

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             +F+ A+EF+  RFVGEKG+ LLK+V WSNGRETE PT  +KQC  +D V+L+ R++LVEL
Sbjct  391   VFENAEEFVGERFVGEKGEKLLKYVYWSNGRETEEPTAENKQCPARDLVVLMCRVVLVEL  450

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRA  1337
             FLRY++F +E   S LG SV + SL +A
Sbjct  451   FLRYETFTVEGTRSSLGWSVKVKSLTKA  478



>ref|XP_007199988.1| hypothetical protein PRUPE_ppa025045mg [Prunus persica]
 gb|EMJ01187.1| hypothetical protein PRUPE_ppa025045mg [Prunus persica]
Length=482

 Score =   476 bits (1224),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 240/451 (53%), Positives = 317/451 (70%), Gaps = 6/451 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFY QGR +FF+ RI+KYQSTVFRTNMPPG  I S+ KV+ LLD +SFP +FD + V
Sbjct  33    RYDYFYTQGRYDFFKTRIEKYQSTVFRTNMPPGILIPSNPKVIALLDAESFPIIFDTTKV  92

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
              +RDV  GTYMPST  TGGYR+ +Y+DPSEPNHA LK+    LL+ +    +P F ++ +
Sbjct  93    LRRDVLDGTYMPSTAYTGGYRVCAYLDPSEPNHATLKSYFAALLASQHTKFIPLFQSSTS  152

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             +MF  LE +L+ +GKA  N  +D  +FNF      G  P  TKL    P L+  W+   L
Sbjct  153   DMFLNLEAQLSKDGKAYFNTLSDDMSFNFAFELFCGQSPSNTKLGSKGPSLVTLWLFPQL  212

Query  543   HPVLSLGLPKQI---EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGE-ILGVSR  710
              P ++ GLPK +   ED LLHTF  P  LVK  Y++LY+ FYE++ + LD  E   G+SR
Sbjct  213   APQITFGLPKFLALAEDFLLHTFSYPAFLVKSPYKKLYDAFYESAASALDLAEGKFGLSR  272

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             EEACHNL+F   FN+FGGMK+ FP ++KW+   G  LH +L  EIR+V+K + GK+T A 
Sbjct  273   EEACHNLLFVAGFNAFGGMKLLFPALIKWVASGGEELHRELRNEIRAVLKESEGKVTFAA  332

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L KS VYE+ RIEPPVP QYG+AK DIVI+SHDA F++K+GEM+FG Q F  KDP
Sbjct  333   LEKMTLTKSVVYEALRIEPPVPYQYGKAKEDIVIQSHDATFEIKKGEMIFGNQNFVGKDP  392

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETEN-PTVNDKQCAGKDFVMLVSRLMLV  1247
             K+F+  +EF+ HRF GE G+ LLK++ WSNGR+ ++ PT  +KQC GKD V+L+SRL+LV
Sbjct  393   KVFENPEEFVAHRFAGE-GEKLLKYLYWSNGRQMDDHPTAENKQCPGKDLVVLISRLILV  451

Query  1248  ELFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             E FLRYD+F ++ G   LG+SVT  SL +A+
Sbjct  452   EFFLRYDTFTVDAGTVLLGSSVTFKSLTKAS  482



>ref|XP_004292467.1| PREDICTED: allene oxide synthase-like [Fragaria vesca subsp. 
vesca]
Length=485

 Score =   474 bits (1220),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 236/450 (52%), Positives = 319/450 (71%), Gaps = 5/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R D+FYNQGR++FF+ R+ KY+STVFRTNMPPGPFI+S+ KVV +LD +SFP LFD S V
Sbjct  36    RYDFFYNQGRDDFFKTRMAKYKSTVFRTNMPPGPFIASNPKVVVVLDAESFPILFDNSKV  95

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR++F GTYMPST  TGGYRI S++DPSE  H  LKN    LLS    +++P F   ++
Sbjct  96    EKRNIFDGTYMPSTNFTGGYRICSFLDPSEAKHTSLKNFFLSLLSANHKNVIPLFQTHFS  155

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F   E +LA +  +  N+ NDQ + NF+     G +P  T L   A  L+  W+L  L
Sbjct  156   DLFVKAEAQLAKDDTSDFNSLNDQTSLNFIFELFCGQNPSSTALGSKAATLVTLWLLPQL  215

Query  543   HPVLSLGLPKQIEDPLL---HTFRLPPALVKKDYQRLYEFFYENSTAILDHGE-ILGVSR  710
              P ++LGLPK +        HTF  P  LVK  Y ++Y+ FYE++T  L+  E   G+S+
Sbjct  216   TPQITLGLPKLLNVLEDLLLHTFPFPALLVKPAYNKVYKAFYESATKALEEAESTFGISK  275

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNL+F  CFN++GGMK+ FP +LKW+  AG  LH +L +EIR+ VK  GGK+T+A 
Sbjct  276   DEACHNLIFMVCFNAYGGMKLLFPILLKWVCLAGEDLHRKLREEIRAAVKDAGGKVTLAA  335

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L KS VYES RI+P VP QYG+AK D+VI SHDA FQ+K+GE++FG+Q  AT+DP
Sbjct  336   LDKMTLTKSVVYESLRIDPAVPFQYGKAKEDLVINSHDAAFQIKKGEVIFGYQTIATRDP  395

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             KIFD+ +EF+ +RFVG+ G+ LLK+V WSNG ETENPT  +K CAGKD V+L++R+MLVE
Sbjct  396   KIFDKPEEFVGNRFVGD-GEKLLKYVWWSNGPETENPTAANKICAGKDLVVLMNRIMLVE  454

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F  ++G   LG  VT  +L +A+
Sbjct  455   FFLRYDTFTADIGTFLLGPKVTFKTLTKAS  484



>ref|XP_006423164.1| hypothetical protein CICLE_v10028333mg [Citrus clementina]
 ref|XP_006479350.1| PREDICTED: allene oxide synthase-like [Citrus sinensis]
 gb|ESR36404.1| hypothetical protein CICLE_v10028333mg [Citrus clementina]
Length=481

 Score =   474 bits (1219),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 237/449 (53%), Positives = 316/449 (70%), Gaps = 5/449 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY QG+++FF+ RI K++ST+F+TNMPPGPFI+S+  V+ +LD  SFP LFD S V
Sbjct  33    RLDYFYFQGQDKFFQDRINKHKSTIFKTNMPPGPFIASNPNVIAVLDAVSFPVLFDTSKV  92

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR+VF GT+ PS   TGG+R+ +Y+DPSEP H+ LK+ +   L+ +    +P F    +
Sbjct  93    EKRNVFVGTFFPSVSFTGGHRVCAYLDPSEPKHSSLKSFILSTLASKHDKFIPLFKTCVS  152

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F  LE+++A  G+A  N  ND  AFNF  R      P  TK+    P    KW+   L
Sbjct  153   ELFIELEDQMAEKGEANYNTLNDTLAFNFFFRLFCDKSPNDTKIASKGPSFANKWLFPQL  212

Query  543   HPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+ +L LPK    +ED LLHTF LP  + K DYQ+LY+ F + S  ILD  E  G+ R+
Sbjct  213   APITTLRLPKFLNPLEDLLLHTFPLPFFVAKSDYQKLYDAFNKFSGPILDEAERFGIQRD  272

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNLVF + FNS+GG+K  FP ++KW+G  G  LH QLA EIR+VVKA GG +T A +
Sbjct  273   EACHNLVFLSNFNSYGGLKTGFPALIKWVGLTGEKLHRQLADEIRTVVKAEGG-VTFAAL  331

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             E+M L KS VYE+ RIEPPVP QYG+AK D+VI SHDA +++K+G M+FG+QPFATKDP+
Sbjct  332   ERMVLTKSVVYEALRIEPPVPFQYGKAKVDMVIHSHDAAYEIKKGNMIFGYQPFATKDPR  391

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             +F+  +EF+ HRFVGE G+ LLK+V WSNGRETE+PT  +KQC  K+ V+L+SR+ LVE 
Sbjct  392   VFENPEEFVGHRFVGE-GEKLLKYVYWSNGRETEDPTAENKQCPAKNLVVLLSRVFLVEF  450

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             FLRYD+F +E G    G+S T+ SL +AT
Sbjct  451   FLRYDTFTVEAGKLLTGSSATIKSLTKAT  479



>ref|XP_010096245.1| Allene oxide synthase [Morus notabilis]
 gb|EXB63640.1| Allene oxide synthase [Morus notabilis]
Length=504

 Score =   474 bits (1220),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 230/448 (51%), Positives = 320/448 (71%), Gaps = 4/448 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R D++YNQGR+ FF  R +KY+STVFR N PPGPFI+ D KVV LLD  SFP LFD + V
Sbjct  51    RWDFYYNQGRDGFFSARQEKYKSTVFRANAPPGPFIAKDPKVVVLLDAVSFPILFDTTKV  110

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK++VF GTYMPS   TGGYR+LS++DPSEP H  LK+  F +L+ +  + +P    +  
Sbjct  111   EKKNVFDGTYMPSVNFTGGYRVLSFLDPSEPKHNALKSYFFNVLASKHDNFIPVLGKSLT  170

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+ LE++LA + +   N  +D A+FN++ +      P  T L     K +  W++  +
Sbjct  171   ELFNNLESQLAKSKEVNFNPISDNASFNYVFQLFCDKSPSETGLGAQGNKTVDIWLVPQV  230

Query  543   HPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P++S+G+PK    +ED L+HTF +P  LVK  Y+ ++E F   ++ ILD  +  G+ R+
Sbjct  231   IPLVSVGVPKFLQLVEDLLIHTFPIPAFLVKGKYKTIFEAFSSAASPILDQAKDFGLERD  290

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNL+F TCFN++GG+K+ FP++ KW+GRAG + H  LAKEIR+VVK  GG +T A +
Sbjct  291   EACHNLIFLTCFNTYGGLKVLFPSLFKWLGRAGPTWHANLAKEIRNVVKQEGGVVTFAAL  350

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             E+M L+KS VYE  RI+PPVP QY  AK D+VI+SHDA F++K+GEM+FG+QPFATKDPK
Sbjct  351   EKMPLLKSVVYEVLRIDPPVPFQYAHAKEDLVIQSHDASFKIKKGEMIFGYQPFATKDPK  410

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             +F+  + F+P+RF+G K +A LK+V WSNGRETE PT ++KQCAG+D V+LV+R+MLVE 
Sbjct  411   VFENPETFVPYRFMG-KAEANLKYVYWSNGRETEAPTADNKQCAGRDLVVLVARVMLVEF  469

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRA  1337
             FLRYD+F     +  +G+ VT TSL +A
Sbjct  470   FLRYDTFTCTDEVFLVGSKVTFTSLTKA  497



>gb|ACR36602.1| unknown [Zea mays]
Length=480

 Score =   472 bits (1215),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 243/447 (54%), Positives = 331/447 (74%), Gaps = 3/447 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D++Y QG++++F  R+++Y STV R N+PPGPF++ D +VV +LD KSFP LFD+  V
Sbjct  30    RLDFYYFQGQDKYFESRVERYGSTVVRMNVPPGPFMARDPRVVAVLDAKSFPVLFDMDKV  89

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+D+FTGTYMPST LTGGYR+ SY+DPS   H K+K L+F LL  R+  ++P F + ++
Sbjct  90    EKKDLFTGTYMPSTSLTGGYRVCSYLDPS--THTKVKQLLFSLLLSRKDDVIPTFRSNFS  147

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +  T+E ELA  GKA  N  ND  +F+F+  + +GV P  T+L    P    KW+++ L
Sbjct  148   SLLATVEAELAKGGKAEFNKLNDVTSFDFIGEAYFGVRPSATELGKGGPSKAAKWLIWQL  207

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+++LGLP  +E+PLLHTF LPP LVK DY+ LY++F   +   LD  E LG+SREEAC
Sbjct  208   HPLVTLGLPMVLEEPLLHTFHLPPFLVKGDYRALYKYFSTVAKQALDTAEGLGLSREEAC  267

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FAT FNS+GG+K+ FP +L  +   G  LH +L  EIR  V   GGK+T+A +E+M
Sbjct  268   HNLLFATTFNSYGGLKVLFPGLLANVASGGEKLHERLVAEIRGAVADAGGKVTLAAVERM  327

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF-  1079
             EL KS V+ES R++PPV  QYG AK+D+++ESHDA FQV++GEMLFG+QP ATKDP++F 
Sbjct  328   ELAKSVVWESLRLDPPVKFQYGHAKKDLLVESHDAVFQVRKGEMLFGYQPCATKDPRVFG  387

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
             D A +F+P RF+GE+G  LL++V WSNGRET+NP+V++KQC GK+FV+LV RL+LVELFL
Sbjct  388   DTAGDFVPDRFLGEEGSKLLQYVYWSNGRETDNPSVDNKQCPGKNFVVLVGRLLLVELFL  447

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             RYD+F  EVG   LG SV  T + +AT
Sbjct  448   RYDTFTAEVGKELLGTSVIFTGVTKAT  474



>ref|XP_008344492.1| PREDICTED: allene oxide synthase-like [Malus domestica]
Length=481

 Score =   472 bits (1215),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 237/451 (53%), Positives = 321/451 (71%), Gaps = 6/451 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR+ FF+ R++KYQSTVFRTNMPPG  I+ + KV+ LLD +SFP LFD + V
Sbjct  32    RYDYFYNQGRDNFFKIRMEKYQSTVFRTNMPPGALIAQNPKVIALLDAESFPILFDTTKV  91

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
              KRDV  GTYMPST  TGGYR+ +Y+DPSEPNHA LK     LL+ + +  +P F ++ +
Sbjct  92    AKRDVLDGTYMPSTAYTGGYRMCAYLDPSEPNHATLKRYFASLLASKHNQFIPLFQSSLS  151

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F  LE +++ +GKA  N+ +D  +FNF+     G  P +T L    P L+  W+   L
Sbjct  152   DLFPKLEEQISKDGKADFNSLSDDMSFNFVFELFCGQSPSKTTLGSKGPSLVTLWLFPQL  211

Query  543   HPVLSLGLPKQI---EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGE-ILGVSR  710
              P ++ GLPK +   ED LLHTF  P  LVK  YQ+LY+  YE++ + LD  E   G+SR
Sbjct  212   APQITFGLPKFLMFAEDFLLHTFSYPAFLVKPAYQKLYDAVYESAGSALDLAEGNFGISR  271

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             EE CHNL+F   FN+FGGMK+ FP ++KW+   G +LH QL  EIR++VK + GKIT++ 
Sbjct  272   EETCHNLLFLAGFNAFGGMKLLFPALIKWVASGGGNLHRQLRNEIRTIVKESEGKITLST  331

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L KS V+E+ RIEPPVP QYG+AK DIV+ SHDA F++K+GEM+FG Q F  KDP
Sbjct  332   LDKMTLTKSVVFEALRIEPPVPYQYGKAKEDIVVHSHDATFEIKKGEMIFGNQNFVGKDP  391

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETEN-PTVNDKQCAGKDFVMLVSRLMLV  1247
             K+F+  +EF+ +RFVGE G+ LLK+V WSNGR+ ++ PT  +KQCAGKD V+L+SRLMLV
Sbjct  392   KVFENPEEFVGNRFVGE-GEKLLKYVYWSNGRQADDHPTAENKQCAGKDLVVLMSRLMLV  450

Query  1248  ELFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             E FLRYD+F ++ G   LG+SVT  +L +A+
Sbjct  451   EFFLRYDTFTVDSGTLLLGSSVTFKTLTKAS  481



>ref|XP_007143237.1| hypothetical protein PHAVU_007G055700g [Phaseolus vulgaris]
 gb|ESW15231.1| hypothetical protein PHAVU_007G055700g [Phaseolus vulgaris]
Length=479

 Score =   472 bits (1214),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 244/450 (54%), Positives = 313/450 (70%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R D+ Y+QGR++FF  RIQKY STV RTNMPPGPF+SSD +V+ LLDG SFP LFD   V
Sbjct  30    RHDFLYHQGRDKFFATRIQKYNSTVIRTNMPPGPFVSSDPRVIALLDGASFPVLFDNRKV  89

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK +VF GT+MPST  TGG+R+ SY+D  EP HA LK      L+ R+  ++P F N   
Sbjct  90    EKLNVFEGTFMPSTAFTGGHRVCSYLDTREPKHALLKRFFLNALAARKDTVVPLFRNCLH  149

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLY-GVDPMRTKLRLDAPKLIGKWVLFN  539
             E    +E++L  N +A  NA  DQA+FNFL R      DP    L    PKLI  W+LF 
Sbjct  150   ESLCEIEDQLRKNDEADFNAVFDQASFNFLFRFFCDNKDPSHNILGSKGPKLISTWLLFQ  209

Query  540   LHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+ +LGLPK    +ED  L TF LP    K +Y +LYE F   +T +LD  E +G+ R
Sbjct  210   LAPLGTLGLPKIFNYVEDFFLRTFPLPAFFTKSNYHKLYEAFRTFATTLLDEAEKVGLER  269

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHN+VF  CFNS+GG+K  FP +LKW+G  G +LH  L  EIR VVK  GG +T+  
Sbjct  270   DEACHNVVFMACFNSYGGLKNQFPMLLKWVGLCGENLHADLRSEIRGVVKEEGG-VTLGA  328

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L+KS VYE+ RIEP VP QYGRA+ D+V++SHDA F+VK+GEMLFG+QPFATKD 
Sbjct  329   LEKMSLVKSVVYETMRIEPLVPYQYGRAREDLVVQSHDASFKVKKGEMLFGYQPFATKDS  388

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             +IF+ A+ F+P RFVGE G+ +L HVLWSNGRETE PT +DKQCAGK+ V+++ R+ L E
Sbjct  389   RIFEDAEVFVPGRFVGE-GEKMLAHVLWSNGRETEEPTPSDKQCAGKNLVVVLCRVFLAE  447

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             LFLRYD+F+ E   S  G  +T+TSL +A+
Sbjct  448   LFLRYDTFEFEFKESGFGPRITITSLTKAS  477



>ref|XP_009627350.1| PREDICTED: 9-divinyl ether synthase-like [Nicotiana tomentosiformis]
Length=483

 Score =   471 bits (1211),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 240/450 (53%), Positives = 322/450 (72%), Gaps = 5/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYN G +EFF  ++QKY STVFRTNMPPGPFI+ + KV+ LLD K+FP LFD S V
Sbjct  35    RYDYFYNLGTDEFFLTKMQKYNSTVFRTNMPPGPFIAKNPKVIVLLDAKTFPVLFDNSKV  94

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK +V  GTY+PST+  GGYR  +Y+DPSE  HA LK     L+S   +  +P F  + +
Sbjct  95    EKMNVLDGTYVPSTDFYGGYRPCAYLDPSESTHATLKGFFLSLISQLHNQFIPLFRTSIS  154

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYG-VDPMRTKLRLDAPKLIGKWVLFN  539
              +F  LENE++ NGKA  N  +D  +F+F+ R L     P  T L  + PKL   W+L  
Sbjct  155   GLFANLENEISQNGKANFNNISDIMSFDFVFRLLCDKTSPHDTNLGSNGPKLFDIWLLPQ  214

Query  540   LHPVLSLGL---PKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+ SLGL   P  +ED +LHTF LP  LV+ +YQ+LY+ F +++ + L+  E  G+ R
Sbjct  215   LAPLFSLGLKFVPNFLEDLMLHTFPLPFFLVRSNYQKLYDAFSKHAESTLNEAEKNGIKR  274

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF   FN++GGMK+ FP ++KW+   G SLHT+LA EIR+++K   G IT++ 
Sbjct  275   DEACHNLVFLAGFNAYGGMKVLFPALIKWVANGGKSLHTRLANEIRTIIKEECGTITLSA  334

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             + +M L+KS VYE  RIEPPVP QYG+AK DI+I+SHD+ F VK+GEM+FG+QPFATKDP
Sbjct  335   INKMSLVKSVVYEVLRIEPPVPFQYGKAKEDIIIQSHDSTFLVKKGEMIFGYQPFATKDP  394

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             KIFD+ +EFIP RF+ E G+ LLK+V WSN RET++PTV++KQC  K+ V+L+ RLMLVE
Sbjct  395   KIFDKPEEFIPERFMAE-GEKLLKYVYWSNARETDDPTVDNKQCPAKNLVVLLCRLMLVE  453

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             +F+RYD+F +E     LG+SVT T+L++AT
Sbjct  454   VFMRYDTFTVESTKLFLGSSVTFTTLEKAT  483



>ref|XP_009345782.1| PREDICTED: allene oxide synthase-like, partial [Pyrus x bretschneideri]
Length=480

 Score =   470 bits (1210),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 236/451 (52%), Positives = 319/451 (71%), Gaps = 6/451 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR+ FF+ R++KYQSTVFRTNMPPG  I+ + KV+ LLD +SFP LFD + V
Sbjct  31    RYDYFYNQGRDNFFKIRMEKYQSTVFRTNMPPGALIAPNPKVIALLDAESFPILFDTTKV  90

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
              KRDV  GTYMPST  TGGYR+ +Y+DPSEPNHA LK     LL+ + +  +P F ++ +
Sbjct  91    AKRDVLDGTYMPSTAYTGGYRMCAYLDPSEPNHATLKRYFASLLASKHNQFIPLFQSSLS  150

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F  LE +++ +GKA  N+ +D  +FNF+     G  P +T L    P L+  W+   L
Sbjct  151   DLFPKLEEQISKDGKADFNSLSDDMSFNFVFELFCGQSPSKTTLGSKGPSLVTLWLFPQL  210

Query  543   HPVLSLGLPKQI---EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGE-ILGVSR  710
              P ++ GLPK +   ED LLHTF  P  LVK  YQ+LY+  YE++ + LD  E   G+SR
Sbjct  211   APQITFGLPKFLMFAEDFLLHTFSYPAFLVKPAYQKLYDAVYESAGSALDLAEGNFGISR  270

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             EE CHNL+F   FN+FGGMK+ FP ++KW+   G +LH QL  EIR+VVK + G IT + 
Sbjct  271   EETCHNLLFLAGFNAFGGMKLLFPALIKWVASGGANLHRQLRNEIRTVVKESEGTITFSA  330

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L KS V+E+ RIEPPVP QYG+AK DI++ SHDA F++K+GEM+FG Q F  KDP
Sbjct  331   LDKMTLTKSVVFEALRIEPPVPYQYGKAKEDIMVHSHDATFEIKKGEMIFGNQNFVGKDP  390

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETEN-PTVNDKQCAGKDFVMLVSRLMLV  1247
             K+F+  +EF+ +RFVGE G+ LLK+V WSNGR+ ++ PT  +KQCAGKD V+L+SRLMLV
Sbjct  391   KVFENPEEFVGNRFVGE-GEKLLKYVYWSNGRQADDHPTAENKQCAGKDLVVLMSRLMLV  449

Query  1248  ELFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             E FLRYD+F ++ G   LG+SVT  +L +A+
Sbjct  450   EFFLRYDTFTVDSGTVLLGSSVTFKTLTKAS  480



>ref|XP_008454885.1| PREDICTED: allene oxide synthase 2-like [Cucumis melo]
Length=481

 Score =   470 bits (1209),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 239/450 (53%), Positives = 315/450 (70%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFY QGR+EFFR RI KY STVFR NMPPGPFISSDS+VV LLD  SFP LFD + V
Sbjct  31    RYDYFYFQGRDEFFRSRITKYNSTVFRANMPPGPFISSDSRVVVLLDALSFPILFDTAKV  90

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR++  GTYMPS   TG  R  +Y+DPSE  H+ LK L    L+ R    +P F ++ +
Sbjct  91    EKRNILDGTYMPSLSFTGNIRTCAYLDPSETEHSVLKRLFLSFLASRHDRFIPLFRSSLS  150

Query  363   EMFDTLEnelagngkagl-naanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
             EMF  LE++L+   K    N+ +D  +F+++ R L    P  +KL  + P +   W++F 
Sbjct  151   EMFVKLEDKLSEKKKIADFNSISDSMSFDYVFRLLSDGTP-DSKLAAEGPGMFDLWLVFQ  209

Query  540   LHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+ S+GLPK     ED ++HT  LP   VK  Y++LYE FY +S + LD  E  G+ R
Sbjct  210   LAPLASIGLPKIFSVFEDLVIHTIPLPFFPVKSGYRKLYEAFYSSSGSFLDEAEKQGIDR  269

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             E+ACHNLVF   FN++GGMK+ FP +LKW+G AG  LH +LA+E+R+ VK  GG +T + 
Sbjct  270   EKACHNLVFLAGFNAYGGMKVLFPTLLKWVGTAGEDLHRKLAEEVRTTVKEEGG-LTFSA  328

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L+KS VYE+ RIEPPVP QYG+AK DIVI+SHD+ F++K+GE +FG+QPFATKDP
Sbjct  329   LEKMSLLKSVVYEALRIEPPVPFQYGKAKEDIVIQSHDSSFKIKKGETIFGYQPFATKDP  388

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             KIF  +++F+  RFVGE+G+ LLK+V WSN RET  PT  +KQC GK+ V+L+ R+M+VE
Sbjct  389   KIFKDSEKFVGDRFVGEEGEKLLKYVYWSNERETVEPTAENKQCPGKNLVVLIGRIMVVE  448

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F +EV   PLG +V   SL RAT
Sbjct  449   FFLRYDTFTVEVADLPLGPAVKFKSLTRAT  478



>gb|AFH89624.1| allene oxide synthase [Cymbidium ensifolium]
Length=496

 Score =   471 bits (1211),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 241/453 (53%), Positives = 322/453 (71%), Gaps = 9/453 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY +G++EFFR +I+ Y STVFRTNMPPGPF++ D +V+ +LD K+FP LFD S V
Sbjct  43    RLDYFYFKGQDEFFRSKIKLYSSTVFRTNMPPGPFMARDPRVIAVLDAKNFPILFDTSKV  102

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK++VFTGTYMP+T LTGGYR+ SY+DPSEP H K+K  +F LL+ R+   LP FH  YA
Sbjct  103   EKKNVFTGTYMPTTRLTGGYRVCSYLDPSEPTHTKVKQFLFNLLASRKDVFLPAFHTTYA  162

Query  363   EM-FDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
                F +LE+++A NG A  N+ N++ +F+FL  + +G  P +       P     W++  
Sbjct  163   ATPFSSLESQIASNGHADFNSLNNELSFDFLGEAYFGARPSKVG-SSGLPTKAAIWLVLQ  221

Query  540   LHP----VLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVS  707
             L P    VL+  LP  +ED LLHTF LP  + K  Y++LY++F       LD  E LG+S
Sbjct  222   LAPIAGNVLTKYLPWFLEDLLLHTFALPSIIAKPGYRKLYDYFKSAGAPALDMAEKLGLS  281

Query  708   REEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANG--GKIT  881
             REEACHNL+FATCFN++GG+++ FP ++K + +A   LH +LA E+R  V   G  G++T
Sbjct  282   REEACHNLLFATCFNTYGGLRVLFPGVVKRLAQAEGDLHARLAAEVREAVAQLGENGRLT  341

Query  882   MAGMEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFAT  1061
             +A +E+MEL  S VYE  RI+PPV  QY  AK+D V+ESHDA FQV +GEMLFG+QP AT
Sbjct  342   LAALEKMELTNSVVYEVLRIDPPVQFQYAHAKKDFVLESHDAAFQVHKGEMLFGYQPTAT  401

Query  1062  KDPKIFD-RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRL  1238
             +DP+IF   A++F+P RFVG +G  LLK+V WSNG ETENPTVNDKQCAGK+FV+LV+RL
Sbjct  402   RDPRIFGATAEKFVPDRFVGSEGAKLLKYVWWSNGPETENPTVNDKQCAGKNFVILVARL  461

Query  1239  MLVELFLRYDSFDIEVGMSPLGASVTLTSLKRA  1337
              + ELFL YDSF  +V  S +G+ +T TSL +A
Sbjct  462   FVAELFLSYDSFTADVSQSLIGSQITFTSLTKA  494



>ref|XP_009804872.1| PREDICTED: 9-divinyl ether synthase-like [Nicotiana sylvestris]
Length=483

 Score =   470 bits (1209),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 240/450 (53%), Positives = 323/450 (72%), Gaps = 5/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYN G +EFF  +IQKY STVFRTNMPPGPFI+ + KV+ LLD K+FP LFD S V
Sbjct  35    RYDYFYNLGTDEFFLTKIQKYNSTVFRTNMPPGPFIAKNPKVIVLLDAKTFPVLFDNSKV  94

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK++V  GTYMPST+  GGYR  +Y+DP E  HA LK     L+S   +  +P F ++ +
Sbjct  95    EKKNVLDGTYMPSTDFYGGYRPCAYLDPYESTHATLKGFFLSLISKLHNQFIPLFRSSIS  154

