BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27628_g1_i1 len=1802 path=[1780:0-1801]

Length=1802
                                                                      Score     E

ref|XP_009630174.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    605   0.0      
ref|XP_009760353.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    605   0.0      
ref|XP_006362307.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    601   0.0      
ref|XP_004250903.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    598   0.0      
emb|CDP09622.1|  unnamed protein product                                593   0.0      
ref|XP_006419477.1|  hypothetical protein CICLE_v10005026mg             583   0.0      
gb|KDO71783.1|  hypothetical protein CISIN_1g012949mg                   582   0.0      
ref|XP_008385654.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    580   0.0      
ref|XP_009337716.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    580   0.0      
ref|XP_008227653.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    580   0.0      
ref|XP_002263865.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    580   0.0      Vitis vinifera
gb|KDP43190.1|  hypothetical protein JCGZ_22742                         577   0.0      
gb|EYU46179.1|  hypothetical protein MIMGU_mgv1a007248mg                576   0.0      
ref|XP_007211727.1|  hypothetical protein PRUPE_ppa006068mg             574   0.0      
gb|KDO71784.1|  hypothetical protein CISIN_1g012949mg                   569   0.0      
ref|XP_007015227.1|  Aldolase superfamily protein isoform 1             568   0.0      
ref|XP_010088968.1|  Hydroxymethylglutaryl-CoA lyase                    568   0.0      
ref|XP_011036394.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    567   0.0      
ref|XP_011080451.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    567   0.0      
ref|XP_002314006.1|  putative hydroxymethylglutaryl-CoA lyase fam...    567   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008449633.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    564   0.0      
ref|XP_004140185.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    564   0.0      
ref|XP_003545429.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    564   0.0      
ref|XP_008449632.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    563   0.0      
ref|XP_003529496.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    560   0.0      
ref|XP_009343554.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    559   0.0      
ref|XP_003518478.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    558   0.0      
ref|XP_003555172.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    558   0.0      
gb|KHN27356.1|  Hydroxymethylglutaryl-CoA lyase, mitochondrial          558   0.0      
ref|XP_006397376.1|  hypothetical protein EUTSA_v10022501mg             558   0.0      
ref|XP_010544284.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    557   0.0      
ref|XP_010045087.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    556   0.0      
ref|XP_006397377.1|  hypothetical protein EUTSA_v10022501mg             558   0.0      
gb|KHN11014.1|  Hydroxymethylglutaryl-CoA lyase, mitochondrial          556   0.0      
ref|XP_010544283.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    558   0.0      
ref|XP_010271863.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    553   0.0      
ref|XP_004510817.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    553   0.0      
ref|NP_850087.1|  Hydroxymethylglutaryl-CoA lyase                       552   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002880836.1|  hypothetical protein ARALYDRAFT_481553             553   0.0      
ref|XP_007141518.1|  hypothetical protein PHAVU_008G202900g             550   0.0      
ref|NP_565629.1|  Hydroxymethylglutaryl-CoA lyase                       551   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007146147.1|  hypothetical protein PHAVU_006G016200g             549   0.0      
ref|XP_006294144.1|  hypothetical protein CARUB_v10023137mg             550   0.0      
ref|XP_010473064.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    547   0.0      
ref|XP_003599680.1|  Hydroxymethylglutaryl-CoA lyase                    546   0.0      
ref|XP_010510861.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    545   0.0      
ref|XP_010473063.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    546   0.0      
gb|KEH33538.1|  hydroxymethylglutaryl-CoA lyase                         545   0.0      
ref|XP_010417825.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    545   0.0      
ref|XP_010510859.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    544   0.0      
ref|XP_010417824.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    544   0.0      
ref|XP_009133927.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    541   0.0      
emb|CDX83245.1|  BnaA03g22610D                                          541   0.0      
dbj|BAE71196.1|  putative hydroxymethylglutaryl-CoA lyase               541   0.0      Trifolium pratense [peavine clover]
ref|XP_009133925.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    540   0.0      
ref|XP_010673785.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    536   0.0      
ref|XP_010510860.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    538   0.0      
ref|XP_008786857.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    535   0.0      
ref|XP_008786856.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    535   0.0      
ref|XP_010931529.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    529   2e-180   
ref|XP_010931528.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    528   1e-179   
emb|CDY38533.1|  BnaC03g26640D                                          527   5e-179   
ref|XP_009383249.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    523   1e-178   
ref|XP_008788508.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    524   1e-178   
ref|XP_010922056.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    523   4e-178   
ref|XP_010922054.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    524   7e-178   
ref|XP_008798376.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    504   2e-170   
ref|XP_008798372.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    504   4e-170   
ref|XP_008798371.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    504   6e-170   
ref|XP_009395943.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    503   1e-169   
ref|XP_009103560.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    496   6e-168   
ref|XP_009103559.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    496   8e-168   
ref|XP_010909004.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    496   2e-167   
ref|XP_010909003.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    496   5e-167   
ref|XP_010247162.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    492   7e-166   
ref|XP_006836266.1|  hypothetical protein AMTR_s00101p00146100          491   2e-165   
ref|XP_010247161.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    491   4e-165   
emb|CDY04467.1|  BnaA07g12930D                                          490   6e-165   
ref|XP_003599681.1|  Hydroxymethylglutaryl-CoA lyase                    484   7e-164   
ref|XP_010922055.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    486   2e-163   
ref|XP_010521562.1|  PREDICTED: LOW QUALITY PROTEIN: hydroxymethy...    498   3e-163   
emb|CDX71485.1|  BnaC04g17200D                                          483   7e-163   
ref|XP_010653622.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    474   1e-158   
ref|XP_009760355.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    471   2e-158   
ref|XP_010238769.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    471   5e-158   
emb|CBI32791.3|  unnamed protein product                                468   7e-157   
ref|XP_011040755.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    467   1e-156   
gb|EMT18732.1|  Hydroxymethylglutaryl-CoA lyase, mitochondrial          471   1e-156   
ref|XP_010653624.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    466   2e-156   
ref|XP_011040754.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    467   3e-156   
gb|KDP37694.1|  hypothetical protein JCGZ_06351                         466   5e-156   
ref|XP_004229450.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    465   1e-155   
ref|XP_002517305.1|  hydroxymethylglutaryl-CoA lyase, putative          463   3e-155   Ricinus communis
gb|ABA95738.2|  Hydroxymethylglutaryl-CoA lyase, mitochondrial pr...    463   3e-155   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010653628.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    460   4e-155   
gb|ABA91354.1|  Hydroxymethylglutaryl-CoA lyase, mitochondrial pr...    462   5e-155   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009763934.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    461   7e-155   
ref|XP_008240671.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    461   8e-155   
ref|XP_010673052.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    464   1e-154   
ref|XP_009763933.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    462   2e-154   
ref|XP_006339410.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    462   2e-154   
emb|CBX24399.1|  hypothetical_protein                                   461   5e-154   
ref|XP_006663802.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    460   7e-154   
ref|XP_011075457.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    461   8e-154   
gb|ABR16866.1|  unknown                                                 462   1e-153   Picea sitchensis
gb|EPS65155.1|  hypothetical protein M569_09626                         459   2e-153   
ref|XP_006430529.1|  hypothetical protein CICLE_v10011898mg             459   3e-153   
ref|XP_004288605.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    456   7e-153   
ref|XP_010112831.1|  Hydroxymethylglutaryl-CoA lyase                    456   7e-153   
ref|XP_009588073.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    457   1e-152   
emb|CDM82754.1|  unnamed protein product                                457   4e-152   
ref|XP_006482060.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    456   4e-152   
ref|XP_006419478.1|  hypothetical protein CICLE_v10005026mg             454   5e-152   
gb|ACG45252.1|  hydroxymethylglutaryl-CoA lyase                         456   8e-152   Zea mays [maize]
gb|KDO71785.1|  hypothetical protein CISIN_1g012949mg                   453   1e-151   
ref|NP_001132253.1|  hydroxymethylglutaryl-CoA lyase                    455   3e-151   Zea mays [maize]
ref|XP_004967725.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    454   9e-151   
ref|XP_010055785.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    454   2e-150   
gb|KHN08894.1|  Hydroxymethylglutaryl-CoA lyase, mitochondrial          448   2e-150   
gb|EYU18607.1|  hypothetical protein MIMGU_mgv1a007389mg                452   2e-150   
ref|XP_004973309.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    452   4e-150   
ref|XP_004973199.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    452   5e-150   
ref|XP_007028281.1|  Aldolase superfamily protein                       449   1e-149   
ref|XP_008443338.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    449   1e-149   
gb|KCW90023.1|  hypothetical protein EUGRSUZ_A02227                     452   1e-149   
ref|XP_006604320.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    447   2e-149   
ref|XP_003566872.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    451   2e-149   
ref|XP_010230759.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    451   2e-149   
ref|XP_002448945.1|  hypothetical protein SORBIDRAFT_05g002170          447   6e-149   Sorghum bicolor [broomcorn]
ref|NP_001150050.1|  LOC100283677                                       447   7e-149   Zea mays [maize]
gb|ACL53018.1|  unknown                                                 447   1e-148   Zea mays [maize]
ref|XP_006644039.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    446   1e-148   
ref|XP_004136670.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    446   2e-148   
ref|XP_003554113.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    447   2e-148   
ref|XP_007162069.1|  hypothetical protein PHAVU_001G121000g             447   2e-148   
gb|ABN08537.1|  Pyruvate carboxyltransferase                            446   2e-148   Medicago truncatula
ref|XP_004493382.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    446   5e-148   
ref|XP_004289586.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    442   7e-148   
ref|XP_004159633.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    444   8e-148   
ref|XP_004977480.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    443   2e-147   
ref|NP_001066093.1|  Os12g0134000                                       442   3e-147   Oryza sativa Japonica Group [Japonica rice]
gb|KHF99280.1|  Hydroxymethylglutaryl-CoA lyase, mitochondrial -l...    441   8e-147   
ref|XP_008798375.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    443   1e-146   
dbj|BAD81168.1|  putative hydroxymethylglutaryl-CoA lyase               442   1e-146   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008677303.1|  PREDICTED: LOC100283677 isoform X1                 440   4e-146   
ref|NP_001042696.1|  Os01g0269000                                       442   4e-146   Oryza sativa Japonica Group [Japonica rice]
gb|KEH23586.1|  hydroxymethylglutaryl-CoA lyase                         437   6e-146   
emb|CBX25247.1|  hypothetical_protein                                   440   6e-146   
gb|EEC70380.1|  hypothetical protein OsI_01328                          442   1e-145   Oryza sativa Indica Group [Indian rice]
ref|XP_003624949.1|  Hydroxymethylglutaryl-CoA lyase                    437   2e-145   
emb|CBX25345.1|  hypothetical_protein                                   437   5e-145   
ref|XP_004980143.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    435   2e-144   
emb|CBX25437.1|  hypothetical_protein                                   434   5e-144   
ref|XP_002990507.1|  hypothetical protein SELMODRAFT_131779             419   6e-139   
ref|XP_002983750.1|  hypothetical protein SELMODRAFT_118899             418   7e-139   
ref|XP_001771511.1|  predicted protein                                  417   3e-138   
ref|XP_004510818.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    419   3e-138   
emb|CDP06202.1|  unnamed protein product                                419   5e-137   
ref|XP_002308880.2|  hypothetical protein POPTR_0006s03520g             408   2e-135   Populus trichocarpa [western balsam poplar]
ref|XP_007202441.1|  hypothetical protein PRUPE_ppa009949mg             405   3e-134   
ref|XP_001770817.1|  predicted protein                                  398   5e-131   
ref|XP_001767580.1|  predicted protein                                  394   4e-128   
ref|XP_007430573.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    380   8e-124   
ref|XP_002601472.1|  hypothetical protein BRAFLDRAFT_270381             379   2e-123   Branchiostoma floridae
ref|WP_028878535.1|  hydroxymethylglutaryl-CoA lyase                    378   3e-123   
ref|XP_008119004.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    378   4e-123   
ref|XP_007574236.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    379   4e-123   
ref|XP_008397801.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    378   1e-122   
ref|XP_005799199.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    377   3e-122   
ref|XP_003227616.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    377   4e-122   
ref|XP_007068091.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    375   1e-121   
ref|XP_010770898.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    374   2e-121   
ref|XP_010770897.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    374   3e-121   
ref|XP_008169232.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    374   4e-121   
ref|XP_006130547.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    374   4e-121   
gb|KFO81235.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    373   4e-121   
ref|XP_008613404.1|  hydroxymethylglutaryl-CoA lyase, mitochondrial     372   1e-120   
ref|XP_004082429.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    373   1e-120   
gb|KDO31235.1|  hydroxymethylglutaryl-CoA lyase                         371   3e-120   
gb|KFQ74252.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    370   6e-120   
ref|XP_008282420.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    371   7e-120   
gb|KFP02262.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    369   9e-120   
ref|XP_010729592.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    370   1e-119   
ref|XP_006980887.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    369   2e-119   
ref|XP_008493876.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    369   2e-119   
gb|KFO62189.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    369   2e-119   
ref|XP_004592315.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    369   2e-119   
ref|XP_008862524.1|  hypothetical protein H310_01244                    369   2e-119   
ref|XP_005988802.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    369   3e-119   
ref|XP_005238238.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    369   3e-119   
ref|XP_009909953.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    368   3e-119   
gb|KFQ56742.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    368   4e-119   
gb|KDO53630.1|  hypothetical protein CISIN_1g0158831mg                  365   5e-119   
ref|XP_004637657.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    368   7e-119   
ref|XP_003641072.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    368   7e-119   
gb|KFR07972.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    367   8e-119   
ref|XP_005433102.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    367   8e-119   
ref|XP_009821593.1|  hypothetical protein H257_00555                    367   8e-119   
gb|EMC90228.1|  putative 3-hydroxymethyl-3-methylglutaryl-CoA lya...    367   9e-119   
gb|KFO11432.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    367   1e-118   
ref|XP_005915581.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    368   1e-118   
gb|KFP15961.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    367   1e-118   
gb|KFW73605.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    367   1e-118   
ref|XP_010877513.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    368   1e-118   
ref|XP_005427979.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    368   1e-118   
gb|KFV99018.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    366   1e-118   
gb|KFZ58637.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    366   1e-118   
gb|KFQ68614.1|  hypothetical protein N335_11361                         366   2e-118   
gb|KGL82586.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    366   2e-118   
ref|XP_004940522.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    369   2e-118   
emb|CDQ74683.1|  unnamed protein product                                367   2e-118   
gb|KFQ75914.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    365   2e-118   
ref|XP_005486082.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    367   2e-118   
ref|XP_009080289.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    365   2e-118   
ref|XP_004556012.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    367   2e-118   
gb|KFP71293.1|  hypothetical protein N310_02806                         365   2e-118   
gb|KFQ63128.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    365   3e-118   
ref|XP_008316736.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    367   3e-118   
ref|XP_005317654.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    366   3e-118   
ref|XP_003415431.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    366   3e-118   
ref|XP_006631395.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    367   3e-118   
ref|XP_004377180.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    366   3e-118   
ref|XP_006196828.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    366   3e-118   
gb|KFM07856.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    365   4e-118   
ref|XP_005737201.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    366   4e-118   
ref|XP_005737202.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    367   4e-118   
ref|XP_003471376.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    366   4e-118   
gb|KFV63788.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    365   4e-118   
ref|NP_001085152.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase         366   4e-118   Xenopus laevis [clawed frog]
ref|XP_003387466.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase-like    366   4e-118   
ref|XP_005474136.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    366   5e-118   
gb|EMC78536.1|  Hydroxymethylglutaryl-CoA lyase                         364   5e-118   
gb|KFW72832.1|  hypothetical protein AS28_08604                         364   5e-118   
ref|XP_003212675.2|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    365   5e-118   
ref|XP_004465461.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    365   5e-118   
ref|XP_006800699.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    366   5e-118   
ref|WP_033067578.1|  hydroxymethylglutaryl-CoA lyase                    365   6e-118   
ref|XP_006777619.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    365   6e-118   
ref|NP_001185644.1|  hydroxymethylglutaryl-CoA lyase, mitochondri...    365   7e-118   
ref|XP_005518165.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    365   7e-118   
ref|XP_005518166.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    366   7e-118   
ref|XP_005506939.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    367   9e-118   
ref|XP_002934605.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    365   9e-118   
ref|XP_005513518.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    365   1e-117   
ref|XP_005739025.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    365   1e-117   
ref|XP_005513517.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    365   1e-117   
ref|XP_005300259.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    365   1e-117   
ref|XP_010574389.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    364   1e-117   
ref|NP_032280.2|  hydroxymethylglutaryl-CoA lyase, mitochondrial ...    365   1e-117   Mus musculus [mouse]
ref|XP_005607413.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    364   1e-117   
ref|XP_003441173.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    365   1e-117   
ref|XP_003962602.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    365   1e-117   
gb|ERE82297.1|  hydroxymethylglutaryl-CoA lyase                         364   1e-117   
ref|XP_009330466.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    365   1e-117   
ref|XP_004657383.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    365   1e-117   
gb|EOB08912.1|  Putative 3-hydroxymethyl-3-methylglutaryl-CoA lya...    363   1e-117   
ref|NP_776092.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cyt...    365   1e-117   Mus musculus [mouse]
ref|XP_004566603.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    365   2e-117   
ref|XP_004425780.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    364   2e-117   
ref|XP_003212674.2|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    364   2e-117   
ref|XP_006538626.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    363   2e-117   
gb|KFO76843.1|  hypothetical protein N303_12643                         363   2e-117   
ref|XP_001504254.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    364   2e-117   Equus caballus [domestic horse]
ref|XP_005058245.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    364   2e-117   
ref|XP_005153249.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    365   2e-117   
ref|XP_005009268.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    364   2e-117   
ref|XP_004285705.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    364   2e-117   
ref|XP_003446225.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    364   2e-117   
ref|XP_008060340.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    363   2e-117   
gb|KGL89012.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    363   3e-117   
ref|XP_007121155.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    363   3e-117   
ref|XP_005529783.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    363   3e-117   
ref|XP_009484956.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    365   3e-117   
ref|NP_077362.1|  hydroxymethylglutaryl-CoA lyase, mitochondrial ...    363   3e-117   Rattus norvegicus [brown rat]
ref|XP_005353088.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    363   3e-117   
gb|AAL89669.1|AF411956_10  hydroxymethylglutaryl-CoA lyase              363   4e-117   Takifugu rubripes [tiger puffer]
ref|NP_001185643.1|  hydroxymethylglutaryl-CoA lyase, mitochondri...    363   4e-117   
ref|XP_006862366.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    363   4e-117   
ref|XP_004705165.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    363   4e-117   
ref|WP_014236090.1|  hydroxymethylglutaryl-CoA lyase                    362   4e-117   
emb|CAG09900.1|  unnamed protein product                                363   5e-117   
gb|AAB03107.1|  3-hydroxy-3-methylglutaryl-CoA lyase                    362   7e-117   
ref|XP_006159438.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    362   8e-117   
ref|XP_008571270.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    362   9e-117   
ref|XP_009878142.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    363   9e-117   
ref|NP_957509.1|  hydroxymethylglutaryl-CoA lyase, mitochondrial        363   1e-116   
ref|XP_004893881.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    362   1e-116   
ref|XP_009096839.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    362   1e-116   
gb|KFU90851.1|  putative 3-hydroxymethyl-3-methylglutaryl-CoA lya...    361   1e-116   
ref|XP_004603493.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    362   1e-116   
ref|XP_009560100.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    362   1e-116   
gb|ACI34184.1|  Hydroxymethylglutaryl-CoA lyase, mitochondrial pr...    362   1e-116   
ref|XP_010771490.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    362   1e-116   
ref|XP_007459232.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    362   1e-116   
ref|XP_006883582.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    362   1e-116   
gb|KFW78193.1|  hypothetical protein N305_08404                         360   2e-116   
sp|P35915.1|HMGCL_CHICK  RecName: Full=Hydroxymethylglutaryl-CoA ...    360   2e-116   
ref|XP_007491358.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    362   2e-116   
ref|XP_004320307.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    362   2e-116   
gb|ACN10707.1|  Hydroxymethylglutaryl-CoA lyase, mitochondrial pr...    362   2e-116   
ref|XP_008571285.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    361   2e-116   
ref|XP_006111059.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    361   2e-116   
emb|CDQ64418.1|  unnamed protein product                                361   2e-116   
ref|XP_008846824.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    361   2e-116   
emb|CDQ61328.1|  unnamed protein product                                362   2e-116   
ref|XP_007546216.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    362   2e-116   
ref|XP_008428023.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    362   3e-116   
ref|XP_005058244.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    362   3e-116   
ref|XP_007906952.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    360   3e-116   
ref|XP_005044285.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    365   3e-116   
ref|WP_008890573.1|  hydroxymethylglutaryl-CoA lyase                    360   3e-116   
gb|KFP02837.1|  hypothetical protein N300_10829                         360   3e-116   
ref|XP_002934907.2|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    361   3e-116   
ref|XP_005494782.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    360   3e-116   
ref|XP_007522659.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    361   4e-116   
ref|XP_005676915.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    360   4e-116   
ref|XP_008571277.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    360   5e-116   
ref|XP_009997572.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    361   5e-116   
dbj|BAE26056.1|  unnamed protein product                                360   5e-116   
ref|XP_003769219.1|  PREDICTED: probable 3-hydroxymethyl-3-methyl...    361   5e-116   
gb|KFQ00615.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    360   5e-116   
ref|XP_006078015.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    360   6e-116   
ref|XP_003891366.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    360   6e-116   
ref|XP_003769218.1|  PREDICTED: probable 3-hydroxymethyl-3-methyl...    360   6e-116   
ref|XP_008571265.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    360   7e-116   
ref|WP_007090323.1|  hydroxymethylglutaryl-CoA lyase                    359   7e-116   
ref|XP_005875273.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    360   8e-116   
ref|XP_007906951.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    360   8e-116   
ref|XP_005955878.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    360   9e-116   
gb|EMT15018.1|  Hydroxymethylglutaryl-CoA lyase                         357   1e-115   
ref|XP_008320324.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    360   1e-115   
ref|WP_022730293.1|  hydroxymethylglutaryl-CoA lyase                    358   1e-115   
ref|XP_010354056.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    359   1e-115   
ref|XP_008146317.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    359   2e-115   
ref|XP_004267822.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    359   2e-115   
ref|XP_003891367.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    358   2e-115   
ref|XP_008494608.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    358   2e-115   
ref|NP_001127443.1|  hydroxymethylglutaryl-CoA lyase, mitochondri...    358   2e-115   
gb|EMS61546.1|  Hydroxymethylglutaryl-CoA lyase, mitochondrial          356   2e-115   
ref|XP_010887274.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    359   3e-115   
ref|XP_003769217.1|  PREDICTED: probable 3-hydroxymethyl-3-methyl...    360   3e-115   
gb|ETK92887.1|  hypothetical protein, variant                           359   3e-115   
ref|XP_003964220.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    358   3e-115   
ref|XP_005811932.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    358   3e-115   
gb|ETP22839.1|  hypothetical protein, variant                           358   3e-115   
ref|XP_007978249.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    357   3e-115   
ref|XP_004673641.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    358   4e-115   
ref|XP_006179210.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    358   4e-115   
ref|XP_004176914.1|  PREDICTED: LOW QUALITY PROTEIN: 3-hydroxymet...    367   4e-115   
ref|XP_001363832.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    358   4e-115   
ref|XP_004741248.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    358   4e-115   
ref|XP_004024945.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    358   4e-115   
ref|XP_007978248.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    358   4e-115   
ref|XP_003271651.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    357   4e-115   
ref|XP_005318600.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    358   4e-115   
ref|NP_001263401.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, ...    358   4e-115   
ref|XP_010354057.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    357   5e-115   
gb|ETO81747.1|  hypothetical protein, variant                           358   5e-115   
ref|NP_001068600.1|  hydroxymethylglutaryl-CoA lyase, mitochondri...    358   6e-115   
ref|XP_004741249.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    357   6e-115   
ref|XP_008580323.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    358   6e-115   
pir||I57009  3-Hydroxy-3-methylglutaryl coenzyme A lyase - mouse        357   7e-115
ref|XP_008901163.1|  hypothetical protein, variant                      358   7e-115   
ref|XP_005347666.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    358   7e-115   
gb|KFQ01156.1|  hypothetical protein N329_09506                         356   7e-115   
gb|KFO93783.1|  hypothetical protein N320_10804                         356   7e-115   
gb|AAA92733.1|  hydroxymethylglutaryl-CoA lyase                         357   7e-115   
gb|KFR03489.1|  hypothetical protein Y956_14934                         356   8e-115   
ref|NP_000182.2|  hydroxymethylglutaryl-CoA lyase, mitochondrial ...    357   8e-115   
gb|ETI53046.1|  hypothetical protein, variant                           358   8e-115   
ref|XP_010624259.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    357   9e-115   
ref|XP_005394831.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    357   1e-114   
gb|EKC33830.1|  Putative 3-hydroxymethyl-3-methylglutaryl-CoA lya...    356   1e-114   
pdb|2CW6|A  Chain A, Crystal Structure Of Human Hmg-Coa Lyase: In...    356   1e-114   
ref|XP_006262485.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    357   1e-114   
ref|XP_010988118.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    357   1e-114   
ref|XP_008961376.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    356   1e-114   
ref|XP_006007995.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    357   1e-114   
gb|KFR16790.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    355   1e-114   
ref|XP_006094114.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    357   1e-114   
gb|ELT97187.1|  hypothetical protein CAPTEDRAFT_172450                  356   2e-114   
ref|XP_010828344.1|  PREDICTED: LOW QUALITY PROTEIN: hydroxymethy...    356   2e-114   
ref|XP_004772464.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    357   2e-114   
ref|XP_001166273.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    356   2e-114   
ref|XP_001196745.2|  PREDICTED: hydroxymethylglutaryl-CoA lyase-like    356   2e-114   
ref|XP_009448949.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    356   2e-114   
ref|XP_004772465.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    356   2e-114   
ref|WP_037988001.1|  hydroxymethylglutaryl-CoA lyase                    355   2e-114   
ref|XP_009448952.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    355   2e-114   
ref|XP_009940651.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    355   3e-114   
ref|NP_001270179.1|  hydroxymethylglutaryl-CoA lyase, mitochondrial     356   3e-114   
ref|XP_002714560.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    357   3e-114   
ref|XP_007187012.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    356   3e-114   
ref|XP_002716026.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    356   3e-114   
ref|XP_008150825.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    357   3e-114   
ref|XP_003799805.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    356   3e-114   
ref|XP_004696401.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    356   4e-114   
ref|XP_003495057.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    356   4e-114   
gb|AAB19099.1|  hydroxymethylglutaryl-CoA lyase                         354   5e-114   
ref|XP_004005174.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    355   5e-114   
gb|KFO32541.1|  Hydroxymethylglutaryl-CoA lyase, mitochondrial          357   5e-114   
ref|XP_010993687.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    356   5e-114   
ref|XP_007611886.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    356   6e-114   
ref|XP_006090770.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    355   7e-114   
emb|CEG65310.1|  Putative Hydroxymethylglutaryl-CoA lyase               355   7e-114   
ref|XP_003986300.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    355   8e-114   
ref|XP_004416094.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    355   8e-114   
ref|XP_001638492.1|  predicted protein                                  353   8e-114   
ref|XP_005394830.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    355   9e-114   
gb|KFW78751.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytop...    354   9e-114   
ref|XP_006728194.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    355   9e-114   
ref|XP_003764932.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    355   9e-114   
ref|XP_007892256.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    355   1e-113   
gb|AAA92728.1|  hydroxymethylglutaryl-CoA lyase                         353   1e-113   
ref|XP_003789704.1|  PREDICTED: probable 3-hydroxymethyl-3-methyl...    355   1e-113   
ref|XP_004580545.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    355   1e-113   
gb|EPQ05917.1|  Putative 3-hydroxymethyl-3-methylglutaryl-CoA lya...    355   1e-113   
pdb|3MP4|A  Chain A, Crystal Structure Of Human Lyase R41m Mutant       353   1e-113   
gb|KFV42523.1|  hypothetical protein N328_04276                         353   1e-113   
gb|KFZ68372.1|  hypothetical protein N338_08208                         353   1e-113   
ref|XP_004678665.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    354   1e-113   
ref|XP_008151538.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    355   1e-113   
ref|XP_004424061.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    355   1e-113   
ref|XP_002400252.1|  hydroxymethylglutaryl-CoA lyase, putative          354   1e-113   
ref|XP_004453696.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    354   2e-113   
ref|XP_003356653.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    354   2e-113   
gb|EHH53141.1|  hypothetical protein EGM_13714                          355   2e-113   
emb|CEI97007.1|  Putative Hydroxymethylglutaryl-CoA lyase               354   2e-113   
ref|XP_006835791.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    354   2e-113   
ref|XP_005863362.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    354   2e-113   
ref|XP_005863363.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    355   2e-113   
ref|XP_006149248.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    354   2e-113   
ref|XP_004394815.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    353   2e-113   
ref|XP_007095602.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    354   2e-113   
ref|XP_005617870.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    353   2e-113   
ref|NP_001103870.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, ...    353   3e-113   
ref|XP_006973801.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    354   3e-113   
ref|XP_006196080.1|  PREDICTED: LOW QUALITY PROTEIN: 3-hydroxymet...    354   3e-113   
ref|XP_003934918.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    353   4e-113   
ref|XP_003638949.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    353   4e-113   
ref|NP_061909.2|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, cyt...    354   6e-113   
ref|XP_008011860.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    353   6e-113   
ref|NP_001035865.1|  3-hydroxymethyl-3-methylglutaryl-CoA lyase, ...    353   7e-113   
ref|XP_010887273.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    353   7e-113   
ref|XP_004615868.1|  PREDICTED: LOW QUALITY PROTEIN: 3-hydroxymet...    355   8e-113   
ref|XP_003462353.2|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    352   8e-113   
ref|XP_003989704.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    352   9e-113   
ref|XP_001105003.2|  PREDICTED: probable 3-hydroxymethyl-3-methyl...    353   1e-112   
gb|ELR49446.1|  Hydroxymethylglutaryl-CoA lyase, mitochondrial          352   1e-112   
ref|XP_004386879.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    352   1e-112   
ref|XP_005552749.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    353   1e-112   
ref|XP_004940521.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    354   1e-112   
emb|CEG81009.1|  Putative Hydroxymethylglutaryl-CoA lyase               352   1e-112   
ref|XP_005552751.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    351   1e-112   
ref|XP_003828979.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    352   1e-112   
dbj|BAE88248.1|  unnamed protein product                                352   1e-112   
ref|XP_002803820.1|  PREDICTED: probable 3-hydroxymethyl-3-methyl...    352   1e-112   
ref|XP_004940523.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    353   1e-112   
ref|XP_005851278.1|  hypothetical protein CHLNCDRAFT_138066             351   1e-112   
ref|XP_006893200.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    352   1e-112   
ref|XP_003356654.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    353   1e-112   
ref|XP_007257629.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    352   2e-112   
ref|XP_003254172.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    352   2e-112   
ref|XP_003926423.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    352   2e-112   
ref|XP_004019207.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    353   2e-112   
ref|XP_002746709.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    352   2e-112   
ref|XP_006066507.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    350   2e-112   
ref|XP_006757808.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    352   2e-112   
ref|XP_008844343.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    351   2e-112   
ref|XP_005223314.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    351   2e-112   
ref|XP_004092002.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    350   3e-112   
ref|XP_008070015.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    351   3e-112   
ref|XP_638884.1|  hydroxymethylglutaryl-CoA lyase                       353   4e-112   
ref|XP_005902715.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    352   4e-112   
ref|XP_002913321.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    350   5e-112   
ref|XP_419903.3|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA...    351   6e-112   
ref|XP_002673715.1|  predicted protein                                  353   8e-112   
ref|XP_005965217.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    351   1e-111   
ref|XP_007516555.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    350   1e-111   
ref|XP_003404467.1|  PREDICTED: LOW QUALITY PROTEIN: 3-hydroxymet...    350   1e-111   
ref|XP_008998875.1|  PREDICTED: hydroxymethylglutaryl-CoA lyase, ...    349   1e-111   
emb|CDS04816.1|  hypothetical protein LRAMOSA07346                      349   1e-111   
ref|XP_004649142.1|  PREDICTED: LOW QUALITY PROTEIN: 3-hydroxymet...    350   2e-111   
ref|XP_004077245.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    349   2e-111   
ref|XP_006926486.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    349   2e-111   
ref|WP_012800988.1|  hydroxymethylglutaryl-CoA lyase                    348   2e-111   
gb|EXI84425.1|  Hydroxymethylglutaryl-CoA lyase YngG                    348   2e-111   
ref|XP_538973.3|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA...    353   3e-111   
ref|XP_001499476.2|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    352   3e-111   
ref|WP_014187818.1|  hydroxymethylglutaryl-CoA lyase                    347   3e-111   
ref|XP_008689984.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    348   4e-111   
ref|XP_007484189.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    350   4e-111   
ref|XP_009066086.1|  hypothetical protein LOTGIDRAFT_222853             348   4e-111   
ref|XP_002117096.1|  hypothetical protein TRIADDRAFT_61193              346   8e-111   
gb|KFB39172.1|  AGAP008717-PA-like protein                              347   9e-111   
ref|XP_009529235.1|  hypothetical protein PHYSODRAFT_315765             354   1e-110   
gb|EFA78829.1|  hydroxymethylglutaryl-CoA lyase                         348   1e-110   
ref|XP_003226122.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    347   1e-110   
ref|XP_005377972.1|  PREDICTED: 3-hydroxymethyl-3-methylglutaryl-...    347   1e-110   
gb|ETK92886.1|  hypothetical protein L915_03852                         347   2e-110   