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYG-VDPMRTKLRLDAPKLIGKWVLFN  539
              +F  LENE++ NGKA  N  +D  +F+F+ R L    +P  T L  + PKL   W+L  
Sbjct  155   GLFVNLENEISQNGKANFNNNSDIMSFDFVFRLLCDKTNPHDTNLGSNGPKLFDIWLLPQ  214

Query  540   LHPVLSLGL---PKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P++SLGL   P  +ED +LHTF LP  LV+ +YQ+LY+ F +++ + L+  E  G+ R
Sbjct  215   LAPLVSLGLKFVPNFLEDLMLHTFPLPFFLVRSNYQKLYDAFSKHAESTLNEAEKNGIKR  274

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF   FN++GGMK+ FP ++KW+   G SLHT+LA EIR+++K   G IT++ 
Sbjct  275   DEACHNLVFLAGFNAYGGMKVVFPALIKWVANGGKSLHTRLANEIRTIIKEECGTITLSA  334

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             + +M L KS VYE  RIEP VP QYG+AK DI+I+SHD+ F +K+GEM+FG+QPFATKDP
Sbjct  335   INKMSLTKSVVYEVLRIEPAVPFQYGKAKEDILIQSHDSTFLIKKGEMMFGYQPFATKDP  394

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             KIFD+ +EFIP RF+ E G+ LLK+V WSN RET++PTV++KQCAGK+ V+L+ RLMLVE
Sbjct  395   KIFDKPEEFIPERFMAE-GENLLKYVYWSNARETDDPTVDNKQCAGKNLVVLLCRLMLVE  453

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              F+RYD+F +E     LG+SVT+  ++RAT
Sbjct  454   FFMRYDTFTVESTKLFLGSSVTVKKVERAT  483



>ref|XP_010690971.1| PREDICTED: allene oxide synthase-like [Beta vulgaris subsp. vulgaris]
Length=535

 Score =   472 bits (1214),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 242/450 (54%), Positives = 323/450 (72%), Gaps = 12/450 (3%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R D+FY QG E+FFR R++ Y STV+R NMPPGP++S D +V+ LLDGKSFP LFD S V
Sbjct  92    RWDFFYLQGIEKFFRSRMENYNSTVYRVNMPPGPWVSDDPRVIVLLDGKSFPILFDTSKV  151

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRDVFTGTYMPST  TGG+R+ SY+DPSEP H  LK+L+F +++     ++P F ++  
Sbjct  152   EKRDVFTGTYMPSTSYTGGFRVCSYLDPSEPMHGSLKSLLFSVIASNHKEIIPFFQSSLK  211

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLY-GVDPMRTKLRLDAPKLIGKWVLFN  539
             EMF  LE+EL    KA   A ND A+F F+ R    G +P  T L+ DAP ++ KW+   
Sbjct  212   EMFTALEDELRDKNKAAFVALNDSASFQFVFRLFCDGNNPPET-LKSDAPSMLKKWLAGQ  270

Query  540   LHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+ +LGLPK    +ED  LH+ R+P  LVK DY++L++ F  ++T+ LD  E LG+SR
Sbjct  271   LAPINTLGLPKLLNPVEDLFLHSLRVPFFLVKSDYKKLFDAFSSSATSFLDKAESLGISR  330

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             EEACHNL+F   FNSFGG  +FFP+M KW+  AG SLH +LA+EIR+VVK+ GG +T   
Sbjct  331   EEACHNLMFVGGFNSFGGFSVFFPSMFKWVASAGESLHRELAEEIRTVVKSEGG-VTYNA  389

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             + +M L +S VYE+ RIEPPVP QYG+AK D+V+ SHD  F++K+GEM+FG+QPFAT DP
Sbjct  390   INKMVLTRSVVYEALRIEPPVPYQYGKAKDDLVVRSHDGTFKIKKGEMIFGYQPFATNDP  449

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             KIF   ++F+ +RFVGE G+AL K+VLWSNGR  ++PTV +KQC  K+ V L+S + LVE
Sbjct  450   KIFTDPEKFVGNRFVGE-GEALSKYVLWSNGRGIDDPTVENKQCPAKNLVELLSTVFLVE  508

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F +E      G ++T  S+K+AT
Sbjct  509   FFLRYDTFSVEN-----GTNLTFLSVKKAT  533



>ref|XP_002863754.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40013.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=465

 Score =   469 bits (1207),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 216/305 (71%), Positives = 259/305 (85%), Gaps = 0/305 (0%)
 Frame = +3

Query  429   DQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNLHPVLSLGLPKQIEDPLLHTFRL  608
             D  A NFLAR+ YG +P+ TKL+ DAP LI KWVLFNLHP+LSLGLP+ +EDPLLHTF L
Sbjct  161   DGTACNFLARAFYGTNPVDTKLKADAPGLITKWVLFNLHPLLSLGLPRIVEDPLLHTFSL  220

Query  609   PPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEACHNLVFATCFNSFGGMKIFFPNM  788
             PPALVK DYQRLYEFFYE++  IL   + LG+SREEA HNL+FATCFN++GGMKI FPNM
Sbjct  221   PPALVKSDYQRLYEFFYESAGEILVEADKLGISREEATHNLLFATCFNTWGGMKILFPNM  280

Query  789   LKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQMELMKSTVYESFRIEPPVPTQYG  968
             +K IGRAG  +H QLA+EIRSV+K+NGG++TM G+E+MEL KS VYE  R EPPVP QYG
Sbjct  281   VKRIGRAGHKVHNQLAEEIRSVIKSNGGELTMGGIEKMELTKSVVYECLRFEPPVPAQYG  340

Query  969   RAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFDRAQEFIPHRFVGEKGKALLKHV  1148
             RAK+D+VIESHDA F+VK GEML+G+QP AT+DPKIFDRA EF+P RFVGE+G+ LL+HV
Sbjct  341   RAKKDLVIESHDAAFKVKAGEMLYGYQPLATRDPKIFDRADEFVPERFVGEEGEKLLRHV  400

Query  1149  LWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLRYDSFDIEVGMSPLGASVTLTSL  1328
             LWSNG ETE PTV +KQCAGKDFV+LV+RL ++E+F RYDSFDIEV  SPLG+SV  TSL
Sbjct  401   LWSNGPETETPTVGNKQCAGKDFVVLVARLFVIEIFRRYDSFDIEVAKSPLGSSVNFTSL  460

Query  1329  KRATF  1343
             ++A+F
Sbjct  461   RKASF  465


 Score =   144 bits (362),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +3

Query  3    RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
            R DYFY+QG EEFF+ RI+KY STV+R NMPPG FI+ + +VV LLDGKSFP LFDV  V
Sbjct  73   RWDYFYDQGAEEFFKSRIRKYNSTVYRVNMPPGGFIAENPQVVALLDGKSFPVLFDVDKV  132

Query  183  EKRDVFTGTYMPSTELTGGYRILSYIDP  266
            EK+D+FTGTYMPST+LTGGYRILSY+DP
Sbjct  133  EKKDLFTGTYMPSTDLTGGYRILSYLDP  160



>ref|XP_010068136.1| PREDICTED: LOW QUALITY PROTEIN: allene oxide synthase 2-like 
[Eucalyptus grandis]
Length=614

 Score =   474 bits (1220),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 238/450 (53%), Positives = 319/450 (71%), Gaps = 13/450 (3%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY++G +EFFR R+QKYQSTVFR+NM PGPF++ + KVV LLD  SFP LFD S V
Sbjct  172   RLDYFYHEGTDEFFRTRMQKYQSTVFRSNMVPGPFMARNPKVVVLLDAISFPILFDTSKV  231

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+DVF GTYMPS   TGGYR+ +Y+DPSEP HA  K L    L+ R +  +P + ++ +
Sbjct  232   EKKDVFVGTYMPSINFTGGYRVCAYLDPSEPKHAIFKGLFLSTLATRHNKFIPLYRSSLS  291

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLD-APKLIGKWVLFN  539
             ++F  LE+E +  GK   N   ++ +F+FLA      +P  T L  D   K    W+ F 
Sbjct  292   QLFIELEDEFSSKGKVYFNDYCNKMSFSFLANLFCDRNPSSTILATDKVTKFFDSWLFFQ  351

Query  540   LHPVLSLGLPKQI---EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+++LGLPK +   ED +LHTF LP  L+K DY++ YE F E + +ILD  E LG+ R
Sbjct  352   LAPLMTLGLPKILNFLEDIVLHTFPLPSLLLKCDYKKFYEVFNEYAKSILDEAESLGIKR  411

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF  CFNS+GGMK   P ++KW+G AG  L  +LA+EIR+VV + GG +TMA 
Sbjct  412   DEACHNLVFLVCFNSYGGMKTTLPALIKWVGLAGEELQRRLAEEIRTVVXSEGG-VTMAA  470

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L KS  +E+ R++PPV  QYG AK D+VI +HDA F++K+GEM+FG+QPFATKDP
Sbjct  471   LEKMSLTKSVAWEALRVKPPVAFQYGHAKEDLVIHNHDAAFEIKKGEMIFGYQPFATKDP  530

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             +IF+R +EF+  RFVGE+G+ LLK+V WSNGRE ++PTV +KQC  K+ V+L+SR+MLVE
Sbjct  531   RIFERPEEFVGDRFVGEEGEKLLKYVYWSNGREIDDPTVGNKQCPAKNLVVLLSRVMLVE  590

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F IE G        T TS+ +AT
Sbjct  591   FFLRYDTFTIEAG--------TFTSMSKAT  612


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 64/107 (60%), Gaps = 11/107 (10%)
 Frame = +3

Query  960   QYGRAK-RDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFDRAQEFIPHRFVGEKGKAL  1136
             Q GR +  D+VI  HDA F++++ EM FG+QPF TK+P +FDR++           G+  
Sbjct  38    QVGRWEAEDMVIHEHDAAFEIRKREMSFGYQPFGTKEPSVFDRSRGV---------GRPP  88

Query  1137  LKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLRYDSFD  1277
             LK V  SNGRE ++P+V +++C  K+  +L+     + LFL    F+
Sbjct  89    LKFVYRSNGREIDDPSVGNRRCPEKNMAVLLCSCSTI-LFLETQHFN  134



>ref|XP_009350924.1| PREDICTED: allene oxide synthase-like [Pyrus x bretschneideri]
Length=514

 Score =   470 bits (1209),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 237/451 (53%), Positives = 319/451 (71%), Gaps = 6/451 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR+ FF+ R++KYQSTVFRTNMPPG  I+ + KV+ LLD +SFP LFD + V
Sbjct  65    RYDYFYNQGRDNFFKIRMEKYQSTVFRTNMPPGALIAPNPKVIALLDAESFPILFDTTKV  124

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
              KRDV  GTYMPST  TGGYR+ +Y+DPSEPNHA LK     LL+ + +  +P F ++ +
Sbjct  125   AKRDVLDGTYMPSTAYTGGYRMCAYLDPSEPNHATLKRYFASLLASKHNQFIPLFQSSLS  184

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F  LE +++ +GKA  N+ +D  +FNF+     G  P +T L    P L+  W+   L
Sbjct  185   DLFPKLEEQISKDGKADFNSLSDDMSFNFVFELFCGQSPSKTTLGSKGPSLVTLWLFPQL  244

Query  543   HPVLSLGLPKQI---EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGE-ILGVSR  710
              P ++ GLPK +   ED LLHTF  P  LVK  YQ+LY+  YE++ + LD  E   G+SR
Sbjct  245   APQITFGLPKFLMFAEDFLLHTFSYPAFLVKPAYQKLYDAVYESAGSALDLAEGNFGISR  304

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             EE CHNL+F   FN+FGGMK+ FP ++KW+   G +LH QL  EIR+VVK + G IT + 
Sbjct  305   EETCHNLLFLAGFNAFGGMKLLFPALIKWVASGGENLHRQLRNEIRTVVKESEGTITFSA  364

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L KS V+E+ RIEPPVP QYG+AK DIV+ SHDA F++K+GEM+FG Q F  KDP
Sbjct  365   LDKMTLTKSVVFEALRIEPPVPYQYGKAKEDIVVHSHDATFEIKKGEMIFGNQNFVGKDP  424

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETEN-PTVNDKQCAGKDFVMLVSRLMLV  1247
             K+F+  +EF+ +RFVGE G+ LLK+V WSNGR+ ++ PT  +KQCAGKD V+L+SRLMLV
Sbjct  425   KVFENPEEFVGNRFVGE-GEKLLKYVYWSNGRQADDHPTAENKQCAGKDIVVLMSRLMLV  483

Query  1248  ELFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             E FLRYD+F ++ G   LG+SVT  +L +A+
Sbjct  484   EFFLRYDTFTVDSGTVLLGSSVTFKTLTKAS  514



>emb|CBI32529.3| unnamed protein product [Vitis vinifera]
Length=431

 Score =   467 bits (1201),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 236/447 (53%), Positives = 311/447 (70%), Gaps = 51/447 (11%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQG++EFF+ R+QKY STVFR NMPPGPFISSDSKVV LLD  SFP LFD S V
Sbjct  35    RFDYFYNQGQDEFFKTRMQKYHSTVFRANMPPGPFISSDSKVVVLLDAVSFPVLFDSSKV  94

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR+V  GT+MPST+LTGGYR+L+++DPSEP H  LK   F LL+ R    +P F     
Sbjct  95    EKRNVLDGTFMPSTDLTGGYRVLAFLDPSEPKHDLLKRFSFSLLASRHRDFIPVFRP---  151

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
                                        N  ++ L+        L+L     +G  +L N 
Sbjct  152   ---------------------------NIFSKWLF--------LQLSPLMTLGLSMLPNF  176

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
                        IED LLHTF LPP LVK DY +LY+ FYE+++++LD GE +G++R+EAC
Sbjct  177   -----------IEDLLLHTFPLPPFLVKSDYNKLYKAFYESASSVLDEGERMGINRDEAC  225

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNLVF   F++FGGMK+ FP ++KW+G AG  LH +LA EIR+VVKA GG +T A +++M
Sbjct  226   HNLVFLAGFSTFGGMKVLFPPLIKWVGLAGEKLHRELADEIRTVVKAEGG-VTFAALDKM  284

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              L KS VYE+ RI PPVP QYG+A+ D+VI SHDA F++K+GEM+FG+QPFATKDPK+F+
Sbjct  285   ALTKSVVYEALRIGPPVPFQYGKAREDMVIHSHDAAFEIKKGEMIFGYQPFATKDPKVFE  344

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
               ++F+ HRF+GE G+ LLK+V WSNGRET+NPT  +KQC+GKD V+L+S+LMLVE+FLR
Sbjct  345   NPEDFVAHRFMGE-GEKLLKYVYWSNGRETDNPTAENKQCSGKDLVVLISKLMLVEIFLR  403

Query  1263  YDSFDIEVGMSPLGASVTLTSLKRATF  1343
             YD+F++E G   LG++V   SL ++++
Sbjct  404   YDTFEVESGTMVLGSAVLFKSLTKSSY  430



>ref|NP_001284390.1| allene oxide synthase 2-like [Cucumis melo]
 gb|AAK54282.1|AF081955_1 fatty acid 9-hydroperoxide lyase [Cucumis melo]
Length=481

 Score =   468 bits (1204),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 239/450 (53%), Positives = 315/450 (70%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFY QGR+EFFR RI KY STVFR NMPPGPFISSDS+VV LLD  SFP LFD + V
Sbjct  31    RYDYFYFQGRDEFFRSRITKYNSTVFRANMPPGPFISSDSRVVVLLDALSFPILFDTAKV  90

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR++  GTYMPS   TG  R  +Y+DPSE  H+ LK L    L+ R    +P F ++ +
Sbjct  91    EKRNILDGTYMPSLSFTGNIRTCAYLDPSETEHSVLKRLFLSFLASRHDRFIPLFRSSLS  150

Query  363   EMFDTLEnelagngkagl-naanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
             EMF  LE++L+   K    N+ +D  +F+++ R L    P  +KL  + P +   W++F 
Sbjct  151   EMFVKLEDKLSEKKKIADFNSISDSMSFDYVFRLLSDGTP-DSKLAAEGPGMFDLWLVFQ  209

Query  540   LHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+ S+GLPK     ED ++HT  LP   VK  Y++LYE FY +S + LD  E  G+ R
Sbjct  210   LAPLASIGLPKIFSVFEDLVIHTIPLPFFPVKSGYRKLYEAFYSSSGSFLDEAEKQGIDR  269

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             E+ACHNLVF   FN++GGMK+ FP +LKW+G AG  LH +LA+E+R+ VK  GG +T + 
Sbjct  270   EKACHNLVFLAGFNAYGGMKVLFPTLLKWVGTAGEDLHRKLAEEVRTTVKEEGG-LTFSA  328

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L+KS VYE+ RIEPPVP QYG+AK DIVI+SHD+ F++K+GE +FG+QPFATKDP
Sbjct  329   LEKMSLLKSVVYEALRIEPPVPFQYGKAKEDIVIQSHDSSFKIKKGETIFGYQPFATKDP  388

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             KIF  +++F+  RFVGE+G+ LLK+V WSN RET  PT  +KQC GK+ V+L+ R+M+VE
Sbjct  389   KIFKDSEKFVGDRFVGEEGEKLLKYVYWSNERETVEPTPENKQCPGKNLVVLIGRIMVVE  448

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F +EV   PLG +V   SL RAT
Sbjct  449   FFLRYDTFTVEVADLPLGPAVKFKSLTRAT  478



>ref|XP_009337896.1| PREDICTED: allene oxide synthase-like, partial [Pyrus x bretschneideri]
Length=480

 Score =   468 bits (1203),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 236/451 (52%), Positives = 319/451 (71%), Gaps = 6/451 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR+ FF+ R++KYQSTVFRTNMPPG  I+ + KV+ LLD +SF  LFD + V
Sbjct  31    RYDYFYNQGRDNFFKIRMEKYQSTVFRTNMPPGALIAPNPKVIALLDAESFSILFDTTKV  90

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
              KRDV  GTYMPST  TGGYR+ +Y+DPSEPNHA LK     LL+ + +  +P F ++ +
Sbjct  91    AKRDVLDGTYMPSTAYTGGYRMCAYLDPSEPNHATLKRYFASLLASKHNQFIPLFQSSLS  150

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F  LE +++ +GKA  N+ +D  +FNF+   L G  P +T L    P L+  W+   L
Sbjct  151   DLFPKLEEQISKDGKADFNSLSDDMSFNFVFELLCGQSPSKTTLGSKGPSLVTLWLFPQL  210

Query  543   HPVLSLGLPKQI---EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGE-ILGVSR  710
              P ++ GLPK +   ED LLHTF  P  LVK  YQ+LY+  YE++ + LD  E   G+SR
Sbjct  211   APQITFGLPKFLMFAEDFLLHTFSYPAFLVKPAYQKLYDAVYESAGSALDLAEGNFGISR  270

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             EE CHNL+F   FN+FGGMK+ FP ++KW+   G +LH QL  EIR++VK + G IT + 
Sbjct  271   EETCHNLLFLAGFNAFGGMKLLFPALIKWVASGGGNLHRQLRNEIRTIVKESEGTITFSA  330

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L KS V+E+ RIEPPVP QYG+AK DIV+ SHDA F++K+GEM+FG Q F  KDP
Sbjct  331   LDKMTLTKSVVFEALRIEPPVPYQYGKAKEDIVVHSHDATFEIKKGEMIFGNQNFVGKDP  390

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRET-ENPTVNDKQCAGKDFVMLVSRLMLV  1247
             K+F+  +EF+ +RFVGE G+ LLK+V WSNGR+  ++PT  +KQCAGKD V+L+SRLMLV
Sbjct  391   KVFENPEEFVGNRFVGE-GEKLLKYVYWSNGRQAGDHPTAENKQCAGKDLVVLMSRLMLV  449

Query  1248  ELFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             E FLRYD+F ++ G   LG+SVT  +L +A+
Sbjct  450   EFFLRYDTFTVDSGTVLLGSSVTFKTLTKAS  480



>dbj|BAE45341.1| allene oxide synthase [Pisum sativum]
Length=340

 Score =   461 bits (1187),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 234/341 (69%), Positives = 277/341 (81%), Gaps = 2/341 (1%)
 Frame = +3

Query  198   FTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYAEMFDT  377
             FTGTYMPST+LTGGYRILSY+DP EP H +LK  +FFLL  R  H +PEFH++Y  +F+T
Sbjct  1     FTGTYMPSTQLTGGYRILSYLDPPEPKHDQLKRFLFFLLKSRSSHFIPEFHSSYTNLFET  60

Query  378   LEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNLHPVLS  557
             LE ELA  GKA    + DQ AFN+LA++ YGV+P  TKL  DAP +I KW    L P+L+
Sbjct  61    LEKELAKKGKAVFTDSGDQTAFNYLAKAFYGVNPSETKLGTDAPSIITKWAARQLGPILT  120

Query  558   LGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTA-ILDHGEILGVSREEACHNLV  734
              GLP+ IE+PLLHTF LPPALVKKDYQRLYEFFYE+S+  +LD    LGVS+EEA HNL+
Sbjct  121   TGLPRLIEEPLLHTFLLPPALVKKDYQRLYEFFYESSSGPVLDEAVRLGVSKEEAVHNLI  180

Query  735   FATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQMELMK  914
             FATCFNSFGGMKI FP+ML +IG AGV+LH +LA+EIRSVVK+NGGK+TMAG+EQM LMK
Sbjct  181   FATCFNSFGGMKILFPSMLAYIGEAGVNLHRRLAEEIRSVVKSNGGKVTMAGLEQMRLMK  240

Query  915   STVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFDRAQE  1094
             S VYE+ RI+PPVP QY +AKRD+VIE+H+  FQVKEGEMLFGFQPFATKDPKIFDRA+E
Sbjct  241   SVVYETLRIDPPVPFQYAKAKRDLVIENHENAFQVKEGEMLFGFQPFATKDPKIFDRAEE  300

Query  1095  FIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDF  1217
             F+  RF+GE G+ LLKHVLWSNG ETE   V +KQCAGKD 
Sbjct  301   FVGDRFLGE-GEKLLKHVLWSNGPETEQTNVGNKQCAGKDL  340



>ref|XP_010915208.1| PREDICTED: allene oxide synthase 2-like [Elaeis guineensis]
Length=484

 Score =   466 bits (1198),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 235/447 (53%), Positives = 320/447 (72%), Gaps = 5/447 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D++Y QG + FF+ R+ KYQSTVFR N+PP   ++SD +V+ +LD KSFP LFD+SVV
Sbjct  36    RLDFYYFQGHDAFFKSRVSKYQSTVFRVNVPPAFSMASDPRVIAVLDAKSFPVLFDLSVV  95

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +K DV TGTY+PS  LTGG+R L+Y+DP++P HA LK L+F LL+ R   L+P F  AY+
Sbjct  96    DKTDVLTGTYIPSAALTGGFRPLAYLDPADPRHAALKQLLFDLLAARGPRLIPSFRAAYS  155

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              + D+LE  LA +G A  N  N+  A NF+   L+G     T     A K   KW+ F L
Sbjct  156   ALLDSLEAALANSGPADFNTLNEATALNFVCEFLFGGAAPSTT----AHKKAIKWLFFQL  211

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGE-ILGVSREEA  719
             HP+++LGLPK +E+   HTF LPP LV+ DY+ L  +F E +  +LD  E   G+SREE 
Sbjct  212   HPLVTLGLPKLLEELFFHTFHLPPFLVRSDYKALASYFAEAAKPVLDDAEKTRGLSREET  271

Query  720   CHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQ  899
              HNLVF   FN++GG+K+ FP +L+ +  +G  LH +LA+EIRSVV++ GG +T+AG+E+
Sbjct  272   LHNLVFVAVFNAYGGIKLSFPRILRRLAESGPELHARLAREIRSVVRSEGGAVTVAGLER  331

Query  900   MELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF  1079
             MEL KS V+E  R++PPV  QY RAK+D+VIESH+A F+VK+GEM+FG+QP AT+D ++F
Sbjct  332   MELTKSVVWELLRLDPPVEYQYARAKKDLVIESHEAAFRVKKGEMIFGYQPVATRDERVF  391

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
              +  EF+  RFVGE+GK LLK+V WSNGRETE   V +KQC GKD V+++ RL++VE FL
Sbjct  392   RKGGEFVADRFVGEEGKKLLKYVYWSNGRETEEAEVGNKQCPGKDVVVMMCRLLVVEFFL  451

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             RYDSF  EVGM PL   VT+TS+ +A+
Sbjct  452   RYDSFTAEVGMLPLEPKVTVTSITKAS  478



>ref|NP_001276295.1| allene oxide synthase, chloroplastic-like [Glycine max]
 gb|ABC68416.1| cytochrome P450 monooxygenase CYP74A1 [Glycine max]
Length=487

 Score =   465 bits (1196),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 237/450 (53%), Positives = 313/450 (70%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R +YFY+QGR++FF  RI+K+ STV RTNMPPGPFISSD +VV LLDG SFP LFD   V
Sbjct  38    RHNYFYHQGRDKFFATRIEKHNSTVIRTNMPPGPFISSDPRVVALLDGASFPILFDNDKV  97

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK +V  GT+MPST+ TGG+R+ +Y+D +EPNHA +K     +L+ R+   +P F N   
Sbjct  98    EKLNVLDGTFMPSTKFTGGFRVCAYLDTTEPNHALIKQFFLNVLAKRKDSFVPLFRNCLQ  157

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLY-GVDPMRTKLRLDAPKLIGKWVLFN  539
             E F  +E++L+ N KA  N     A+FNF+ R    G DP +T L    PKL+  W+LF 
Sbjct  158   ESFAEIEDQLSKNTKADFNTVFSDASFNFMFRLFCDGKDPSQTNLGSKGPKLVDTWLLFQ  217

Query  540   LHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+ +LGLPK    IED L+ T   P  L K  Y+ LYE F  ++T  LD  E LG+ R
Sbjct  218   LAPLATLGLPKIFNYIEDFLIRTLPFPACLTKSGYKNLYEAFKTHATTALDEAEKLGLKR  277

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
              EACHN+VF   FN++GG+K  FP +LKW+G +G  LH  LA+E+R VV   GG +T   
Sbjct  278   NEACHNVVFTAGFNAYGGLKNQFPYVLKWLGLSGEKLHADLAREVRRVVNDEGG-VTFTA  336

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E M L+KS VYE  RIEP VP QY RA+ ++V+ SHDA F+VK+GEMLFG+QPFAT+DP
Sbjct  337   LENMPLVKSVVYEVMRIEPAVPYQYARARENLVVSSHDASFEVKKGEMLFGYQPFATRDP  396

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             +IF+ A+ F+P RFVGE G+ +LKHVLWSNGRETE P+ ++KQC GK+ V+L+ RL LVE
Sbjct  397   RIFEDAEVFVPRRFVGE-GEKMLKHVLWSNGRETEEPSASNKQCPGKNLVVLLCRLFLVE  455

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             LFLRYD+F+ E   +  G ++T+ SL +A+
Sbjct  456   LFLRYDTFEFEYTQAGFGPTITIKSLTKAS  485



>ref|XP_009349452.1| PREDICTED: allene oxide synthase-like [Pyrus x bretschneideri]
Length=484

 Score =   464 bits (1195),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 234/451 (52%), Positives = 319/451 (71%), Gaps = 6/451 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR+ FF+ R++KYQSTVFRTNMPPG  I+ + KV+ LLD +SF  LFD + V
Sbjct  35    RYDYFYNQGRDNFFKIRMEKYQSTVFRTNMPPGALIAPNPKVIALLDAESFSILFDTTKV  94

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
              KR+V  GTYMPST  TGGYR+ +Y+DPSEPNHA LK     LL+ + +  +P F ++ +
Sbjct  95    AKRNVLDGTYMPSTAYTGGYRMCAYLDPSEPNHATLKRYFASLLASKHNQFIPLFQSSLS  154

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F  LE +++ +GKA  N+ +D  +FNF+   L G  P +T L    P L+  W+   L
Sbjct  155   DLFPKLEEQISKDGKADFNSLSDDMSFNFVFELLCGQSPSKTTLGSKGPSLVTLWLFPQL  214

Query  543   HPVLSLGLPKQI---EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGE-ILGVSR  710
              P ++ GLPK +   ED LLHTF  P  LVK  YQ+LY+  YE++ + LD  E   G+SR
Sbjct  215   APQITFGLPKFLMFAEDFLLHTFSYPAFLVKPAYQKLYDAVYESAGSALDLAEGNFGISR  274

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             EE CHNL+F   FN+FGGMK+ FP ++KW+   G +LH +L  EIR+VVK + G IT + 
Sbjct  275   EETCHNLLFLAGFNAFGGMKLLFPALIKWVASGGGNLHRKLRNEIRTVVKESEGTITFSA  334

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L KS V+E+ RIEPPVP QYG+AK DIV+ SHDA F++K+GEM+FG Q F  KDP
Sbjct  335   LDKMTLTKSVVFEALRIEPPVPYQYGKAKEDIVVHSHDATFEIKKGEMIFGNQNFVGKDP  394

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETEN-PTVNDKQCAGKDFVMLVSRLMLV  1247
             K+F+  +EF+ +RFVGE G+ LLK+V WSNGR+ ++ PT  +KQCAGKD V+++SRLMLV
Sbjct  395   KVFENPEEFVGNRFVGE-GEKLLKYVYWSNGRQADDHPTAENKQCAGKDLVVVMSRLMLV  453

Query  1248  ELFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             E FLRYD+F ++ G   LG+SVT  +L +A+
Sbjct  454   EFFLRYDTFTVDSGTVLLGSSVTFKTLTKAS  484



>ref|XP_002313825.2| allene oxide synthase family protein [Populus trichocarpa]
 gb|EEE87780.2| allene oxide synthase family protein [Populus trichocarpa]
Length=482

 Score =   464 bits (1194),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 233/449 (52%), Positives = 321/449 (71%), Gaps = 6/449 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+EFF  R+QKY+ST+F+TNMPPGPFI+ + KV+ +LD  SFP LFD S V
Sbjct  33    RLDYFYNQGRDEFFSTRVQKYESTIFKTNMPPGPFIAKNPKVIAVLDAVSFPVLFDTSKV  92

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK +V  GT+ PS   TGGYR  +Y+DPSEP H  LK+     L+ + +  +P F  + +
Sbjct  93    EKYNVLDGTFFPSVSFTGGYRACAYLDPSEPQHTSLKSFFMSTLASKHNDFIPLFRASLS  152

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F  +E+E+    KA  N  ++  +F+F+ R     D   TK+  + P ++ KW+   L
Sbjct  153   KLFINIEDEIVSQKKANFNKPSEAMSFDFVFRLFGDKDSSDTKVGSEGPAIVNKWLALQL  212

Query  543   HPVLSLGLP---KQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+ +LGLP   K +ED  L TF LP   VK DY +LY+ FY +S+++LD  E LG+ R+
Sbjct  213   APLATLGLPKYFKYLEDIFLRTFPLPFIFVKSDYNKLYDAFYASSSSVLDKAESLGIKRD  272

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNLVF   FN+FGGMK +FP ++KW+G AG  LH QLA EIR+VVK  GG +T   +
Sbjct  273   EACHNLVFLAGFNAFGGMKAWFPTLIKWVGTAGEMLHGQLANEIRTVVKEEGG-VTFQAL  331

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             ++M L KS V+E+ RIEPPVP QYG+A+ +IV+ SHDA F++K+GEM+FG+QPFATKDP+
Sbjct  332   DKMILTKSVVFEALRIEPPVPFQYGKARDNIVVHSHDAAFEIKKGEMIFGYQPFATKDPR  391

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             IFD  +EF+ HRFVG+ G+ LL++V WSNGRETE+PT  +KQC GKD V+L+SR++LVE 
Sbjct  392   IFDDPEEFVGHRFVGD-GEKLLRYVYWSNGRETEDPTAENKQCPGKDLVLLLSRVLLVEF  450

Query  1254  FLRYDSFDIEVGMS-PLGASVTLTSLKRA  1337
             FLRYD+F ++   +  LG++VT TSL +A
Sbjct  451   FLRYDTFTVKTASALALGSTVTFTSLIKA  479



>dbj|BAK05658.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87344.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   464 bits (1194),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 234/447 (52%), Positives = 327/447 (73%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D++Y QG++++F  R++KY STV R N+PPGPF++ D +VV +LD KSFP LFDV+ V
Sbjct  34    RLDFYYFQGQDKYFESRVEKYGSTVVRINVPPGPFMARDPRVVAVLDAKSFPVLFDVTKV  93

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+++FTGTYMPST LTGG+R+ SY+DPSEP H K+K L+F LL+ R+   +P F + ++
Sbjct  94    EKKNLFTGTYMPSTSLTGGFRVCSYLDPSEPTHTKVKQLLFSLLASRKDAFIPAFRSHFS  153

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +  T+E++L  +GK+  N  ND  +F F+  + +GV P  + L    P    KW++F L
Sbjct  154   SLLATVESQLLLSGKSNFNTLNDATSFEFIGDAYFGVLPSASDLGTTGPAKAAKWLIFQL  213

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+++LGLP  +E+PLLHT  LPP LV  DY+ LY++F+  +T  LD  E LG+ R+EAC
Sbjct  214   HPLVTLGLPMILEEPLLHTVHLPPFLVSGDYKALYKYFFAAATKALDTAEGLGLKRDEAC  273

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FAT FNS+GG+K+  P +L  I  +G   H +L  EIR+ V   GGK+T+  +E+M
Sbjct  274   HNLLFATVFNSYGGLKVLLPGILARIADSGEKFHKKLVTEIRAAVAEAGGKVTIEALEKM  333

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL KS V+E+ R++PPV  QYGRAK D+ IESHDA F VK+GEMLFG+QP ATKDP++F 
Sbjct  334   ELTKSAVWEALRLDPPVKFQYGRAKADMNIESHDAVFAVKKGEMLFGYQPCATKDPRVFG  393

Query  1083  -RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
               A+EF+  RFVG++G  LLK+V WSNGRETE+P+V++KQC GK+ V+LV RL++VELFL
Sbjct  394   PTAREFVGDRFVGKEGSKLLKYVYWSNGRETESPSVHNKQCPGKNLVVLVGRLLVVELFL  453

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             RYD+F  +VG+  LG  V  T + +AT
Sbjct  454   RYDTFTAKVGLDLLGTKVEFTGVTKAT  480



>gb|ACZ28493.1| allene oxide synthase [Lemna paucicostata]
Length=478

 Score =   463 bits (1192),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 236/447 (53%), Positives = 313/447 (70%), Gaps = 3/447 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D+F N+   +FF+ R+  Y ST+ R N PPGPF++ + KVV +LDGKSFP LFD S V
Sbjct  33    RLDFFSNE--FQFFQSRVDSYGSTIVRLNAPPGPFMAKNPKVVAILDGKSFPVLFDTSKV  90

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK++VFTGTYMPST LTGGYR+ +Y+DPSEPNH K+K L+  +L  R+ H++PEF  AY 
Sbjct  91    EKKNVFTGTYMPSTALTGGYRVCAYLDPSEPNHTKIKQLLLDILFSRKDHVIPEFRRAYQ  150

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F  ++ E+A +GK   N  ND A F FL R  +GV P  T+L     K    W+L  L
Sbjct  151   KLFGDMDAEIAKSGKFVFNDNNDGAGFEFLGRLFFGVSPSETELGAGGVKNANLWLLAQL  210

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P++ LGLPK +E+ L+HTF LPP L K  YQ LY++    +T  L   E LG+SREEA 
Sbjct  211   CPLMVLGLPKILEELLIHTFPLPPFLFKGKYQGLYKYVSSVATDALKMAENLGLSREEAI  270

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNLVFA CFNS GG+K+ FP +L++I  AG  L   LA E+RS V + GG++T+  +E+M
Sbjct  271   HNLVFAVCFNSLGGIKVLFPGILRYIALAGKDLQANLASEVRSAVSSTGGELTVEALEKM  330

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
              L KS VYES R++PPV  QYG  K+D+VIESHD  ++VK GEMLFG+QPFAT+D KIF 
Sbjct  331   PLTKSVVYESLRLDPPVKYQYGVVKKDMVIESHDRSYEVKAGEMLFGYQPFATRDKKIFG  390

Query  1083  -RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
               A +F+  RF+GE+G  LL+ VLWSNG ET +PT  DKQC GK+ ++L+SRL++ E FL
Sbjct  391   PDADKFVADRFIGEEGARLLQFVLWSNGPETVDPTPLDKQCPGKNLIVLISRLLVAEFFL  450

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             RYD F  E+G+ PL    T+TSL +A+
Sbjct  451   RYDFFTAEIGVVPLAVKTTITSLTKAS  477



>gb|AHM92934.1| AOS [Triticum aestivum]
Length=480

 Score =   462 bits (1188),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 236/447 (53%), Positives = 323/447 (72%), Gaps = 2/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D++Y QG  ++F  R++K+ STV R N+PPGPF++ D +VV +LD KSFP LFDV  V
Sbjct  29    RLDFYYFQGEAKYFESRVEKHGSTVLRINVPPGPFMARDPRVVAVLDAKSFPVLFDVDKV  88

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+++FTGTYMPST LTGG+R+ SY+DPSEP H K+K L+F LL+ R+   +P F + ++
Sbjct  89    EKKNLFTGTYMPSTSLTGGFRVCSYLDPSEPTHTKVKQLLFSLLASRKDAFIPAFRSHFS  148

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +  T+E++L   GK+  N  ND  +F F+  + +GV P  + L    P    KW++F L
Sbjct  149   SLLATVESQLVLGGKSNFNTLNDATSFEFIGDAYFGVLPSASDLGTTGPTKAAKWLIFQL  208

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+++LGLP  +E+PLLHT  LPP LV  DY+ LY++FY  +T  LD  E LG+ R+EAC
Sbjct  209   HPLVTLGLPMILEEPLLHTVHLPPILVSGDYKALYKYFYAAATKALDTAEGLGLKRDEAC  268

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FAT FNS+GG+K+  P +L  I  AG   H +LA E+R+ V   GGK+T+  +E+M
Sbjct  269   HNLLFATVFNSYGGLKVLLPGILARIAGAGEKFHQRLAAEVRTAVADAGGKVTIEALEKM  328

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF-  1079
             EL KS V+E+ R+EPPV  QYGRAK D+ IESHDA F VK+GEMLFG+QP ATKDP++F 
Sbjct  329   ELTKSAVWEALRLEPPVKFQYGRAKADMNIESHDAVFAVKKGEMLFGYQPCATKDPRVFG  388

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
               A+EF+  RFVGE G  LL++V WSNGRETE+P+V++KQC GK+ V+LV RL++VELFL
Sbjct  389   STAREFVGDRFVGE-GSKLLQYVYWSNGRETESPSVDNKQCPGKNLVVLVGRLLVVELFL  447

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             RYD+F  +VG+  LG  V  T + +AT
Sbjct  448   RYDTFTADVGVDLLGTKVEFTGVTKAT  474



>ref|XP_010036438.1| PREDICTED: allene oxide synthase 2-like [Eucalyptus grandis]
 gb|KCW48022.1| hypothetical protein EUGRSUZ_K01755 [Eucalyptus grandis]
Length=471

 Score =   461 bits (1187),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 234/450 (52%), Positives = 311/450 (69%), Gaps = 13/450 (3%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY++GR+EFFR R+QKYQSTVFR+NM PGPF++ + KVV LLD  SFP LFD S V
Sbjct  29    RLDYFYHEGRDEFFRTRMQKYQSTVFRSNMVPGPFMARNPKVVVLLDAISFPILFDTSKV  88

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+DVF GTYMPS   TGGYR+ +Y+DPSEP HA  K L    L+ R +  +P + +A +
Sbjct  89    EKKDVFVGTYMPSINFTGGYRVCAYLDPSEPKHAIFKGLFLSSLATRHNKFIPLYRSALS  148

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLD-APKLIGKWVLFN  539
             ++F  LE+E +  GK   N   ++ +F+FLA      +P  T L  D   K    W+ F 
Sbjct  149   QLFIELEDEFSSKGKVYFNDYCNKMSFSFLANLFCDRNPSSTILATDKVTKFFDSWLFFQ  208

Query  540   LHPVLSLGLPKQI---EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+++LGLPK +   ED +LHTF LP  L+K DY+              D  E LG+ R
Sbjct  209   LAPLMTLGLPKILNFLEDIVLHTFPLPSLLLKCDYRNSTRCSMSTQNRYWDEAESLGIKR  268

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF  CFNS+GGMK   P ++KW+G AG  L  +LA+EIR+VV++ GG +TMA 
Sbjct  269   DEACHNLVFLVCFNSYGGMKTTLPALIKWVGLAGEELQRRLAEEIRTVVRSEGG-VTMAA  327

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L KS  +E+ R +PPV  QYG AK D+VI +HDA F++K+GEM+FG+QPFATKDP
Sbjct  328   LEKMSLTKSVAWEALRFKPPVAFQYGHAKEDLVIHNHDAAFEIKKGEMIFGYQPFATKDP  387

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             +IF+R +EF+  RFVGE+G+ LLK+V WSNGRE ++PTV +KQC  K+ V+L+SR+MLVE
Sbjct  388   RIFERPEEFVGDRFVGEEGEKLLKYVYWSNGREIDDPTVGNKQCPAKNLVVLLSRVMLVE  447

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F IE G        T TS+ +AT
Sbjct  448   FFLRYDTFTIEAG--------TFTSMSKAT  469



>ref|XP_003558446.1| PREDICTED: allene oxide synthase 2-like [Brachypodium distachyon]
Length=486

 Score =   460 bits (1183),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 237/448 (53%), Positives = 324/448 (72%), Gaps = 2/448 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D++Y QG++++F  R+ KY STV R N+PPGPF++ D +VV +LD KSFP LFDV+ V
Sbjct  33    RLDFYYLQGQDKYFESRVDKYGSTVVRMNVPPGPFMARDPRVVAVLDAKSFPVLFDVTKV  92

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+++FTGTYMPST LTGG+R+ +Y+DPSEPNH K+K L+F LL+ R+   +P F   ++
Sbjct  93    EKKNLFTGTYMPSTSLTGGHRVCAYLDPSEPNHGKVKQLLFSLLASRKDAFIPAFRTHFS  152

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +  T+E++L   GK+  NA ND  +F F+  + +GV P  + L    P    KW+++ L
Sbjct  153   SLLATVESQLVLAGKSDFNALNDATSFEFIGDAYFGVRPSASDLGTTGPTKAAKWLIWQL  212

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+++LGLP  +E+PLLHT  LPP LV +DY+ LY++F   +   LD  E LG+ REEAC
Sbjct  213   HPLVTLGLPMILEEPLLHTVHLPPILVSRDYKALYKYFSAAAGPALDTAESLGLPREEAC  272

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FAT FNS+GG+K+  P +L  I  AG   H +LA EIR+ V+  GGK+TMA +E+M
Sbjct  273   HNLLFATVFNSYGGLKVLLPGVLARIAGAGEKFHKKLAAEIRAAVEDAGGKVTMAAVEKM  332

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDAR-FQVKEGEMLFGFQPFATKDPKIF  1079
             EL KS V+E+ R++PPV  QYGRAK D+ IESHD + F VK+GEMLFG+QP AT+DP++F
Sbjct  333   ELTKSAVWEALRLDPPVKFQYGRAKADLSIESHDDKVFAVKKGEMLFGYQPCATRDPRVF  392

Query  1080  D-RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELF  1256
                A+EF+  RFVG++G  LL++V WSNGRETENP V DKQC GK+ V+LV RL+LVELF
Sbjct  393   GATAREFVGDRFVGDEGMKLLQYVYWSNGRETENPGVGDKQCPGKNLVVLVGRLLLVELF  452

Query  1257  LRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             LRYD+F    G   LG  V  T++ +AT
Sbjct  453   LRYDTFTAGAGTDLLGTKVEFTAVTKAT  480



>ref|XP_006365486.1| PREDICTED: 9-divinyl ether synthase-like [Solanum tuberosum]
Length=494

 Score =   460 bits (1184),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 224/448 (50%), Positives = 311/448 (69%), Gaps = 4/448 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DY+Y+ G +EFFR +  KY STVFRTNMPPGPFI+ D KV+ LLD  SFP LFD S V
Sbjct  44    RYDYYYSLGADEFFRTKSLKYNSTVFRTNMPPGPFIAKDPKVIVLLDAISFPILFDCSKV  103

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK++V  GT+MPST+  GGYR  +++D SEP HA  K     ++S      +P F N+ +
Sbjct  104   EKKNVLDGTFMPSTDFFGGYRPCAFLDASEPKHATHKGFYLSIISKLHTQFIPIFKNSVS  163

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYG-VDPMRTKLRLDAPKLIGKWVLFN  539
              +F  LE E++ N K   N  +D  +F+F+ R L    +P  T L  + PK    W+L  
Sbjct  164   VLFQNLEIEMSKNMKGNFNDISDAMSFDFVFRLLCNNTNPHDTNLGTNGPKCFDLWMLPQ  223

Query  540   LHPVLSLGL---PKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P++++GL   P  +ED +LHTF+LP  L+K  YQ+LY+ F E++ + LD  E  G+ R
Sbjct  224   LAPLVTIGLKFVPNFLEDLMLHTFQLPFFLIKSKYQKLYDAFNEHAGSTLDDAEKSGIKR  283

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF   FN++GGMKI FP+++KW+   G SLHT+LA EIR+++K  GG IT++ 
Sbjct  284   DEACHNLVFLAGFNAYGGMKILFPSLMKWVASGGKSLHTRLANEIRTIIKEEGGSITLSA  343

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             + +M L+KSTVYE  RIEPP+P QYG+AK DI+++SHD+ F +K+GEM+FG+Q FATKD 
Sbjct  344   INKMSLIKSTVYEVLRIEPPIPFQYGKAKEDIMVQSHDSNFLIKKGEMIFGYQTFATKDA  403

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
              IF+  +EFI  RF+G +G+ LLK+V WSN RET++PTV++KQCAGKD  +L+ RLMLVE
Sbjct  404   NIFENPEEFIAERFMGSEGEKLLKYVYWSNARETDSPTVDNKQCAGKDLAVLLCRLMLVE  463

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKR  1334
              F+RYD+F +E      G  +T  +L++
Sbjct  464   FFMRYDTFTVESSKYLAGPLITFKTLEK  491



>ref|XP_004498182.1| PREDICTED: allene oxide synthase, chloroplastic-like [Cicer arietinum]
Length=485

 Score =   459 bits (1182),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 232/451 (51%), Positives = 315/451 (70%), Gaps = 7/451 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR++FF  RI+KY ST+F+TNMPPGPFISS+ +V+ LLD  SFP LFD   V
Sbjct  35    RHDYFYNQGRDKFFSTRIKKYNSTIFKTNMPPGPFISSNPRVIALLDASSFPILFDNKKV  94

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK +V  GT+MPST+ TGG+R+ +Y+D +EPNHA +KN     L  R+   +P F +  +
Sbjct  95    EKYNVLDGTFMPSTKFTGGHRVCAYLDTTEPNHAVIKNFFINALLLRKDTFVPLFRSILS  154

Query  363   EMFDTLEnelagngkagl-naanDQAAFNFLARSLY-GVDPMRTKLRLDAPKLIGKWVLF  536
             ++F  +E+ L+G       N+    A+FNF+ R      DP+ TK+  + PK+   W+LF
Sbjct  155   DVFSEIEDGLSGKSGKADFNSIVSVASFNFMFRLFCDNKDPLDTKVGSEGPKMFDTWLLF  214

Query  537   NLHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVS  707
              L P+ +LG PK    +ED LL T   P  L +  Y++LYE F  ++T IL   E  G++
Sbjct  215   QLAPLATLGPPKIFSYLEDLLLRTVPFPACLARSSYKKLYEAFSSSATTILKEAEKAGLN  274

Query  708   REEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMA  887
             R EACHNLVF   FN++GG+K  FP + KWIG +G  LH +LA EIRSVVK +GG +T+ 
Sbjct  275   RNEACHNLVFTAGFNAYGGLKNQFPILFKWIGLSGEELHKELANEIRSVVKKHGG-VTIE  333

Query  888   GMEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKD  1067
              +E M L KS VYE  RIEP VP QYG+A+ D++++SHDA F++K+GEM+FG+QPFATKD
Sbjct  334   SLENMSLTKSVVYEVLRIEPVVPYQYGKAREDLIVKSHDASFEIKKGEMIFGYQPFATKD  393

Query  1068  PKIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLV  1247
             P IFD A+ F+P RFVGE G+ LLK+VLWSNG+ET+  +V++KQC GK+ V+L+ RL LV
Sbjct  394   PMIFDDAEVFLPKRFVGE-GEKLLKYVLWSNGKETDESSVDNKQCPGKNLVVLLCRLFLV  452

Query  1248  ELFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             E FLRYD+F +E      GASV++TSL +A+
Sbjct  453   EFFLRYDTFVVETKNVAFGASVSITSLTKAS  483



>gb|AFA28141.1| allene oxide synthase, partial [Triticum aestivum]
Length=443

 Score =   457 bits (1176),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 230/442 (52%), Positives = 320/442 (72%), Gaps = 1/442 (0%)
 Frame = +3

Query  6     IDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVVE  185
             +D++Y QG++++F  R+ KY STV R N+PPGPF++ D +VV +LD KSFP LFDV  VE
Sbjct  1     LDFYYFQGQDKYFESRVDKYGSTVVRINVPPGPFMARDPRVVAVLDAKSFPVLFDVDKVE  60

Query  186   KRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYAE  365
             K+++FTGTYMPST LTGG+R+ SY+DPSEP H K+K L+F LL+ R+   +P F + ++ 
Sbjct  61    KKNLFTGTYMPSTSLTGGFRVCSYLDPSEPTHTKVKQLLFSLLASRKDAFIPAFRSHFSS  120

Query  366   MFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNLH  545
             +  T+E++L  + K+  N  ND  +F F+  + +GV P  + L    P    KW++F LH
Sbjct  121   LLATVESQLVLSKKSNFNTLNDATSFEFIGDAYFGVLPSASDLGTTGPTKAAKWLIFQLH  180

Query  546   PVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEACH  725
             P+++LGLP  +E+PLLHT  LPP LV  DY+ LY++FY  +T  LD  E LG+ R+EACH
Sbjct  181   PLVTLGLPMILEEPLLHTVHLPPILVSGDYKALYKYFYAAATKALDTAEGLGLKRDEACH  240

Query  726   NLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQME  905
             NL+FAT FNS+GG+K+  P +L  I  AG   H +L  EIR+ V   GGK+T+  +E+ME
Sbjct  241   NLLFATVFNSYGGLKVLLPGILARIAGAGEKFHQKLVAEIRAAVADAGGKVTIEALEKME  300

Query  906   LMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF-D  1082
             L KS V+E+ R++PPV  QYGRAK D+ IESHDA F VK+G MLFG+QP AT+DP++F  
Sbjct  301   LTKSAVWEALRLDPPVKFQYGRAKADMNIESHDAVFAVKKGGMLFGYQPCATRDPRVFGS  360

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
              A+EF+  RFVGE+G+ LL++V WSNGRETE+P+V++KQC GK+ V+LV RL++VELFLR
Sbjct  361   TAREFVGDRFVGEEGRKLLQYVYWSNGRETESPSVDNKQCPGKNLVVLVGRLLVVELFLR  420

Query  1263  YDSFDIEVGMSPLGASVTLTSL  1328
             YD+F  +VG+  LG  V  T +
Sbjct  421   YDTFSADVGVDLLGTKVEFTGV  442



>ref|XP_010096254.1| Allene oxide synthase [Morus notabilis]
 gb|EXB63649.1| Allene oxide synthase [Morus notabilis]
Length=506

 Score =   459 bits (1181),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 222/449 (49%), Positives = 316/449 (70%), Gaps = 5/449 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R D++YNQGR+ FFR R +KY+STVFR N PPGPFI+ +SKVV LLD  SFP LFD + V
Sbjct  52    RWDFYYNQGRDGFFRARQEKYKSTVFRANAPPGPFIAKESKVVVLLDAISFPILFDTTKV  111

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK + F  TYMPS    GGYR+L+++DPSEP H  LK   F +L+ +  + +P    + A
Sbjct  112   EKTNFFDTTYMPSVNFFGGYRVLAFLDPSEPKHKALKQYFFNVLASKHDNFIPLLRKSLA  171

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPK-LIGKWVLFN  539
             ++F+ LE++L  + +   N  +D A+FN++        P +T L     K  +  W++  
Sbjct  172   DLFNNLESQLEKSKEVNFNPISDSASFNYIFELFCDKSPSKTDLGPQGNKTFVDIWLVPQ  231

Query  540   LHPVLSLGLPKQ---IEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             + P+++ G+PK    +ED L+HTF +P  LVK  Y+ ++E F  ++   LD  +  G+ R
Sbjct  232   VTPIVTFGVPKLLQLVEDLLIHTFPIPAFLVKGKYKTIFEAFSSSAGPTLDKAKDFGIQR  291

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNL+F TCFN++GG+K+ FP + KW+GRA  + H  LAKEIR+VVK  GG +T+A 
Sbjct  292   DEACHNLIFITCFNTYGGLKVLFPALFKWLGRASPTWHANLAKEIRNVVKQEGGVVTLAA  351

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L+KS VYE  RI+PPVP Q  RAK D+VI+SHDA F++K+GE+++G+QPFATKDP
Sbjct  352   LEKMSLLKSVVYEVLRIDPPVPFQCARAKEDLVIQSHDASFKIKKGELIYGYQPFATKDP  411

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             K+F+  + F+P+RF+G K +A +K+V WSNGRETE+PTV+DKQCAGKD V+L++R+MLVE
Sbjct  412   KVFENPETFVPYRFMG-KAEANIKYVYWSNGRETEDPTVDDKQCAGKDLVVLMARVMLVE  470

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRA  1337
              FLRYD+F     +  +G+ VT TSL +A
Sbjct  471   FFLRYDTFTCTDEVFLVGSKVTFTSLTKA  499



>gb|AGU41845.1| allene oxide synthase, partial [Triticum aestivum]
Length=466

 Score =   457 bits (1177),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 231/438 (53%), Positives = 319/438 (73%), Gaps = 1/438 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D++Y QG  ++F  R++K+ STV R N+PPGPF++ D +VV +LD KSFP LFDV  V
Sbjct  29    RLDFYYFQGEAKYFESRVEKHGSTVLRINVPPGPFMARDPRVVAVLDAKSFPVLFDVDKV  88

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+++FTGTYMPST LTGG+R+ SY+DPSEP H K+K L+F LL+ R+   +P F + ++
Sbjct  89    EKKNLFTGTYMPSTSLTGGFRVCSYLDPSEPTHTKVKQLLFSLLASRKDAFIPAFRSHFS  148

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +  T+E++L   GK+  N  ND  +F F+  + +GV P  + L    P    KW++F L
Sbjct  149   SLLATVESQLVLGGKSNFNTLNDATSFEFIGDAYFGVLPSASDLGTTGPTKAAKWLIFQL  208

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+++LGLP  +E+PLLHT  LPP LV  DY+ LY++FY  +T  LD  E LG+ R+EAC
Sbjct  209   HPLVTLGLPMILEEPLLHTVHLPPILVSGDYKALYKYFYAAATKALDTAEGLGLKRDEAC  268

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FAT FNS+GG+K+  P +L  I  AG   H +L  EIR+ V   GGK+T+  +E+M
Sbjct  269   HNLLFATVFNSYGGLKVLLPGILARIAGAGEKFHQKLVAEIRAAVADAGGKVTIEALEKM  328

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF-  1079
             EL KS V+E+ R++PPV  QYGRAK D+ IESHDA F VK+GEMLFG+QP AT+DP++F 
Sbjct  329   ELTKSAVWEALRLDPPVKFQYGRAKADMNIESHDAVFAVKKGEMLFGYQPCATRDPRVFG  388

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
               A+EF+  RFVGE+G+ LL++V WSNGRETE+P+V++KQC GK+ V+LV RL++VELFL
Sbjct  389   STAREFVGDRFVGEEGRKLLQYVYWSNGRETESPSVDNKQCPGKNLVVLVGRLLVVELFL  448

Query  1260  RYDSFDIEVGMSPLGASV  1313
             RYD+F  +VG+  LG  V
Sbjct  449   RYDTFTADVGVDLLGTKV  466



>ref|XP_009760041.1| PREDICTED: 9-divinyl ether synthase-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009760042.1| PREDICTED: 9-divinyl ether synthase-like isoform X2 [Nicotiana 
sylvestris]
Length=477

 Score =   457 bits (1177),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 231/450 (51%), Positives = 313/450 (70%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R D+ YNQG + FFR R++ YQSTVFRTN+PPGPF + +SKV+ L+D  S+P LFD S V
Sbjct  29    RYDFHYNQGADAFFRTRMKNYQSTVFRTNVPPGPFNAPNSKVIVLVDAVSYPILFDNSKV  88

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +K + F GT+M ST   GGY++  ++  ++P H+ LK L    L+      +P F ++ +
Sbjct  89    DKENYFEGTFMSSTAFNGGYKVCGFLGTTDPKHSTLKGLFLSTLAKLHDKFIPIFISSIS  148

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLY-GVDPMRTKLRLDAPKLIGKWVLFN  539
             E+F +LE EL+  G +  N  +D  +F FL R    G  P  T L    PK + KWV F 
Sbjct  149   ELFTSLEKELSEKGSSYFNPISDNLSFEFLFRLFCEGRSPTDTSLGTGGPKAVDKWVFFQ  208