>ref|XP_009630174.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Nicotiana 
tomentosiformis]
 ref|XP_009630175.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Nicotiana 
tomentosiformis]
 ref|XP_009630176.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Nicotiana 
tomentosiformis]
 ref|XP_009630177.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Nicotiana 
tomentosiformis]
Length=430

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/430 (75%), Positives = 363/430 (84%), Gaps = 36/430 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL+LDRLP LSNID ++ RFSS  CRP+G+D  MG+ W DGR+CSSSNSC ED DEYG
Sbjct  5     EEPLNLDRLPSLSNIDWLE-RFSSGGCRPIGEDMAMGDSWTDGRSCSSSNSCVEDDDEYG  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRS--FSGGWRNV---------------------------  1369
             R ++ W+R       NG+S+RRS  FS  +R                             
Sbjct  64    RENFKWRRH---GSRNGISSRRSKSFSTNYRVCGTVSHSQYLTDHQYKSYSNHRSTVSKT  120

Query  1368  --LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
               LF+G+PKYVKIVEVGPRDGLQNEKN VPTSVKVEL++KLVSCGLPVVEVTGFVSPKWV
Sbjct  121   FKLFDGMPKYVKIVEVGPRDGLQNEKNIVPTSVKVELVQKLVSCGLPVVEVTGFVSPKWV  180

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQLSDAKDVM+AVK+LE ARLPVLTPN+KGFEAA+A+GAKEVAVFASASESFSK+NINCS
Sbjct  181   PQLSDAKDVMEAVKDLESARLPVLTPNMKGFEAAVAAGAKEVAVFASASESFSKSNINCS  240

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESLVRYRAVTSAAKKLSIPVRGY+SC +GCPVEG I PSKVAY+AKELH+MGCFEISL
Sbjct  241   IEESLVRYRAVTSAAKKLSIPVRGYVSCAIGCPVEGEISPSKVAYVAKELHDMGCFEISL  300

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGVATPG+V+PMLEAVMAVVPVEKLAVHFHDTYGQSL NILVSLQMG+ T+DSSV+G
Sbjct  301   GDTIGVATPGSVVPMLEAVMAVVPVEKLAVHFHDTYGQSLSNILVSLQMGISTIDSSVAG  360

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGATGNV+TEDVVYML+GLG+KTNVD+ KLL AGEFISK+L R S SKAAIAL
Sbjct  361   LGGCPYAKGATGNVSTEDVVYMLNGLGIKTNVDIQKLLLAGEFISKYLDRPSGSKAAIAL  420

Query  474   TRVSADASKI  445
             +RV+ADASKI
Sbjct  421   SRVTADASKI  430