Query  540   LHPVLSLGL---PKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P++SLG+   P  +ED +LHTF LP   VK D+Q+LY  FY N  +ILD  E LGV R
Sbjct  209   LAPLISLGIKFVPNFLEDLVLHTFPLPYFPVKSDHQKLYNAFYNNMGSILDEAEKLGVKR  268

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHN VF   FNS+GGMK+FFP ++KW+G AG+SLH++LA EIR+ VK  GG +T A 
Sbjct  269   DEACHNYVFLAGFNSYGGMKVFFPALIKWVGTAGLSLHSRLANEIRTTVKTEGG-VTFAA  327

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L+KS VYE+ R++PPVP Q  +A++DIVI SHDA F VK+ E++FG+QP AT+DP
Sbjct  328   LEKMTLVKSVVYETLRMDPPVPFQTVKARKDIVITSHDASFLVKKDELIFGYQPLATRDP  387

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             K+F   +EF   RFVG+ G+ LLK+V WSNG+ET++PTVNDKQC GKD ++L+ R+ LVE
Sbjct  388   KVFKNPEEFNADRFVGD-GEKLLKYVYWSNGKETDDPTVNDKQCPGKDLIVLLGRIFLVE  446

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             LFLRYD+F+IE G   LG+ VT  S+ +AT
Sbjct  447   LFLRYDTFEIEFGKLLLGSKVTFKSVTKAT  476



>ref|XP_007041376.1| Fatty acid hydroperoxide lyase 2 [Theobroma cacao]
 gb|EOX97207.1| Fatty acid hydroperoxide lyase 2 [Theobroma cacao]
Length=481

 Score =   457 bits (1177),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 235/450 (52%), Positives = 319/450 (71%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+ YFY +GR++FF  RIQK+QSTVFR NMPPGPFISS ++V+CLLD  SFP LFD S V
Sbjct  32    RLAYFYYEGRDKFFENRIQKHQSTVFRINMPPGPFISSSAQVICLLDAISFPVLFDSSKV  91

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRDV  GT++PS   +GG+R+ +Y+DPSEP H  LK+     L+ R ++ +P F    +
Sbjct  92    EKRDVLDGTFLPSLAYSGGHRVCAYLDPSEPKHTSLKSFFLATLAARHNNFIPLFRTGLS  151

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F+ LE +++   +A  N   D  +FN++ R L   +P  T++    PKL+ KW+L  L
Sbjct  152   ELFNELEAKISSKKEAYFNTLCDTMSFNYVFRLLCDKNPSETRIGSKGPKLVDKWLLCQL  211

Query  543   HPVLSLGLPKQ----IEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
              P+ SLGL       IED LL TF  P  LVK DY++LY+ F E  +++LD  E  G+ R
Sbjct  212   APLGSLGLLPNFLCLIEDLLLRTFTFPFFLVKSDYKKLYDAFSEFGSSVLDEAEKFGIER  271

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF   FN++GGMK+ FP ++KW+  AG  LH +LA EIR+V KA GG ++ + 
Sbjct  272   DEACHNLVFLAGFNAYGGMKVLFPGLIKWVALAGEKLHKRLADEIRTVAKAEGG-VSFSA  330

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L KS VYE  RI+PPVP QY +AK D+V++SHDA F++K+GEMLFG+QPFAT+DP
Sbjct  331   LDKMVLTKSVVYEFLRIDPPVPFQYAKAKADLVVQSHDAAFEIKKGEMLFGYQPFATRDP  390

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             K+F+  +EF+  RFVG+ G+ LLK+V WSNGRETE  T  +KQCAGK+ VML+ RL+LVE
Sbjct  391   KVFENPEEFVADRFVGD-GEKLLKYVYWSNGRETEECTAENKQCAGKNLVMLLCRLLLVE  449

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             LF RYD+F++E GM    ASVT  SL +A+
Sbjct  450   LFRRYDTFEVEAGMFMFAASVTFKSLTKAS  479



>emb|CAB86383.1| allene oxide synthase [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   457 bits (1176),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 232/447 (52%), Positives = 324/447 (72%), Gaps = 1/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D++Y QG++++F  R++KY STV R N+PPGPF++ D +VV +LD KSFP LFDV+ V
Sbjct  34    RLDFYYFQGQDKYFESRVEKYGSTVVRINVPPGPFMARDPRVVAVLDAKSFPVLFDVTKV  93

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+++FTGTYMPST LTGG+ + SY+DPSEP H K+K L+F LL+ R+   +P F + ++
Sbjct  94    EKKNLFTGTYMPSTSLTGGFPVCSYLDPSEPTHTKVKQLLFSLLASRKDAFIPAFRSHFS  153

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +  T+E++L  +GK+  N  ND  +F F+    +GV P  + L    P    KW++F L
Sbjct  154   SLLATVESQLLLSGKSNFNTLNDATSFEFIGDGYFGVLPSASDLGTTGPAKAAKWLIFQL  213

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+++LGLP  +E+PLLHT  LPP LV  DY+ LY++F+  +T  LD  E LG+ R+EAC
Sbjct  214   HPLVTLGLPMILEEPLLHTVHLPPFLVSGDYKALYKYFFAAATKALDTAEGLGLKRDEAC  273

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FAT FNS+GG+K+  P +L  I  +G   H +L  EIR+ V   GGK+T+  +E+M
Sbjct  274   HNLLFATVFNSYGGLKVLLPGILARIADSGEKFHKKLVTEIRAAVAEAGGKVTIEALEKM  333

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             EL KS V+E+ R++P V  QYGRAK D+ IESHDA F VK+GEMLFG+QP ATKDP++F 
Sbjct  334   ELTKSAVWEALRLDPAVKFQYGRAKADMNIESHDAVFAVKKGEMLFGYQPCATKDPRVFG  393

Query  1083  -RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
               A+EF+  RFVG++G  LLK+V WSNGRETE+P+V++KQC GK+ V+LV RL++VELFL
Sbjct  394   PTAREFVGDRFVGKEGSKLLKYVYWSNGRETESPSVHNKQCPGKNLVVLVGRLLVVELFL  453

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             RYD+F  +VG+  LG  V  T + +AT
Sbjct  454   RYDTFTAKVGLDLLGTKVEFTGVTKAT  480



>gb|AGH32771.1| hydroperoxide lyase [Glycine max]
Length=478

 Score =   456 bits (1172),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 234/450 (52%), Positives = 307/450 (68%), Gaps = 5/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR++FF +RI+KY STV RTNMPPGPFISS+ +V+ LLDG SFP LFD S V
Sbjct  28    RHDYFYNQGRDKFFAERIKKYNSTVIRTNMPPGPFISSNPRVIALLDGVSFPILFDNSKV  87

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +KRDV  GT+MPST  TGGYR  ++ D +EP+HA LK      L+ +    LP F N  +
Sbjct  88    DKRDVLDGTFMPSTSFTGGYRACAFQDTTEPSHALLKRFYLNFLASKHETFLPLFRNNLS  147

Query  363   EMFDTLEnelagngkagl-naanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
             + F  LE++LAG       N++   A FNFL R L   DP  T +  D P L+  W+   
Sbjct  148   DHFSDLEDKLAGKSGKASFNSSVGSATFNFLFRLLSDKDPSETIIGSDGPSLVQTWLAAQ  207

Query  540   LHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+ +LGLP+    +ED L+ +   P   VK  Y++LYE      TAILD  E +G+ R
Sbjct  208   LAPLATLGLPRIFNYVEDFLIRSIPFPAWTVKSSYKKLYEGLSTAGTAILDEAERVGIKR  267

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF   FN+ GG+   FP ++KW+G AG  LH QLA+EIR+VVK  GG +++  
Sbjct  268   DEACHNLVFMLSFNAQGGLVNQFPILIKWLGLAGEGLHKQLAEEIRTVVKDEGG-VSLRA  326

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             ++QM L KS VYE  RIEP VP QY +A+ D+V+ESHDA +++KEGEM+FG+QPFATKDP
Sbjct  327   LDQMTLTKSVVYEVLRIEPAVPFQYAKAREDLVVESHDAAYEIKEGEMIFGYQPFATKDP  386

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             KIF+ A++F+ HRF+G  G+ LL+HVLWSNG +TE PT +DKQC  K+ V+L+ RL LVE
Sbjct  387   KIFENAEDFVAHRFLGHDGERLLRHVLWSNGPQTEEPTPDDKQCPAKNLVVLMCRLYLVE  446

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F  +     LG  VT+ SL +A+
Sbjct  447   FFLRYDTFTFDFKPVVLGPDVTIKSLAKAS  476



>ref|XP_009789831.1| PREDICTED: 9-divinyl ether synthase-like [Nicotiana sylvestris]
Length=476

 Score =   455 bits (1171),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 229/450 (51%), Positives = 312/450 (69%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R D+ YNQG + FFR R++ YQSTVFRTN+PPGPF + +SKV+ L+D  S+P LFD S V
Sbjct  29    RYDFHYNQGADAFFRTRMKNYQSTVFRTNVPPGPFNAPNSKVIVLVDAVSYPILFDNSKV  88

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +K + F GT+M ST   GGY++  ++  ++P H+ LK L    L+      +P F ++ +
Sbjct  89    DKENYFEGTFMSSTAFNGGYKVCGFLGTTDPKHSTLKGLFLSTLAKLHDKFIPIFISSIS  148

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLY-GVDPMRTKLRLDAPKLIGKWVLFN  539
             E+F +LE EL+  G +  N  +D  +F FL R    G  P  T L    PK + KWV F 
Sbjct  149   ELFTSLEKELSEKGSSYFNPISDNLSFEFLFRLFCEGRSPTDTSLGTGGPKAVDKWVFFQ  208

Query  540   LHPVLSLGL---PKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P++SLG+   P  +ED +LHTF LP   VK D+Q+LY  FY N  +ILD  E LGV R
Sbjct  209   LAPLISLGIKFVPNFLEDLVLHTFPLPYFPVKSDHQKLYNAFYNNMGSILDEAEKLGVKR  268

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHN VF   FNS+GGMK+FFP ++KW+G AG+SLH++LA EIR+ VK  GG +T A 
Sbjct  269   DEACHNFVFLAGFNSYGGMKVFFPALIKWVGTAGLSLHSRLANEIRTTVKTEGG-VTFAA  327

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L+KS VYE+ R++PPVP Q  +A++DIVI SHDA F VK+ E++FG+QP AT+DP
Sbjct  328   LEKMTLVKSVVYETLRMDPPVPFQTVKARKDIVITSHDASFLVKKDELIFGYQPLATRDP  387

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             K+F   +EF   RFVG+ G+ LLK+V WSNG+ET++PTVNDKQC GKD ++L+ R+ LVE
Sbjct  388   KVFKNPEEFNADRFVGD-GEKLLKYVYWSNGKETDDPTVNDKQCPGKDLIVLLGRIFLVE  446

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F+IE G   LG+ VT  S+ ++T
Sbjct  447   FFLRYDTFEIEFGKLLLGSKVTFKSVTKST  476



>dbj|BAJ78218.1| 9/13-hydroperoxide lyase [Lotus japonicus]
Length=482

 Score =   456 bits (1172),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 237/451 (53%), Positives = 303/451 (67%), Gaps = 7/451 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFY+QGR+ FF  RI+K  STVFRTNMPPGPFISSD +VV LLDG SFP LFD   V
Sbjct  32    RHDYFYHQGRDAFFATRIKKNNSTVFRTNMPPGPFISSDPRVVALLDGASFPILFDNDKV  91

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR+V  GT+MP+T  TGG+R+ +Y+D +EP HA LK      L  R+   +P F    +
Sbjct  92    EKRNVLDGTFMPTTSFTGGHRVCAYLDTAEPQHAALKRFFLGFLLSRKDTFVPLFRTTLS  151

Query  363   EMFDTLEnelagngkagl-naanDQAAFNFLARSLY-GVDPMRTKLRLDAPKLIGKWVLF  536
             E F  +E++L+        N     A+FNF+ R L    DP  TKL  + PKL   W+LF
Sbjct  152   ETFIEIEDQLSRKTGTAGFNDVFATASFNFMFRLLCDNKDPSETKLGSEGPKLFDTWLLF  211

Query  537   NLHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVS  707
              L P+ +LG PK    +ED LL T   P       Y++LYE F  ++  +LD  E  G+ 
Sbjct  212   QLAPLATLGPPKIFNYLEDILLRTIPFPSWFTSSGYKKLYEAFSTSAVKVLDEAEQAGLK  271

Query  708   REEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMA  887
             R EACHNLVF   FN++GG+K  FP ++KW+G  G  LH +LA EIRSVVK  GG +T+ 
Sbjct  272   RSEACHNLVFMAGFNAYGGLKNQFPVVIKWVGLGGKKLHEELASEIRSVVKEEGG-VTIQ  330

Query  888   GMEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKD  1067
              +E+M L+KS VYE  RIEP VP QY +A+ D+VI SHDA F+VK+GEMLFGFQPFATKD
Sbjct  331   SLEKMSLLKSVVYEVLRIEPTVPYQYAKAREDLVIHSHDASFEVKKGEMLFGFQPFATKD  390

Query  1068  PKIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLV  1247
             P+IFD  +EF+P RF GE G+ LLKHVLW NG+ETE P+  +KQCAG++ V+L+ RL LV
Sbjct  391   PRIFDDPEEFLPRRFEGE-GEKLLKHVLWGNGKETEEPSPGNKQCAGRNLVVLMCRLFLV  449

Query  1248  ELFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             E FLRYD+F+ E   S  G +VT+ SL +A+
Sbjct  450   EFFLRYDTFEFEFKSSAFGPAVTIKSLTKAS  480



>emb|CAB86384.1| allene oxide synthase [Hordeum vulgare subsp. vulgare]
Length=480

 Score =   455 bits (1171),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 233/447 (52%), Positives = 324/447 (72%), Gaps = 2/447 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D++Y QG  ++F  R++K+ STV R N+PPGPF++ D +VV +LD KSFP LFDV  V
Sbjct  29    RLDFYYFQGEAKYFESRVEKHGSTVLRINVPPGPFMARDPRVVAVLDAKSFPVLFDVDKV  88

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+++FTGTYMPST LTGG+R+ +Y+DPSEP H K+K L+F LL+ R+  ++P F + ++
Sbjct  89    EKKNLFTGTYMPSTSLTGGFRVCAYLDPSEPTHTKVKQLLFSLLASRKDAVIPAFRSHFS  148

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +  T+E++L  +GK+  N  ND  +F F+A + +GV P  + L    P    KW++F L
Sbjct  149   SLLATVESQLVLSGKSNFNTLNDFTSFEFIADTYFGVLPSASDLGTTGPAKAAKWLIFQL  208

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+++ GLP  +E+PLLHT  LPP  V  DY+ LY++FY  +T  LD  E LG++R+EAC
Sbjct  209   HPLVTFGLPMILEEPLLHTVLLPPIFVSGDYKALYKYFYAAATKALDMAESLGLNRDEAC  268

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FAT FNS+GG+K+  P  L  I  AG   H +LA E+R+ V   GGK+T+  +E+M
Sbjct  269   HNLLFATVFNSYGGLKVMLPGFLGRIAEAGEKFHQRLAAEVRTAVADAGGKVTIEALEKM  328

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF-  1079
             EL KS V+E+ R+EPPV  QYGRAK D+ IESHDA F V++GEMLFG+QP ATKDP++F 
Sbjct  329   ELTKSAVWEALRLEPPVKFQYGRAKVDMNIESHDAVFAVQKGEMLFGYQPCATKDPRVFG  388

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
               A+EF+  RFVGE G  LL++V WSNGRETE+P+V++KQC GK+ V+LV RL++VELFL
Sbjct  389   STAREFVGDRFVGE-GSKLLQYVYWSNGRETESPSVDNKQCPGKNLVVLVGRLLVVELFL  447

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             RYD+F  +VG+  LG  V  T + +AT
Sbjct  448   RYDTFTADVGVDLLGPKVEFTGVTKAT  474



>gb|KCW62912.1| hypothetical protein EUGRSUZ_G00504 [Eucalyptus grandis]
Length=458

 Score =   454 bits (1168),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 231/450 (51%), Positives = 309/450 (69%), Gaps = 26/450 (6%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY++G +EFFR R+QKYQSTVFR+NM PGPF++ + KVV LLD  SFP LFD S V
Sbjct  29    RLDYFYHEGTDEFFRTRMQKYQSTVFRSNMVPGPFMARNPKVVVLLDAISFPILFDTSKV  88

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+DVF GTYMPS   TGGYR+ +Y+DPSEP HA  K L    L+ R +  +P + ++ +
Sbjct  89    EKKDVFVGTYMPSINFTGGYRVCAYLDPSEPKHAIFKGLFLSTLATRHNKFIPLYRSSLS  148

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLD-APKLIGKWVLFN  539
             ++F  LE+E +  GK   N   ++ +F+FLA      +P  T L  D   K    W+ F 
Sbjct  149   QLFIELEDEFSSKGKVYFNDYCNKMSFSFLANLFCDRNPSSTILATDKVTKFFDSWLFFQ  208

Query  540   LHPVLSLGLPKQI---EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+++LGLPK +   ED +LHTF LP  L+K DY++ YE F E + +ILD  E LG+ R
Sbjct  209   LAPLMTLGLPKILNFLEDIVLHTFPLPSLLLKCDYKKFYEVFNEYAKSILDEAESLGIKR  268

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF  CFNS+GGMK   P ++KW+G AG  L  +LA+EIR+V            
Sbjct  269   DEACHNLVFLVCFNSYGGMKTTLPALIKWVGLAGEELQRRLAEEIRTV------------  316

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
               +M L KS  +E+ R++PPV  QYG AK D+VI +HDA F++K+GEM+FG+QPFATKDP
Sbjct  317   --KMSLTKSVAWEALRVKPPVAFQYGHAKEDLVIHNHDAAFEIKKGEMIFGYQPFATKDP  374

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             +IF+R +EF+  RFVGE+G+ LLK+V WSNGRE ++PTV +KQC  K+ V+L+SR+MLVE
Sbjct  375   RIFERPEEFVGDRFVGEEGEKLLKYVYWSNGREIDDPTVGNKQCPAKNLVVLLSRVMLVE  434

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F IE G        T TS+ +AT
Sbjct  435   FFLRYDTFTIEAG--------TFTSMSKAT  456



>ref|XP_003537908.1| PREDICTED: allene oxide synthase, chloroplastic-like [Glycine 
max]
Length=478

 Score =   454 bits (1169),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 233/450 (52%), Positives = 307/450 (68%), Gaps = 5/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR++FF +RI+KY STV RTNMPPGPFISS+ +V+ LLDG SFP LFD S V
Sbjct  28    RHDYFYNQGRDKFFAERIKKYNSTVIRTNMPPGPFISSNPRVIALLDGVSFPILFDNSKV  87

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +KRDV  GT+MPST  TGGYR  ++ D +EP+HA LK      L+ +    LP F N  +
Sbjct  88    DKRDVLDGTFMPSTSFTGGYRACAFQDTTEPSHALLKRFYLNFLASKHETFLPLFRNNLS  147

Query  363   EMFDTLEnelagngkagl-naanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
             + F  LE++LAG       N++   A FNFL R L   DP  T +  D P L+  W+   
Sbjct  148   DHFSDLEDKLAGKSGKASFNSSVGSATFNFLFRLLSDKDPSETIIGSDGPSLVQTWLAAQ  207

Query  540   LHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+ +LGLP+    +ED L+ +   P   VK  Y++LYE      TAILD  E +G+ R
Sbjct  208   LAPLATLGLPRIFNYVEDFLIRSIPFPAWTVKSSYKKLYEGLSTAGTAILDEAERVGIKR  267

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF   FN+ GG+   FP ++KW+G AG  LH QLA+EIR+VVK  GG +++  
Sbjct  268   DEACHNLVFMLSFNAQGGLVNQFPILIKWLGLAGEGLHKQLAEEIRTVVKDEGG-VSLRA  326

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             ++QM L KS VYE  RIEP VP QY +A+ D+V+ESHDA +++K+GEM+FG+QPFATKDP
Sbjct  327   LDQMTLTKSVVYEVLRIEPAVPFQYAKAREDLVVESHDAAYEIKKGEMIFGYQPFATKDP  386

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             KIF+ A++F+ HRF+G  G+ LL+HVLWSNG +TE PT +DKQC  K+ V+L+ RL LVE
Sbjct  387   KIFENAEDFVAHRFLGHDGEKLLRHVLWSNGPQTEEPTPDDKQCPAKNLVVLMCRLYLVE  446

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F  +     LG  VT+ SL +A+
Sbjct  447   FFLRYDTFTFDFKPVVLGPDVTIKSLAKAS  476



>ref|XP_007131886.1| hypothetical protein PHAVU_011G049600g [Phaseolus vulgaris]
 gb|ESW03880.1| hypothetical protein PHAVU_011G049600g [Phaseolus vulgaris]
Length=480

 Score =   454 bits (1169),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 229/451 (51%), Positives = 308/451 (68%), Gaps = 5/451 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFY+QGR++FF  RIQKY+STV RTNMPPGPFISS+ +V+ LLD  SFP LFD S V
Sbjct  31    RHDYFYHQGRDKFFATRIQKYKSTVIRTNMPPGPFISSNPRVIALLDAVSFPILFDNSKV  90

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +KRDV  GT+MPST   GGYR+ ++ D +EP+HA +K     LL+ +    +P F N  A
Sbjct  91    DKRDVLDGTFMPSTSFFGGYRVCAFQDTTEPSHALIKTFYLNLLASKHASFIPLFRNNLA  150

Query  363   EMFDTLEnelagngkagl-naanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
             E F  LE++LAG       N +   A+FNFL R L G DP  T +  D P L+  W+   
Sbjct  151   EHFADLEDKLAGKSSKVSFNTSVGSASFNFLFRLLTGQDPTSTVIGSDGPSLVTTWLAAQ  210

Query  540   LHPVLSLGLP---KQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+ +LGLP     +ED L+ T   P   VK  Y++LY  F    +++LD  E LG+ R
Sbjct  211   LAPLATLGLPWIFNYVEDILIRTLPFPAWTVKSSYKKLYNGFASAGSSVLDEAERLGIKR  270

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF   FN+ GG    FP ++KW+G  G  LH QLA+EIRSVVK   G +++  
Sbjct  271   DEACHNLVFTLGFNAQGGFVNQFPILMKWVGLGGEGLHKQLAEEIRSVVKEENG-VSLQA  329

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L KS VYE+ RIEP VP QY +A++D+V+ESHDA +++K+GEM+FG+QPFATKDP
Sbjct  330   LDRMTLTKSVVYEAMRIEPAVPFQYAKARKDLVVESHDAAYEIKKGEMIFGYQPFATKDP  389

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             KIF++ +EF+ +RFVG  G+ LL HVLWSN RETE PT ++KQC  K+ V+L+ RL LVE
Sbjct  390   KIFEKPEEFVANRFVGPDGEKLLNHVLWSNARETEEPTPDNKQCPAKNLVVLLCRLYLVE  449

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRATF  1343
              FLRYD+F  +  ++ LG  +T+ SL +A++
Sbjct  450   FFLRYDTFSFDFKLAVLGPEITIKSLLKASY  480



>gb|AGI15963.1| hydroperoxide lyase [Glycine max]
Length=478

 Score =   453 bits (1166),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 235/450 (52%), Positives = 309/450 (69%), Gaps = 5/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR++FF +RI+KY STV RTNMPPGPFISS+ +V+ LLDG SFPTLFD S V
Sbjct  28    RHDYFYNQGRDKFFAERIKKYNSTVIRTNMPPGPFISSNPRVIALLDGVSFPTLFDNSKV  87

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +KRDV  GT+MPST  TGGYR  ++ D +EP+HA LK      L+ +    LP F N  +
Sbjct  88    DKRDVLDGTFMPSTSFTGGYRACAFQDTTEPSHALLKRFYLNFLASKHETFLPLFRNNLS  147

Query  363   EMFDTLEnelagn-gkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
             + F  LE++LAG   KA  N++   A FNFL R L   DP  T +  D P L+  W+   
Sbjct  148   DHFSDLEDKLAGKPDKASFNSSVGSATFNFLFRLLSDKDPSETIIGSDGPSLVQTWLAAQ  207

Query  540   LHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+ +LGLP+    +ED L+ +   P   VK  Y++LYE      TAILD    +G+ R
Sbjct  208   LAPLATLGLPRIFNYVEDFLIRSIPFPAWTVKSSYKKLYEGLSTAGTAILDEAGRVGIKR  267

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF   FN+ GG+   FP ++KW+G AG  LH QLA+EIR+VVK  GG +++  
Sbjct  268   DEACHNLVFMLSFNAQGGLVNQFPILIKWLGLAGEGLHKQLAEEIRTVVKDEGG-VSLRA  326

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             ++QM L KS VYE  RIEP VP QY +A+ D+V+ESHDA +++K+GEM+FG+QPFATKDP
Sbjct  327   LDQMTLTKSVVYEVLRIEPAVPFQYAKAREDLVVESHDAAYEIKKGEMIFGYQPFATKDP  386

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             KIF+ A++F+ HRF+G  G+ LL+HVLWSNG +TE PT +DKQC  K+ V+L+ RL LVE
Sbjct  387   KIFENAEDFVAHRFLGHDGEKLLRHVLWSNGPQTEEPTPDDKQCPAKNLVVLMCRLYLVE  446

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F  +     LG  VT+ SL +A+
Sbjct  447   FFLRYDTFTFDFKPVVLGPDVTIKSLAKAS  476



>emb|CDO97109.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   452 bits (1164),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 236/449 (53%), Positives = 322/449 (72%), Gaps = 6/449 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DY+YNQG +EFF+ R+QKY STVFRTN+PPGPF++ + KVV +LD  SFP LFD S V
Sbjct  37    RRDYYYNQGTDEFFKSRMQKYNSTVFRTNVPPGPFMAKNPKVVAVLDAVSFPILFDSSKV  96

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK++V  GT+MPST+ TGGYR+ +++D  EP+HA +K      L    +  +P F ++ +
Sbjct  97    EKKNVLDGTFMPSTDFTGGYRVCAFLDTREPSHAAVKGFFSSQLGKLHNKFIPTFRSSVS  156

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLY-GVDPMRTKLRLDAPKLIGKWVLFN  539
             E+F  LE+EL   GKA  N  +D+ +F+F+ R      +P  T +    PK   KW+   
Sbjct  157   ELFANLEDELDKEGKANFNDHSDKISFDFIFRLFCDNKNPDETGVGSSGPKSFDKWLFLM  216

Query  540   LHPVLSLGL---PKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             LHP+++LGL   P  +ED LLHTF LP   VK DYQ+L++ F +  + ILD  E  G++R
Sbjct  217   LHPLITLGLKFVPSFVEDFLLHTFPLPFLFVKSDYQKLHDAFDKYGSGILDESEKYGITR  276

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF   F+++GG K+ FP ++KW+G AG  LH QLA EIR+VVK  GG +T++ 
Sbjct  277   DEACHNLVFLAGFSAYGGAKVLFPALIKWVGAAGEDLHRQLAHEIRTVVKEEGG-VTVSA  335

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             + +M L KS VYE+ RIEPPVP QYG+A+ D+VI SHD+ F +++GEM+FG+QPFATKDP
Sbjct  336   LNKMSLTKSVVYEALRIEPPVPFQYGKAREDVVISSHDSSFLIEKGEMIFGYQPFATKDP  395

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             K+FD  +EF+  RF+G+ G+ LLK+V WSNGRET+NPTV+DKQC GKD V+L+S+L+LVE
Sbjct  396   KVFDNPEEFVGDRFLGD-GERLLKYVYWSNGRETDNPTVDDKQCPGKDLVVLLSKLLLVE  454

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRA  1337
             LFLRYD+F +E     LG  VT+TSL +A
Sbjct  455   LFLRYDTFSVEAATILLGPLVTVTSLTKA  483



>ref|XP_009789760.1| PREDICTED: 9-divinyl ether synthase-like [Nicotiana sylvestris]
Length=475

 Score =   452 bits (1163),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 227/449 (51%), Positives = 313/449 (70%), Gaps = 5/449 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R D+ YNQG + FFR R+Q Y+STV+R N+PPGPF +  SK + L+D  SFP LFD S V
Sbjct  28    RFDFHYNQGTDGFFRSRMQSYKSTVYRANVPPGPFNAPKSKAIVLVDAVSFPILFDNSKV  87

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +K + F GT+MPST+ TGGYR+  ++D SEP HA LK L    L++  +  +P F ++ +
Sbjct  88    DKTNYFDGTFMPSTDFTGGYRLCPFLDTSEPKHATLKGLFLSTLANLHNRFIPLFLSSMS  147

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F  LE+EL+  G+A  N  +D  AF+FL R      P  T L  D P  + KWV F L
Sbjct  148   ELFTHLEHELSDKGEAYFNTLSDDMAFDFLFRLFCEKSPSETSLGSDGPTFLNKWVFFQL  207