>ref|XP_009760353.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009760354.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Nicotiana sylvestris]
Length=430

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/430 (75%), Positives = 364/430 (85%), Gaps = 36/430 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL+LDRLP LSNID ++ RFSS ACRP+G+D  +G+ W DGR+CSSSNSC ED DEYG
Sbjct  5     EEPLNLDRLPSLSNIDWLE-RFSSGACRPIGEDMAIGDSWTDGRSCSSSNSCVEDDDEYG  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRS--FSGGWRNV---------------------------  1369
             R ++ W+R       NG+S+RRS  FS  +R                             
Sbjct  64    RENFKWRRH---GSRNGISSRRSKSFSTNYRVCGTLSHSQYLTDHQSKSYRNNRSTVSKP  120

Query  1368  --LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
               LF+G+PKYVKIVEVGPRDGLQNEKN VPTSVKVEL++KLVSCGLPVVEVTGFVSPKWV
Sbjct  121   FKLFDGMPKYVKIVEVGPRDGLQNEKNIVPTSVKVELVQKLVSCGLPVVEVTGFVSPKWV  180

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQLSDAKDVM+AVK+LE ARLPVLTPN+KGFEAA+A+GAKEVAVFASASESFSK+NINCS
Sbjct  181   PQLSDAKDVMEAVKDLESARLPVLTPNMKGFEAAVAAGAKEVAVFASASESFSKSNINCS  240

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESLVRYRAVTSAA+KLSIPVRGY+SC +GCP EGAI PSKVAY+AKELH+MGCFEISL
Sbjct  241   IEESLVRYRAVTSAARKLSIPVRGYVSCAIGCPTEGAISPSKVAYVAKELHDMGCFEISL  300

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGVATPG+V+PMLEAVMAVVPVEKLAVHFHDTYGQSL NILVSLQMG+ TVDSSV+G
Sbjct  301   GDTIGVATPGSVVPMLEAVMAVVPVEKLAVHFHDTYGQSLSNILVSLQMGISTVDSSVAG  360

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGATGNV+TEDVVYML+GLG+KTNVD+ KLL AGEFISK+L R S SKAAIAL
Sbjct  361   LGGCPYAKGATGNVSTEDVVYMLNGLGIKTNVDIQKLLLAGEFISKYLDRPSGSKAAIAL  420

Query  474   TRVSADASKI  445
             +RV+ADASKI
Sbjct  421   SRVTADASKI  430



>ref|XP_006362307.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Solanum tuberosum]
Length=430

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/428 (75%), Positives = 356/428 (83%), Gaps = 32/428 (7%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL+L+RLP LSNID ++ RFSS ACRPVG+D  MG+ W DGRNCSSSNSC ED DEYG
Sbjct  5     EEPLNLERLPSLSNIDWLE-RFSSGACRPVGEDMAMGDSWSDGRNCSSSNSCVEDNDEYG  63

Query  1461  RGSYGWKRQ-----------------------------FRDRPYNGVSNRRSFSGGWRNV  1369
             R +Y W+R                                DR     SN RS        
Sbjct  64    RENYKWRRHGSRNAISSRRSKSLSKNYRVCGTVSRSQCLTDRQPKSYSNHRSTVRKTFK-  122

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
             LFNG+P +VKIVEVG RDGLQNEK  VPTSVKVELI+KLVSCGLPVVEVTGFVSPKWVPQ
Sbjct  123   LFNGMPNHVKIVEVGARDGLQNEKKTVPTSVKVELIQKLVSCGLPVVEVTGFVSPKWVPQ  182

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             LSDAKDVM+AVK+LEGARLPVLTPN+KGFEAA+A+GAKEVAVFASASESFSK+NINCSIE
Sbjct  183   LSDAKDVMEAVKDLEGARLPVLTPNMKGFEAAVAAGAKEVAVFASASESFSKSNINCSIE  242

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ESLVRYRAVTSAAKKL+IP+RGY+SC +GCPVEGA+ PSKVAY+AKELH+MGCFEISLGD
Sbjct  243   ESLVRYRAVTSAAKKLAIPIRGYVSCAIGCPVEGAMSPSKVAYVAKELHDMGCFEISLGD  302

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIG+ATPGTV+PMLEAVMAVVPVEKLAVHFHDTYGQSL NILVSLQMG+ TVDSSV+GLG
Sbjct  303   TIGIATPGTVVPMLEAVMAVVPVEKLAVHFHDTYGQSLSNILVSLQMGISTVDSSVAGLG  362

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGATGNVATEDVVYML+GLG+KTNVDL KLL AGEFISKHLGR S SKAAIAL+ 
Sbjct  363   GCPYAKGATGNVATEDVVYMLNGLGIKTNVDLQKLLVAGEFISKHLGRPSGSKAAIALSG  422

Query  468   VSADASKI  445
              +ADASK+
Sbjct  423   ATADASKM  430



>ref|XP_004250903.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Solanum 
lycopersicum]
 ref|XP_010313251.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Solanum 
lycopersicum]
Length=430

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/430 (75%), Positives = 359/430 (83%), Gaps = 36/430 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL+L+RLP LSNID ++ RFSS ACRP G+D  MG+ W DGRNCSSSNSC ED DEYG
Sbjct  5     EEPLNLERLPSLSNIDWVE-RFSSGACRPAGEDMAMGDSWSDGRNCSSSNSCVEDNDEYG  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRS--------------------------FSGGWRNV---  1369
             R ++ W+R       N +S+RRS                          +S     V   
Sbjct  64    RENFKWRRH---GSRNVISSRRSKNLSKNYIVCGTVSRSQCSTDRQPKSYSNHRSTVRKT  120

Query  1368  --LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
               LFNG+P +VKIVEVG RDGLQNEK  VPTSVKVELI+KLVSCGLPVVEVTGFVSPKWV
Sbjct  121   FKLFNGMPNHVKIVEVGARDGLQNEKKTVPTSVKVELIQKLVSCGLPVVEVTGFVSPKWV  180

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQLSDAKDVM+AVK+LEGARLPVLTPN+KGFEAA+A+GAKEVAVFASASESFSK+NINCS
Sbjct  181   PQLSDAKDVMEAVKDLEGARLPVLTPNMKGFEAAVAAGAKEVAVFASASESFSKSNINCS  240

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESLVRYRAVTSAAKKL+IP+RGY+SC +GCPVEGAI PSKVAY+AKELH+MGCFEISL
Sbjct  241   IEESLVRYRAVTSAAKKLAIPIRGYVSCAIGCPVEGAISPSKVAYVAKELHDMGCFEISL  300

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIG+ATPGTV+PMLEAVMAVVPVEKLAVHFHDTYGQSL NILVSLQMG+ TVDSSV+G
Sbjct  301   GDTIGIATPGTVVPMLEAVMAVVPVEKLAVHFHDTYGQSLSNILVSLQMGISTVDSSVAG  360

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYML+GLG+KTNVDL KLL AGEFISKHL R S SKAAIAL
Sbjct  361   LGGCPYAKGASGNVATEDVVYMLNGLGIKTNVDLQKLLLAGEFISKHLDRPSGSKAAIAL  420

Query  474   TRVSADASKI  445
             T V+ADASK+
Sbjct  421   TGVTADASKM  430



>emb|CDP09622.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/430 (74%), Positives = 357/430 (83%), Gaps = 35/430 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEP+SLDRLP LSNID    RFSS+ACRP G+D GMG RWI+GR+CS+SNSC+EDF+EY 
Sbjct  5     EEPISLDRLPSLSNIDHH--RFSSSACRPRGEDLGMGHRWIEGRSCSTSNSCEEDFEEYN  62

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLFNG-------------------------  1357
             R ++ W +Q R     G+SN R+ S G RN + NG                         
Sbjct  63    RENFMWWKQRRCTSRRGISNGRTLSLG-RNQVPNGNISDSLYLPDDQYNSCNYKCTMDMP  121

Query  1356  ------VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
                   +PKYVKIVEVGPRDGLQNEKN VPTS+KVELIRKLVS GL V+E T FVSPKWV
Sbjct  122   NKLLRDLPKYVKIVEVGPRDGLQNEKNIVPTSIKVELIRKLVSSGLAVIEATSFVSPKWV  181

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQLSDAK+VM+AVKNLEG RLPVLTPNLKGFEAAIA+GAKE+AVFASASESFSK+NINCS
Sbjct  182   PQLSDAKEVMEAVKNLEGTRLPVLTPNLKGFEAAIAAGAKEIAVFASASESFSKSNINCS  241

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESL RYRAVT AA+KLSIPVRGY+SCV+GCPVEGA+ PSKVAY+AKEL++MGCFEISL
Sbjct  242   IEESLTRYRAVTHAAQKLSIPVRGYVSCVIGCPVEGAVPPSKVAYVAKELYDMGCFEISL  301

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGV T GTV+PMLEAVM VVPVEKLAVHFHDTYGQSLPNILVSLQMG+ TVDSSVSG
Sbjct  302   GDTIGVGTLGTVLPMLEAVMVVVPVEKLAVHFHDTYGQSLPNILVSLQMGISTVDSSVSG  361

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYML+GLG+KTNVDLGKLL AGEFI+KHLGR+S SK AIA 
Sbjct  362   LGGCPYAKGASGNVATEDVVYMLNGLGIKTNVDLGKLLLAGEFINKHLGRQSGSKTAIAF  421

Query  474   TRVSADASKI  445
             +R +ADASKI
Sbjct  422   SRKTADASKI  431



>ref|XP_006419477.1| hypothetical protein CICLE_v10005026mg [Citrus clementina]
 ref|XP_006489017.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Citrus sinensis]
 gb|ESR32717.1| hypothetical protein CICLE_v10005026mg [Citrus clementina]
Length=426

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/423 (73%), Positives = 350/423 (83%), Gaps = 26/423 (6%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP +S IDR+  RFSSNACRP GD  GMG  WI+G +CS+SNS DE++DEY 
Sbjct  5     EEPLGLDKLPSMSTIDRIQ-RFSSNACRPSGDGMGMGSCWIEGSSCSTSNSYDEEYDEYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLF------------------------NGV  1354
             R ++ W+R  RD  +    +RR+ S G  + +F                         G+
Sbjct  64    REAFPWRRHTRDMSHGDSFSRRTVSLGRNHKMFGSACDIYSSNCNDKDIRDITNKFLKGI  123

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             P+ VKIVEVGPRDGLQNEKN VPT VKVELIR+LVS GLPVVE T FVSPKWVPQL+DA+
Sbjct  124   PRSVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADAR  183

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             DVM+AV++LEGARLPVLTPNLKGFEAAIA+GAKEVA+FASASE+FSK+NINCSIEESLVR
Sbjct  184   DVMEAVRDLEGARLPVLTPNLKGFEAAIAAGAKEVAIFASASEAFSKSNINCSIEESLVR  243

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
             YRAV  AAK LSIPVRGY+SCVVGCPVEGAI PSKVAY+AKELH+MGCFEISLGDTIGV 
Sbjct  244   YRAVARAAKDLSIPVRGYVSCVVGCPVEGAIPPSKVAYVAKELHDMGCFEISLGDTIGVG  303

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYA  634
             TPGTV+PMLEAVMAVVPVEKLAVHFHDTYGQSLPNIL+SLQMG+ TVD SV+GLGGCPYA
Sbjct  304   TPGTVVPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILISLQMGISTVDCSVAGLGGCPYA  363

Query  633   KGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSADA  454
             KGA+GNVATEDVVYML GLGV+TNVDL KL+ AG+FI+KHLGR S SK AIAL R++ADA
Sbjct  364   KGASGNVATEDVVYMLSGLGVETNVDLRKLMLAGDFINKHLGRPSGSKTAIALNRIAADA  423

Query  453   SKI  445
             SKI
Sbjct  424   SKI  426



>gb|KDO71783.1| hypothetical protein CISIN_1g012949mg [Citrus sinensis]
Length=426

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/423 (73%), Positives = 350/423 (83%), Gaps = 26/423 (6%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP +S IDR+  RFSSNACRP GD  GMG  WI+G +CS+SNS DED+DEY 
Sbjct  5     EEPLGLDKLPSMSTIDRIQ-RFSSNACRPSGDGMGMGSCWIEGSSCSTSNSYDEDYDEYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLF------------------------NGV  1354
             R ++ W+R  RD  +    +RR+ S G  + +F                         G+
Sbjct  64    REAFPWRRHTRDMSHGDSFSRRTVSLGRNHKMFGSACDIYNSNCNDKDIRDITNKFLKGI  123

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             P++VKIVEVGPRDGLQNEKN VPT VKVELIR+LVS GLPVVE T FVSPKWVPQL+DA+
Sbjct  124   PRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADAR  183

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             DVM+AV++LEGARLPVLTPNLKGFEAAIA+GAKEVA+FASASE+FSK+NINCSIE+SLVR
Sbjct  184   DVMEAVRDLEGARLPVLTPNLKGFEAAIAAGAKEVAIFASASEAFSKSNINCSIEDSLVR  243

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
             YRAV  AAK LSIPVRGY+SCVVGCPVEGAI PSKVAY+AKELH+MGCFEISLGDTIGV 
Sbjct  244   YRAVAHAAKVLSIPVRGYVSCVVGCPVEGAIPPSKVAYVAKELHDMGCFEISLGDTIGVG  303

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYA  634
             TPGTV+PMLEAVMAVVPVEKLAVH HDTYGQSLPNIL+SLQMG+ TVD SV+GLGGCPYA
Sbjct  304   TPGTVVPMLEAVMAVVPVEKLAVHLHDTYGQSLPNILISLQMGISTVDCSVAGLGGCPYA  363

Query  633   KGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSADA  454
             KGA+GNVATEDVVYML GLGV+TNVDL KL+ AG+FI+KHLGR S SK AIAL R++ADA
Sbjct  364   KGASGNVATEDVVYMLSGLGVETNVDLRKLMLAGDFINKHLGRPSGSKTAIALNRIAADA  423

Query  453   SKI  445
             SKI
Sbjct  424   SKI  426



>ref|XP_008385654.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Malus 
domestica]
Length=431

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/428 (71%), Positives = 347/428 (81%), Gaps = 31/428 (7%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL  D+LP +S +DR+  RFSS ACR   DD  MG  WI+GR+CS+SNSCDED+DEY 
Sbjct  5     EEPLGFDKLPSMSTMDRIQ-RFSSTACRSRSDDXAMGNCWIEGRSCSTSNSCDEDYDEYA  63

Query  1461  RGSYGWKRQFRDR--PYNGVSNRRSFSGG------------W---------------RNV  1369
             R  + WKR  RDR   +    N+R+ S G            W                N 
Sbjct  64    REGFPWKRHTRDRDLSHGDSFNQRTLSLGRNHRVFGNVCDSWYLSDQYNAKCNDKDITNK  123

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
                G+PK+VKIVEVGPRDGLQNEKN +  SVK+ELI++LVSCGL VVE T FVSPKWVPQ
Sbjct  124   FLKGIPKFVKIVEVGPRDGLQNEKNTISASVKIELIQRLVSCGLSVVEATSFVSPKWVPQ  183

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+DAKDVM+AV NLEGARLPVLTPNLKGFEAA+A+GAK++AVFASASESFSK+NINCSIE
Sbjct  184   LADAKDVMEAVHNLEGARLPVLTPNLKGFEAAVAAGAKDIAVFASASESFSKSNINCSIE  243

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ESLVRYRAVT AAK+L+IPVRGY+SCVVGCPVEGAI PS+VAY+AKEL+ MGCFEISLGD
Sbjct  244   ESLVRYRAVTRAAKELTIPVRGYVSCVVGCPVEGAIPPSRVAYVAKELYNMGCFEISLGD  303

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTV+PMLEAVMA VPVEKLAVHFHDTYGQSL NILVSLQMG+ TVDSS++GLG
Sbjct  304   TIGVGTPGTVVPMLEAVMAAVPVEKLAVHFHDTYGQSLSNILVSLQMGISTVDSSIAGLG  363

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGA+GNVATEDVVYML+GLGVKTNVDL KLL  G+FISKHLGR S SK A+AL+R
Sbjct  364   GCPYAKGASGNVATEDVVYMLYGLGVKTNVDLAKLLVTGDFISKHLGRPSGSKTAVALSR  423

Query  468   VSADASKI  445
             V+ADASKI
Sbjct  424   VTADASKI  431



>ref|XP_009337716.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Pyrus x bretschneideri]
Length=431

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/428 (72%), Positives = 347/428 (81%), Gaps = 31/428 (7%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDG-MGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL  D+LP +S +DR+  RFSS ACR   DD  MG  WI+GR+CS+SNSCDED+DEYG
Sbjct  5     EEPLGFDKLPSMSTMDRIQ-RFSSTACRSRSDDAAMGNCWIEGRSCSTSNSCDEDYDEYG  63

Query  1461  RGSYGWKRQFRDR--PYNGVSNRRSFSGG------------W---------------RNV  1369
             R  + WKR  RDR   +    N+R+ S G            W                N 
Sbjct  64    REGFPWKRHTRDRDLSHGDSFNQRTLSLGRNHRVFGNVCDSWYLSDQYNAKCNDKDITNK  123

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
                GVPK+VKIVEVGPRDGLQNEKN +  SVK+ELI++LVSCGL VVE T FVSPKWVPQ
Sbjct  124   FLKGVPKFVKIVEVGPRDGLQNEKNIISASVKIELIQRLVSCGLSVVEATSFVSPKWVPQ  183

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+DAKDVM+AV NLEGARLPVLTPNLKGFEAA+A+GAK++AVFASASESFSK+NINCSIE
Sbjct  184   LADAKDVMEAVHNLEGARLPVLTPNLKGFEAAVAAGAKDIAVFASASESFSKSNINCSIE  243

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ESLVRYRAVT AAK+LSIPVRGY+SCVVGCP EGAI PS+VAY+AKEL+ MGCFEISLGD
Sbjct  244   ESLVRYRAVTRAAKELSIPVRGYVSCVVGCPAEGAIPPSRVAYVAKELYNMGCFEISLGD  303

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTV+PMLEAVMA VPVEKLAVHFHDTYGQSL NILVSLQMG+ TVDSS++GLG
Sbjct  304   TIGVGTPGTVVPMLEAVMAAVPVEKLAVHFHDTYGQSLSNILVSLQMGISTVDSSIAGLG  363