Query  543   HPVLSLGL---PKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P++SLGL   P  IED +LHTF LP   +K DY+++++ FY++  +ILD  E LG+ R+
Sbjct  208   APLISLGLKHVPNFIEDLVLHTFPLPFFPLKSDYKKIFDVFYKSMGSILDEAEKLGLKRD  267

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHN +F   FNS+GGMK+FFP +++W+G AG SLH +L  EIR+ VK  GG +T + +
Sbjct  268   EACHNFIFLAGFNSYGGMKVFFPALIRWVGAAGESLHRRLTDEIRTAVKEEGG-VTFSAL  326

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
              +M L KS VYE+ RIEPPVP Q  +A+ D++I SHD+ F +K+ E++FG+QP ATKDP 
Sbjct  327   NRMSLTKSVVYETLRIEPPVPFQTEKAREDVIIHSHDSSFLIKKDEIIFGYQPLATKDPM  386

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             IFD  +EFI  RFVG+K + L+K+V WSNG+E+++ TV+DKQC GK+ V+L+ RLMLVE 
Sbjct  387   IFDNPEEFIADRFVGDK-EELIKYVYWSNGKESDDSTVDDKQCPGKNLVVLLGRLMLVEF  445

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             FLRYD+F+IE G   LG+ VT  S+ +AT
Sbjct  446   FLRYDTFEIEFGRLLLGSKVTFKSVTKAT  474



>gb|AAF64041.1|AF229811_1 fatty acid hydroperoxide lyase [Cucumis sativus]
Length=478

 Score =   452 bits (1163),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 232/450 (52%), Positives = 307/450 (68%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFY QGR+EFFR RI KY STVF  NMPPGPFISSDS+VV LLD  SFP LFD + V
Sbjct  28    RYDYFYFQGRDEFFRSRITKYNSTVFHANMPPGPFISSDSRVVVLLDALSFPILFDTTKV  87

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR++  GTYMPS   TGG R  +Y+DPSE  H  LK L    L+      +P F ++ +
Sbjct  88    EKRNILDGTYMPSLSFTGGIRTCAYLDPSETEHTVLKRLFLSFLASHHDRFIPLFRSSLS  147

Query  363   EMFDTLEnelagngkagl-naanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
             EMF  LE++LA   K    N+ +D  +F+++ R      P  T L  D P +   W+   
Sbjct  148   EMFVKLEDKLADKNKIADFNSISDAVSFDYVFRLFSDGTPDST-LAADGPGMFDLWLGLQ  206

Query  540   LHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+ S+GLPK     ED ++HT  LP   VK  Y++LY+ FY +S + LD  E  G+ R
Sbjct  207   LAPLASIGLPKIFSVFEDLIIHTIPLPFFPVKSRYRKLYKAFYSSSGSFLDEAEKQGIDR  266

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             E+ACHNLVF   FN++GGMK+ FP +LKW+G  G  LH +LA+E+R+ VK  GG +T + 
Sbjct  267   EKACHNLVFLAGFNAYGGMKVLFPTILKWVGTGGEDLHRKLAEEVRTTVKEEGG-LTFSA  325

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L+KS VYE+ RIEPPVP QYG+AK DIVI+SHD+ F++K+GE +FG+QPFATKDP
Sbjct  326   LEKMSLLKSVVYEALRIEPPVPFQYGKAKEDIVIQSHDSCFKIKKGETIFGYQPFATKDP  385

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             KIF  +++F+  RFVGE+G+ LLK+V WSN RET  PT  +KQC GK+ V+++ R+++VE
Sbjct  386   KIFKDSEKFVGDRFVGEEGEKLLKYVYWSNERETVEPTAENKQCPGKNLVVMMGRIIVVE  445

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F ++V    LG +V   SL RAT
Sbjct  446   FFLRYDTFTVDVADLALGPAVKFKSLTRAT  475



>gb|AFG26687.1| cytochrome P450 CYP74C, partial [Glycine max]
Length=476

 Score =   452 bits (1162),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 233/450 (52%), Positives = 309/450 (69%), Gaps = 7/450 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR++FF +RI+KY STV RTNMPPGPFISS+ +V+ LLDG SFP LFD S V
Sbjct  28    RHDYFYNQGRDKFFAERIKKYNSTVIRTNMPPGPFISSNPRVIALLDGVSFPILFDNSKV  87

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +KRDV  GT+MPST  TGGYR  ++ D +EP+HA LK      L+ +    LP F N  +
Sbjct  88    DKRDVLDGTFMPSTSFTGGYRACAFQDTTEPSHALLKRFYLNFLASKHETFLPLFRNNLS  147

Query  363   EMFDTLEnelagngkagl-naanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
             + F  LE++LAG       N++   A FNFL R L   DP  T +  D P L+  W+   
Sbjct  148   DHFSDLEDKLAGKSGKASFNSSVGSATFNFLFRLLSDKDPSETIIGSDGPSLVQTWLAAQ  207

Query  540   LHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+ +LGLP+    +ED L+ +   P   VK  Y++LYE    ++TAILD  E +G+ R
Sbjct  208   LAPLATLGLPRIFNYVEDFLIRSIPFPAWTVKSSYKKLYEGL--STTAILDEAERVGIKR  265

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF   FN+ GG+   FP ++KW+G AG  LH QLA+EIR+VVK  GG +++  
Sbjct  266   DEACHNLVFMLSFNAQGGLVNQFPILIKWLGLAGEGLHKQLAEEIRTVVKDEGG-VSLRA  324

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             ++QM L KS VYE  RIEP VP QY +A+ D+V+ESHDA +++K+GEM+FG+QPFATKDP
Sbjct  325   LDQMTLTKSVVYEVLRIEPAVPFQYAKAREDLVVESHDAAYEIKKGEMIFGYQPFATKDP  384

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             KIF+ A++F+ HRF+G  G+ LL+HVLWSNG +TE PT +DKQC  K+ V+L+ RL LVE
Sbjct  385   KIFENAEDFVAHRFLGHDGEKLLRHVLWSNGPQTEEPTPDDKQCPAKNLVVLMCRLYLVE  444

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F  +     LG  VT+ SL +A+
Sbjct  445   FFLRYDTFTFDFKPVVLGPDVTIKSLAKAS  474



>ref|XP_009618647.1| PREDICTED: 9-divinyl ether synthase-like [Nicotiana tomentosiformis]
Length=480

 Score =   452 bits (1162),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 228/450 (51%), Positives = 311/450 (69%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R D+ YNQG + FFR R++ YQSTVFRTN+PPGPF + +SKV+ L+D  S+P LFD S V
Sbjct  32    RYDFHYNQGADAFFRTRMKNYQSTVFRTNVPPGPFNAPNSKVIVLVDAVSYPILFDNSKV  91

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +K + F GT+M ST   GGY++  ++  ++P H+ LK L    L+      +P F ++ +
Sbjct  92    DKENYFEGTFMSSTAFNGGYKVCGFLGTTDPKHSTLKGLFLSTLAKLHDKFIPIFISSIS  151

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLY-GVDPMRTKLRLDAPKLIGKWVLFN  539
             E+F +LE EL+ NG +  N  +D  +F FL R    G  P  T L    PK + KWV F 
Sbjct  152   ELFTSLEKELSENGSSYFNPLSDNLSFEFLFRLFCEGRSPTDTSLGTGGPKSVDKWVFFQ  211

Query  540   LHPVLSLGL---PKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P++SLG+   P  +ED +LHTF LP   VK D+Q+LY  FY N  +ILD  E LGV R
Sbjct  212   LAPLISLGIKFVPNFLEDLVLHTFPLPYFPVKSDHQKLYNAFYNNMGSILDEAEKLGVKR  271

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHN+VF   FNS+GGMK+FFP ++KW+G AG+SLH++L  EIR+ VK  GG +T A 
Sbjct  272   DEACHNIVFLAGFNSYGGMKVFFPALIKWVGTAGLSLHSKLENEIRTTVKTEGG-VTFAA  330

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L+KS VYE+ R++PPVP Q  +A++D VI SHDA F VK+ E++FG+QP AT+DP
Sbjct  331   LEKMTLVKSVVYETLRMDPPVPFQTVKARKDTVITSHDASFLVKKDELIFGYQPLATRDP  390

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             K+F   +EF   RFVG+ G+  LK+V WSNG+ET++PTVNDKQC GKD ++L+ R+ LVE
Sbjct  391   KVFKNPEEFNADRFVGD-GEKFLKYVYWSNGKETDDPTVNDKQCPGKDLIVLLGRIFLVE  449

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F+IE G   LG+ VT  S+ +AT
Sbjct  450   FFLRYDTFEIEFGKLLLGSKVTFKSVTKAT  479



>gb|ACZ28492.1| allene oxide synthase [Lemna paucicostata]
Length=479

 Score =   452 bits (1162),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 233/446 (52%), Positives = 321/446 (72%), Gaps = 3/446 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R++++ N+   +FF+ R+ +Y ST+ R N PPGPF++ + +VV LLDGKSFP LFD S V
Sbjct  33    RLEFYSNE--YQFFQSRVDRYGSTIVRLNAPPGPFMAKNPRVVALLDGKSFPVLFDTSKV  90

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK++VFTGTYMPST LTGGYR+ +Y+DPSEPNH K+K L+  +L+ R+ +++PEF +AY 
Sbjct  91    EKKNVFTGTYMPSTALTGGYRVCAYLDPSEPNHTKIKQLLLNILASRKDNVIPEFRSAYG  150

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++FD +E E+A +GK   N  ND  AF FL +  +GV P +T+L     K    W+L  L
Sbjct  151   KLFDDMEAEVAKSGKFVFNDHNDGTAFEFLGKLFFGVSPSKTELGPGGVKNANLWLLAQL  210

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
              P+++LGLP+ +E+ LLHTF +PP LV+  YQ LY++    +T  L   E LG+SREEA 
Sbjct  211   CPLMTLGLPQLLEELLLHTFPIPPFLVQSQYQALYKYISSAATDALKMAENLGLSREEAI  270

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNLVFATCFNS GG+K+ FP +L++I +AG  L T L  ++RS V   GG++T+  +E+M
Sbjct  271   HNLVFATCFNSLGGVKVLFPGILRYIAQAGKILQTLLIADVRSAVLTTGGQLTVEALEKM  330

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD  1082
             +++KS VYES R++PPV  QYG  K+D VIESHD  ++VK GEMLFG+QPFAT+D KIF 
Sbjct  331   QVVKSVVYESLRLDPPVKYQYGVVKKDTVIESHDKSYKVKAGEMLFGYQPFATRDKKIFG  390

Query  1083  -RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFL  1259
               A +F+P RF GE+G  LL+ VLWSN  ET+NPT  DKQC GK+ ++L+SRL++ E FL
Sbjct  391   PDADKFVPLRFTGEQGAKLLQFVLWSNAPETQNPTPLDKQCPGKNLIVLISRLLVAEFFL  450

Query  1260  RYDSFDIEVGMSPLGASVTLTSLKRA  1337
             RYD F  E+G+ PL    T+TSL +A
Sbjct  451   RYDFFTAEIGVVPLAVKTTITSLTKA  476



>ref|NP_001274399.1| allene oxide synthase, chloroplastic-like [Cucumis sativus]
 ref|XP_004137004.1| PREDICTED: allene oxide synthase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004166591.1| PREDICTED: allene oxide synthase, chloroplastic-like [Cucumis 
sativus]
 gb|AGZ95025.1| hydroperoxide lyase [Cucumis sativus]
 gb|AHC08715.1| hydroperoxide lyase [Cucumis sativus]
 gb|KGN43979.1| hypothetical protein Csa_7G075590 [Cucumis sativus]
Length=478

 Score =   451 bits (1161),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 233/450 (52%), Positives = 308/450 (68%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFY QGR+EFFR RI KY STVF  NMPPGPFISSDS+VV LLD  SFP LFD + V
Sbjct  28    RYDYFYFQGRDEFFRSRITKYNSTVFHANMPPGPFISSDSRVVVLLDALSFPILFDTTKV  87

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR++  GTYMPS   TGG R  +Y+DPSE  H  LK L    L+ R    +P F ++ +
Sbjct  88    EKRNILDGTYMPSLSFTGGIRTCAYLDPSETEHTVLKRLFLSFLASRHDRFIPLFRSSLS  147

Query  363   EMFDTLEnelagngkagl-naanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
             EMF  LE++LA   K    N+ +D  +F+++ R      P  T L  D P +   W+   
Sbjct  148   EMFVKLEDKLADKNKIADFNSISDAMSFDYVFRLFSDGTPDST-LAADGPGMFDLWLGLQ  206

Query  540   LHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+ S+GLPK     ED ++HT  LP   VK  Y++LY+ FY +S + LD  E  G+ R
Sbjct  207   LAPLASIGLPKIFSVFEDLIIHTIPLPFFPVKSRYRKLYKAFYSSSGSFLDEAEKQGIDR  266

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             E+ACHNLVF   FN++GGMK+ FP +LKW+G  G  LH +LA+E+R+ VK  GG +T + 
Sbjct  267   EKACHNLVFLAGFNAYGGMKVLFPTILKWVGTGGEDLHRKLAEEVRTTVKEEGG-LTFSA  325

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L+KS VYE+ RIEPPVP QYG+AK DIVI+SHD+ F++K+GE +FG+QPFATKDP
Sbjct  326   LEKMSLLKSVVYEALRIEPPVPFQYGKAKEDIVIQSHDSCFKIKKGETIFGYQPFATKDP  385

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             KIF  +++F+  RFVGE+G+ LLK+V WSN RET  PT  +KQC GK+ V+++ R+++VE
Sbjct  386   KIFKDSEKFVGDRFVGEEGEKLLKYVYWSNERETVEPTAENKQCPGKNLVVMMGRIIVVE  445

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F ++V    LG +V   SL RAT
Sbjct  446   FFLRYDTFTVDVADLALGPAVKFKSLTRAT  475



>gb|KHN06162.1| Allene oxide synthase, chloroplastic [Glycine soja]
Length=483

 Score =   451 bits (1161),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 234/455 (51%), Positives = 308/455 (68%), Gaps = 10/455 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR++FF +RI+KY STV RTNMPPGPFISS+ +V+ LLDG SFP LFD S V
Sbjct  28    RHDYFYNQGRDKFFAERIKKYNSTVIRTNMPPGPFISSNPRVIALLDGVSFPILFDNSKV  87

Query  183   EKRDVFTGTYMPSTELTG-----GYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEF  347
             +KRDV  GT+MPST  TG     GYR  ++ D +EP+HA LK      L+ +    LP F
Sbjct  88    DKRDVLDGTFMPSTSFTGASWAGGYRACAFQDTTEPSHALLKRFYLNFLASKHETFLPLF  147

Query  348   HNAYAEMFDTLEnelagngkagl-naanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGK  524
              N  ++ F  LE++LAG       N++ D A FNFL R L   DP  T +  D P L+  
Sbjct  148   RNNLSDHFSDLEDKLAGKSGKASFNSSVDSATFNFLFRLLSDKDPSETIIGSDGPSLVQT  207

Query  525   WVLFNLHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEI  695
             W+   L P+ +LGLP+    +ED L+ +   P   VK  Y++LYE      TAILD  E 
Sbjct  208   WLAAQLAPLATLGLPRIFNYVEDFLIRSIPFPAWTVKSSYKKLYEGLSTAGTAILDEAER  267

Query  696   LGVSREEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGK  875
             +G+ R+EACHNLVF   FN+ GG+   FP ++KW+G AG  LH QLA+EIR+VVK  GG 
Sbjct  268   VGIKRDEACHNLVFMLSFNAQGGLVNQFPILIKWLGLAGEGLHKQLAEEIRTVVKDEGG-  326

Query  876   ITMAGMEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPF  1055
             +++  ++QM L KS VYE  RIEP VP QY +A+ D+V+ESHDA +++K+GEM+FG+QPF
Sbjct  327   VSLRALDQMTLTKSVVYEVLRIEPAVPFQYAKAREDLVVESHDAAYEIKKGEMIFGYQPF  386

Query  1056  ATKDPKIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSR  1235
             ATKDPKIF+ A++F+ HRF+G  G+ LL+HVLWSNG +TE PT +DKQC  K+ V+L+ R
Sbjct  387   ATKDPKIFENAEDFVAHRFLGHDGEKLLRHVLWSNGPQTEEPTPDDKQCPAKNLVVLMCR  446

Query  1236  LMLVELFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             L LVE FLRYD+F  +     LG  VT+ SL +A+
Sbjct  447   LYLVEFFLRYDTFTFDFKPVVLGPDVTIKSLAKAS  481



>gb|ABA54984.1| allene oxide syntase [Solanum tuberosum]
Length=491

 Score =   451 bits (1160),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 224/450 (50%), Positives = 314/450 (70%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R D+ YNQG +EFFR R++K+ ST+FRTN+PPGPF + +SKVV L+D  S+P LFD S V
Sbjct  43    RYDFHYNQGADEFFRSRMEKHDSTIFRTNVPPGPFNARNSKVVVLVDAVSYPILFDNSQV  102

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +K + F GT+M S    GGY++  ++  ++P H  LK L    L+      +P F  +  
Sbjct  103   DKENYFEGTFMSSPSFNGGYKVCGFLGTTDPKHTTLKGLFLSTLTRLHDKFIPIFTTSIT  162

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLY-GVDPMRTKLRLDAPKLIGKWVLFN  539
             +MF +LE EL+  G +  N  +D  +F FL R    G +P+ T +  + PK++ KWV   
Sbjct  163   QMFTSLEKELSEKGTSYFNPISDNLSFEFLFRLFCEGKNPVDTSVGTNGPKIVDKWVFLQ  222

Query  540   LHPVLSLGL---PKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P++SLGL   P  +ED +LHTF LP  LVK D+Q+LY  FY +   ILD  E LGV R
Sbjct  223   LAPLISLGLKFVPNFLEDLVLHTFPLPYFLVKGDHQKLYNAFYNSMKDILDEAEKLGVKR  282

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             EEACHN +F   FNS+GGMK+FFP+++KWIG +G SLHT+L KEIR+ VK  GG +T++ 
Sbjct  283   EEACHNFIFLAGFNSYGGMKVFFPSLIKWIGTSGPSLHTRLVKEIRTAVKEAGG-VTLSA  341

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L+KS VYE+ R++PPVP Q  +A+++I++ +H+A F +K+ E++FG+QP ATKD 
Sbjct  342   IDKMPLVKSVVYETLRMDPPVPFQTVKARKNIIVSNHEASFLIKKDELIFGYQPLATKDS  401

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             K+F  A+EF P RFVG  G+ LLK+V WSNG+ET+NPTVNDKQC GKD ++L+ RL++VE
Sbjct  402   KVFKNAEEFNPDRFVG-YGEKLLKYVYWSNGKETDNPTVNDKQCPGKDLIVLLGRLLVVE  460

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              F+RYD+F+IE G   LG+ VT  SL +AT
Sbjct  461   FFMRYDTFEIEFGKLLLGSKVTFKSLTKAT  490



>emb|CAI30876.1| allene oxide synthase [Solanum tuberosum]
Length=491

 Score =   450 bits (1158),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 223/450 (50%), Positives = 314/450 (70%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R D+ YNQG +EFFR R++K+ ST+FRTN+PPGPF + +SKVV L+D  S+P LFD S V
Sbjct  43    RYDFHYNQGADEFFRSRMEKHDSTIFRTNVPPGPFNARNSKVVVLVDAVSYPILFDNSQV  102

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +K + F GT+M S    GGY++  ++  ++P H  LK L    L+      +P F  +  
Sbjct  103   DKENYFEGTFMSSPSFNGGYKVCGFLGTTDPKHTTLKGLFLSTLTRLHDKFIPIFTTSIT  162

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLY-GVDPMRTKLRLDAPKLIGKWVLFN  539
             +MF +LE EL+  G +  N  +D  +F FL R    G +P+ T +  + PK++ KWV   
Sbjct  163   QMFTSLEKELSEKGTSYFNPMSDNLSFEFLFRLFCEGKNPVDTSVGTNGPKIVDKWVFLQ  222

Query  540   LHPVLSLGL---PKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P++SLGL   P  +ED +LHTF LP  LVK D+Q+LY  FY +   ILD  E LGV R
Sbjct  223   LAPLISLGLKFVPNFLEDLVLHTFPLPYFLVKGDHQKLYNAFYNSMKDILDEAEKLGVKR  282

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             EEACHN +F   FNS+GGMK+FFP+++KWIG +G +LHT+L KEIR+ VK  GG +T++ 
Sbjct  283   EEACHNFIFLAGFNSYGGMKVFFPSLIKWIGTSGPTLHTRLVKEIRTAVKEAGG-VTLSA  341

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L+KS VYE+ R++PPVP Q  +A+++I++ +H+A F +K+ E++FG+QP ATKD 
Sbjct  342   IDKMPLVKSVVYETLRMDPPVPFQTVKARKNIIVSNHEASFLIKKDELIFGYQPLATKDS  401

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             K+F  A+EF P RFVG  G+ LLK+V WSNG+ET+NPTVNDKQC GKD ++L+ RL++VE
Sbjct  402   KVFKNAEEFNPDRFVG-YGEKLLKYVYWSNGKETDNPTVNDKQCPGKDLIVLLGRLLVVE  460

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              F+RYD+F+IE G   LG+ VT  SL +AT
Sbjct  461   FFMRYDTFEIEFGKLLLGSKVTFKSLTKAT  490



>gb|AFA28136.1| allene oxide synthase, partial [Triticum aestivum]
Length=423

 Score =   447 bits (1149),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 224/423 (53%), Positives = 311/423 (74%), Gaps = 1/423 (0%)
 Frame = +3

Query  6     IDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVVE  185
             +D++Y QG++++F  R+ KY STV R N+PPGPF++ D +VV +LD KSFP LFDV  VE
Sbjct  1     LDFYYFQGQDKYFESRVDKYDSTVVRINVPPGPFMARDPRVVAVLDAKSFPVLFDVDKVE  60

Query  186   KRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYAE  365
             K+++FTGTYMPST LTGG+R+ SY+DPSEP H K+K L+F LL+ R+   +P F + ++ 
Sbjct  61    KKNLFTGTYMPSTSLTGGFRVCSYLDPSEPTHTKVKQLLFSLLASRKDAFIPAFRSHFSS  120

Query  366   MFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNLH  545
             +  T+E++L  + K+  N  ND  +F F+  + +GV P  + L    P    KW++F LH
Sbjct  121   LLATVESQLVLSKKSNFNTLNDATSFEFIGDAYFGVLPSASDLGTTGPTKAAKWLIFQLH  180

Query  546   PVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEACH  725
             P+++LGLP  +E+PLLHT  LPP LV  DY+ LY++FY  +T  LD  E LG+ R+EACH
Sbjct  181   PLVTLGLPMILEEPLLHTVHLPPILVSGDYKALYKYFYAAATKALDTAEGLGLKRDEACH  240

Query  726   NLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQME  905
             NL+FAT FNS+GG+K+  P +L  I  AG   H +L  EIR+ V   GGK+T+  +E+ME
Sbjct  241   NLLFATVFNSYGGLKVLLPGILARIAGAGEKFHQKLVAEIRAAVADAGGKVTIEALEKME  300

Query  906   LMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF-D  1082
             L KS V+E+ R++PPV  QYGRAK D+ IESHDA F VK+GEMLFG+QP AT+DP++F  
Sbjct  301   LTKSAVWEALRLDPPVKFQYGRAKADMNIESHDAVFAVKKGEMLFGYQPCATRDPRVFGS  360

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
              A+EF+  RFVGE+G+ LL++V WSNGRETE+P+V++KQC GK+ V+LV RL++VELFLR
Sbjct  361   TAREFVGDRFVGEEGRKLLQYVYWSNGRETESPSVDNKQCPGKNLVVLVGRLLVVELFLR  420

Query  1263  YDS  1271
             YD+
Sbjct  421   YDT  423



>ref|XP_007153145.1| hypothetical protein PHAVU_003G010700g [Phaseolus vulgaris]
 gb|ESW25139.1| hypothetical protein PHAVU_003G010700g [Phaseolus vulgaris]
Length=509

 Score =   450 bits (1157),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 238/450 (53%), Positives = 318/450 (71%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R +YFY++GR+ FF  R++++ STV RTNMPPGPFI+SD +VV LLDG SFP LFD   V
Sbjct  60    RHNYFYHEGRDNFFAARVRRHNSTVIRTNMPPGPFIASDPRVVALLDGASFPILFDNQKV  119

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +K DV  GT+MPST+ TGG+R+ +Y+D +EPNH  +K      L+ R+  +LP F N   
Sbjct  120   QKLDVLDGTFMPSTKFTGGFRVCAYLDTAEPNHELIKGFFLQALARRKDAVLPLFRNCLG  179

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLY-GVDPMRTKLRLDAPKLIGKWVLFN  539
             E F  +E +++ N KA  N    QA+FNF+ R      DP +T L    PKL+  W+LF 
Sbjct  180   ESFAEIEEQMSKNKKADFNGVFSQASFNFIFRLFCDNKDPSQTNLASKGPKLVDTWLLFQ  239

Query  540   LHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+ +LGLPK    IED L+ T   P  + K  Y  LY+ F  ++TA+LD  + LG+ R
Sbjct  240   LAPLATLGLPKIFNYIEDFLIRTLPFPACITKSGYNSLYDAFKTHATALLDEAQKLGLDR  299

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHN+VF   FN++GG+K  FP +LKW+G AG  LH +LA+E+R VV A GG +T+  
Sbjct  300   DEACHNVVFTAGFNAYGGLKNQFPVLLKWVGLAGEKLHEELAREVRRVVNAEGG-VTLNA  358

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E+M L+KS VYE  RIEP VP QY RA+ D+V+ SHDA F+VK+GEMLFG+QPFATKDP
Sbjct  359   LEKMPLVKSVVYEMLRIEPAVPYQYARAREDLVVRSHDASFEVKKGEMLFGYQPFATKDP  418

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             +IF+ A+ F+  RFVGE G+ LLKHVLWSNG+ETE P+V++KQC GK+ V+L+ RL+LVE
Sbjct  419   RIFEDAEVFVARRFVGE-GEKLLKHVLWSNGKETEEPSVSNKQCPGKNLVVLLCRLLLVE  477

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             LFLRYD+F+ E   S  G SVT+TSL +A+
Sbjct  478   LFLRYDTFEFEFKQSGFGPSVTITSLTKAS  507



>gb|AFA28140.1| allene oxide synthase, partial [Triticum aestivum]
Length=431

 Score =   447 bits (1149),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 227/430 (53%), Positives = 311/430 (72%), Gaps = 1/430 (0%)
 Frame = +3

Query  42    FRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVVEKRDVFTGTYMPS  221
             F  R++KY STV R N+PPGPF++ D +VV +LD KSFP LFDV  VEK+++FTGTYMPS
Sbjct  1     FESRVEKYGSTVVRINVPPGPFMARDPRVVAVLDAKSFPVLFDVDKVEKKNLFTGTYMPS  60

Query  222   TELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYAEMFDTLEnelagn  401
             T LTGG+R+ SY+DPSEP H K+K L+F LL+ R+   +P F + ++ +  T+E++L  +
Sbjct  61    TSLTGGFRVCSYLDPSEPTHTKVKQLLFSLLASRKDAFIPAFRSHFSSLLATVESQLVLS  120

Query  402   gkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNLHPVLSLGLPKQIE  581
              K+  N  ND  +F F+  + +GV P  + L    P    KW++F LHP+++LGLP  +E
Sbjct  121   KKSNFNTLNDATSFEFIGDAYFGVLPSASDLGTTGPTKAAKWLIFQLHPLVTLGLPMILE  180

Query  582   DPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEACHNLVFATCFNSFG  761
             +PLLHT  LPP LV  DY+ LY++FY  +T  LD  E LG+ R+EACHNL+FAT FNS+G
Sbjct  181   EPLLHTVHLPPILVSGDYKALYKYFYAAATKALDTAEGLGLKRDEACHNLLFATVFNSYG  240

Query  762   GMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQMELMKSTVYESFRI  941
             G+K+  P +L  I  AG   H +L  EIR+ V   GGK+T+  +E+MEL KS V+E+ R+
Sbjct  241   GLKVLLPGILARIAGAGEKFHQKLVAEIRAAVADAGGKVTIEALEKMELTKSAVWEALRL  300

Query  942   EPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF-DRAQEFIPHRFVG  1118
             +PPV  QYGRAK D+ IESHDA F VK+GEMLFG+QP AT+DP++F   A+EF+  RFVG
Sbjct  301   DPPVKFQYGRAKADMNIESHDAVFAVKKGEMLFGYQPCATRDPRVFGSTAREFVGDRFVG  360

Query  1119  EKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLRYDSFDIEVGMSP  1298
             E+G+ LL++V WSNGRETE+P+V++KQC GK+ V+LV RL++VELFLRYD+F  +VG+  
Sbjct  361   EEGRKLLQYVYWSNGRETESPSVDNKQCPGKNLVVLVGRLLVVELFLRYDTFTADVGVDL  420

Query  1299  LGASVTLTSL  1328
             LG  V  T +
Sbjct  421   LGTKVEFTGV  430



>gb|ABI93819.1| fatty acid 9/13-hydroperoxide lyase [Solanum pennellii]
Length=488

 Score =   449 bits (1154),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 232/449 (52%), Positives = 317/449 (71%), Gaps = 8/449 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DY+YN G +EFFR + QKY STVF+TNMPPGPFI+ +SKV+ LLD K+FP LFD S V
Sbjct  44    RYDYYYNLGTDEFFRTKSQKYNSTVFKTNMPPGPFIAKNSKVIALLDSKTFPILFDNSKV  103

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK++V  GTYMPST+  GGYR  +++DPSEP HA+LK     ++S      +P F  + +
Sbjct  104   EKKNVLDGTYMPSTDFFGGYRPCAFLDPSEPKHARLKGFYLSIISKYHTQSIPIFETSVS  163

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +F  LENE++ NGKA  N  +D  +F+F+ R L          R   PK   KW+L  L
Sbjct  164   ALFQNLENEISKNGKANFNDISDAMSFDFVFRLL-----CDKTTRNVGPKYFDKWMLPQL  218

Query  543   HPVLSLGL---PKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+++LGL   P  +ED +LHTF LP  LVK  YQ+LY+ F E++ +IL+  E  G+ R+
Sbjct  219   VPLVTLGLKFVPNFLEDLILHTFPLPFCLVKSIYQKLYDAFSEHAGSILNEIEKSGIKRD  278

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNLVF   FN++GGMK+ FP+ +KW+   G SLHT+LA EIR+++K  GG IT++ +
Sbjct  279   EACHNLVFLAGFNAYGGMKVLFPSPIKWVASVGKSLHTRLANEIRTIIKEEGGSITLSAI  338

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
              +M L+KSTVYE  RIEPP+P QYG+AK DI+++SHD+ F +K+GEM+FG+Q FATKD K
Sbjct  339   NKMSLVKSTVYEVLRIEPPIPFQYGKAKEDIMVQSHDSNFLIKKGEMIFGYQTFATKDAK  398

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             IF+  +EFI  RF+G +G+ LLK+V WSN RET++PTV++KQC  KD V+L+ RL+LVE 
Sbjct  399   IFENPEEFIAERFMGSEGEKLLKYVYWSNARETDDPTVDNKQCPAKDLVVLLCRLLLVEF  458

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             F+RYD+F +E      G+SVT  +L + T
Sbjct  459   FMRYDTFTVESRKYLAGSSVTFKTLDKKT  487



>ref|NP_001234502.1| cytochrome P450 CYP74C4 [Solanum lycopersicum]
 gb|AAL86702.1|AF461042_1 cytochrome P450 CYP74C4 [Solanum lycopersicum]
Length=494

 Score =   449 bits (1154),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 224/448 (50%), Positives = 315/448 (70%), Gaps = 4/448 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DY+Y+ G +EFFR +  KY ST+FRTNMPPGPFI+ D KV+ LLD  SFP LFD S V
Sbjct  44    RYDYYYSLGADEFFRTKSLKYNSTIFRTNMPPGPFIAKDPKVIVLLDAISFPILFDCSKV  103

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK++V  GTYMPST+  GGYR  +++DPSEP+HA  K     ++S      +P F N+ +
Sbjct  104   EKKNVLDGTYMPSTDFFGGYRPCAFLDPSEPSHATHKGFYLSIISKLHTQFIPIFENSVS  163

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYG-VDPMRTKLRLDAPKLIGKWVLFN  539
              +F  LE +++ +GKA  N  +D  +F+F+ R L    +P+ TKL    PK    W+L  
Sbjct  164   LLFQNLEIQISKDGKANFNDISDAMSFDFVFRLLCNNTNPLDTKLGTTGPKCFDLWMLPQ  223

Query  540   LHPVLSLGL---PKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+++LGL   P  +ED +LHTF+LP  ++K  YQ+LY+ F E++ + LD  E  G+  
Sbjct  224   LAPLVTLGLKFVPNFLEDLMLHTFQLPFFIIKSKYQKLYDAFNEHAGSTLDDAEKSGIKG  283

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF   FN++GGMKI FP+++KW+   G SLHT LA EIR+++K  GG IT++ 
Sbjct  284   DEACHNLVFLAGFNAYGGMKILFPSLMKWVASGGKSLHTPLANEIRTIIKEEGGSITLSA  343

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             + +M L+KSTVYE  RIEPP+P QYG+AK DI+++SHD+ F +K+GEM+FG+Q FATKD 
Sbjct  344   INKMSLVKSTVYEVLRIEPPIPFQYGKAKEDIMVQSHDSNFLIKKGEMIFGYQTFATKDA  403

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             KIF+  +EFI  RF+G +G+ LLK+V WSN RET++PTV++KQCAG+D  +L+ RL+LVE
Sbjct  404   KIFENPEEFIAERFMGSEGEKLLKYVYWSNARETDSPTVDNKQCAGRDLAVLLCRLLLVE  463

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKR  1334
              F+RYD+F +E      G  +T  +L++
Sbjct  464   FFMRYDTFTVESSKYLAGPLITFKTLEK  491



>gb|KCW62907.1| hypothetical protein EUGRSUZ_G00499 [Eucalyptus grandis]
Length=427

 Score =   445 bits (1145),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 226/449 (50%), Positives = 297/449 (66%), Gaps = 55/449 (12%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY++G +EFFR R+QKYQSTVFR+NM PGPF++ + KVV LLD  SFP LFD S V
Sbjct  29    RLDYFYHEGTDEFFRTRMQKYQSTVFRSNMVPGPFMARNPKVVVLLDAISFPILFDTSKV  88

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+DVF  TYMPS   TGGYR+ +Y+DPSEP HA  K L    L+ R        HN + 
Sbjct  89    EKKDVFVATYMPSINFTGGYRMCAYLDPSEPKHAIFKGLFLSTLATR--------HNKFI  140

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              ++   +                     F +  L+ + P+ T                  
Sbjct  141   PLYRMTKF--------------------FDSWLLFQLAPLMT------------------  162

Query  543   HPVLSLGLPKQ---IEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
                  LGLPK    +ED +LHTF LP  L+K DY++ YE F E + +ILD  E LG+ R+
Sbjct  163   -----LGLPKILNFLEDIVLHTFPLPSLLLKCDYKKFYEVFNEYAKSILDEAESLGIKRD  217

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNLVF  CFNS+GGMK   P ++KW+G AG  L  +L +EIR+VV++ GG +TMA +
Sbjct  218   EACHNLVFLVCFNSYGGMKTTLPALIKWVGLAGEELQRRLTEEIRTVVRSEGG-VTMAAL  276

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             E+M L KS  +E+ RIEPPVP QYG AK D+VI +HDA F++K+GEM+ G+QPFATKDP+
Sbjct  277   EKMSLTKSVAWEALRIEPPVPFQYGHAKEDLVIHNHDAAFEIKKGEMICGYQPFATKDPR  336

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             IF+R +EF+  RFVGE+G+ LLK+V WSNGRE ++PTV +KQC  K+ V+L+SR+MLVE 
Sbjct  337   IFERPEEFVGDRFVGEEGEKLLKYVYWSNGREIDDPTVGNKQCPAKNLVVLLSRVMLVEF  396

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             FLRYD+F IE G  PLG++ T TS+ +AT
Sbjct  397   FLRYDTFTIEAGTLPLGSTATFTSMSKAT  425



>gb|KCW62903.1| hypothetical protein EUGRSUZ_G00493 [Eucalyptus grandis]
Length=450

 Score =   446 bits (1146),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 231/450 (51%), Positives = 305/450 (68%), Gaps = 31/450 (7%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY QGR+EFFR R++KYQSTVFR NMPPGPFISS+ KVV LLD  SFP LFD S V
Sbjct  26    RLDYFYFQGRDEFFRHRMRKYQSTVFRVNMPPGPFISSNPKVVVLLDAISFPVLFDTSKV  85

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR+V  GTYMPST  TGG+R  +++DPSEP HA +K+    LL+ RR+  +P   +  +
Sbjct  86    EKRNVLDGTYMPSTAFTGGHRACAFLDPSEPKHAAIKHWFLSLLAARRNVFIPTLRSCLS  145

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F  LE+EL+  GKA  N+ ND+ +FNF+ + L    P  T L      +   W+L  L
Sbjct  146   DLFVDLEDELSSKGKASFNSLNDKMSFNFVFKLLCDQKPSSTILGTKGAAMFNLWILLQL  205

Query  543   HPVLSLGLPKQI----EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
              P+LSLG   ++    ED +LHTF LPP L+K  Y++LY+ F E++++ILD  E LG+ R
Sbjct  206   APILSLGFNNKVLNFLEDVILHTFPLPPLLIKSSYKKLYDTFSEHASSILDEAEKLGIDR  265

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF   FN++GGMK   P ++KW+G  G  LH QLA+EIRS V + GG +T+A 
Sbjct  266   DEACHNLVFLAGFNAYGGMKATLPILIKWVGSGGEDLHRQLAREIRSTVASEGG-VTLAA  324

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L KS VYE  RI PPV  QYG+A+RD+V+ SHDA FQ+K+GEM+FG++       
Sbjct  325   LDKMSLTKSVVYEVLRINPPVQFQYGKARRDMVVRSHDAAFQIKKGEMIFGYR-------  377

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
                                + LLK+V WSNGRE ++PTV +KQC GKD V+L  R+MLVE
Sbjct  378   -------------------EKLLKYVYWSNGREIDDPTVGNKQCPGKDLVLLTCRVMLVE  418

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             LFLRYD+F IE G  P+G+SVT  SL +AT
Sbjct  419   LFLRYDTFGIECGSLPVGSSVTFKSLTKAT  448



>gb|ABR16111.1| unknown [Picea sitchensis]
Length=475

 Score =   446 bits (1148),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 228/449 (51%), Positives = 304/449 (68%), Gaps = 7/449 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R +YF  +G ++FF++RI KY+STV + NMPPGP I SDS+V+ LLDGKSFP L+D+S V
Sbjct  32    RFEYFVTEGVDKFFKKRIDKYKSTVLKVNMPPGPLIVSDSRVIMLLDGKSFPVLYDLSKV  91

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK++V TGTYMPST  TGGYR+  Y+DPSE NH+KLK   F +L   R    PEF  A+ 
Sbjct  92    EKKNVLTGTYMPSTSFTGGYRVAVYLDPSEENHSKLKRFCFEVLGSSRDRYFPEFARAFD  151

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+   ++ E+A  GKA      +Q  FNFL RSL G DP+   L  D P  + KW+   L
Sbjct  152   ELSAAVDKEMASRGKASFGEQIEQLIFNFLCRSLTGADPVTQGLGTDGPSYVIKWLAPQL  211

Query  543   HPVLSLG-LPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEI-LGVSREE  716
              P LS G LPK +++  +H+ RLP   V   Y +L+ F + ++   LD  E   G+ R E
Sbjct  212   APTLSSGFLPKIVDELTIHSIRLPFWPVSGYYDKLFNFLWTHAAPALDVAEKEFGLKRAE  271

Query  717   ACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGME  896
             ACH+L+F   FN+FGGM I FP+++K+IG AG  L   LA+EIR  V+A G  +    +E
Sbjct  272   ACHDLLFNISFNAFGGMSILFPSIVKYIGNAGNQLQRDLAEEIRGAVRAQG-NLNGRALE  330

Query  897   QMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKI  1076
              M L++STVYE  RI+PPVP QY RAK D V+ESHD  + VK+GE+L G+QPFATKDPK+
Sbjct  331   SMALVRSTVYEVLRIDPPVPLQYARAKTDFVVESHDGVYGVKKGELLGGYQPFATKDPKL  390

Query  1077  FDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELF  1256
             FDRA EF+P RF+G +G+ +LKHVLWSNGRET+  + ++KQC GKD V++V+RL +   F
Sbjct  391   FDRADEFVPRRFMGPEGEKMLKHVLWSNGRETDETSADNKQCGGKDIVVMVARLFVAHFF  450

Query  1257  LRYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             L+YDS+ I+   S    SV  T+L +ATF
Sbjct  451   LQYDSYTIDQSSS----SVKFTALNKATF  475



>ref|XP_011088323.1| PREDICTED: allene oxide synthase-like [Sesamum indicum]
Length=473

 Score =   446 bits (1147),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 229/450 (51%), Positives = 311/450 (69%), Gaps = 7/450 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+ Y+Y+QG  EFF+ R+ KY+STVFR NMPPGPF++ D +VVCLLD  SF TLFD S V
Sbjct  24    RLKYYYSQGEVEFFKTRMHKYESTVFRCNMPPGPFMARDPRVVCLLDAVSFQTLFDNSKV  83

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRDV  GT+MPST  TGGYR  +Y+DPSEPNHA LK      L+ +   ++P F    +
Sbjct  84    EKRDVLDGTFMPSTAFTGGYRACAYLDPSEPNHAILKGFFLSFLAGKHKIIIPLFRQTIS  143

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +F  LE+E++  G +  N  +D A+F F+ R L    P    +    PK++ KW+   L
Sbjct  144   GLFSGLEDEVSSKGSSNFNDLSDTASFEFVFRLLCDKSPSEANIGSKGPKMVDKWLFLQL  203

Query  543   HPVLSLGL---PKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+++LGL   PK +ED L+HTF LP  LVK DY +LYE FY+++  +LD  E +G+ R+
Sbjct  204   APLMTLGLKFVPKLLEDLLIHTFPLPFLLVKSDYNKLYEAFYKSAGPLLDEAERIGLKRD  263

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNLVF   FN++GGMK  FP ++KW+G AG  LH +LA EIR+ VK  G  +T++ +
Sbjct  264   EACHNLVFLAGFNAYGGMKRLFPALIKWVGAAGEDLHRRLADEIRAAVKKGG--VTLSAL  321

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             ++M L KS VYE+ RIEPPVP QY +AK+D  I +H++ F +K+GEMLFG+QP ATKDPK
Sbjct  322   DEMNLTKSVVYEALRIEPPVPYQYAKAKQDFTIHNHESSFLIKKGEMLFGYQPIATKDPK  381

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             +F+   EFI  RFVGE G+ L+++V WSNGRET+ PT  +KQC GK+ V+L+ RL+LVE 
Sbjct  382   VFENPDEFIADRFVGE-GEKLIQYVYWSNGRETDGPTTENKQCPGKELVVLLCRLLLVEF  440

Query  1254  FLRYDSFDIEVGMSPLGASV-TLTSLKRAT  1340
             FL YD+F ++      G++V T  SL +AT
Sbjct  441   FLNYDTFKVDTSNLVFGSAVLTFKSLTKAT  470



>gb|AFA28139.1| allene oxide synthase, partial [Triticum aestivum]
Length=423

 Score =   444 bits (1142),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 224/423 (53%), Positives = 310/423 (73%), Gaps = 1/423 (0%)
 Frame = +3

Query  6     IDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVVE  185
             +D++Y QG++++F  R+ KY STV R N+PPGPF++ D +VV +LD KSFP LFDV  VE
Sbjct  1     LDFYYFQGQDKYFESRVDKYGSTVVRINVPPGPFMARDPRVVAVLDAKSFPVLFDVDKVE  60

Query  186   KRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYAE  365
             K+++FTGTYMPST LTGG+R+ SY+DPSEP H K+K L+F LL+ R+   +P F + ++ 
Sbjct  61    KKNLFTGTYMPSTSLTGGFRVCSYLDPSEPTHTKVKQLLFSLLASRKDAFIPAFRSHFSS  120

Query  366   MFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNLH  545
             +  T+E++L  + K+  N  ND  +F F+  + +GV P  + L    P    KW++F LH
Sbjct  121   LLATVESQLVLSKKSNFNTLNDATSFEFIGDAYFGVLPSASDLGTTGPTKAAKWLIFQLH  180

Query  546   PVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEACH  725
             P+++LGLP   E+PLLHT  LPP LV  DY+ LY++FY  +T  LD  E LG+ R+EACH
Sbjct  181   PLVTLGLPMIPEEPLLHTVHLPPILVSGDYKALYKYFYAAATKALDTAEGLGLKRDEACH  240

Query  726   NLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQME  905
             NL+FAT FNS+GG+K+  P +L  I  AG   H +L  EIR+ V   GGK+T+  +E+ME
Sbjct  241   NLLFATVFNSYGGLKVLLPGILARIAGAGEKFHQKLVAEIRAAVADAGGKVTIEALEKME  300

Query  906   LMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF-D  1082
             L KS V+E+ R++PPV  QYGRAK D+ IESHDA F VK+GEMLFG+QP AT+DP++F  
Sbjct  301   LTKSAVWEALRLDPPVKFQYGRAKADMNIESHDAVFAVKKGEMLFGYQPCATRDPRVFGS  360

Query  1083  RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLR  1262
              A+EF+  RFVGE+G+ LL++V WSNGRETE+P+V++KQC GK+ V+LV RL++VELFLR
Sbjct  361   TAREFVGDRFVGEEGRKLLQYVYWSNGRETESPSVDNKQCPGKNLVVLVGRLLVVELFLR  420

Query  1263  YDS  1271
             YD+
Sbjct  421   YDT  423



>gb|KDO51417.1| hypothetical protein CISIN_1g043892mg [Citrus sinensis]
Length=470

 Score =   445 bits (1145),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 228/449 (51%), Positives = 306/449 (68%), Gaps = 16/449 (4%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY QG+++FF+ RI K++ST+F+TNMPPGPFI+S+  V+ +LD  SFP LFD S V
Sbjct  33    RLDYFYFQGQDKFFQDRINKHKSTIFKTNMPPGPFIASNPNVIAVLDAVSFPVLFDTSKV  92

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK              TGG+R+ +Y+DPSEP H+ LK+ +   L+ +    +P F    +
Sbjct  93    EK-----------LSFTGGHRVCAYLDPSEPKHSSLKSFILSTLASKHDKFIPLFKTCVS  141

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+F  LE+++A  G+A  N  ND  AFNF  R      P  TK+    P    KW+   L
Sbjct  142   ELFIELEDQMAEKGEANYNTLNDTLAFNFFFRLFCDKSPNDTKIASKGPSFANKWLFPQL  201

Query  543   HPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+ +L LPK    +ED LLHTF LP  + K DYQ+LY+ F + S  ILD  E  G+ R+
Sbjct  202   APITTLRLPKFLNPLEDLLLHTFPLPFFVAKSDYQKLYDAFNKFSGPILDEAERFGIQRD  261

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNLVF +  N++GG+K  FP ++KW+G AG  LH QLA EIR+VVKA GG +T A +
Sbjct  262   EACHNLVFLSTLNAYGGLKTGFPALIKWVGLAGEKLHRQLADEIRTVVKAEGG-VTFAAL  320

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
             E+M L KS VYE+ RIEPPVP QYG+AK D+VI SHDA +++K+G M+FG+QPFATKDP+
Sbjct  321   ERMVLTKSVVYEALRIEPPVPFQYGKAKVDMVIHSHDAAYEIKKGNMIFGYQPFATKDPR  380

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             +F+  +EF+ HRFVGE G+ LLK+V WSNGRETE+PT  +KQC  K+ V+L+SR+ LVE 
Sbjct  381   VFENPEEFVGHRFVGE-GEKLLKYVYWSNGRETEDPTAENKQCPAKNLVVLLSRVFLVEF  439

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             F RYD+F +E G    G+S T+ SL +AT
Sbjct  440   FHRYDTFTVEAGKLLTGSSATIKSLTKAT  468



>ref|XP_004230843.1| PREDICTED: 9-divinyl ether synthase [Solanum lycopersicum]
Length=488

 Score =   446 bits (1146),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 228/449 (51%), Positives = 316/449 (70%), Gaps = 8/449 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYN G +EFFR + +KY STVF+TNMPPGPFI+ + KV+ LLD K+FP LFD S V
Sbjct  44    RYDYFYNLGTDEFFRTKSRKYNSTVFKTNMPPGPFIAKNPKVIALLDSKTFPILFDNSKV  103

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK++V  GTYMPST   GGYR  +++DPSEP HA+LK     ++S      +P F  + +
Sbjct  104   EKKNVLDGTYMPSTNFFGGYRPCAFLDPSEPKHARLKGFYLSIISKYHTQSIPIFETSVS  163

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +F  LE +++ NGKA  N  +D  +F+F+ R L          R   PK   KW+L  L
Sbjct  164   ALFQNLEIQISKNGKANFNDISDAMSFDFVFRLL-----CDKTTRNVGPKYFDKWMLPQL  218

Query  543   HPVLSLGL---PKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+++LGL   P  +ED +LHTF LP  LVK +YQ+LY+ F E++ +IL   E  G+ R+
Sbjct  219   VPLVTLGLKFVPNFMEDLILHTFPLPFCLVKSNYQKLYDAFSEHAGSILSEIEKSGIKRD  278

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNLVF + FN++GGMK+ FP+++KW+  AG SLHT+LA EIR+++K  GG IT++ +
Sbjct  279   EACHNLVFLSGFNAYGGMKVVFPSLIKWVASAGKSLHTRLANEIRTIIKGEGGSITLSSV  338

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
              +M L+KSTVYE  RIEPP+P QYG+AK+DI+++SHD+ F +K+GEM+FG+Q FATKD K
Sbjct  339   NKMSLVKSTVYEVLRIEPPLPFQYGKAKQDIMVQSHDSNFLIKKGEMIFGYQTFATKDAK  398

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             IF+  +EFI  RF+G +G+ LLK+V WSN RET++PTV++KQ   KD V+L+ RL++VE 
Sbjct  399   IFENPEEFIAERFMGSEGEKLLKYVYWSNARETDDPTVDNKQSPAKDLVVLLCRLLVVEF  458

Query  1254  FLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             F+RYD F +E      G+SVT  +L + T
Sbjct  459   FMRYDKFTVESNKFLFGSSVTFKTLDKKT  487



>gb|AFA28137.1| allene oxide synthase, partial [Triticum aestivum]
Length=431

 Score =   444 bits (1141),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 226/430 (53%), Positives = 310/430 (72%), Gaps = 1/430 (0%)
 Frame = +3

Query  42    FRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVVEKRDVFTGTYMPS  221
             F  R++KY STV R N+PPGPF++ D +VV +LD KSFP LFDV  VEK+++FTGTYMPS
Sbjct  1     FESRVEKYGSTVVRINVPPGPFMARDPRVVAVLDAKSFPVLFDVDKVEKKNLFTGTYMPS  60

Query  222   TELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYAEMFDTLEnelagn  401
             T LTGG+R+ SY+DPSEP H K+K L+F LL+ R+   +P F + ++ +  T+E++L  +
Sbjct  61    TSLTGGFRVCSYLDPSEPTHTKVKQLLFSLLASRKDAFIPAFRSHFSSLLATVESQLVLS  120

Query  402   gkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNLHPVLSLGLPKQIE  581
              K+  N  ND  +F F+  + +GV P  + L         KW++F LHP+++LGLP  +E
Sbjct  121   KKSNFNTLNDATSFEFIGDAYFGVLPSASDLGTTGLTKAAKWLIFQLHPLVTLGLPMILE  180

Query  582   DPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEACHNLVFATCFNSFG  761
             +PLLHT  LPP LV  DY+ LY++FY  +T  LD  E LG+ R+EACHNL+FAT FNS+G
Sbjct  181   EPLLHTVHLPPILVSGDYKALYKYFYAAATKALDTAEGLGLKRDEACHNLLFATVFNSYG  240

Query  762   GMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQMELMKSTVYESFRI  941
             G+K+  P +L  I  AG   H +L  EIR+ V   GGK+T+  +E+MEL KS V+E+ R+
Sbjct  241   GLKVLLPGILARIAGAGEKFHQKLVAEIRAAVADAGGKVTIEALEKMELTKSAVWEALRL  300

Query  942   EPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF-DRAQEFIPHRFVG  1118
             +PPV  QYGRAK D+ IESHDA F VK+GEMLFG+QP AT+DP++F   A+EF+  RFVG
Sbjct  301   DPPVKFQYGRAKADMNIESHDAVFAVKKGEMLFGYQPCATRDPRVFGSTAREFVGDRFVG  360

Query  1119  EKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLRYDSFDIEVGMSP  1298
             E+G+ LL++V WSNGRETE+P+V++KQC GK+ V+LV RL++VELFLRYD+F  +VG+  
Sbjct  361   EEGRKLLQYVYWSNGRETESPSVDNKQCPGKNLVVLVGRLLVVELFLRYDTFTADVGVDL  420

Query  1299  LGASVTLTSL  1328
             LG  V  T +
Sbjct  421   LGTKVEFTGV  430



>ref|NP_001265949.1| 9-divinyl ether synthase-like [Solanum lycopersicum]
 gb|AAN76867.1|AF454634_1 cytochrome P450 CYP74C3 [Solanum lycopersicum]
Length=491

 Score =   446 bits (1146),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 222/450 (49%), Positives = 311/450 (69%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R D+ YNQG +EFFR R++KY STVFRTN+PPGPF + +SKVV L+D  S+P LFD S V
Sbjct  43    RYDFHYNQGADEFFRSRMKKYDSTVFRTNVPPGPFNARNSKVVVLVDAVSYPILFDNSQV  102

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +K + F GT+M S    GGY++  ++  S+P H  LK L    L+      +P F  +  
Sbjct  103   DKENYFEGTFMSSPSFNGGYKVCGFLGTSDPKHTTLKGLFLSTLTRLHDKFIPIFTTSIT  162

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLY-GVDPMRTKLRLDAPKLIGKWVLFN  539
              MF +LE EL+  G +  N   D  +F FL R    G +P+ T +  + PK++ KWV   
Sbjct  163   SMFTSLEKELSEKGTSYFNPIGDNLSFEFLFRLFCEGKNPIDTSVGPNGPKIVDKWVFLQ  222

Query  540   LHPVLSLGL---PKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P++SLGL   P  +ED +LHTF LP  LVK+D+Q+LY  FY +   ILD  E LGV R
Sbjct  223   LAPLISLGLKFVPNFLEDLVLHTFPLPYILVKRDHQKLYNAFYNSMKDILDEAEKLGVKR  282

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHN VF   FNS+GG+K+FFP+++KWIG +G SLH +L KEIR+ VK  GG +T++ 
Sbjct  283   DEACHNFVFLAGFNSYGGLKVFFPSLIKWIGTSGPSLHARLVKEIRTAVKEAGG-VTLSA  341

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L+KS VYE+ R++PPVP Q  +A+++I+I +H++ F +K+ E++FG+QP ATKD 
Sbjct  342   IDKMPLVKSVVYETLRMDPPVPFQTVKARKNIIITNHESSFLIKKDELIFGYQPLATKDS  401

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             K+F  A+EF P RFVG  G+ LLK+V WSNG+E +NP+VNDKQC GKD ++L+ RL++VE
Sbjct  402   KVFKNAEEFNPDRFVG-GGEKLLKYVYWSNGKEIDNPSVNDKQCPGKDLIVLMGRLLVVE  460

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              F+RYD+F++E G   LG+ VT  SL +AT
Sbjct  461   FFMRYDTFEVEFGKLLLGSKVTFKSLTKAT  490



>ref|XP_010068132.1| PREDICTED: allene oxide synthase-like [Eucalyptus grandis]
Length=556

 Score =   447 bits (1151),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 231/450 (51%), Positives = 305/450 (68%), Gaps = 31/450 (7%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY QGR+EFFR R++KYQSTVFR NMPPGPFISS+ KVV LLD  SFP LFD S V
Sbjct  132   RLDYFYFQGRDEFFRHRMRKYQSTVFRVNMPPGPFISSNPKVVVLLDAISFPVLFDTSKV  191

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR+V  GTYMPST  TGG+R  +++DPSEP HA +K+    LL+ RR+  +P   +  +
Sbjct  192   EKRNVLDGTYMPSTAFTGGHRACAFLDPSEPKHAAIKHWFLSLLAARRNVFIPTLRSCLS  251

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             ++F  LE+EL+  GKA  N+ ND+ +FNF+ + L    P  T L      +   W+L  L
Sbjct  252   DLFVDLEDELSSKGKASFNSLNDKMSFNFVFKLLCDQKPSSTILGTKGAAMFNLWILLQL  311

Query  543   HPVLSLGLPKQI----EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
              P+LSLG   ++    ED +LHTF LPP L+K  Y++LY+ F E++++ILD  E LG+ R
Sbjct  312   APILSLGFNNKVLNFLEDVILHTFPLPPLLIKSSYKKLYDTFSEHASSILDEAEKLGIDR  371

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF   FN++GGMK   P ++KW+G  G  LH QLA+EIRS V + GG +T+A 
Sbjct  372   DEACHNLVFLAGFNAYGGMKATLPILIKWVGSGGEDLHRQLAREIRSTVASEGG-VTLAA  430