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGA+GNVATEDVVYML+GLGVKTNVDL KLL  G+FISKHLGR S SK A+AL+R
Sbjct  364   GCPYAKGASGNVATEDVVYMLNGLGVKTNVDLAKLLVTGDFISKHLGRPSGSKTAVALSR  423

Query  468   VSADASKI  445
             V+ADASKI
Sbjct  424   VTADASKI  431



>ref|XP_008227653.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Prunus 
mume]
Length=429

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/426 (72%), Positives = 348/426 (82%), Gaps = 29/426 (7%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDG-MGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL  D+LP +S IDR+  RFSS+ACR   DD  MG  WI+GR+CS+SNSC+ED++EY 
Sbjct  5     EEPLGFDKLPSMSTIDRVQ-RFSSSACRSRADDAAMGNCWIEGRSCSTSNSCNEDYEEYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGG------------W---------------RNVLF  1363
             R ++ WKR  RD       N+R+ S G            W                N + 
Sbjct  64    REAFPWKRHTRDISRGDSFNQRTLSLGRNHRVFGNICDSWYLSDQYESKCNDKDITNKIL  123

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
              G+PK+VKIVEVGPRDGLQNEKN V  SVK+ELI +LVSCGL VVE T FVSPKWVPQL+
Sbjct  124   KGIPKFVKIVEVGPRDGLQNEKNIVSASVKIELIHRLVSCGLSVVEATSFVSPKWVPQLA  183

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             DAKDVM+ V+NLEGARLPVLTPNLKGFEAAIA+GAK++AVFASASESFSK+NINCSIEES
Sbjct  184   DAKDVMEVVQNLEGARLPVLTPNLKGFEAAIAAGAKDIAVFASASESFSKSNINCSIEES  243

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             LVRYRAVT AAK+LSIPVRGY+SC +GCPVEGAI PS+VAY+AKEL+ MGCFEISLGDTI
Sbjct  244   LVRYRAVTRAAKELSIPVRGYVSCAIGCPVEGAIPPSRVAYVAKELYNMGCFEISLGDTI  303

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GVATPGTV+PMLEAVMAVVPVEKLAVHFHDTYGQSL NILVSLQMG+  VDSS++GLGGC
Sbjct  304   GVATPGTVVPMLEAVMAVVPVEKLAVHFHDTYGQSLSNILVSLQMGISIVDSSIAGLGGC  363

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVS  463
             PYAKGA+GNVATEDVVYML+GLGVKTNVDL KLL AG+FISKHLGR S SK A+AL+RV+
Sbjct  364   PYAKGASGNVATEDVVYMLNGLGVKTNVDLAKLLMAGDFISKHLGRPSGSKTAVALSRVT  423

Query  462   ADASKI  445
             ADASKI
Sbjct  424   ADASKI  429



>ref|XP_002263865.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Vitis 
vinifera]
 ref|XP_010651540.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Vitis 
vinifera]
 emb|CBI24281.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/430 (72%), Positives = 346/430 (80%), Gaps = 34/430 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD L  LS ID    RFSSNACRP  +D GMG  WIDGR CSSSN+C+ED++ Y 
Sbjct  5     EEPLGLDNLSSLSTIDLQ--RFSSNACRPRAEDMGMGSCWIDGRTCSSSNNCNEDYEGYT  62

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGG------------WR-------------------  1375
             R ++ WKRQ R+        RR+ S G            W                    
Sbjct  63    REAFQWKRQTRETSQGDSLKRRTSSQGRSCMVYGSSCDSWYSSDHQYGFQCNNKGVRGMA  122

Query  1374  NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
             N    G+PK+VKIVEVGPRDGLQNEKN VPT+VKVELI +LVSCGLPVVE T FVSPKWV
Sbjct  123   NKFLGGIPKFVKIVEVGPRDGLQNEKNIVPTAVKVELIHRLVSCGLPVVEATSFVSPKWV  182

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDVM+AV+NLEGARLPVLTPNLKGFEAAIA+GAKEVA+FASASESFSK+NINCS
Sbjct  183   PQLADAKDVMEAVRNLEGARLPVLTPNLKGFEAAIAAGAKEVAIFASASESFSKSNINCS  242

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESL RYRAV  AAKKLSIPVRGY+SCVVGCPVEGAI PSKVAY+AKEL++MGCFEISL
Sbjct  243   IEESLTRYRAVALAAKKLSIPVRGYVSCVVGCPVEGAISPSKVAYVAKELYDMGCFEISL  302

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGVATPG ++PMLEAVMAVVPVEKLAVHFHDTYGQSLPNIL+SLQMG+ T+DSSV+G
Sbjct  303   GDTIGVATPGAIVPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILLSLQMGISTIDSSVAG  362

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYML+GLGVKTNVDLGKL+  G+FIS  LGR S SK AIAL
Sbjct  363   LGGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLGKLMLVGDFISNRLGRPSGSKTAIAL  422

Query  474   TRVSADASKI  445
             +RV+ DASKI
Sbjct  423   SRVNVDASKI  432



>gb|KDP43190.1| hypothetical protein JCGZ_22742 [Jatropha curcas]
Length=435

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/432 (71%), Positives = 350/432 (81%), Gaps = 35/432 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP +S IDR+  RFSS ACRP  DD GMG  WI+GR+CSSSNSC+++++EY 
Sbjct  5     EEPLGLDKLPSMSTIDRIQ-RFSSGACRPSADDVGMGNFWIEGRSCSSSNSCEDNYEEYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNV-----------------------------  1369
             R ++ WKR  RD       NRR+ S G  +V                             
Sbjct  64    RETFPWKRHTRDLCQGDSFNRRTMSLGRNHVARGTGQDSRCLPNRQYNSKSKSNDKDMRN  123

Query  1368  ----LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPK  1201
                    G+P +VKIVEVGPRDGLQNEKN VPT VK+ELI +LVS GLPVVE T FVSPK
Sbjct  124   LTNKFLKGIPNFVKIVEVGPRDGLQNEKNIVPTDVKIELIHRLVSSGLPVVEATSFVSPK  183

Query  1200  WVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANIN  1021
             WVPQL+DA+DVM+AV+NLEG+RLPVLTPNLKGFEAA+A+GAKEVA+FASASESFSK+NIN
Sbjct  184   WVPQLADARDVMEAVQNLEGSRLPVLTPNLKGFEAAVAAGAKEVAIFASASESFSKSNIN  243

Query  1020  CSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEI  841
             CSIEESL RYRAVT+AAK+  IPVRGY+SCVVGCPVEGAI  SKVAY+AKEL++MGCFEI
Sbjct  244   CSIEESLARYRAVTNAAKERGIPVRGYVSCVVGCPVEGAISLSKVAYVAKELYDMGCFEI  303

Query  840   SLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSV  661
             SLGDTIGV TPGTV+PMLEAVMAVVP EKLAVHFHDTYGQSLPNIL+SLQMG+ TVDSSV
Sbjct  304   SLGDTIGVGTPGTVVPMLEAVMAVVPAEKLAVHFHDTYGQSLPNILISLQMGISTVDSSV  363

Query  660   SGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAI  481
             +GLGGCPYAKGA+GNVATEDVVYML+GLGVKTNVDL KLL AG+FISK+LGR+S SK A+
Sbjct  364   AGLGGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLPKLLSAGDFISKYLGRQSGSKTAV  423

Query  480   ALTRVSADASKI  445
             AL+RV+ADASKI
Sbjct  424   ALSRVTADASKI  435



>gb|EYU46179.1| hypothetical protein MIMGU_mgv1a007248mg [Erythranthe guttata]
Length=413

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/410 (75%), Positives = 348/410 (85%), Gaps = 13/410 (3%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             E+PL LD+LP LSNIDR+  RFSS+ACRP+G+D G G  WIDGR+CSSSNSC +DF+EY 
Sbjct  5     EQPLGLDKLPSLSNIDRIY-RFSSSACRPMGEDMGKGNCWIDGRSCSSSNSCADDFEEYD  63

Query  1461  RGSYGWKRQFRDRPYNGVSN------RRSF-----SGGWRNVLFNGVPKYVKIVEVGPRD  1315
             + +  W RQ R+      S       R S+     +G  + +LF G+P+ VKIVEVGPRD
Sbjct  64    QETITWGRQMRNSSQRNSSQGRRQNPRNSYCNDNETGEPKYMLFKGIPRLVKIVEVGPRD  123

Query  1314  GLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGAR  1135
             GLQNEK  VPTSVKV+LI+KL S GLPVVEVTGFVSPKWVPQL+DA DVM AVKNLEG R
Sbjct  124   GLQNEKTIVPTSVKVKLIQKLASSGLPVVEVTGFVSPKWVPQLADANDVMAAVKNLEGIR  183

Query  1134  LPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSI  955
             LP LTPNLKGF+AAIA+GAKEVAVFASASESFS++NINCSIEESLVRYRAVTSAAKKL+I
Sbjct  184   LPALTPNLKGFDAAIAAGAKEVAVFASASESFSRSNINCSIEESLVRYRAVTSAAKKLAI  243

Query  954   PVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVM  775
             PVRGY+SCVVGCP+EG I P KVAY+AKELH MGCFEISLGDTIGVATPGTV+PMLEAVM
Sbjct  244   PVRGYVSCVVGCPIEGYIAPLKVAYVAKELHNMGCFEISLGDTIGVATPGTVLPMLEAVM  303

Query  774   AVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVV  595
             AVVPV+KLAVHFHDTYGQSLPNIL+SLQMG+ TVDSSVSGLGGCPYAKGA+GNVATEDVV
Sbjct  304   AVVPVDKLAVHFHDTYGQSLPNILLSLQMGISTVDSSVSGLGGCPYAKGASGNVATEDVV  363

Query  594   YMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSADASKI  445
             YML+GLGVKTNVD+ KLL AGE+IS++LGR   SK A+AL   S D+SKI
Sbjct  364   YMLNGLGVKTNVDMEKLLSAGEYISQYLGRPIGSKTALALRSSSKDSSKI  413



>ref|XP_007211727.1| hypothetical protein PRUPE_ppa006068mg [Prunus persica]
 gb|EMJ12926.1| hypothetical protein PRUPE_ppa006068mg [Prunus persica]
Length=429

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/426 (71%), Positives = 346/426 (81%), Gaps = 29/426 (7%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDG-MGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL  D+LP +S IDR+  RFSS+ACR   DD  MG  WI+GR+CS+SNSC+ED++EY 
Sbjct  5     EEPLGFDKLPSMSTIDRVQ-RFSSSACRSRADDAAMGNCWIEGRSCSTSNSCNEDYEEYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGG------------W---------------RNVLF  1363
             R ++ WKR  RD       N+R+ S G            W                N + 
Sbjct  64    REAFPWKRHTRDISRGDSFNQRTLSLGRNHRVFGNICDSWYLSDQYESKCNDKDITNKIL  123

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
              G+PK+VKIVEVGPRDGLQNEKN V  SVK+ELI +LVSCGL VVE T FVSPKWVPQL+
Sbjct  124   KGIPKFVKIVEVGPRDGLQNEKNIVSASVKIELIHRLVSCGLSVVEATSFVSPKWVPQLA  183

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             DAKDVM+ V NLEGARLPVLTPNLKGFEAAIA+GAK++AVFASASESFSK+NINCSIEES
Sbjct  184   DAKDVMEVVHNLEGARLPVLTPNLKGFEAAIAAGAKDIAVFASASESFSKSNINCSIEES  243

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             LVRYRAVT AAK+LSIPVRGY+SC +GCPVEGAI PS+VAY+AKEL+ MGCFEISLGDTI
Sbjct  244   LVRYRAVTRAAKELSIPVRGYVSCAIGCPVEGAIPPSRVAYVAKELYNMGCFEISLGDTI  303

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPGTV+PMLEAV+AVVPVEKLAVHFHDTYGQSL NILVSLQMG+  VDSS++GLGGC
Sbjct  304   GVGTPGTVVPMLEAVIAVVPVEKLAVHFHDTYGQSLSNILVSLQMGISIVDSSIAGLGGC  363

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVS  463
             PYAKGA+GNVATEDVVYML+GLGVKTNVDL KLL AG+FISKHLGR S SK A+AL+RV+
Sbjct  364   PYAKGASGNVATEDVVYMLNGLGVKTNVDLAKLLMAGDFISKHLGRPSGSKTAVALSRVT  423

Query  462   ADASKI  445
             ADASKI
Sbjct  424   ADASKI  429



>gb|KDO71784.1| hypothetical protein CISIN_1g012949mg [Citrus sinensis]
Length=452

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/449 (68%), Positives = 350/449 (78%), Gaps = 52/449 (12%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP +S IDR+  RFSSNACRP GD  GMG  WI+G +CS+SNS DED+DEY 
Sbjct  5     EEPLGLDKLPSMSTIDRIQ-RFSSNACRPSGDGMGMGSCWIEGSSCSTSNSYDEDYDEYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLF------------------------NGV  1354
             R ++ W+R  RD  +    +RR+ S G  + +F                         G+
Sbjct  64    REAFPWRRHTRDMSHGDSFSRRTVSLGRNHKMFGSACDIYNSNCNDKDIRDITNKFLKGI  123

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             P++VKIVEVGPRDGLQNEKN VPT VKVELIR+LVS GLPVVE T FVSPKWVPQL+DA+
Sbjct  124   PRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADAR  183

Query  1173  DVMQAVKNLEGARLPVLTPNLK--------------------------GFEAAIASGake  1072
             DVM+AV++LEGARLPVLTPNLK                          GFEAAIA+GAKE
Sbjct  184   DVMEAVRDLEGARLPVLTPNLKVILQRSILFQQCHASVISSNLWVYLQGFEAAIAAGAKE  243

Query  1071  vavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPS  892
             VA+FASASE+FSK+NINCSIE+SLVRYRAV  AAK LSIPVRGY+SCVVGCPVEGAI PS
Sbjct  244   VAIFASASEAFSKSNINCSIEDSLVRYRAVAHAAKVLSIPVRGYVSCVVGCPVEGAIPPS  303

Query  891   KVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLP  712
             KVAY+AKELH+MGCFEISLGDTIGV TPGTV+PMLEAVMAVVPVEKLAVH HDTYGQSLP
Sbjct  304   KVAYVAKELHDMGCFEISLGDTIGVGTPGTVVPMLEAVMAVVPVEKLAVHLHDTYGQSLP  363

Query  711   NILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAG  532
             NIL+SLQMG+ TVD SV+GLGGCPYAKGA+GNVATEDVVYML GLGV+TNVDL KL+ AG
Sbjct  364   NILISLQMGISTVDCSVAGLGGCPYAKGASGNVATEDVVYMLSGLGVETNVDLRKLMLAG  423

Query  531   EFISKHLGRESSSKAAIALTRVSADASKI  445
             +FI+KHLGR S SK AIAL R++ADASKI
Sbjct  424   DFINKHLGRPSGSKTAIALNRIAADASKI  452



>ref|XP_007015227.1| Aldolase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007015228.1| Aldolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY32846.1| Aldolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY32847.1| Aldolase superfamily protein isoform 1 [Theobroma cacao]
Length=433

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/430 (71%), Positives = 344/430 (80%), Gaps = 33/430 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL  D+LP +S IDR+  RFS+ ACRP G+D GMG  WI+GR+CS+SNSCDED++EY 
Sbjct  5     EEPLGFDKLPSMSTIDRIQ-RFSAGACRPRGEDMGMGTCWIEGRSCSTSNSCDEDYEEYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFS-------------------------------GGWR  1375
               ++ W+R  RD       NRR+ S                                G  
Sbjct  64    GEAFPWRRHVRDVSEGEAFNRRASSLSKNRMKCRHVCDSRYLPDLQYRSKCNGRGVRGIT  123

Query  1374  NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
             N     +PK+VKIVEVGPRDGLQNEKN VPTSVKVELIR+LVS GL VVE T FVSPKWV
Sbjct  124   NKFLKDIPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIRRLVSSGLTVVEATSFVSPKWV  183

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDVM+AV+++E ARLPVLTPNLKGFEAA+A+GAKEVAVFASASESFSK+NINCS
Sbjct  184   PQLADAKDVMKAVRDMEDARLPVLTPNLKGFEAAVAAGAKEVAVFASASESFSKSNINCS  243

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESLVRYRAV +AAK+LS+PVRGY+SC VGCPVEGAI PSKVAY+AKEL+ MGCFEISL
Sbjct  244   IEESLVRYRAVCAAAKELSVPVRGYVSCAVGCPVEGAIPPSKVAYVAKELYNMGCFEISL  303

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
              DTIGV TPGTV+PMLEAVMAVV  EKLAVHFHDTYGQSLPNILVSLQMG+ TVDSSV+G
Sbjct  304   ADTIGVGTPGTVVPMLEAVMAVVSAEKLAVHFHDTYGQSLPNILVSLQMGISTVDSSVAG  363

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYML+GLGVKTNVDL KL  AG+FIS HLGR+S SK AIAL
Sbjct  364   LGGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLAKLKLAGDFISDHLGRQSGSKTAIAL  423

Query  474   TRVSADASKI  445
              RV+ADASKI
Sbjct  424   GRVTADASKI  433



>ref|XP_010088968.1| Hydroxymethylglutaryl-CoA lyase [Morus notabilis]
 gb|EXB37183.1| Hydroxymethylglutaryl-CoA lyase [Morus notabilis]
Length=432

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/429 (71%), Positives = 345/429 (80%), Gaps = 32/429 (7%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL  D++P +S IDR+  RFSS ACRP  D+ G G  WI+GR+CS+SNSC +D++   
Sbjct  5     EEPLGFDKVPSMSTIDRIQ-RFSSGACRPREDNMGFGNCWIEGRSCSTSNSCSDDYEGRE  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGG-----------W-------------------RN  1372
                + W R  RD       NRR+ S G           W                    N
Sbjct  64    TEIFPWVRHTRDFSQGDTLNRRTSSLGRNQVTGTGCSSWYSSDHQYKPKSNDRDKQDVTN  123

Query  1371  VLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVP  1192
                  +PK+VKIVEVGPRDGLQNEKN VPT+VK+ELI +LVSCGLPVVE T FVSPKWVP
Sbjct  124   KFLKSMPKFVKIVEVGPRDGLQNEKNIVPTAVKIELIHRLVSCGLPVVEATSFVSPKWVP  183

Query  1191  QLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSI  1012
             QL+DAKDVM AV+NLEGARLPVLTPNLKGFEAA+A+GAKEVAVFASASESFSK+NINCSI
Sbjct  184   QLADAKDVMGAVQNLEGARLPVLTPNLKGFEAAVAAGAKEVAVFASASESFSKSNINCSI  243

Query  1011  EESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLG  832
             EESL RYRAVT AAK+LSIPVRGYISCVVGCPVEGAI PSKVAY+AKEL++MGCFEISL 
Sbjct  244   EESLARYRAVTHAAKELSIPVRGYISCVVGCPVEGAIAPSKVAYVAKELYDMGCFEISLA  303

Query  831   DTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGL  652
             DTIGV TPGTV+PMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMG+ T+DSS++GL
Sbjct  304   DTIGVGTPGTVVPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGISTIDSSIAGL  363

Query  651   GGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALT  472
             GGCPYAKGA+GNVATEDVVYML+GLGVKTNVDL KLL+AG+FISK LGR S SK+AIAL+
Sbjct  364   GGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLTKLLKAGDFISKQLGRPSGSKSAIALS  423

Query  471   RVSADASKI  445
             R++ADASKI
Sbjct  424   RLTADASKI  432



>ref|XP_011036394.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Populus 
euphratica]
 ref|XP_011036395.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Populus 
euphratica]
 ref|XP_011009105.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Populus euphratica]
 ref|XP_011009106.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Populus euphratica]
Length=429

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/430 (71%), Positives = 343/430 (80%), Gaps = 37/430 (9%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL  D+LP ++ I+R+  RFSS ACRP  DD GMG  WI+GR CSSSNSC+ED+ EY 
Sbjct  5     EEPLGFDKLPSMNTIERIQ-RFSSGACRPRADDMGMGHCWIEGRTCSSSNSCEEDY-EYT  62

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNV-----------------------------  1369
             R ++ WKR  RD   +   NRRS S G +N+                             
Sbjct  63    RETFPWKRHTRD---SCQGNRRSVSSGSKNMVSGSSCDSRYFPDHQYSSKSNDKDIRGIT  119

Query  1368  --LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
                  G+PK+VKIVEVGPRDGLQNEKN VPT VKVELI +LVS GLPVVE T FVSPKWV
Sbjct  120   NKFLKGIPKFVKIVEVGPRDGLQNEKNIVPTDVKVELIHRLVSSGLPVVEATSFVSPKWV  179

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DA+DVM+AV  LE +RLPVLTPNLKGFEAA+A+GAKEVAVFASASESFSK+NINCS
Sbjct  180   PQLADARDVMEAVHGLEASRLPVLTPNLKGFEAAVAAGAKEVAVFASASESFSKSNINCS  239

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESL RYRAVT AAK+LSIPVRGY+SCV+GCP EG+I PSKVAY+AKELH+MGCFEISL
Sbjct  240   IEESLARYRAVTHAAKELSIPVRGYVSCVIGCPEEGSIHPSKVAYVAKELHDMGCFEISL  299

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGV TPGTV  MLEAVMAVVPVEKLA+HFHDTYGQSLPNILVSLQMG+  VDSSV+G
Sbjct  300   GDTIGVGTPGTVALMLEAVMAVVPVEKLAIHFHDTYGQSLPNILVSLQMGISVVDSSVAG  359

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYMLHGLGV+TNVDL KLL AG+FI K LGR S SK A+AL
Sbjct  360   LGGCPYAKGASGNVATEDVVYMLHGLGVRTNVDLAKLLSAGDFICKQLGRPSGSKTAMAL  419

Query  474   TRVSADASKI  445
             +RV+ADASKI
Sbjct  420   SRVTADASKI  429



>ref|XP_011080451.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Sesamum 
indicum]
 ref|XP_011080452.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Sesamum 
indicum]
 ref|XP_011080453.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Sesamum 
indicum]
 ref|XP_011080454.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Sesamum 
indicum]
Length=427

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/424 (74%), Positives = 357/424 (84%), Gaps = 27/424 (6%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP LSNIDR+  RFSS+ACRP+ +D GMG  WI+GR+CSSSNSC+EDF++  
Sbjct  5     EEPLGLDKLPSLSNIDRL-YRFSSSACRPIREDMGMGNCWIEGRSCSSSNSCNEDFEDNT  63

Query  1461  RGSYGWKRQFRD------------------RPYNGVSNR--RSF-----SGGWRNVLFNG  1357
                  W+RQ R+                  R  + +SN   RS+     +G  +  LF  
Sbjct  64    EEPVTWRRQRRNSLQRTSSLGRSCVACGTMRDLHYLSNYQCRSYCNDNCTGELKYKLFKD  123

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             +P+YVKIVEVGPRDGLQNEK  VPTSVKV+LIRKLVSCGLPVVE T FVSPKWVPQL+DA
Sbjct  124   IPRYVKIVEVGPRDGLQNEKTIVPTSVKVKLIRKLVSCGLPVVEATSFVSPKWVPQLADA  183

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
             KDVM AVKNLEG RLPVLTPNLKGFEAA+A+GAKEVAVFASASESFSK+NINCSIEESL 
Sbjct  184   KDVMDAVKNLEGVRLPVLTPNLKGFEAAVAAGAKEVAVFASASESFSKSNINCSIEESLA  243

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             RYRAVTSAAKKLSIPVRGY+SCVVGCPVEG I PSKVAY+AKELH MGCFEISLGDTIGV
Sbjct  244   RYRAVTSAAKKLSIPVRGYVSCVVGCPVEGFISPSKVAYVAKELHNMGCFEISLGDTIGV  303

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
             ATPGTV+PMLEAVMAVVPVEKLAVHFHDTYGQSLPNIL+SLQMG+ TVDSSVSGLGGCPY
Sbjct  304   ATPGTVLPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILLSLQMGISTVDSSVSGLGGCPY  363

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSAD  457
             A+GA+GNVATEDVVYML+GLGVKTN+D+ KLL AGE+I+++LGR+S SK A+AL+R++AD
Sbjct  364   ARGASGNVATEDVVYMLNGLGVKTNIDMDKLLSAGEYINQYLGRQSGSKTAVALSRINAD  423

Query  456   ASKI  445
             AS I
Sbjct  424   ASNI  427



>ref|XP_002314006.1| putative hydroxymethylglutaryl-CoA lyase family protein [Populus 
trichocarpa]
 gb|EEE87961.1| putative hydroxymethylglutaryl-CoA lyase family protein [Populus 
trichocarpa]
Length=429

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/430 (71%), Positives = 344/430 (80%), Gaps = 37/430 (9%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL  D+LP ++ I+R+  RFSS ACRP  DD GMG  WI+GR CSSSNSC+ED+ EY 
Sbjct  5     EEPLGFDKLPSMNTIERIQ-RFSSGACRPRADDIGMGHCWIEGRICSSSNSCEEDY-EYT  62

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNV-----------------------------  1369
             R ++ WKR  RD P  G  NRR+ S G +NV                             
Sbjct  63    RETFPWKRHTRD-PCQG--NRRTMSSGSKNVVSGSSCDSRYFPDHQYSSKSNDKDIRDIT  119

Query  1368  --LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
                  G+PK+VKIVEVGPRDGLQNEKN VPT VKVELI +LVS GLPVVE T FVSPKWV
Sbjct  120   NKFLKGIPKFVKIVEVGPRDGLQNEKNIVPTDVKVELIHRLVSSGLPVVEATSFVSPKWV  179

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DA+DVM+AV  LE +RLPVLTPNLKGFEAA+A+GAKEVAVFASASESFSK+NINCS
Sbjct  180   PQLADARDVMEAVHGLEASRLPVLTPNLKGFEAAVAAGAKEVAVFASASESFSKSNINCS  239

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             I+ESL RYRAVT AAK+LSIPVRGY+SCV+GCP EG+I PSKVAY+AKELH+MGCFEISL
Sbjct  240   IKESLARYRAVTHAAKELSIPVRGYVSCVIGCPEEGSIHPSKVAYVAKELHDMGCFEISL  299

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGV TPGTV  MLEAVMAVVPVEKLA+HFHDTYGQSLPNILVSLQMG+  VDSSV+G
Sbjct  300   GDTIGVGTPGTVALMLEAVMAVVPVEKLAIHFHDTYGQSLPNILVSLQMGISVVDSSVAG  359

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYMLHGLGV+TNVDL KLL AG+FI K LGR S SK A+AL
Sbjct  360   LGGCPYAKGASGNVATEDVVYMLHGLGVRTNVDLAKLLSAGDFICKQLGRPSGSKTAVAL  419

Query  474   TRVSADASKI  445
             +RV+ADASKI
Sbjct  420   SRVTADASKI  429



>ref|XP_008449633.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X2 [Cucumis melo]
 ref|XP_008449634.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X2 [Cucumis melo]
 ref|XP_008449635.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X2 [Cucumis melo]
Length=432

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/430 (70%), Positives = 342/430 (80%), Gaps = 34/430 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP +S IDR+  RFSS+ACRP+GDD GMG  WI G   SSSNSC E +DE  
Sbjct  5     EEPLGLDKLPSMSTIDRIQ-RFSSSACRPIGDDMGMGICWIQGGRSSSSNSCKE-YDEDA  62

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWR-------------------------------  1375
               ++ W+R  ++   NG  NRR+ S G +                               
Sbjct  63    GDTFPWRRHRKNTSQNGSVNRRTMSAGSKKFASENFCEPHCSLGHEYKTKSTSDNIQHMT  122

Query  1374  NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
             N     +PK+VKIVEVGPRDGLQNEKN VPTSVKVELI +LVS GLPVVE T FVSP  V
Sbjct  123   NKFLKDIPKFVKIVEVGPRDGLQNEKNMVPTSVKVELIHRLVSSGLPVVEATSFVSPTRV  182

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQLSDA +VM+AV+NLEGARLPVLTPNLKGF AAI +GAKEVAVFASASESFSKANINCS
Sbjct  183   PQLSDAAEVMEAVRNLEGARLPVLTPNLKGFRAAITAGAKEVAVFASASESFSKANINCS  242

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESL RYRAVTSAAK+L+IPVRGY+SCVVGCP EGA+ PSKVAY+AKEL+EMGCFEISL
Sbjct  243   IEESLDRYRAVTSAAKELAIPVRGYVSCVVGCPTEGAVSPSKVAYVAKELYEMGCFEISL  302

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGVATPGTV+ MLEAVMAVVPV+KLAVHFHDTYGQSLPNIL+SLQMG+ T+DSSV+G
Sbjct  303   GDTIGVATPGTVVAMLEAVMAVVPVDKLAVHFHDTYGQSLPNILISLQMGISTIDSSVAG  362

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGATGNVATEDVVYMLHGLG+KTNVDL K++ AG FI+ HLGR S SK AIAL
Sbjct  363   LGGCPYAKGATGNVATEDVVYMLHGLGIKTNVDLAKVMSAGNFINSHLGRLSGSKTAIAL  422

Query  474   TRVSADASKI  445
              RV+AD+SK+
Sbjct  423   NRVAADSSKM  432



>ref|XP_004140185.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Cucumis sativus]
 ref|XP_004156054.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Cucumis sativus]
 gb|KGN48080.1| hypothetical protein Csa_6G429100 [Cucumis sativus]
Length=432

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/430 (70%), Positives = 342/430 (80%), Gaps = 34/430 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP +S IDR+  RFSS+ACRP+GDD GMG  WI G   SSSNSC E +DE G
Sbjct  5     EEPLGLDKLPSMSTIDRIQ-RFSSSACRPIGDDMGMGICWIQGGRSSSSNSCKE-YDENG  62

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWR-------------------------------  1375
               ++ W+R  ++   NG  NRR+ S G +                               
Sbjct  63    GDTFPWRRHRKNTSQNGFVNRRTTSAGSKIFASENFCESHCSPGHEYKTKSTSDNIQHMT  122

Query  1374  NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
             N     +PK+VKIVEVGPRDGLQNEKN VPTSVKVELI +LVS GLPVVE T FVSP  V
Sbjct  123   NKFLKDIPKFVKIVEVGPRDGLQNEKNMVPTSVKVELIHRLVSSGLPVVEATSFVSPTRV  182

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQLSDA +VM+AV+NLEGARLPVLTPNLK F AAIA+GAKEVAVFASASESFSKANINCS
Sbjct  183   PQLSDAAEVMEAVRNLEGARLPVLTPNLKSFRAAIAAGAKEVAVFASASESFSKANINCS  242

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESL RYRAVTSAAK+L+IPVRGY+SCVVGCP EGA+ PS VAY+AKEL+EMGCFEISL
Sbjct  243   IEESLDRYRAVTSAAKELAIPVRGYVSCVVGCPTEGAVSPSNVAYVAKELYEMGCFEISL  302

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGVATPGTV+PMLEAVM VVPV+KLAVHFHDTYGQSLPNIL+SLQMG+ T+DSSV+G
Sbjct  303   GDTIGVATPGTVVPMLEAVMGVVPVDKLAVHFHDTYGQSLPNILISLQMGISTIDSSVAG  362

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGATGNVATEDVVYMLHGLG+KTNVDL K++ AG FI+ HLGR S SK AIAL
Sbjct  363   LGGCPYAKGATGNVATEDVVYMLHGLGIKTNVDLAKVMSAGNFINNHLGRPSGSKTAIAL  422

Query  474   TRVSADASKI  445
              RV+AD+SK+
Sbjct  423   NRVAADSSKM  432



>ref|XP_003545429.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Glycine max]
 ref|XP_006595776.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Glycine max]
Length=433

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/428 (69%), Positives = 348/428 (81%), Gaps = 31/428 (7%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP ++ IDR+  RFSS +CRP  D+ GMG  WI+GR+CS+SNSC+ED +EY 
Sbjct  5     EEPLGLDKLPSMNTIDRIQ-RFSSGSCRPRVDNLGMGNCWIEGRSCSTSNSCNEDDEEYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLF---------------------------  1363
               ++ WK Q RD   +   +++S + G R++ F                           
Sbjct  64    AETFPWKIQTRDLSQDDSFSQKSLTKGRRSMKFGMIDDSISDCQSSPKCHTKDMQGLAYK  123

Query  1362  --NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
               N +PK+VKIVEVGPRDGLQNEKN VPTSVK+ELI +L S GL V+E T FVSPKWVPQ
Sbjct  124   FLNSIPKFVKIVEVGPRDGLQNEKNIVPTSVKIELIHRLASTGLSVIEATSFVSPKWVPQ  183

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+DAKDVMQAV NL G RLPVLTPNLKGFEAA+ASGA+EVA+FASASESFSK+NINCSIE
Sbjct  184   LADAKDVMQAVHNLRGIRLPVLTPNLKGFEAAMASGAREVAIFASASESFSKSNINCSIE  243

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ESL+R+RAVT AAK+LSIPVRGY+SCV GCPVEG I PSKVAY+AKEL++MGCFEISLGD
Sbjct  244   ESLIRFRAVTRAAKQLSIPVRGYVSCVAGCPVEGPIPPSKVAYVAKELYDMGCFEISLGD  303

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTV+PML AVMAVVP++K+AVHFHDTYGQSLPNILVSLQMG+ TVDSSV+GLG
Sbjct  304   TIGVGTPGTVVPMLLAVMAVVPIDKIAVHFHDTYGQSLPNILVSLQMGISTVDSSVAGLG  363

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGA+GNVATEDVVYML+GLGVKTNVDLGKL+ AG+FIS HLGR S+SK AIAL R
Sbjct  364   GCPYAKGASGNVATEDVVYMLNGLGVKTNVDLGKLMLAGDFISNHLGRPSTSKTAIALNR  423

Query  468   VSADASKI  445
             V+++ASKI
Sbjct  424   VTSNASKI  431



>ref|XP_008449632.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Cucumis melo]
Length=468

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/430 (70%), Positives = 342/430 (80%), Gaps = 34/430 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP +S IDR+  RFSS+ACRP+GDD GMG  WI G   SSSNSC E +DE  
Sbjct  41    EEPLGLDKLPSMSTIDRIQ-RFSSSACRPIGDDMGMGICWIQGGRSSSSNSCKE-YDEDA  98

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWR-------------------------------  1375
               ++ W+R  ++   NG  NRR+ S G +                               
Sbjct  99    GDTFPWRRHRKNTSQNGSVNRRTMSAGSKKFASENFCEPHCSLGHEYKTKSTSDNIQHMT  158

Query  1374  NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
             N     +PK+VKIVEVGPRDGLQNEKN VPTSVKVELI +LVS GLPVVE T FVSP  V
Sbjct  159   NKFLKDIPKFVKIVEVGPRDGLQNEKNMVPTSVKVELIHRLVSSGLPVVEATSFVSPTRV  218

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQLSDA +VM+AV+NLEGARLPVLTPNLKGF AAI +GAKEVAVFASASESFSKANINCS
Sbjct  219   PQLSDAAEVMEAVRNLEGARLPVLTPNLKGFRAAITAGAKEVAVFASASESFSKANINCS  278

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESL RYRAVTSAAK+L+IPVRGY+SCVVGCP EGA+ PSKVAY+AKEL+EMGCFEISL
Sbjct  279   IEESLDRYRAVTSAAKELAIPVRGYVSCVVGCPTEGAVSPSKVAYVAKELYEMGCFEISL  338

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGVATPGTV+ MLEAVMAVVPV+KLAVHFHDTYGQSLPNIL+SLQMG+ T+DSSV+G
Sbjct  339   GDTIGVATPGTVVAMLEAVMAVVPVDKLAVHFHDTYGQSLPNILISLQMGISTIDSSVAG  398

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGATGNVATEDVVYMLHGLG+KTNVDL K++ AG FI+ HLGR S SK AIAL
Sbjct  399   LGGCPYAKGATGNVATEDVVYMLHGLGIKTNVDLAKVMSAGNFINSHLGRLSGSKTAIAL  458

Query  474   TRVSADASKI  445
              RV+AD+SK+
Sbjct  459   NRVAADSSKM  468