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L KS VYE  RI PPV  QYG+A+RD+V+ SHDA FQ+K+GEM+FG++       
Sbjct  431   LDKMSLTKSVVYEVLRINPPVQFQYGKARRDMVVRSHDAAFQIKKGEMIFGYR-------  483

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
                                + LLK+V WSNGRE ++PTV +KQC GKD V+L  R+MLVE
Sbjct  484   -------------------EKLLKYVYWSNGREIDDPTVGNKQCPGKDLVLLTCRVMLVE  524

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             LFLRYD+F IE G  P+G+SVT  SL +AT
Sbjct  525   LFLRYDTFGIECGSLPVGSSVTFKSLTKAT  554



>gb|KHN04746.1| Allene oxide synthase, chloroplastic [Glycine soja]
Length=479

 Score =   444 bits (1142),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 232/450 (52%), Positives = 305/450 (68%), Gaps = 14/450 (3%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R +YFY+QGR++FF  RI+K+ STV RTNMPPGPFISSD +VV LLDG SFP LFD   V
Sbjct  38    RHNYFYHQGRDKFFATRIEKHNSTVIRTNMPPGPFISSDPRVVALLDGASFPILFDNDKV  97

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK +V  GT+MPST+          +D +EPNHA +K     +L+ R+   +P F N   
Sbjct  98    EKLNVLDGTFMPSTKFN--------LDTTEPNHALIKQFFLNVLAKRKDSFVPLFRNCLQ  149

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLY-GVDPMRTKLRLDAPKLIGKWVLFN  539
             E F  +E++L+ N KA  N     A+FNF+ R    G DP +T L    PKL+  W+LF 
Sbjct  150   ESFAEIEDQLSKNTKADFNTVFSDASFNFMFRLFCDGKDPSQTNLGSKGPKLVDTWLLFQ  209

Query  540   LHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+ +LGLPK    IED L+ T   P  L K  Y+ LYE F  ++T  LD  E LG+ R
Sbjct  210   LAPLATLGLPKIFNYIEDFLIRTLPFPACLTKSGYKNLYEAFKTHATTALDEAEKLGLKR  269

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
              EACHN+VF   FN++GG+K  FP +LKW+G +G  LH  LA+E+R VV   GG +T   
Sbjct  270   NEACHNVVFTAGFNAYGGLKNQFPYVLKWLGLSGEKLHADLAREVRRVVNDEGG-VTFTA  328

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +E M L+KS VYE  RIEP VP QY RA+ ++V+ SHDA F+VK+GEMLFG+QPFAT+DP
Sbjct  329   LENMPLVKSVVYEVMRIEPAVPYQYARARENLVVSSHDASFEVKKGEMLFGYQPFATRDP  388

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             +IF+ A+ F+P RFVGE G+ +LKHVLWSNGRETE P+ ++KQC GK+ V+L+ RL LVE
Sbjct  389   RIFEDAEVFVPRRFVGE-GEKMLKHVLWSNGRETEEPSASNKQCPGKNLVVLLCRLFLVE  447

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             LFLRYD+F+ E   +  G ++T+ SL +A+
Sbjct  448   LFLRYDTFEFEYTQAGFGPTITIKSLTKAS  477



>ref|XP_006364096.1| PREDICTED: 9-divinyl ether synthase-like [Solanum tuberosum]
Length=491

 Score =   443 bits (1140),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 219/450 (49%), Positives = 311/450 (69%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R D+ YNQG +EFFR R++K+ ST+FRTN+PPGPF + +SKVV L+D  S+P LFD S V
Sbjct  43    RYDFHYNQGADEFFRSRMEKHDSTIFRTNVPPGPFNARNSKVVVLVDAVSYPILFDNSQV  102

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +K + F GT+M S    GGY++  ++  ++P H  LK L    L+      +P F  +  
Sbjct  103   DKENYFEGTFMSSPSFNGGYKVCGFLGTTDPKHTTLKGLFLSTLTRLHDKFIPIFTTSIT  162

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLY-GVDPMRTKLRLDAPKLIGKWVLFN  539
             + F ++E EL+  G +  N  +D  +F FL R    G +P+ T +  + PK++ KWV   
Sbjct  163   QTFTSIEKELSEKGTSYFNPISDNLSFEFLFRLFCEGKNPVETSVGTNGPKIVDKWVFLQ  222

Query  540   LHPVLSLGL---PKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P++SLGL   P  +ED +LHTF LP  LVK D+Q+LY  FY +   ILD  E LGV R
Sbjct  223   LAPLISLGLKYVPNFLEDLVLHTFPLPYFLVKGDHQKLYNAFYNSMKDILDEAEKLGVKR  282

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHN +F   FNS+GGMK+FFP+++KWIG +G SLHT+L KEIR+ VK  GG +T++ 
Sbjct  283   DEACHNFIFLAGFNSYGGMKVFFPSLIKWIGTSGPSLHTRLVKEIRTAVKEAGG-VTLSA  341

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L+KS VYE+ R++PPVP Q  +A+++I++ +H+A F +K+ E++FG+QP ATKD 
Sbjct  342   IDKMPLVKSVVYETLRMDPPVPFQTVKARKNIIVSNHEASFLIKKDELIFGYQPLATKDS  401

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             K+F   +EF P RFVG  G+ LLK+V WSNG+E +NPTVNDKQC GKD ++L+ RL++VE
Sbjct  402   KVFKNGEEFNPDRFVG-YGEKLLKYVYWSNGKEIDNPTVNDKQCPGKDLIVLLGRLLVVE  460

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              F+RYD+F+IE G   LG+ VT  SL +AT
Sbjct  461   FFMRYDTFEIEFGKLLLGSKVTFKSLTKAT  490



>gb|KCW62904.1| hypothetical protein EUGRSUZ_G00496 [Eucalyptus grandis]
Length=423

 Score =   441 bits (1133),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 221/450 (49%), Positives = 294/450 (65%), Gaps = 58/450 (13%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY QGR+EFFR R++KY+STVFR NMPPGPFISS+ KVV LLD  SFP LFD S V
Sbjct  26    RLDYFYFQGRDEFFRHRMRKYRSTVFRVNMPPGPFISSNPKVVVLLDAISFPVLFDTSKV  85

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR+   GTYMPST  TGG+R  +++DPSEP                        H +  
Sbjct  86    EKRNALDGTYMPSTAFTGGHRACAFLDPSEPK-----------------------HASIK  122

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
               F +L                        AR    +  +R+ +          W+L  L
Sbjct  123   HWFMSL----------------------LAARRNVFIPTLRSSM-------FNLWILLQL  153

Query  543   HPVLSLGLPKQI----EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
              P+LSLG   ++    ED +LHTF LPP L+K  Y++LY+ F E++++ILD  E LG+ R
Sbjct  154   APILSLGFDNKVLNFLEDVILHTFPLPPLLIKSSYKKLYDAFSEHASSILDEAEKLGIDR  213

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF   FN++GGMK   P ++KW+G  G  LH +L +EIRS V + GG +T+  
Sbjct  214   DEACHNLVFLAGFNAYGGMKATLPILIKWVGWGGEDLHRRLTREIRSTVASEGG-VTLTA  272

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L KS VYE+ RI+PPV  QYG+A+RD+V+ S+DA FQ+K+GEM+FG+QPFATKDP
Sbjct  273   LDKMSLTKSVVYEALRIDPPVKFQYGKARRDMVVRSYDAAFQIKKGEMIFGYQPFATKDP  332

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             +IFD  ++F+  RFVGE G+ LLK+V WSNGRE ++PTV +KQC GKD V+L+ R+MLVE
Sbjct  333   RIFDDPEDFVGDRFVGE-GEKLLKYVYWSNGREIDDPTVGNKQCPGKDLVLLMCRVMLVE  391

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             +FLRYD+F +E G  P G+SVT  SL +AT
Sbjct  392   MFLRYDTFGLECGSLPAGSSVTFRSLTKAT  421



>gb|ABR16049.1| unknown [Picea sitchensis]
 gb|ACN40913.1| unknown [Picea sitchensis]
Length=475

 Score =   442 bits (1136),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 224/448 (50%), Positives = 306/448 (68%), Gaps = 7/448 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R +YF  +G ++FF+ RI KY+STVF+ NMPPGP I  DS+VV LLDGKSFP L+D+S V
Sbjct  32    RFEYFVTEGVDKFFKNRIDKYKSTVFKVNMPPGPPIVWDSRVVMLLDGKSFPVLYDLSKV  91

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK++V TG YMPST  TGGYR+  Y+DPSE NH KLK   F  L + R    PEF  A+ 
Sbjct  92    EKKNVLTGAYMPSTAFTGGYRVSVYLDPSEENHIKLKRFCFEALKNSRDRYFPEFSRAFD  151

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+   ++ E+A +GKA      +Q  FNFL RS+ G DP+   L  D P  + +W+   L
Sbjct  152   ELSAAVDKEMASSGKASFATQIEQLIFNFLCRSITGADPVTQGLGTDGPSYVTQWLAPQL  211

Query  543   HPVLSLG-LPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEI-LGVSREE  716
              P+ S G LPK +++  +H+  LP  LV   Y +L+ F + +++ +LD  E   G++R E
Sbjct  212   APIASSGFLPKIVDELTIHSIPLPFWLVSGSYDKLFNFLWTHASPVLDVAEKEFGLNRAE  271

Query  717   ACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGME  896
             ACH+L+F   FN+FGGM I FP+++K+I  AG  L   LAKE+R  V++ GG +    +E
Sbjct  272   ACHDLLFNISFNAFGGMLIMFPSIVKYIALAGNQLQRDLAKEVRGAVRSQGG-LNGRALE  330

Query  897   QMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKI  1076
              M L++STVYE  R+ PPVP QY RAK D V+ESHD  + VK+GE+L G+QPFATKDPK+
Sbjct  331   SMALVRSTVYEVLRMAPPVPLQYARAKTDFVVESHDGFYGVKKGELLGGYQPFATKDPKL  390

Query  1077  FDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELF  1256
             FDRA EF+P RF+G++G+ +LKHVLWSNGRET+  + ++KQCAGKD V++V+RL +   F
Sbjct  391   FDRADEFVPRRFMGQEGEKMLKHVLWSNGRETDETSADNKQCAGKDIVVMVARLFVAHFF  450

Query  1257  LRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             LRYDS+ I+   S    SVT ++L +AT
Sbjct  451   LRYDSYTIDQSSS----SVTFSTLNKAT  474



>gb|ABK25164.1| unknown [Picea sitchensis]
Length=484

 Score =   441 bits (1135),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 223/448 (50%), Positives = 306/448 (68%), Gaps = 7/448 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R +YF  +G ++FF+ RI KY+STVF+ NMPPGP I  DS+VV LLDGKSFP L+D+S V
Sbjct  32    RFEYFVTEGVDKFFKNRIDKYKSTVFKVNMPPGPPIVWDSRVVMLLDGKSFPVLYDLSKV  91

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK++V TG YMPST  TGGYR+  Y+DPSE NH+KLK   F  L + R    PEF  A+ 
Sbjct  92    EKKNVLTGAYMPSTAFTGGYRVSVYLDPSEENHSKLKRFCFEALKNSRDRYFPEFSRAFD  151

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
             E+   ++ E+A +GKA      +Q  FNFL RS+ G DP+   L  D P  + +W+   L
Sbjct  152   ELSAAVDKEMASSGKASFATQIEQLIFNFLCRSITGADPVTQGLGTDGPSYVTQWLAPQL  211

Query  543   HPVLSLG-LPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEI-LGVSREE  716
              P+ S G LPK +++  +H+  LP  LV   Y +L+ F + ++  +LD  E   G++R E
Sbjct  212   APIASSGFLPKIVDELTIHSIPLPFWLVSGSYDKLFNFLWTHAAPVLDVAEKEFGLNRAE  271

Query  717   ACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGME  896
             ACH+L+F   FN+FGGM I FP+++K+I  AG  L   LA+E+R  V++ GG +    +E
Sbjct  272   ACHDLLFNISFNAFGGMLIMFPSIVKYIALAGNQLQRDLAEEVRGAVRSQGG-LNGRALE  330

Query  897   QMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKI  1076
              M L++STVYE  R+ PPVP QY RAK D V+ESHD  + VK+GE+L G+QPFATKDPK+
Sbjct  331   SMALVRSTVYEVLRMAPPVPLQYARAKTDFVVESHDGFYGVKKGELLGGYQPFATKDPKL  390

Query  1077  FDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELF  1256
             FDRA EF+P RF+G++G+ +LKHVLWSNGRET+  + ++KQCAGKD V++V+RL +   F
Sbjct  391   FDRADEFVPRRFMGQEGEKMLKHVLWSNGRETDETSADNKQCAGKDIVVMVARLFVAHFF  450

Query  1257  LRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             LRYDS+ I+   S    SVT ++L +AT
Sbjct  451   LRYDSYTIDQSSS----SVTFSTLNKAT  474



>gb|KEH40767.1| fatty acid hydroperoxide lyase [Medicago truncatula]
Length=489

 Score =   440 bits (1132),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 223/450 (50%), Positives = 306/450 (68%), Gaps = 7/450 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R D+FYNQGR++FF  RIQKY STVF+TNMPPGPFISS+ +V+ LLD  SFP LFD   V
Sbjct  39    RHDFFYNQGRDKFFSTRIQKYNSTVFKTNMPPGPFISSNPRVIALLDASSFPILFDNKKV  98

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK +VF GT+MPS + TGGYR+  ++D +EPNHA +K L+  +L   ++  +P F    +
Sbjct  99    EKYNVFDGTFMPSIDFTGGYRVCPFLDTTEPNHALIKGLLLNVLLSGKYSFIPLFKTILS  158

Query  363   EMFDTLEnelagngkagl-naanDQAAFNFLARSLY-GVDPMRTKLRLDAPKLIGKWVLF  536
             + F+ +E  L+G       N+    A+FNF+ R      DP  T L    PK++  W+LF
Sbjct  159   DGFNEIEEGLSGKSGKADFNSIMSVASFNFMFRLFCDNNDPSETILGDQGPKMLDTWILF  218

Query  537   NLHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVS  707
              L P+ +L  PK    +ED LL T   P  L +  Y++LYE F  ++  IL+  E  G+ 
Sbjct  219   QLAPIETLKPPKLFNYLEDLLLRTVPFPACLTRSSYKKLYEAFSSSAVTILNDAEKAGLK  278

Query  708   REEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMA  887
             R EACHNL+F   FN +GG+K  FP + KWIG  G  LH +LA EIR++VK  GG +T+ 
Sbjct  279   RSEACHNLIFMAGFNGYGGLKNQFPILFKWIGLCGEELHKELANEIRTIVKNEGG-VTIQ  337

Query  888   GMEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKD  1067
              +E+M L+KS VYE  RIEP V  QY +A+ D++++SHDA F++K+GEM+FG+Q FATKD
Sbjct  338   SLEKMSLVKSVVYEVLRIEPVVRYQYAKAREDLIVKSHDAAFEIKKGEMIFGYQSFATKD  397

Query  1068  PKIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLV  1247
             P++FD A+ F+P RF+GE G+ LLK+VLWSNGRETENPTV++KQC  K+ V+L+ +L LV
Sbjct  398   PRVFDDAEIFVPKRFIGE-GEKLLKYVLWSNGRETENPTVDNKQCPAKNLVVLLCKLFLV  456

Query  1248  ELFLRYDSFDIEVGMSPLGASVTLTSLKRA  1337
               FLRYD+F  E   + +G S+T+TSL +A
Sbjct  457   VFFLRYDTFTFETKDAVIGVSITITSLTKA  486



>ref|XP_009400043.1| PREDICTED: allene oxide synthase 2-like [Musa acuminata subsp. 
malaccensis]
Length=493

 Score =   440 bits (1132),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 223/448 (50%), Positives = 314/448 (70%), Gaps = 2/448 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R++++Y Q  EEFFR RI  + STVFR NMPPGPF++++S+VV LLD KSF  L DVS V
Sbjct  43    RLEFYYKQREEEFFRSRIAAHGSTVFRINMPPGPFMAANSRVVALLDAKSFRVLLDVSKV  102

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK++V TGT++P   LTGG+R+ +Y+DPSEP+HA++K L+F L++ R++  +P F + +A
Sbjct  103   EKKNVLTGTFVPPVSLTGGHRMCAYLDPSEPDHARVKQLVFNLVAARKNFFIPVFRSNFA  162

Query  363   EMFDTLEnelagngkagl-naanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
              +F+ ++ ++A        N  +D A F++   + +GV P  T L    P    KW+   
Sbjct  163   VLFEAMDAQVASASGKSDFNKLSDAAVFDYFGEACFGVRPSATALGATGPTKATKWLFPQ  222

Query  540   LHPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEA  719
             + P+++LGLP  +E+  LHTF LP  L   DY+ LY +F   +++ LD  E LG++R+EA
Sbjct  223   IAPLMTLGLPTLLEELFLHTFPLPSCLFSSDYKALYRYFESAASSTLDDAEKLGLNRKEA  282

Query  720   CHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQ  899
             CH+++F   FN+FGG K   P +   +  AG SLH+QLA+EIRS V A GG++T+A +E+
Sbjct  283   CHHILFVAIFNAFGGFKAALPGIFGLVAEAGPSLHSQLAEEIRSAVAAEGGEVTLAAVER  342

Query  900   MELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF  1079
             MEL +S VYE+ R++PPV  QYG+AK D++IESHDA +QVK+GEML G+QP ATKDPK+F
Sbjct  343   MELTRSVVYEALRLDPPVKYQYGKAKADLIIESHDAAYQVKKGEMLLGYQPCATKDPKVF  402

Query  1080  D-RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELF  1256
                A EF+  RFVG  G+ LL++V+WSNG ETE PTV +KQCAGK  V+LV RL+LVE F
Sbjct  403   GPNAGEFVADRFVGNAGRKLLEYVVWSNGPETEEPTVGNKQCAGKYLVVLVGRLLLVEFF  462

Query  1257  LRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             LRYD+F  +VG   LG  V +TSL + T
Sbjct  463   LRYDTFTADVGSVLLGKQVNVTSLSKPT  490



>gb|EYU42637.1| hypothetical protein MIMGU_mgv1a005446mg [Erythranthe guttata]
Length=483

 Score =   440 bits (1131),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 237/458 (52%), Positives = 316/458 (69%), Gaps = 11/458 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R D+FY QG++EFFR R++KY STVFR N+ PGPF + DSKVV LLD  SFP LFDVS V
Sbjct  26    RFDFFYKQGQDEFFRARVKKYNSTVFRVNVRPGPFNAKDSKVVVLLDAVSFPVLFDVSKV  85

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRDVFTGT+MPST  TGGYR+ SY+DPSEP HA LK+     LS     L+P F ++  
Sbjct  86    EKRDVFTGTFMPSTHFTGGYRVCSYLDPSEPKHAILKSFFLSFLSRAHKSLIPTFRSSVG  145

Query  363   EMFDTLEnelagngkagln---aanDQAAFNFLARSLY-GVDPMRTKLRLDAPKLIGKWV  530
              MF  LE ELA  G+A      A +D+ +F+FL R    G     T +       + KW+
Sbjct  146   HMFVDLEEELAVKGQAEGAGFNAVSDKMSFDFLFRLFGDGKSSYETSVGGGGNGNLDKWL  205

Query  531   LFNLHPVLSLGL---PKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHG----  689
             LF L P+++LGL   P  +ED +LHTF LP   VK  Y+++++ F + + A+LD      
Sbjct  206   LFQLAPLVTLGLKWLPNFLEDFVLHTFPLPFWAVKSGYEKVHDAFRDAAAALLDEAAKTM  265

Query  690   EILGVSREEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANG  869
               + +S++EA HNL+F T FN++GGMK+ FP +LK+IG AG  LH +LA EIR+VVK  G
Sbjct  266   SPVIISKDEATHNLLFLTGFNAYGGMKVLFPALLKYIGAAGEDLHRRLAAEIRAVVKEEG  325

Query  870   GKITMAGMEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQ  1049
             GK+T+A + +M L KS  +E  RIEPPV  Q+GRAK DI + SH A F +K GEM+ G+Q
Sbjct  326   GKVTLAAVNKMSLTKSVAWEVMRIEPPVAYQFGRAKHDITVASHTAAFVIKRGEMICGYQ  385

Query  1050  PFATKDPKIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLV  1229
             PFATKDP+IF+  ++F+ +RFVGE+G+ L+K+VLWSNGRE E+PT  +KQC  KD V+L+
Sbjct  386   PFATKDPEIFESPEDFVANRFVGEEGEKLIKYVLWSNGREDEDPTAANKQCPAKDMVVLL  445

Query  1230  SRLMLVELFLRYDSFDIEVGMSPLGASVTLTSLKRATF  1343
             +R+M+VE FL+YD+F +E G   LG SVT+ SL  AT+
Sbjct  446   ARMMVVEFFLKYDTFTVESGTLLLGTSVTVKSLTNATW  483



>gb|ABC75838.1| cytochrome P450 CYP74C9 [Petunia integrifolia subsp. inflata]
 gb|ABC75839.1| cytochrome P450 CYP74C9 [Petunia integrifolia subsp. inflata]
Length=480

 Score =   437 bits (1125),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 225/450 (50%), Positives = 313/450 (70%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R D+ YNQG + FFR R+Q YQSTV+R N+PPGPF +  SK + L+D  SF  LFD S V
Sbjct  32    RYDFHYNQGTDGFFRSRMQNYQSTVYRANVPPGPFNAPKSKAIVLVDAVSFTVLFDNSKV  91

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +K++ F GT+MPST+ TGGYR+  ++D SEP HA +K      L+   +  +P F ++ +
Sbjct  92    DKKNFFDGTFMPSTDFTGGYRLCPFLDTSEPKHATIKGFFLSTLAKLHNRFIPLFLSSMS  151

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLY-GVDPMRTKLRLDAPKLIGKWVLFN  539
             E+F  LE+EL+  G+A  N  +D   F+F+ R L     P  T L  D P  + KWV F 
Sbjct  152   ELFTNLEHELSNKGEAYFNTISDNMTFDFIFRLLCENKSPSETSLGSDGPTFLNKWVFFQ  211

Query  540   LHPVLSLGL---PKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+++LGL   P  IED +LHTF LP   +K DY+++++ FY +  +ILD  E +GV R
Sbjct  212   LAPLITLGLKYVPNFIEDLVLHTFPLPFCPLKSDYKKIFDAFYNSMGSILDEAEKIGVKR  271

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHN +F   FNS+GG K+FFP ++KW+G AG SLH +L  EIR++VK  GG +T++ 
Sbjct  272   DEACHNFIFLAGFNSYGGNKVFFPALIKWVGAAGESLHRRLVDEIRTIVKEEGG-VTLSA  330

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             + +M L KS VYE+ RIEPPVP Q  +A+ DIVI SHD+ F +K+ E++FG+QP ATKDP
Sbjct  331   LNKMSLTKSVVYETLRIEPPVPFQTAKAREDIVINSHDSSFLIKKDEIIFGYQPLATKDP  390

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             KIFD  +EFI  RF+G+ G+ L+++V WSNG+E+++PTVNDKQC GK+ V+L+ RL+LVE
Sbjct  391   KIFDNPEEFIGDRFMGD-GEKLIEYVYWSNGKESDDPTVNDKQCPGKNLVVLLGRLLLVE  449

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+FDIE G   LG+ V+  S+ +AT
Sbjct  450   FFLRYDTFDIEYGKLLLGSKVSFKSVTKAT  479



>gb|AFA28138.1| allene oxide synthase, partial [Triticum aestivum]
Length=411

 Score =   435 bits (1118),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 220/411 (54%), Positives = 301/411 (73%), Gaps = 1/411 (0%)
 Frame = +3

Query  42    FRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVVEKRDVFTGTYMPS  221
             F  R++KY STV R N+PPGPF++ D +VV +LD KSFP LFDV  VEK+++FTGTYMPS
Sbjct  1     FESRVEKYGSTVVRINVPPGPFMARDPRVVAVLDAKSFPVLFDVDKVEKKNLFTGTYMPS  60

Query  222   TELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYAEMFDTLEnelagn  401
             T LTGG+R+ SY+DPSEP H K+K L+F LL+ R+   +P F + ++ +  T+E++L  +
Sbjct  61    TSLTGGFRVCSYLDPSEPTHTKVKQLLFSLLASRKDAFIPAFRSHFSSLLATVESQLVLS  120

Query  402   gkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNLHPVLSLGLPKQIE  581
              K+  N  ND  +F F+  + +GV P  + L    P    KW++F LHP+++LGLP  +E
Sbjct  121   KKSNFNTLNDATSFEFIGDAYFGVLPSASDLGTTGPTKAAKWLIFQLHPLVTLGLPMILE  180

Query  582   DPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEACHNLVFATCFNSFG  761
             +PLLHT  LPP LV  DY+ LY++FY  +T  LD  E LG+ R+EACHNL+FAT FNS+G
Sbjct  181   EPLLHTVHLPPILVSGDYKALYKYFYAAATKALDTAEGLGLKRDEACHNLLFATVFNSYG  240

Query  762   GMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQMELMKSTVYESFRI  941
             G+K+  P +L  I  AG   H +L  EIR+ V   GGK+T+  +E+MEL KS V+E+ R+
Sbjct  241   GLKVLLPGILARIAGAGEKFHQKLVAEIRAAVADAGGKVTIEALEKMELTKSAVWEALRL  300

Query  942   EPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF-DRAQEFIPHRFVG  1118
             +PPV  QYGRAK D+ IESHDA F VK+GEMLFG+QP AT+DP++F   A+EF+  RFVG
Sbjct  301   DPPVKFQYGRAKADMNIESHDAVFAVKKGEMLFGYQPCATRDPRVFGSTAREFVGDRFVG  360

Query  1119  EKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLRYDS  1271
             E+G+ LL++V WSNGRETE+P+V++KQC GK+ V+LV RL++VELFLRYD+
Sbjct  361   EEGRKLLQYVYWSNGRETESPSVDNKQCPGKNLVVLVGRLLVVELFLRYDT  411



>gb|KCW63874.1| hypothetical protein EUGRSUZ_G01541 [Eucalyptus grandis]
Length=423

 Score =   435 bits (1118),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 221/450 (49%), Positives = 292/450 (65%), Gaps = 58/450 (13%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFY QGR+EFFR R++KY+STVFR NMPPGPFISS+  VV LLD  SFP LFD S V
Sbjct  26    RLDYFYFQGRDEFFRHRMRKYRSTVFRVNMPPGPFISSNPNVVVLLDAISFPVLFDTSKV  85

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKR+V  GTYMPST  TGG+R  +++   +P+  K                    H    
Sbjct  86    EKRNVLDGTYMPSTAFTGGHRACAFL---DPSEPK--------------------HATIK  122

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
               F +L                        AR    +  +R+ +          W+L  L
Sbjct  123   HWFLSL----------------------LAARRNVFIPTLRSSM-------FNLWILLQL  153

Query  543   HPVLSLGLPKQI----EDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
              P+LSLG   ++    ED +LHTF LPP L+K  Y++LY+ F E++++ILD  E LG+ R
Sbjct  154   APILSLGFNNKVLNFLEDVILHTFPLPPLLIKSSYKKLYDTFSEHASSILDEAEKLGIDR  213

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EACHNLVF   FN++GGMK   P ++KW+G  G  LH QLA+EIRS V + GG +T+A 
Sbjct  214   DEACHNLVFLAGFNAYGGMKATLPILIKWVGSGGEDLHRQLAREIRSTVASEGG-VTLAA  272

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L KS VYE  RI PPV  QYG+A+RD+V+ SHDA FQ+K+GEM+FG+QPFATKDP
Sbjct  273   LDKMSLTKSVVYEVLRINPPVQFQYGKARRDMVVRSHDAAFQIKKGEMIFGYQPFATKDP  332

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             +IFD  ++F+  RFVGE G+ LLK+V WSNGRE ++PTV +KQC GKD V+L+ R+MLVE
Sbjct  333   RIFDDPEDFVGDRFVGE-GEKLLKYVYWSNGREIDDPTVGNKQCPGKDLVLLMCRVMLVE  391

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             +FLRYD+  +E G  P+G+SVT  SL +AT
Sbjct  392   MFLRYDTLGLECGSLPVGSSVTFKSLTKAT  421



>dbj|BAJ78219.1| 9/13-hydroperoxide lyase [Lotus japonicus]
Length=487

 Score =   436 bits (1120),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 228/450 (51%), Positives = 302/450 (67%), Gaps = 5/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR++FF  R++KY STV RTNMPPGP ISSDSKV+ LLD  SFP LFD S V
Sbjct  36    RHDYFYNQGRDKFFATRVEKYNSTVIRTNMPPGPGISSDSKVIALLDSASFPILFDNSKV  95

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRDV  GT+MPST  TGGYR  ++ D +EP+H  LK     +LS + +  LP      +
Sbjct  96    EKRDVLDGTFMPSTGFTGGYRACAFQDTTEPSHKLLKTFFMQVLSSKHNTFLPLLRTTLS  155