>ref|XP_003529496.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Glycine max]
 gb|KHN28190.1| Hydroxymethylglutaryl-CoA lyase, mitochondrial [Glycine soja]
Length=433

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/430 (70%), Positives = 341/430 (79%), Gaps = 33/430 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP +  IDR+  RFSS ACRP  D+ GMG  WI+GR+CS+SNSCDED +EY 
Sbjct  5     EEPLGLDKLPSMCTIDRIQ-RFSSAACRPRVDNLGMGNCWIEGRSCSTSNSCDEDNEEYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLF---------------------------  1363
               ++ W+RQ RD       ++++ + G  ++ F                           
Sbjct  64    AETFPWRRQTRDLSRGDSFSQKTMTMGRNSMKFGMIDNSFYASDYQYSPQSNNKNVQDMP  123

Query  1362  ----NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
                  G+PK+VKIVEVGPRDGLQNEKN VPT VK+ELI +L S GL V+E T FVSPKWV
Sbjct  124   YKFMKGIPKFVKIVEVGPRDGLQNEKNIVPTDVKIELIHRLASSGLSVIEATSFVSPKWV  183

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDVMQAV NL G RLPVLTPNLKGFEAAIA+GA+EVAVFASASESFSK+NINCS
Sbjct  184   PQLADAKDVMQAVHNLGGIRLPVLTPNLKGFEAAIAAGAREVAVFASASESFSKSNINCS  243

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESLVRYRAVT AAK+LSIPVRGY+SCVVGCPVEG I PS+VAY+AKEL++MGCFEISL
Sbjct  244   IEESLVRYRAVTHAAKELSIPVRGYVSCVVGCPVEGPIPPSRVAYVAKELYDMGCFEISL  303

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGV TPGTV+PML AVMAVVP EKLAVHFHDTYGQSL NILVSLQMG+  VDSSV+G
Sbjct  304   GDTIGVGTPGTVVPMLLAVMAVVPAEKLAVHFHDTYGQSLANILVSLQMGISAVDSSVAG  363

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYML+GLGVKTNVDLGKL+ AGEFI KHLGR S SK  IA 
Sbjct  364   LGGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLGKLMSAGEFIGKHLGRPSGSKTTIAF  423

Query  474   TRVSADASKI  445
             +RV+ADASKI
Sbjct  424   SRVTADASKI  433



>ref|XP_009343554.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Pyrus 
x bretschneideri]
Length=431

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/428 (70%), Positives = 344/428 (80%), Gaps = 31/428 (7%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDG-MGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL  D+LP +S +DR+  RFSS ACR   DD  +G  WI+GR+CS+SNS +ED+DEY 
Sbjct  5     EEPLGCDKLPSMSTMDRIQ-RFSSTACRSRSDDAALGNCWIEGRSCSTSNSYNEDYDEYT  63

Query  1461  RGSYGWKRQFRDR--PYNGVSNRRSFS------------GGWR---------------NV  1369
             R ++ WKR  RD+   +    N+R+ S              W                N 
Sbjct  64    REAFPWKRHTRDQGLSHGDSFNQRTLSVRRNHRVFGNICDSWYFSDQYDPKCNNTDMANK  123

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
                G+PK+VKIVEVGPRDGLQNEKN V  SVK+ELI++LVS GL VVE T FVSPKWVPQ
Sbjct  124   FLKGIPKFVKIVEVGPRDGLQNEKNIVSASVKIELIQRLVSSGLSVVEATSFVSPKWVPQ  183

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+DAKDVM+AV++LEGARLPVLTPNL+GFEAAIA+GAK++AVFA+ASESFSK+NINCSIE
Sbjct  184   LADAKDVMEAVQSLEGARLPVLTPNLQGFEAAIAAGAKDIAVFAAASESFSKSNINCSIE  243

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ESLVRYRAVT AAK+LSIPVRGY+SCVVGCP EGAI PSKVAY+AKEL  MGCFEISL D
Sbjct  244   ESLVRYRAVTRAAKELSIPVRGYVSCVVGCPEEGAISPSKVAYVAKELCNMGCFEISLAD  303

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTV+PMLEAVMAVVPVEKLAVHFHDTYGQSL NILVSLQMG+ T+DSS++GLG
Sbjct  304   TIGVGTPGTVVPMLEAVMAVVPVEKLAVHFHDTYGQSLSNILVSLQMGISTLDSSIAGLG  363

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGA+GNVATEDVVYML+GLGVKTNVDL KLL AG+FISKHLGR S SK A+AL+R
Sbjct  364   GCPYAKGASGNVATEDVVYMLNGLGVKTNVDLAKLLTAGDFISKHLGRPSGSKTAVALSR  423

Query  468   VSADASKI  445
             V+AD SKI
Sbjct  424   VTADGSKI  431



>ref|XP_003518478.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Glycine max]
 ref|XP_006575617.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Glycine max]
 gb|KHN38402.1| Hydroxymethylglutaryl-CoA lyase, mitochondrial [Glycine soja]
Length=433

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/428 (68%), Positives = 348/428 (81%), Gaps = 31/428 (7%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP ++ IDR+  RFSS +CRP  D+ GMG  WI+GR+CS+SNSC+ED +EY 
Sbjct  5     EEPLGLDKLPSMNTIDRIQ-RFSSGSCRPRVDNLGMGNCWIEGRSCSTSNSCNEDDEEYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLF---------------------------  1363
               ++ WKRQ RD   +   ++++   G +++ F                           
Sbjct  64    AETFPWKRQTRDLSPDDSFSQKTLIKGRKSMKFGMIDDSFSDCQTSPKCHTKDLQGLAYK  123

Query  1362  --NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
               N +PK+VKIVEVGPRDGLQNEKN VPT+VK+ELI +L S GL V+E T FVSPKWVPQ
Sbjct  124   YLNSIPKFVKIVEVGPRDGLQNEKNIVPTAVKIELIHRLASTGLSVIEATSFVSPKWVPQ  183

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+DAKDVMQAV NL G RLPVLTPNLKGFEAAIA+GA+EVA+FASASESFSK+NINCSIE
Sbjct  184   LADAKDVMQAVHNLRGIRLPVLTPNLKGFEAAIAAGAREVAIFASASESFSKSNINCSIE  243

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ESL+R++AVT AAK+LSIPVRGY+SCV GCPVEG I PSKVAY+AKEL++MGCFEISLGD
Sbjct  244   ESLIRFQAVTHAAKQLSIPVRGYVSCVAGCPVEGPIPPSKVAYVAKELYDMGCFEISLGD  303

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTV+PML AVMAVVP++K+AVHFHDTYGQSLPNILVSLQMG+ TVDSSV+GLG
Sbjct  304   TIGVGTPGTVVPMLLAVMAVVPIDKIAVHFHDTYGQSLPNILVSLQMGISTVDSSVAGLG  363

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGA+GNVATEDVVYML+GLG+KT+VDLGKL+ AGEFIS HLGR S+SK AIAL R
Sbjct  364   GCPYAKGASGNVATEDVVYMLNGLGIKTDVDLGKLILAGEFISNHLGRPSTSKTAIALNR  423

Query  468   VSADASKI  445
             V+++ASKI
Sbjct  424   VTSNASKI  431



>ref|XP_003555172.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Glycine max]
 ref|XP_006605605.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Glycine max]
Length=435

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/432 (69%), Positives = 342/432 (79%), Gaps = 35/432 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD---GMGERWIDGRNCSSSNSCDEDFDE  1468
             EEPL LD+LP +S IDR+  RFSS AC P  D+   G+G  WI+GR+CS+SNSC+ED +E
Sbjct  5     EEPLGLDKLPSMSTIDRIQ-RFSSAACCPRVDNFNLGLGNCWIEGRSCSTSNSCNEDSEE  63

Query  1467  YGRGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLF-------------------------  1363
             Y   ++ W+RQ RD       +++S + G  ++ F                         
Sbjct  64    YTEETFPWRRQRRDLSRGDTFSQKSMTMGRNSMKFGMIDNSFYTSDYQYSPQNNNNNVQD  123

Query  1362  ------NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPK  1201
                    G+P +VKIVEVGPRDGLQNEKN VPT VK+ELI +L S GL V+E T FVSPK
Sbjct  124   MAYKFMKGIPNFVKIVEVGPRDGLQNEKNIVPTDVKIELIHRLASSGLSVIEATSFVSPK  183

Query  1200  WVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANIN  1021
             WVPQL+DAKDVMQAV NL G RLPVLTPNLKGFEAAIA+GA+EVAVFASASESFSK+NIN
Sbjct  184   WVPQLADAKDVMQAVHNLGGIRLPVLTPNLKGFEAAIAAGAREVAVFASASESFSKSNIN  243

Query  1020  CSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEI  841
             CSIEESLVRYRAVT AAK+LSIPVRGY+SCVVGCPVEG I PSKVAY+AKEL++MGCFEI
Sbjct  244   CSIEESLVRYRAVTRAAKQLSIPVRGYVSCVVGCPVEGPIPPSKVAYVAKELYDMGCFEI  303

Query  840   SLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSV  661
             SLGDTIGV TPGTV+PML AVMAVVP EKLAVHFHDTYGQSLPNILVSLQMG+  VDSSV
Sbjct  304   SLGDTIGVGTPGTVVPMLLAVMAVVPAEKLAVHFHDTYGQSLPNILVSLQMGISAVDSSV  363

Query  660   SGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAI  481
             +GLGGCPYAKGA+GNVATEDVVYML+GLGVKTNVDLGKL+ AGEFI KHLGR S SK A+
Sbjct  364   AGLGGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLGKLMLAGEFIGKHLGRPSGSKTAV  423

Query  480   ALTRVSADASKI  445
             A +RV+ADASKI
Sbjct  424   AFSRVTADASKI  435



>gb|KHN27356.1| Hydroxymethylglutaryl-CoA lyase, mitochondrial [Glycine soja]
Length=435

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/432 (69%), Positives = 342/432 (79%), Gaps = 35/432 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD---GMGERWIDGRNCSSSNSCDEDFDE  1468
             EEPL LD+LP +S IDR+  RFSS AC P  D+   G+G  WI+GR+CS+SNSC+ED +E
Sbjct  5     EEPLGLDKLPSMSTIDRIQ-RFSSAACCPRVDNFNLGLGNCWIEGRSCSTSNSCNEDSEE  63

Query  1467  YGRGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLF-------------------------  1363
             Y   ++ W+RQ RD       +++S + G  ++ F                         
Sbjct  64    YTEETFPWRRQRRDLSRGDTFSQKSMTMGRNSMKFGMIDNSFYTSDYQYSPQNNNKNVQD  123

Query  1362  ------NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPK  1201
                    G+P +VKIVEVGPRDGLQNEKN VPT VK+ELI +L S GL V+E T FVSPK
Sbjct  124   MAYKFMKGIPNFVKIVEVGPRDGLQNEKNIVPTDVKIELIHRLASSGLSVIEATSFVSPK  183

Query  1200  WVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANIN  1021
             WVPQL+DAKDVMQAV NL G RLPVLTPNLKGFEAAIA+GA+EVAVFASASESFSK+NIN
Sbjct  184   WVPQLADAKDVMQAVHNLGGIRLPVLTPNLKGFEAAIAAGAREVAVFASASESFSKSNIN  243

Query  1020  CSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEI  841
             CSIEESLVRYRAVT AAK+LSIPVRGY+SCVVGCPVEG I PSKVAY+AKEL++MGCFEI
Sbjct  244   CSIEESLVRYRAVTRAAKQLSIPVRGYVSCVVGCPVEGPIPPSKVAYVAKELYDMGCFEI  303

Query  840   SLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSV  661
             SLGDTIGV TPGTV+PML AVMAVVP EKLAVHFHDTYGQSLPNILVSLQMG+  VDSSV
Sbjct  304   SLGDTIGVGTPGTVVPMLLAVMAVVPAEKLAVHFHDTYGQSLPNILVSLQMGISAVDSSV  363

Query  660   SGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAI  481
             +GLGGCPYAKGA+GNVATEDVVYML+GLGVKTNVDLGKL+ AGEFI KHLGR S SK A+
Sbjct  364   AGLGGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLGKLMLAGEFIGKHLGRPSGSKTAV  423

Query  480   ALTRVSADASKI  445
             A +RV+ADASKI
Sbjct  424   AFSRVTADASKI  435



>ref|XP_006397376.1| hypothetical protein EUTSA_v10022501mg [Eutrema salsugineum]
 gb|ESQ38829.1| hypothetical protein EUTSA_v10022501mg [Eutrema salsugineum]
Length=433

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/431 (68%), Positives = 347/431 (81%), Gaps = 35/431 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCDEDFDEYGR  1459
             EEPL+ D+LP +S IDR+  RFSS ACR   D GMG RWI+ R+CS+SNSC++D   +G+
Sbjct  5     EEPLAFDKLPSMSTIDRIQ-RFSSGACRLRDDVGMGHRWIEERDCSTSNSCNDDDKSFGK  63

Query  1458  GSYGWKRQ--------------------------------FRDRPYNGVSNRRSFSGGWR  1375
              S+ W+R                                 F++  Y+ +SN    S    
Sbjct  64    ESFPWRRHTRKISEGEHLLRNISFSGRNSTVSGTLWESKNFQEHKYHTISNENGISHS-S  122

Query  1374  NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
             N +  GVPK+VKIVEVGPRDGLQNEKN VPTSVKVELI++LVS GLPVVE T FVSPKWV
Sbjct  123   NKIVRGVPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVSPKWV  182

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDVM AV  L+GARLPVLTPNLKGFEAA+++GAKEVA+FASASESFS +NINC+
Sbjct  183   PQLADAKDVMDAVSTLDGARLPVLTPNLKGFEAAVSAGAKEVAIFASASESFSLSNINCT  242

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESL+R+RAVT+AAK+ SIPVRGY+SCVVGCPVEGA+ PSKVAY+AKEL+EMGCFEISL
Sbjct  243   IEESLLRFRAVTTAAKEHSIPVRGYVSCVVGCPVEGAVPPSKVAYVAKELYEMGCFEISL  302

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIG+ TPG+V+PMLEAVMAVVP EKLAVHFHDTYGQ+L NILVSLQMG+  VDSSV+G
Sbjct  303   GDTIGIGTPGSVVPMLEAVMAVVPAEKLAVHFHDTYGQALANILVSLQMGINIVDSSVAG  362

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYML+GLGV++NVDLGKL+ AG++ISKHLGR + SKAA+AL
Sbjct  363   LGGCPYAKGASGNVATEDVVYMLNGLGVQSNVDLGKLIAAGDYISKHLGRPNGSKAAVAL  422

Query  474   T-RVSADASKI  445
               R++ADASKI
Sbjct  423   NRRITADASKI  433



>ref|XP_010544284.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Tarenaya hassleriana]
 ref|XP_010544285.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Tarenaya hassleriana]
Length=434

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/432 (69%), Positives = 344/432 (80%), Gaps = 36/432 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP +  IDR+  RFSS ACRP  DD G+G  W++GR+CS+SNSC++D D YG
Sbjct  5     EEPLGLDKLPSMRTIDRIQ-RFSSGACRPRADDLGLGHCWLEGRDCSTSNSCNDDDDNYG  63

Query  1461  RGSYGWKRQFR--------------------------------DRPYNGVSNRRSFSGGW  1378
             R  + W+R  R                                DR Y+ +SN RS     
Sbjct  64    REGFPWRRHTRKMSDGEPILRRTSTLGMNHMTCQTLWDPRYLHDRKYSTISNERSIHHS-  122

Query  1377  RNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
              N +F  +PK+VKIVEVGPRDGLQNEKN VPTSVKVELI++LVS GLPVVE T FVSPKW
Sbjct  123   TNKIFVAIPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVSPKW  182

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQL+DAKDVM AV  L GARLPVLTPNLKGFEAA+ +GAKEVAVFASASESFS++NINC
Sbjct  183   VPQLADAKDVMAAVSTLNGARLPVLTPNLKGFEAAVTAGAKEVAVFASASESFSRSNINC  242

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             +IEESL RYRAV +AAK+ SIPVRGY+SCVVGCPVEGA+ PSKVA++ KEL++MGCFEIS
Sbjct  243   TIEESLSRYRAVANAAKERSIPVRGYVSCVVGCPVEGAVPPSKVAHVVKELYDMGCFEIS  302

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIGV TPGTV+PMLEA MAVVP +KLAVHFHDTYGQ+L NIL+SLQMG+  VDSS++
Sbjct  303   LGDTIGVGTPGTVVPMLEAAMAVVPADKLAVHFHDTYGQALANILISLQMGIGIVDSSIA  362

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYAKGA+GNVATEDVVYML+GLGV+TNVDLGKLL  GEFISKHLGR S SKAA+A
Sbjct  363   GLGGCPYAKGASGNVATEDVVYMLNGLGVQTNVDLGKLLSVGEFISKHLGRPSGSKAAVA  422

Query  477   LT-RVSADASKI  445
             L+ R++ADASKI
Sbjct  423   LSRRITADASKI  434



>ref|XP_010045087.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Eucalyptus 
grandis]
 ref|XP_010045088.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Eucalyptus 
grandis]
 gb|KCW87239.1| hypothetical protein EUGRSUZ_B03752 [Eucalyptus grandis]
Length=432

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/430 (71%), Positives = 345/430 (80%), Gaps = 34/430 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP +S IDR+  RFSS ACRP  DD GMG  WI+GR+CSSSNSC  D+DE+ 
Sbjct  5     EEPLGLDKLPSMSTIDRIQ-RFSSGACRPRMDDMGMGSCWIEGRDCSSSNSCSNDYDEFT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGG------------W-------------------R  1375
               S+ W R  R+   N  S  RS +GG            W                    
Sbjct  64    EDSFPWTRHTRNGSKND-SYARSSNGGRKDLVAGSTCASWYFPDHQYRSKCDEKSMRTTS  122

Query  1374  NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
             N    G+PK+VKIVEVGPRDGLQNEKN VPT++KVELIR+LVSCGLPVVE T FVSPKWV
Sbjct  123   NKFLTGIPKFVKIVEVGPRDGLQNEKNTVPTAIKVELIRRLVSCGLPVVEATSFVSPKWV  182