Query  363   EMFDTLEnelagngkaglnaanDQAA-FNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
             + F  L+++LAG         +  AA FNFL   L    P  T +    P L+  W+   
Sbjct  156   DHFSDLDSQLAGKSGKASFNTSISAATFNFLFLLLTDKHPSETVIGDKGPGLVTAWLGAQ  215

Query  540   LHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+ +LGLPK     ED L+ T   P   VK  Y++L E F     ++LD  E +G+ R
Sbjct  216   LAPLATLGLPKIFNYAEDFLIRTIPFPAWTVKWSYKKLCEGFASAGASLLDEAERVGIKR  275

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             +EA HNLVF   FN+FGG+   FP ++KWIG AG  LH +LA+EIR+VV+ + G+++++ 
Sbjct  276   DEAEHNLVFMLGFNAFGGLTNQFPILIKWIGLAGPELHAKLAEEIRTVVRESNGEVSLSA  335

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L KS VYE  RIEP VP QY +A+ D+V+ESHDA F++K+GEM+FG+QPFATKDP
Sbjct  336   LDKMTLTKSVVYEVLRIEPAVPYQYAKAREDVVVESHDAAFEIKKGEMIFGYQPFATKDP  395

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             K+F+  +EF+ HRFVGE G+ LLK+V WSNGRETE PTV++KQC  K+ V+L+ RL +VE
Sbjct  396   KVFENPEEFVGHRFVGE-GEKLLKYVYWSNGRETEEPTVDNKQCPAKNLVVLMCRLYVVE  454

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FLRYD+F  E     LG +VT+ SL +AT
Sbjct  455   FFLRYDTFTFEFKPVVLGPNVTIESLTKAT  484



>ref|XP_010255209.1| PREDICTED: allene oxide synthase, chloroplastic-like [Nelumbo 
nucifera]
Length=462

 Score =   432 bits (1112),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 235/431 (55%), Positives = 295/431 (68%), Gaps = 54/431 (13%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+DYFYNQGR+EFF+ RIQKY STVFR NMPPGPF++S+  VV L+D  SFP LF VS V
Sbjct  46    RLDYFYNQGRDEFFKTRIQKYGSTVFRANMPPGPFMASNPNVVVLVDAVSFPVLFGVSKV  105

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRD+ TGTYMPST LTGGYR+ +Y+DPSEPNH KLK L+F LLS R    +PEFH +++
Sbjct  106   EKRDLLTGTYMPSTALTGGYRVCAYLDPSEPNHTKLKRLIFLLLSSRHSKYIPEFHKSFS  165

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +FD LE E+   G+A  N  ND+ +F++L ++ +  DP  TK+       + KW+ F L
Sbjct  166   VLFDNLETEIKNKGEANFNNLNDKTSFDYLLKAYFDKDPAETKIESKGSNYVTKWLFFQL  225

Query  543   HPVLSLGLPKQ---IEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              P+++LGLPK    +ED LLHTF LPP LVK DY +LY+ FY ++ A+LD  E +G++R+
Sbjct  226   CPLITLGLPKLVSFVEDILLHTFPLPPFLVKSDYMKLYDVFYTSAAALLDEAEKMGLNRK  285

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EACHNL+F TCFN++GGMKI FP ++KW+G AG  LH QLA EIR+ VKA GGK      
Sbjct  286   EACHNLLFVTCFNAYGGMKILFPALMKWVGLAGEELHKQLADEIRAAVKAEGGK------  339

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
                                                         GEM+FGFQPFATKDPK
Sbjct  340   --------------------------------------------GEMIFGFQPFATKDPK  355

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             IFD+A+E+I  RFVGE G+ LLK+V WSNGRETENPT  +KQC GKDFV+LV+RL+LVEL
Sbjct  356   IFDKAEEYIACRFVGE-GEKLLKYVFWSNGRETENPTEGNKQCPGKDFVVLVARLLLVEL  414

Query  1254  FLRYDSFDIEV  1286
             FLRYDSF +E 
Sbjct  415   FLRYDSFTVET  425



>gb|AFA28142.1| allene oxide synthase, partial [Triticum aestivum]
Length=411

 Score =   430 bits (1106),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 221/411 (54%), Positives = 301/411 (73%), Gaps = 1/411 (0%)
 Frame = +3

Query  42    FRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVVEKRDVFTGTYMPS  221
             F  R+++Y STV R N+PPGPF++ D +VV +LD KSFP LFDV  VEK+++FTGTYMPS
Sbjct  1     FESRVERYGSTVVRINVPPGPFMARDPRVVAVLDAKSFPVLFDVDKVEKKNLFTGTYMPS  60

Query  222   TELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYAEMFDTLEnelagn  401
             T LTGG+R+ SY+DPSEP HAK+K L+F LL+ R+   +P F + ++ +  T+E++L   
Sbjct  61    TSLTGGFRVCSYLDPSEPTHAKVKQLLFSLLASRKDAFIPAFRSHFSSLLATVESQLVLG  120

Query  402   gkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNLHPVLSLGLPKQIE  581
             GKA  N  ND  +F F+  + +GV P  + L    P    KW++F LHP+++LGLP  +E
Sbjct  121   GKANFNTLNDATSFEFIGDAYFGVLPSASDLGTTGPAKAAKWLIFQLHPLVTLGLPMILE  180

Query  582   DPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEACHNLVFATCFNSFG  761
             +PLLHT  LPP LV  DY+ LY++F   +T  LD  E LG+ R+EACHNL+FAT FNS+G
Sbjct  181   EPLLHTVHLPPILVSGDYKVLYKYFNAAATKALDTAEGLGLKRDEACHNLLFATVFNSYG  240

Query  762   GMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQMELMKSTVYESFRI  941
             G+K+  P +L  I  AG   H +L  EIR+ V   GGK+T+  +E+MEL KS V+E+ R+
Sbjct  241   GLKVLLPGILARIAGAGEKFHQKLVAEIRAAVADAGGKVTVEALEKMELTKSAVWEALRL  300

Query  942   EPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFD-RAQEFIPHRFVG  1118
             +PPV  QYGRAK D+ IESHDA F VK+GEMLFG+QP AT+DP++F   A+EF+  RFVG
Sbjct  301   DPPVKFQYGRAKADMNIESHDAVFAVKKGEMLFGYQPCATRDPRVFSPTAREFVGDRFVG  360

Query  1119  EKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLRYDS  1271
             E+G+ LL++V WSNGRETE+P+V++KQC GK+ V+LV RL++VELFLRYD+
Sbjct  361   EEGRKLLQYVYWSNGRETESPSVDNKQCPGKNLVVLVGRLLVVELFLRYDT  411



>emb|CAC86899.1| 9/13 hydroperoxide lyase [Medicago truncatula]
 gb|KEH40766.1| fatty acid hydroperoxide lyase [Medicago truncatula]
Length=485

 Score =   431 bits (1107),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 224/452 (50%), Positives = 312/452 (69%), Gaps = 9/452 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR++FF  RIQKY ST+FRTNMPPGPFISS+ +V+ LLD  SFP LFD   V
Sbjct  35    RHDYFYNQGRDKFFSTRIQKYNSTIFRTNMPPGPFISSNPRVIALLDAASFPILFDNKKV  94

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK +V  GT+MPST+ TGGYR+ +Y+D +EPNHA +K      L  R+   +P F    +
Sbjct  95    EKLNVLDGTFMPSTKFTGGYRVCAYLDTTEPNHALIKGFYLNTLLLRKDTFIPLFKTILS  154

Query  363   EMFDTLEnelagngkagl-naanDQAAFNFLARSLYGVD--PMRTKLRLDAPKLIGKWVL  533
             + F+ +E+ L+        N+    A+FNF+ + L+  D  P  T L    PK+   W+L
Sbjct  155   DGFNEIEDGLSSKSGKADFNSMVSVASFNFMFK-LFCDDKNPSETILGDQGPKMFDTWLL  213

Query  534   FNLHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGV  704
             F L P+ +LG PK    +ED LL T   P  L +  Y++LYE F  ++T +L+  E  G+
Sbjct  214   FQLAPLATLGPPKIFNYLEDILLRTVPFPACLTRSSYKKLYEAFSTSATTMLNEAEKAGL  273

Query  705   SREEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITM  884
              R EA HN++F   FN++GG+K  FP + KW+G +G  LH +LA EIR+VVK  GG +T+
Sbjct  274   KRSEALHNIIFTAGFNAYGGLKNQFPILFKWLGSSGEELHKELANEIRTVVKQEGG-VTI  332

Query  885   AGMEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATK  1064
               +E+M L+KS VYE+ RIEP VP QY +A+ D++++SHDA F++K+GEM+FG+QPFATK
Sbjct  333   QSLEKMPLVKSVVYEAMRIEPAVPYQYAKAREDLIVKSHDAAFEIKKGEMIFGYQPFATK  392

Query  1065  DPKIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLML  1244
             DP++FD  + F+  RFVGE G+ LLK+VLWSNG+ETE P+V +KQC GK+ V+L+ RL+L
Sbjct  393   DPRVFDDPEVFVAKRFVGE-GEKLLKYVLWSNGKETEEPSVGNKQCPGKNLVVLLCRLLL  451

Query  1245  VELFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
             VE FLRYD+F+ E   +  GA+V++TSL +A+
Sbjct  452   VEFFLRYDTFENETKNNAFGAAVSITSLTKAS  483



>ref|XP_003606860.1| Allene oxide synthase [Medicago truncatula]
 emb|CAC86898.1| 9/13 hydroperoxide lyase [Medicago truncatula]
 gb|AES89057.1| fatty acid hydroperoxide lyase [Medicago truncatula]
Length=482

 Score =   429 bits (1102),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 220/450 (49%), Positives = 301/450 (67%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR+++F+ RI+KY STV + NMPPG FI+ D KV+ LLDG SFP LFD + V
Sbjct  32    RHDYFYNQGRDKYFQTRIEKYNSTVLKLNMPPGGFIAPDPKVIALLDGASFPILFDNAKV  91

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRDV  GT+MPST+  GGYR  ++ D +EP+H+ LK  +F +LS +    +P F     
Sbjct  92    EKRDVLDGTFMPSTDFFGGYRTCAFQDTAEPSHSLLKRFIFHILSSKHDTFIPLFQTNLT  151

Query  363   EMFDTLEnelagngkagl-naanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
             E F  LE ELAG  +    N +     FNFL + +   +P  TK+    P L+  W+   
Sbjct  152   EHFTDLEKELAGKHQKASFNTSIGGITFNFLFKLITDKNPSETKIGDSGPTLVQTWLAAQ  211

Query  540   LHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+ + GLPK    +ED L+ T  +P   VK  Y +LYE   E  T +LD  E +G+ R
Sbjct  212   LAPLATAGLPKIFNYLEDVLIRTIPIPAWTVKSSYNKLYEGLMEAGTTVLDEAEKMGIKR  271

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             EEACHNLVF   FN+FGG+   FP ++KW+G AG  LH +LA EIR++V+  GG + +  
Sbjct  272   EEACHNLVFTLGFNAFGGLTNQFPILIKWVGLAGADLHKKLADEIRAIVREEGG-VNLYA  330

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L KSTVYE+ RIEP VP QY +A+ D+V++SHDA F++K+GEM+FG+QPFATKD 
Sbjct  331   LDKMTLTKSTVYEALRIEPAVPYQYAKAREDLVVQSHDASFEIKKGEMIFGYQPFATKDA  390

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             KIFD+ ++FI  RF+G+ G+ LLKHV WSNGRET+  T ++K C  K+ V+L+ RL LVE
Sbjct  391   KIFDKPEDFIAERFIGD-GEKLLKHVFWSNGRETDEATPDNKICPAKNLVVLLCRLYLVE  449

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FL YD+F  +   S LG ++T+ SL +A+
Sbjct  450   FFLNYDTFTFDFKPSVLGPTITIKSLVKAS  479



>gb|ACJ85747.1| unknown [Medicago truncatula]
 gb|AFK35135.1| unknown [Medicago truncatula]
Length=482

 Score =   428 bits (1100),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 220/450 (49%), Positives = 301/450 (67%), Gaps = 6/450 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFYNQGR+++F+ RI+KY STV + NMPPG FI+SD KV+ LLDG SFP LFD + V
Sbjct  32    RHDYFYNQGRDKYFQTRIEKYNSTVLKLNMPPGGFIASDPKVIALLDGASFPILFDNAKV  91

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRDV  GT+MPST+  GGYR  ++ D +EP+H+ LK  +F +LS +    +P       
Sbjct  92    EKRDVLDGTFMPSTDFFGGYRTCAFQDTAEPSHSLLKRFIFHILSSKHDTFIPLSQTNLT  151

Query  363   EMFDTLEnelagngkagl-naanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFN  539
             E F  LE ELAG  +    N +     FNFL + +   +P  TK+    P L+  W+   
Sbjct  152   EHFTDLEKELAGKHQKASFNTSIGGITFNFLFKLITDKNPSETKIGDSGPTLVQTWLAAQ  211

Query  540   LHPVLSLGLPK---QIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSR  710
             L P+ + GLPK    +ED L+ T  +P   VK  Y +LYE   E  T +LD  E +G+ R
Sbjct  212   LAPLATAGLPKIFNYLEDVLIRTIPIPAWTVKSSYNKLYEGLMEAGTTVLDEAEKMGIKR  271

Query  711   EEACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAG  890
             EEACHNLVF   FN+FGG+   FP ++KW+G AG  LH +LA EIR++V+  GG + +  
Sbjct  272   EEACHNLVFTLGFNAFGGLTNQFPILIKWVGLAGADLHKKLADEIRAIVREEGG-VNLYA  330

Query  891   MEQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDP  1070
             +++M L KSTVYE+ RIEP VP QY +A+ D+V++SHDA F++K+GEM+FG+QPFATKD 
Sbjct  331   LDKMTLTKSTVYEALRIEPAVPYQYAKAREDLVVQSHDASFEIKKGEMIFGYQPFATKDA  390

Query  1071  KIFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVE  1250
             KIFD+ ++FI  RF+G+ G+ LLKHV WSNGRET+  T ++K C  K+ V+L+ RL LVE
Sbjct  391   KIFDKPEDFIAERFIGD-GEKLLKHVFWSNGRETDEATPDNKICPAKNLVVLLCRLYLVE  449

Query  1251  LFLRYDSFDIEVGMSPLGASVTLTSLKRAT  1340
              FL YD+F  +   S LG ++T+ SL +A+
Sbjct  450   FFLNYDTFTFDFKPSVLGPTITIKSLVKAS  479



>gb|AAU93400.1| plastid allene oxide synthase [Humulus lupulus]
Length=299

 Score =   419 bits (1077),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 210/299 (70%), Positives = 246/299 (82%), Gaps = 0/299 (0%)
 Frame = +3

Query  225   ELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYAEMFDTLEnelagng  404
             ELTGG+RILSY+DPSEP HAKLK+L+FF+L  RR  ++PEFH  Y E+F+ LE++LA  G
Sbjct  1     ELTGGHRILSYLDPSEPKHAKLKSLIFFMLKARRDMVIPEFHATYTELFENLESDLAAKG  60

Query  405   kaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNLHPVLSLGLPKQIED  584
             K     ANDQAAF FL R+LYGV P  TKL  D PKL+ KWVLFNLHP+L LGLPK +E+
Sbjct  61    KTSFGEANDQAAFKFLGRALYGVSPTDTKLGTDGPKLVQKWVLFNLHPILVLGLPKLVEE  120

Query  585   PLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEACHNLVFATCFNSFGG  764
               +H+FRLP  LVK DY+RLY++FYE    +LD  E +G+SREEACHNL+FATCFN+FGG
Sbjct  121   LAIHSFRLPSFLVKSDYRRLYDYFYEAGGYVLDEAEQMGISREEACHNLIFATCFNTFGG  180

Query  765   MKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQMELMKSTVYESFRIE  944
             MKI FPNMLK IGR  V LHTQLA+EIR  V++NGGK+TMA MEQM LMKS VYE+FR E
Sbjct  181   MKILFPNMLKSIGRVRVKLHTQLAEEIRGAVRSNGGKVTMAAMEQMPLMKSVVYEAFRFE  240

Query  945   PPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFDRAQEFIPHRFVGE  1121
             PPVP QYGRAK+D+VIESHDA F+VKEGEMLFGFQPFATKDPKIFDRA+EF+P RFVGE
Sbjct  241   PPVPLQYGRAKKDLVIESHDAVFEVKEGEMLFGFQPFATKDPKIFDRAEEFVPDRFVGE  299



>gb|KCW63873.1| hypothetical protein EUGRSUZ_G01540 [Eucalyptus grandis]
Length=385

 Score =   419 bits (1077),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 213/433 (49%), Positives = 285/433 (66%), Gaps = 58/433 (13%)
 Frame = +3

Query  54    IQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVVEKRDVFTGTYMPSTELT  233
             ++KY+STVFR NMPPGPFISS+  VV LLD  SFP LFD S VEKR+V  GTYMPST  T
Sbjct  1     MRKYRSTVFRVNMPPGPFISSNPNVVVLLDAISFPVLFDTSKVEKRNVLDGTYMPSTAFT  60

Query  234   GGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYAEMFDTLEnelagngkag  413
             GG+R  +++DPSEP HA +K+    LL+ RR+  +P   ++   MFD             
Sbjct  61    GGHRACAFLDPSEPKHATIKHWFLSLLAARRNVFIPTLRSS---MFDL------------  105

Query  414   lnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNLHPVLSLGLPKQI----E  581
                                                  W+L  L P+ SLG    +    E
Sbjct  106   -------------------------------------WILLQLAPISSLGFNNMVLNFLE  128

Query  582   DPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEACHNLVFATCFNSFG  761
             D + HTF LPP L+K  Y++LY+ F E+++++LD  E LG+ R+EACHNLVF   FN++G
Sbjct  129   DVIFHTFPLPPLLIKSSYKKLYDAFSEHASSVLDEAERLGIDRDEACHNLVFLAGFNAYG  188

Query  762   GMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQMELMKSTVYESFRI  941
             GMK   P ++KW+G  G  LH +LA+EIRS + A+ G++T+A +++M L KS VYE+ RI
Sbjct  189   GMKATLPILIKWVGSGGEDLHRRLAREIRSTI-ASEGEVTLATLDKMNLTKSVVYEALRI  247

Query  942   EPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIFDRAQEFIPHRFVGE  1121
             +PPV  QYG+AKRD+V+ SHDA FQ+K+GEM+FG+QPFATKDP++FD  ++F+  RFVGE
Sbjct  248   DPPVQFQYGKAKRDMVVRSHDAAFQIKKGEMVFGYQPFATKDPRVFDDPEDFVGDRFVGE  307

Query  1122  KGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVELFLRYDSFDIEVGMSPL  1301
              G+ LLK+V WSNGRE ++PTV +KQC GKD V+L  R+MLVELFLRYD+F +E G  P+
Sbjct  308   -GEKLLKYVYWSNGREIDDPTVGNKQCPGKDLVLLTCRVMLVELFLRYDTFGMECGSLPV  366

Query  1302  GASVTLTSLKRAT  1340
             G+SVT  SL +AT
Sbjct  367   GSSVTFKSLTKAT  379



>gb|AAO43440.1| allene oxide synthase [Triticum aestivum]
Length=465

 Score =   414 bits (1065),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 210/405 (52%), Positives = 292/405 (72%), Gaps = 2/405 (0%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D++Y QG  ++F  R++K+ STV R N+PPGPF++ D +VV +LD KSFP LFDV  V
Sbjct  29    RLDFYYFQGEAKYFESRVEKHGSTVLRINVPPGPFMARDPRVVAVLDAKSFPVLFDVDKV  88

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EK+++FTGTYMPST LTGG+R+ SY+DPSEP H K+K L+F LL+ R+  ++P F + ++
Sbjct  89    EKKNLFTGTYMPSTSLTGGFRVCSYLDPSEPTHTKVKQLLFSLLASRKDAVIPAFRSHFS  148

Query  363   EMFDTLEnelagngkaglnaanDQAAFNFLARSLYGVDPMRTKLRLDAPKLIGKWVLFNL  542
              +  T+E++L   GK+  N  ND  +F F+A + +GV P  + L    P    KW++F L
Sbjct  149   SLLATVESQLVLAGKSNFNTLNDFTSFEFIADAYFGVLPSASDLGTTGPTKAAKWLIFQL  208

Query  543   HPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREEAC  722
             HP+++ GLP  +E+PLLHT  LPP  V  DY+ LY++ Y  +T  LD  E LG++R+EAC
Sbjct  209   HPLVTFGLPLILEEPLLHTVLLPPIFVSGDYKALYKYLYAAATKALDMAESLGLNRDEAC  268

Query  723   HNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGMEQM  902
             HNL+FAT FNS+GG+K+  P +L  I  AG   H +LA E+R+ V   GGK+T+  +E+M
Sbjct  269   HNLLFATVFNSYGGLKVMLPGILGRIAEAGEKFHQRLAAEVRTAVADAGGKVTIEALEKM  328

Query  903   ELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKIF-  1079
             EL KS V+E+ R+EPPV  QYGRAK D+ IESHDA F V +GEMLFG+QP ATKDP++F 
Sbjct  329   ELTKSAVWEALRLEPPVKFQYGRAKADMNIESHDAVFAVNKGEMLFGYQPCATKDPRVFG  388

Query  1080  DRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKD  1214
               A+EF+  RFVGE+ K LL++  WSNGRETE+P+V++KQC GK+
Sbjct  389   STAREFVGDRFVGERSK-LLQYAYWSNGRETESPSVDNKQCPGKN  432



>ref|NP_001049436.1| Os03g0225900 [Oryza sativa Japonica Group]
 sp|Q7XYS3.2|C74A2_ORYSJ RecName: Full=Allene oxide synthase 2; AltName: Full=Cytochrome 
P450 74A2; AltName: Full=Hydroperoxide dehydrase 2 [Oryza 
sativa Japonica Group]
 gb|AAL38184.1| allene oxide synthase [Oryza sativa Japonica Group]
 gb|AAN52753.1| Putative allene oxide synthase [Oryza sativa Japonica Group]
 gb|ABF94742.1| Cytochrome P450 74A2, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11350.1| Os03g0225900 [Oryza sativa Japonica Group]
 gb|EAY89103.1| hypothetical protein OsI_10591 [Oryza sativa Indica Group]
 dbj|BAG88095.1| unnamed protein product [Oryza sativa Japonica Group]
Length=478

 Score =   413 bits (1062),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 237/444 (53%), Positives = 317/444 (71%), Gaps = 3/444 (1%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R+D++Y QG++++F  R ++Y STV R N+PPGPF++ D +VV LLD KSFP LFDV+ V
Sbjct  27    RLDFYYLQGQDKYFESRAERYGSTVVRINVPPGPFMARDPRVVALLDAKSFPVLFDVAKV  86

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             EKRDVFTGT+MPST LTGGYR+ +Y+DPSEPNHAK+K L+  LL  R+   +P F + + 
Sbjct  87    EKRDVFTGTFMPSTSLTGGYRVCAYLDPSEPNHAKIKQLLLSLLVSRKDAFVPVFRSNFG  146

Query  363   EMFDTLEnelagngkagl-naanDQAAFNFLARSLYGVDP-MRTKLRLDAPKLIGKWVLF  536
              + DT+E++LA  G      A ND  +F F+  + +GV P   + L    P     W+L+
Sbjct  147   ALLDTVESQLASGGGKSDFTALNDATSFEFIGEAYFGVRPSASSSLGTGGPTKAALWLLW  206

Query  537   NLHPVLSLGLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSREE  716
              L P+ +LGLP  IEDPLLHT  LPP L+  DY+ LY +F   ++  LD  E LG+SREE
Sbjct  207   QLAPLTTLGLPMIIEDPLLHTLPLPPFLISSDYKALYAYFAAAASQALDAAEGLGLSREE  266

Query  717   ACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGME  896
             ACHNL+FAT FNS+GG K+  P +L  + +AG  LH +LA EIRS V   GG +T+A +E
Sbjct  267   ACHNLLFATVFNSYGGFKLLLPQILSRVAQAGEKLHERLAAEIRSAVADAGGNVTLAALE  326

Query  897   QMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPKI  1076
             +MEL +S V+E+ R++PPV  QYGRAK D+ IESHDA F +K+GEMLFG+QP AT+DP++
Sbjct  327   KMELTRSVVWEALRLDPPVRFQYGRAKADLEIESHDASFAIKKGEMLFGYQPCATRDPRV  386

Query  1077  FD-RAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             F   A+EF+  RFVGE+G+ LL++V WSNGRETENP+V++KQC GK+ V+LV RL+LVEL
Sbjct  387   FGATAREFVGDRFVGEEGRKLLQYVYWSNGRETENPSVDNKQCPGKNLVVLVGRLLLVEL  446

Query  1254  FLRYDSFDIEVGMSPLGASVTLTS  1325
             FLRYD+F  E G   +   VT  S
Sbjct  447   FLRYDTFTAEAGKKVVITGVTKAS  470



>ref|XP_009761532.1| PREDICTED: 9-divinyl ether synthase [Nicotiana sylvestris]
 sp|Q8W2N5.1|DES_TOBAC RecName: Full=9-divinyl ether synthase; Short=NtDES1; AltName: 
Full=Colneleate synthase; AltName: Full=Cytochrome P450 74D3 
[Nicotiana tabacum]
 gb|AAL40900.1|AF070976_1 divinyl ether synthase [Nicotiana tabacum]
Length=478

 Score =   412 bits (1058),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 209/451 (46%), Positives = 300/451 (67%), Gaps = 8/451 (2%)
 Frame = +3

Query  3     RIDYFYNQGREEFFRQRIQKYQSTVFRTNMPPGPFISSDSKVVCLLDGKSFPTLFDVSVV  182
             R DYFY QG + +F  + +KY STV + NM PGPF S+D K+V  LD  SF  +FD S++
Sbjct  31    RYDYFYKQGEDVWFHSKAEKYNSTVVKINMAPGPFTSNDYKLVAFLDANSFVYMFDNSLI  90

Query  183   EKRDVFTGTYMPSTELTGGYRILSYIDPSEPNHAKLKNlmffllshrrhhllPEFHNAYA  362
             +K D   GT+ P  E  GGYR ++++D S+PNHA LKN +    + R +  +P F N+ +
Sbjct  91    DKTDTLGGTFKPGKEYYGGYRPVAFVDTSDPNHAALKNYILTSFAKRHNLFIPLFRNSVS  150

Query  363   E-MFDTLEnelagngkaglnaanDQAAFNFLARSLYG-VDPMRTKLRLDAPKLIGKWVLF  536
             + +F  LE +++  GK+  NA      F F+ R L    +P  T L    P+ + KW+  
Sbjct  151   DHLFQNLEKQVSDQGKSDFNALLPNMTFGFIFRLLCDQTNPSDTVLGAQGPEHLRKWLFP  210

Query  537   NLHPVLSL-GLPKQIEDPLLHTFRLPPALVKKDYQRLYEFFYENSTAILDHGEILGVSRE  713
              L P LS   LP  IED L H F +P  LVK DY +L + F +N+ ++LD  E LG+ RE
Sbjct  211   QLIPSLSARKLPSFIEDLLFHNFLIPFGLVKSDYNKLVDAFSKNAGSMLDEAEKLGIKRE  270

Query  714   EACHNLVFATCFNSFGGMKIFFPNMLKWIGRAGVSLHTQLAKEIRSVVKANGGKITMAGM  893
             EA HN++F    N F G+  FFP++++++G AG +LH +LAKEIR+ +K  GG +T++ +
Sbjct  271   EAVHNILFLVGINMFAGLNAFFPHLIRFVGEAGPTLHARLAKEIRTAIKEEGGAVTLSAI  330

Query  894   EQMELMKSTVYESFRIEPPVPTQYGRAKRDIVIESHDARFQVKEGEMLFGFQPFATKDPK  1073
              +M L++S VYE+ R+ PPVP QYG+AK+D +++SHDA + +K+G+ L G+QP A++DPK
Sbjct  331   NKMSLVESIVYETLRLRPPVPLQYGKAKKDFMVQSHDASYMIKKGQFLVGYQPMASRDPK  390

Query  1074  IFDRAQEFIPHRFVGEKGKALLKHVLWSNGRETENPTVNDKQCAGKDFVMLVSRLMLVEL  1253
             IFD+  +FIP RF+GE G  +LKHVLWSNGRETENP  ++KQCAGKD V L+ RLMLVE 
Sbjct  391   IFDKPDDFIPDRFMGE-GVKMLKHVLWSNGRETENPAPDNKQCAGKDLVHLLGRLMLVEF  449

Query  1254  FLRYDSFDIEVGMSPL--GASVTLTSLKRAT  1340
             FLRYD+F +E+  +PL    +V + +L +AT
Sbjct  450   FLRYDTFTVEI--TPLFRAPNVAIKTLTKAT  478



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3744971002710