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDVM+AV +LE ARLPVLTPN+KGF+AA+A+GAKEVAVFASASESFSK+NINCS
Sbjct  183   PQLADAKDVMEAVHDLEDARLPVLTPNMKGFQAAVAAGAKEVAVFASASESFSKSNINCS  242

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESL RYRAV  AAK LSIPVRGY+SC +GCPVEGAI PSKVAY+A+ELH+MGCFEISL
Sbjct  243   IEESLARYRAVAQAAKALSIPVRGYVSCAIGCPVEGAIAPSKVAYVARELHDMGCFEISL  302

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGV TPGTV+PMLEAVMAVVP +KLAVHFHDTYGQSLPNIL+SLQMG+ TVDSSV+G
Sbjct  303   GDTIGVGTPGTVVPMLEAVMAVVPADKLAVHFHDTYGQSLPNILISLQMGISTVDSSVAG  362

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGATGNVATEDVVYML+GLGVKTNVDL KL++AGEFISKHL R S SK A+AL
Sbjct  363   LGGCPYAKGATGNVATEDVVYMLNGLGVKTNVDLAKLMKAGEFISKHLCRPSGSKTAVAL  422

Query  474   TRVSADASKI  445
              R +ADASKI
Sbjct  423   CRATADASKI  432



>ref|XP_006397377.1| hypothetical protein EUTSA_v10022501mg [Eutrema salsugineum]
 ref|XP_006397378.1| hypothetical protein EUTSA_v10022501mg [Eutrema salsugineum]
 gb|ESQ38830.1| hypothetical protein EUTSA_v10022501mg [Eutrema salsugineum]
 gb|ESQ38831.1| hypothetical protein EUTSA_v10022501mg [Eutrema salsugineum]
Length=468

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/431 (68%), Positives = 347/431 (81%), Gaps = 35/431 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCDEDFDEYGR  1459
             EEPL+ D+LP +S IDR+  RFSS ACR   D GMG RWI+ R+CS+SNSC++D   +G+
Sbjct  40    EEPLAFDKLPSMSTIDRIQ-RFSSGACRLRDDVGMGHRWIEERDCSTSNSCNDDDKSFGK  98

Query  1458  GSYGWKRQ--------------------------------FRDRPYNGVSNRRSFSGGWR  1375
              S+ W+R                                 F++  Y+ +SN    S    
Sbjct  99    ESFPWRRHTRKISEGEHLLRNISFSGRNSTVSGTLWESKNFQEHKYHTISNENGISHS-S  157

Query  1374  NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
             N +  GVPK+VKIVEVGPRDGLQNEKN VPTSVKVELI++LVS GLPVVE T FVSPKWV
Sbjct  158   NKIVRGVPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVSPKWV  217

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDVM AV  L+GARLPVLTPNLKGFEAA+++GAKEVA+FASASESFS +NINC+
Sbjct  218   PQLADAKDVMDAVSTLDGARLPVLTPNLKGFEAAVSAGAKEVAIFASASESFSLSNINCT  277

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESL+R+RAVT+AAK+ SIPVRGY+SCVVGCPVEGA+ PSKVAY+AKEL+EMGCFEISL
Sbjct  278   IEESLLRFRAVTTAAKEHSIPVRGYVSCVVGCPVEGAVPPSKVAYVAKELYEMGCFEISL  337

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIG+ TPG+V+PMLEAVMAVVP EKLAVHFHDTYGQ+L NILVSLQMG+  VDSSV+G
Sbjct  338   GDTIGIGTPGSVVPMLEAVMAVVPAEKLAVHFHDTYGQALANILVSLQMGINIVDSSVAG  397

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYML+GLGV++NVDLGKL+ AG++ISKHLGR + SKAA+AL
Sbjct  398   LGGCPYAKGASGNVATEDVVYMLNGLGVQSNVDLGKLIAAGDYISKHLGRPNGSKAAVAL  457

Query  474   T-RVSADASKI  445
               R++ADASKI
Sbjct  458   NRRITADASKI  468



>gb|KHN11014.1| Hydroxymethylglutaryl-CoA lyase, mitochondrial [Glycine soja]
Length=433

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/428 (68%), Positives = 345/428 (81%), Gaps = 31/428 (7%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP ++ IDR+  RFSS +CRP  D+ GMG  WI+GR+C +SNSC+ED +EY 
Sbjct  5     EEPLGLDKLPSMNTIDRIQ-RFSSGSCRPRVDNLGMGNCWIEGRSCRTSNSCNEDDEEYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLF---------------------------  1363
               ++ WK Q RD   +   +++S + G +++ F                           
Sbjct  64    AETFPWKIQTRDLSQDDSFSQKSLTKGRKSMKFGMIDDSISDCQSSPKCHTKDMQGLAYK  123

Query  1362  --NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
               N +PK+VKIVEVGPRDGLQNEKN VPTSVK+ELI +L S GL V+E T FVSPKWVPQ
Sbjct  124   FLNSIPKFVKIVEVGPRDGLQNEKNIVPTSVKIELIHRLASTGLSVIEATSFVSPKWVPQ  183

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+DA DVMQAV NL G RLPVLTPNLKGFEAA+ASGA+EVA+FASASESFSK+NINCSIE
Sbjct  184   LADANDVMQAVHNLRGIRLPVLTPNLKGFEAAMASGAREVAIFASASESFSKSNINCSIE  243

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ESL+R+RAVT AAK+LSIPVRGY+SCV GCPVEG I PSKVAY+AKEL++MGCFEISLGD
Sbjct  244   ESLIRFRAVTRAAKQLSIPVRGYVSCVAGCPVEGPIPPSKVAYVAKELYDMGCFEISLGD  303

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTV+PML AVM VVP++K+AVHFHDTYGQSLPNILVSLQMG+ TVDSSV+GLG
Sbjct  304   TIGVGTPGTVVPMLLAVMGVVPIDKIAVHFHDTYGQSLPNILVSLQMGISTVDSSVAGLG  363

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGA+GNVATEDVVYML+GLGVKTNVDLGKL+ AG+FIS HLGR S+SK AIAL R
Sbjct  364   GCPYAKGASGNVATEDVVYMLNGLGVKTNVDLGKLMLAGDFISNHLGRPSTSKTAIALNR  423

Query  468   VSADASKI  445
             V+++ASKI
Sbjct  424   VTSNASKI  431



>ref|XP_010544283.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Tarenaya hassleriana]
Length=481

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/432 (69%), Positives = 344/432 (80%), Gaps = 36/432 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP +  IDR+  RFSS ACRP  DD G+G  W++GR+CS+SNSC++D D YG
Sbjct  52    EEPLGLDKLPSMRTIDRIQ-RFSSGACRPRADDLGLGHCWLEGRDCSTSNSCNDDDDNYG  110

Query  1461  RGSYGWKRQFR--------------------------------DRPYNGVSNRRSFSGGW  1378
             R  + W+R  R                                DR Y+ +SN RS     
Sbjct  111   REGFPWRRHTRKMSDGEPILRRTSTLGMNHMTCQTLWDPRYLHDRKYSTISNERSIHHS-  169

Query  1377  RNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
              N +F  +PK+VKIVEVGPRDGLQNEKN VPTSVKVELI++LVS GLPVVE T FVSPKW
Sbjct  170   TNKIFVAIPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVSPKW  229

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQL+DAKDVM AV  L GARLPVLTPNLKGFEAA+ +GAKEVAVFASASESFS++NINC
Sbjct  230   VPQLADAKDVMAAVSTLNGARLPVLTPNLKGFEAAVTAGAKEVAVFASASESFSRSNINC  289

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             +IEESL RYRAV +AAK+ SIPVRGY+SCVVGCPVEGA+ PSKVA++ KEL++MGCFEIS
Sbjct  290   TIEESLSRYRAVANAAKERSIPVRGYVSCVVGCPVEGAVPPSKVAHVVKELYDMGCFEIS  349

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIGV TPGTV+PMLEA MAVVP +KLAVHFHDTYGQ+L NIL+SLQMG+  VDSS++
Sbjct  350   LGDTIGVGTPGTVVPMLEAAMAVVPADKLAVHFHDTYGQALANILISLQMGIGIVDSSIA  409

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYAKGA+GNVATEDVVYML+GLGV+TNVDLGKLL  GEFISKHLGR S SKAA+A
Sbjct  410   GLGGCPYAKGASGNVATEDVVYMLNGLGVQTNVDLGKLLSVGEFISKHLGRPSGSKAAVA  469

Query  477   LT-RVSADASKI  445
             L+ R++ADASKI
Sbjct  470   LSRRITADASKI  481



>ref|XP_010271863.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Nelumbo 
nucifera]
Length=428

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/429 (70%), Positives = 343/429 (80%), Gaps = 36/429 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD  P + +IDR+  RFSS+ACRP+ DD GMG  WI+GR+CSSSNSCDE   EY 
Sbjct  5     EEPLGLDNFPSI-DIDRLQ-RFSSSACRPMPDDMGMGNFWIEGRSCSSSNSCDE---EYT  59

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLF---------------------------  1363
             R ++ W+RQ RD       NR+  S G  + +F                           
Sbjct  60    RDTFPWRRQTRDGSQGSSLNRKMSSFGRNHRVFGSVCDSYMPNQQYNTHGSENGIRDLTN  119

Query  1362  ---NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVP  1192
                 G+PK+VKIVEVGPRDGLQNEKN VPT+VK+ELI++L S GL VVE T FVSPKWVP
Sbjct  120   KFLRGIPKFVKIVEVGPRDGLQNEKNMVPTAVKIELIQRLASSGLSVVEATSFVSPKWVP  179

Query  1191  QLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSI  1012
             QL+DAKDVM+A++N+EG R PVLTPNLKGFEAAIA+GAKEVAVFASASESFSK+NINCSI
Sbjct  180   QLADAKDVMEAIRNVEGTRFPVLTPNLKGFEAAIAAGAKEVAVFASASESFSKSNINCSI  239

Query  1011  EESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLG  832
             E+SL RY  VT AAKKLSIPVRGY+SCVVGCPVEG + PSKVAY+AKEL+ MGC EISLG
Sbjct  240   EDSLTRYCTVTLAAKKLSIPVRGYVSCVVGCPVEGPVPPSKVAYVAKELYNMGCSEISLG  299

Query  831   DTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGL  652
             DTIGV TPG+V+PMLEAVMAVVP+E+LAVHFHDTYGQSL NIL+SLQMG+ T+DSSVSGL
Sbjct  300   DTIGVGTPGSVVPMLEAVMAVVPIERLAVHFHDTYGQSLANILISLQMGISTIDSSVSGL  359

Query  651   GGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALT  472
             GGCPYAKGA+GNVATEDVVYML+GLGVKTNVDLGKL+ AGEFI KHL R S +KAAIAL+
Sbjct  360   GGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLGKLMSAGEFICKHLARPSGAKAAIALS  419

Query  471   RVSADASKI  445
             RV+ADASKI
Sbjct  420   RVTADASKI  428



>ref|XP_004510817.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=430

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/427 (69%), Positives = 344/427 (81%), Gaps = 30/427 (7%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP ++ +DR+  RFS+  CRP  D+ GMG  WI+GR+CS+SN C+ED +EY 
Sbjct  5     EEPLGLDKLPSMNTMDRVR-RFSTGCCRPQVDNLGMGNYWIEGRSCSTSNCCNEDNEEYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLFN--------------------------  1360
               ++ WKRQ  D+      ++++ + G  ++ F+                          
Sbjct  64    AETFPWKRQTTDKSQCDSFSQKTMTIGRNSMKFDNSFYSSDYQYSRKRNNNDIQDMAYKF  123

Query  1359  --GVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQL  1186
               G+P++VKIVEVGPRDGLQNEKN VPT+VK+ELI +L S GL V+E T FVSPKWVPQL
Sbjct  124   MKGMPEFVKIVEVGPRDGLQNEKNIVPTAVKIELIHRLASTGLSVIEATSFVSPKWVPQL  183

Query  1185  SDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEE  1006
             +DAKDVMQAV NL G RLPVLTPNLKG+EAAIA+GA+EVA+FASASESFSK+NINCSIEE
Sbjct  184   ADAKDVMQAVHNLGGIRLPVLTPNLKGYEAAIAAGAREVAIFASASESFSKSNINCSIEE  243

Query  1005  SLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDT  826
             SL RYRAVT AAK+LSIPVRGY+SCVVGCPVEG I PSKVAY+AKEL++MGCFEISLGDT
Sbjct  244   SLARYRAVTRAAKELSIPVRGYVSCVVGCPVEGPISPSKVAYVAKELNDMGCFEISLGDT  303

Query  825   IGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGG  646
             IGV TPGTV+PML AVMAVVPVEKLAVHFHDTYGQSL NILVSLQMG+  VDSSV+GLGG
Sbjct  304   IGVGTPGTVVPMLLAVMAVVPVEKLAVHFHDTYGQSLANILVSLQMGISAVDSSVAGLGG  363

Query  645   CPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             CPYAKGA+GNVATEDVVYML+GLGVKTNVD+GKL+ AG+FI+KHLGR S SK AIAL RV
Sbjct  364   CPYAKGASGNVATEDVVYMLNGLGVKTNVDIGKLMSAGDFINKHLGRVSGSKTAIALHRV  423

Query  465   SADASKI  445
             +ADASKI
Sbjct  424   TADASKI  430



>ref|NP_850087.1| Hydroxymethylglutaryl-CoA lyase [Arabidopsis thaliana]
 gb|AAM91612.1| putative hydroxymethylglutaryl-CoA lyase [Arabidopsis thaliana]
 gb|AAN15400.1| putative hydroxymethylglutaryl-CoA lyase [Arabidopsis thaliana]
 gb|AEC07888.1| Hydroxymethylglutaryl-CoA lyase [Arabidopsis thaliana]
Length=433

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/431 (67%), Positives = 343/431 (80%), Gaps = 35/431 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCDEDFDEYGR  1459
             EEPLS D+LP +S +DR+  RFSS ACRP  D GMG RWI+GR+C++SNSC +D   + +
Sbjct  5     EEPLSFDKLPSMSTMDRIQ-RFSSGACRPRDDVGMGHRWIEGRDCTTSNSCIDDDKSFAK  63

Query  1458  GSYGWKRQ--------------------------------FRDRPYNGVSNRRSFSGGWR  1375
              S+ W+R                                 F+++ Y+  SN    S    
Sbjct  64    ESFPWRRHTRKLSEGEHMFRNISFAGRTSTVSGTLRESKSFKEQKYSTFSNENGTSH-IS  122

Query  1374  NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
             N +  G+PK+VKIVEVGPRDGLQNEKN VPTSVKVELI++LVS GLPVVE T FVSPKWV
Sbjct  123   NKISKGIPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVSPKWV  182

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDVM AV  L+GARLPVLTPNLKGF+AA+++GAKEVA+FASASESFS +NINC+
Sbjct  183   PQLADAKDVMDAVNTLDGARLPVLTPNLKGFQAAVSAGAKEVAIFASASESFSLSNINCT  242

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESL+RYR V +AAK+ S+PVRGY+SCVVGCPVEG +LPSKVAY+ KEL++MGCFEISL
Sbjct  243   IEESLLRYRVVATAAKEHSVPVRGYVSCVVGCPVEGPVLPSKVAYVVKELYDMGCFEISL  302

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIG+ TPG+V+PMLEAVMAVVP +KLAVHFHDTYGQ+L NILVSLQMG+  VDSS++G
Sbjct  303   GDTIGIGTPGSVVPMLEAVMAVVPADKLAVHFHDTYGQALANILVSLQMGISIVDSSIAG  362

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYML+GLGV TNVDLGKL+ AG+FISKHLGR + SKAA+AL
Sbjct  363   LGGCPYAKGASGNVATEDVVYMLNGLGVHTNVDLGKLIAAGDFISKHLGRPNGSKAAVAL  422

Query  474   T-RVSADASKI  445
               R++ADASKI
Sbjct  423   NRRITADASKI  433



>ref|XP_002880836.1| hypothetical protein ARALYDRAFT_481553 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57095.1| hypothetical protein ARALYDRAFT_481553 [Arabidopsis lyrata subsp. 
lyrata]
Length=469

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/433 (67%), Positives = 348/433 (80%), Gaps = 38/433 (9%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCDEDFDEYGR  1459
             EEPLS D+LP +S +DR+  RFSS ACRP  D GMG RWIDGR+C++SNSC +D   +G+
Sbjct  40    EEPLSFDKLPSMSTMDRIQ-RFSSGACRPRDDVGMGHRWIDGRDCTTSNSCVDDDKSFGK  98

Query  1458  GSYGWKRQ-----------FRDRPYNGVSNRRSFSGGWR---------------------  1375
              S+ W++            FR+   +G ++  + SG  R                     
Sbjct  99    ESFPWRKHTRKLSEGEQHLFRNTSISGRTS--TVSGTLRESKSFKEHKFSTCSNENGKMH  156

Query  1374  --NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPK  1201
               N +  G+PK+VKIVEVGPRDGLQNEKN VPTSVKVELI++LVS GLPVVE T FVSPK
Sbjct  157   SSNKISKGIPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVSPK  216

Query  1200  WVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANIN  1021
             WVPQL+DAKDVM AV  L+GARLPVLTPNLKGFEAA+++GAKEVA+FASASESFS +NIN
Sbjct  217   WVPQLADAKDVMDAVNTLDGARLPVLTPNLKGFEAAVSAGAKEVAIFASASESFSLSNIN  276

Query  1020  CSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEI  841
             C+IEESL+RYRAV +AAK+ S+PVRGY+SCVVGCPVEGA+ PSKVAY+ KEL++MGCFEI
Sbjct  277   CTIEESLLRYRAVATAAKEHSVPVRGYVSCVVGCPVEGAVPPSKVAYVVKELYDMGCFEI  336

Query  840   SLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSV  661
             SLGDTIG+ TPG+V+PMLEAVMAVVP +KLAVHFHDTYGQ+L NILVSLQMG+  VDSS+
Sbjct  337   SLGDTIGIGTPGSVVPMLEAVMAVVPADKLAVHFHDTYGQALANILVSLQMGISIVDSSI  396

Query  660   SGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAI  481
             +GLGGCPYAKGA+GNVATEDVVYML+GLGV+TNVDLGKL+ AG+FISKHLGR + SKAA+
Sbjct  397   AGLGGCPYAKGASGNVATEDVVYMLNGLGVQTNVDLGKLIAAGDFISKHLGRPNGSKAAV  456

Query  480   ALT-RVSADASKI  445
             AL  R++ADASKI
Sbjct  457   ALNRRITADASKI  469



>ref|XP_007141518.1| hypothetical protein PHAVU_008G202900g [Phaseolus vulgaris]
 gb|ESW13512.1| hypothetical protein PHAVU_008G202900g [Phaseolus vulgaris]
Length=432

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/428 (68%), Positives = 343/428 (80%), Gaps = 31/428 (7%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP ++ +DR+  RFSS  CRP  D+ GMG  WI+GR CS+SNSC+ED ++Y 
Sbjct  5     EEPLGLDKLPSMNTVDRIQ-RFSSGGCRPRVDNLGMGNCWIEGRICSTSNSCNEDDEKYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLF---------------------------  1363
               ++ WKRQ RD   +   ++ + + G +++ F                           
Sbjct  64    AETFPWKRQTRDLCQDNCFSQNTVTKGRKSMKFGMTDDSFSDSQSSPKCHTKDLQGLAYK  123

Query  1362  --NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
               N +PK+VKIVEVGPRDGLQNEKN VPT+VK+ELI +L S GL V+E T FVSPKWVPQ
Sbjct  124   FLNCIPKFVKIVEVGPRDGLQNEKNIVPTAVKIELIHRLASTGLSVIEATSFVSPKWVPQ  183

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+DAKDVMQAV NL   R+PVLTPNLKGFEAAIA+GA+EVAVFASASESFSK+NINCSIE
Sbjct  184   LADAKDVMQAVHNLGSIRMPVLTPNLKGFEAAIAAGAREVAVFASASESFSKSNINCSIE  243

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ESL RY+AV  AAK+LSIPVRGY+SCVVGCPVEG I PSKVAY+AKEL++MGCFEISLGD
Sbjct  244   ESLSRYQAVIRAAKQLSIPVRGYVSCVVGCPVEGLIHPSKVAYVAKELYDMGCFEISLGD  303

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPG+V+PML AVMAVVP+EKLAVHFHDTYGQSLPNILVSLQMG+  VDSSV+GLG
Sbjct  304   TIGVGTPGSVVPMLLAVMAVVPIEKLAVHFHDTYGQSLPNILVSLQMGISIVDSSVAGLG  363

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGA+GNVATEDVVYML+G+GVKTNVDLGKLL AG+FIS HLGR S+SK AIAL R
Sbjct  364   GCPYAKGASGNVATEDVVYMLNGVGVKTNVDLGKLLLAGDFISSHLGRPSTSKTAIALNR  423

Query  468   VSADASKI  445
             V++DASKI
Sbjct  424   VTSDASKI  431



>ref|NP_565629.1| Hydroxymethylglutaryl-CoA lyase [Arabidopsis thaliana]
 sp|O81027.2|HMGCL_ARATH RecName: Full=Hydroxymethylglutaryl-CoA lyase, mitochondrial; 
Short=HL; Short=HMG-CoA lyase; AltName: Full=3-hydroxy-3-methylglutarate-CoA 
lyase [Arabidopsis thaliana]
 gb|AAG42010.1|AF327420_1 putative hydroxymethylglutaryl-CoA lyase [Arabidopsis thaliana]
 gb|AAK15568.1|AF349521_1 putative hydroxymethylglutaryl-CoA lyase [Arabidopsis thaliana]
 gb|AAC32247.2| putative hydroxymethylglutaryl-CoA lyase [Arabidopsis thaliana]
 gb|AEC07890.1| Hydroxymethylglutaryl-CoA lyase [Arabidopsis thaliana]
Length=468

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/431 (67%), Positives = 343/431 (80%), Gaps = 35/431 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCDEDFDEYGR  1459
             EEPLS D+LP +S +DR+  RFSS ACRP  D GMG RWI+GR+C++SNSC +D   + +
Sbjct  40    EEPLSFDKLPSMSTMDRIQ-RFSSGACRPRDDVGMGHRWIEGRDCTTSNSCIDDDKSFAK  98

Query  1458  GSYGWKRQ--------------------------------FRDRPYNGVSNRRSFSGGWR  1375
              S+ W+R                                 F+++ Y+  SN    S    
Sbjct  99    ESFPWRRHTRKLSEGEHMFRNISFAGRTSTVSGTLRESKSFKEQKYSTFSNENGTSH-IS  157

Query  1374  NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
             N +  G+PK+VKIVEVGPRDGLQNEKN VPTSVKVELI++LVS GLPVVE T FVSPKWV
Sbjct  158   NKISKGIPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVSPKWV  217

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDVM AV  L+GARLPVLTPNLKGF+AA+++GAKEVA+FASASESFS +NINC+
Sbjct  218   PQLADAKDVMDAVNTLDGARLPVLTPNLKGFQAAVSAGAKEVAIFASASESFSLSNINCT  277

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESL+RYR V +AAK+ S+PVRGY+SCVVGCPVEG +LPSKVAY+ KEL++MGCFEISL
Sbjct  278   IEESLLRYRVVATAAKEHSVPVRGYVSCVVGCPVEGPVLPSKVAYVVKELYDMGCFEISL  337

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIG+ TPG+V+PMLEAVMAVVP +KLAVHFHDTYGQ+L NILVSLQMG+  VDSS++G
Sbjct  338   GDTIGIGTPGSVVPMLEAVMAVVPADKLAVHFHDTYGQALANILVSLQMGISIVDSSIAG  397

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYML+GLGV TNVDLGKL+ AG+FISKHLGR + SKAA+AL
Sbjct  398   LGGCPYAKGASGNVATEDVVYMLNGLGVHTNVDLGKLIAAGDFISKHLGRPNGSKAAVAL  457

Query  474   T-RVSADASKI  445
               R++ADASKI
Sbjct  458   NRRITADASKI  468



>ref|XP_007146147.1| hypothetical protein PHAVU_006G016200g [Phaseolus vulgaris]
 gb|ESW18141.1| hypothetical protein PHAVU_006G016200g [Phaseolus vulgaris]
Length=433

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/430 (70%), Positives = 346/430 (80%), Gaps = 33/430 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP ++ IDR+  RFSS ACRP  D+ GMG  WI+G +CSSSNSC+ED +EY 
Sbjct  5     EEPLGLDKLPSMNTIDRIQ-RFSSGACRPRVDNLGMGSCWIEGPSCSSSNSCNEDNEEYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLF---------------------------  1363
               ++ W+RQ RD       ++++ + G  ++ F                           
Sbjct  64    TETFPWRRQTRDLSRGDSFSQKTMAMGRNSMKFGAIDNSFYASDYQYSPKSNNKSVQDTA  123

Query  1362  ----NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
                  G+P +VKI+EVGPRDGLQNEKN VPT VK+ELI +L S GL V+E T FVSPKWV
Sbjct  124   YKFMKGIPTFVKIIEVGPRDGLQNEKNIVPTDVKIELIHRLASSGLSVIEATSFVSPKWV  183

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDVMQAV+NLEG RLPVLTPNLKGFEAAIA+GA+EVAVFASASESFSK+NINCS
Sbjct  184   PQLADAKDVMQAVRNLEGFRLPVLTPNLKGFEAAIAAGAREVAVFASASESFSKSNINCS  243

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESLVRYRAVT AAK+LSIPVRGY+SCVVGCPVEG ILPSKVAY+AKEL++MGCFEISL
Sbjct  244   IEESLVRYRAVTCAAKELSIPVRGYVSCVVGCPVEGPILPSKVAYVAKELYDMGCFEISL  303

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGV TPGTV+PML AVMAVVP EKLAVHFHDTYGQSLPNILVS+QMG+  VDSSVSG
Sbjct  304   GDTIGVGTPGTVVPMLLAVMAVVPAEKLAVHFHDTYGQSLPNILVSIQMGISAVDSSVSG  363

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYML+GLGVKTNVDLGKL+ AG+FISKHLGR S SK AIA 
Sbjct  364   LGGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLGKLMSAGDFISKHLGRPSGSKTAIAF  423

Query  474   TRVSADASKI  445
             +RV+ADASKI
Sbjct  424   SRVTADASKI  433



>ref|XP_006294144.1| hypothetical protein CARUB_v10023137mg [Capsella rubella]
 gb|EOA27042.1| hypothetical protein CARUB_v10023137mg [Capsella rubella]
Length=470

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/432 (67%), Positives = 344/432 (80%), Gaps = 36/432 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCDEDFDEYGR  1459
             EEPL  D+LP +S IDR+  RFSS ACRP  D GMG RWIDGR+CS+SNSC +D   +G+
Sbjct  41    EEPLGFDKLPSMSTIDRIQ-RFSSGACRPRDDFGMGHRWIDGRDCSTSNSCIDDDRSFGK  99

Query  1458  GSYGWKRQ---------------------------------FRDRPYNGVSNRRSFSGGW  1378
              S+ W+R                                  F++  Y+ +SN  S +   
Sbjct  100   ESFPWRRHTRKLSEGELHLIRNISVSGRTSTVSGILRESRSFKEHKYSTLSNENS-TPHI  158

Query  1377  RNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
              + +  G+PK+VKIVEVGPRDGLQNEKN VPT +KVELI++LVS GL VVE T FVSPKW
Sbjct  159   NHKISKGIPKFVKIVEVGPRDGLQNEKNIVPTCIKVELIQRLVSAGLSVVEATSFVSPKW  218

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQL+DAKDVM AV  L+GARLPVLTPNLKGFEAA+++GAKEVA+FASASESFS +NINC
Sbjct  219   VPQLADAKDVMDAVNTLDGARLPVLTPNLKGFEAAVSAGAKEVAIFASASESFSLSNINC  278

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             +IE+SL+RYRAVT+AAK+  IPVRGY+SCVVGCPVEGA+ PSKVAY+ KELH+MGCFEIS
Sbjct  279   TIEDSLLRYRAVTTAAKEHGIPVRGYVSCVVGCPVEGAVPPSKVAYVVKELHDMGCFEIS  338

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIG+ TPG+V+PMLEAVMAVVP +KLAVHFHDTYGQ+L NIL+SLQMG+  VDSS++
Sbjct  339   LGDTIGIGTPGSVVPMLEAVMAVVPADKLAVHFHDTYGQALANILMSLQMGISIVDSSIA  398

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYAKGA+GNVATEDVVYML+GLGV+TNVDLGKL+ AG+FISKHLGR + SKAA+A
Sbjct  399   GLGGCPYAKGASGNVATEDVVYMLNGLGVQTNVDLGKLIAAGDFISKHLGRPNGSKAAVA  458

Query  477   LTR-VSADASKI  445
             L R ++ADASKI
Sbjct  459   LNRQITADASKI  470



>ref|XP_010473064.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Camelina sativa]
Length=436

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/433 (67%), Positives = 346/433 (80%), Gaps = 36/433 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSC-DEDFDEYG  1462
             EEPL  D+LP +S +DR+  RFSS ACRP  D GMG RWIDGR+C++SNSC D+D    G
Sbjct  5     EEPLGFDKLPSMSTMDRIQ-RFSSGACRPRDDFGMGHRWIDGRDCTTSNSCIDDDRSFGG  63

Query  1461  RGSYGWKRQFRDRPYN--------GVSNR-----------RSFSGGWRNVLFN-------  1360
             + S+ W+R  R              +S R           +SF GG +   F+       
Sbjct  64    KESFPWRRHTRKLSEGEQHLLQNISISGRTSTVSATLRESKSFKGGHKYSTFSNDNGTPH  123

Query  1359  -------GVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPK  1201
                    G+PK+VKIVEVGPRDGLQNEKN VPTSVKVELI++LVS GLPVVE T FVSPK
Sbjct  124   ITHKISKGIPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVSPK  183

Query  1200  WVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANIN  1021
             WVPQL+DAKDVM AV +L+GARLPVLTPNLKGFEAA+++GAKEVA+FASASESFS +NIN
Sbjct  184   WVPQLADAKDVMDAVNSLDGARLPVLTPNLKGFEAAVSAGAKEVAIFASASESFSLSNIN  243

Query  1020  CSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEI  841
             C+I+ESLVRYRAVT+AAK+  +PVRGY+SCVVGCPVEGA+ PSKVAY+ KEL++MGCFEI
Sbjct  244   CTIQESLVRYRAVTTAAKEHGVPVRGYVSCVVGCPVEGAVPPSKVAYVVKELYDMGCFEI  303

Query  840   SLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSV  661
             SLGDTIG+ TPG+V+PMLEAVMAVVP + LAVHFHDTYGQ+L NIL+SLQMG+  VDSS+
Sbjct  304   SLGDTIGIGTPGSVVPMLEAVMAVVPADILAVHFHDTYGQALANILMSLQMGISIVDSSI  363

Query  660   SGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAI  481
             +GLGGCPYAKGA+GNVATEDVVYML+GLGV+TNVDLGKL+ AG+FISKHLGR + SKAA+
Sbjct  364   AGLGGCPYAKGASGNVATEDVVYMLNGLGVQTNVDLGKLIAAGDFISKHLGRPNGSKAAV  423

Query  480   ALT-RVSADASKI  445
             AL  R++ADASKI
Sbjct  424   ALNRRITADASKI  436



>ref|XP_003599680.1| Hydroxymethylglutaryl-CoA lyase [Medicago truncatula]
 gb|AES69931.1| hydroxymethylglutaryl-CoA lyase [Medicago truncatula]
Length=433

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/431 (68%), Positives = 338/431 (78%), Gaps = 35/431 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL  D+LP +S +DR+  RFSS  CRP  D+ GMG  +I+GR+CS+SNSC+ED ++Y 
Sbjct  5     EEPLGHDKLPSMSTMDRVQ-RFSSGCCRPQVDNLGMGNCFIEGRSCSTSNSCNEDNEDYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVL----------------------------  1366
               +Y WKRQ RD       + R+ + G RN L                            
Sbjct  64    AETYPWKRQTRDMSRGDSFSPRTMTTG-RNTLKSGIVDNSFYTSDYQYSQKRNNKDMQDM  122

Query  1365  ----FNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
                   G+P++VKIVEVGPRDGLQNEKN VPT VK+ELI +L S GL V+E T FVSPKW
Sbjct  123   AYKFMKGMPEFVKIVEVGPRDGLQNEKNIVPTDVKIELIHRLASTGLSVIEATSFVSPKW  182

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQL+DAKDVMQAV NL G RLPVLTPNLKGFEAA+A+GA+EVAVFASASESFSK+NINC
Sbjct  183   VPQLADAKDVMQAVHNLRGIRLPVLTPNLKGFEAAVAAGAREVAVFASASESFSKSNINC  242

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             SIEESL RYRAVT AAK+LSIPVRGY+SCVVGCPVEG + PSKVAY+AK L++MGCFEIS
Sbjct  243   SIEESLSRYRAVTRAAKELSIPVRGYVSCVVGCPVEGPVPPSKVAYVAKALYDMGCFEIS  302

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIGV TPGTV+PML AVMA+VP EKLAVHFHDTYGQSLPNILVSLQMG+  VDSSV+
Sbjct  303   LGDTIGVGTPGTVVPMLLAVMAIVPTEKLAVHFHDTYGQSLPNILVSLQMGISAVDSSVA  362

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYAKGA+GNVATEDVVYML+GLG+KTNVD+GKL+ AG+FI K LGR S SK AIA
Sbjct  363   GLGGCPYAKGASGNVATEDVVYMLNGLGIKTNVDIGKLMSAGDFIGKQLGRPSGSKTAIA  422

Query  477   LTRVSADASKI  445
             L RV+ADASKI
Sbjct  423   LNRVTADASKI  433



>ref|XP_010510861.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X3 [Camelina sativa]
Length=434

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/431 (67%), Positives = 343/431 (80%), Gaps = 34/431 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCDEDFDEYGR  1459
             EEPL  D+LP +S +DR+  RFSS ACRP  D GMG RWIDGR+C++SNSC +D   + +
Sbjct  5     EEPLGFDKLPSMSTMDRIQ-RFSSGACRPRDDFGMGHRWIDGRDCTTSNSCIDDDRSFVK  63

Query  1458  GSYGWKRQFRDRPYN--------GVSNR-----------RSFSGGWRNVLFN--------  1360
              S+ W+R  R              +S R           +SF G   +   N        
Sbjct  64    ESFPWRRHTRKLSEGEQHLLQNISISGRTSTVSATLRESKSFKGHKYSTFSNDNGTPHIT  123

Query  1359  -----GVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
                  G+PK+VKIVEVGPRDGLQNEKN VPTSVKVELI++LVS GLPVVE T FVSPKWV
Sbjct  124   NKISKGIPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVSPKWV  183

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDVM AV +L+GARLPVLTPNLKGFEAA+++GAKEVA+FASASESFS +NINC+
Sbjct  184   PQLADAKDVMDAVNSLDGARLPVLTPNLKGFEAAVSAGAKEVAIFASASESFSLSNINCT  243

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESL+RYRAVT+AAK+  +PVRGY+SCVVGCPVEGA+ PSKVAY+ KEL++MGCFEISL
Sbjct  244   IEESLLRYRAVTTAAKEHGVPVRGYVSCVVGCPVEGAVPPSKVAYVVKELYDMGCFEISL  303

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIG+ TPG+V+PMLEAVMAVVP + LAVHFHDTYGQ+L NIL+SLQMG+  VDSS++G
Sbjct  304   GDTIGIGTPGSVVPMLEAVMAVVPADILAVHFHDTYGQALANILMSLQMGISIVDSSIAG  363

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYML+GLGV+TNVDLGKL+ AG+FISKHLGR + SKAA+AL
Sbjct  364   LGGCPYAKGASGNVATEDVVYMLNGLGVQTNVDLGKLIAAGDFISKHLGRPNGSKAAVAL  423

Query  474   T-RVSADASKI  445
               R++ADASKI
Sbjct  424   NRRITADASKI  434



>ref|XP_010473063.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Camelina sativa]
Length=475

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/433 (67%), Positives = 346/433 (80%), Gaps = 36/433 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSC-DEDFDEYG  1462
             EEPL  D+LP +S +DR+  RFSS ACRP  D GMG RWIDGR+C++SNSC D+D    G
Sbjct  44    EEPLGFDKLPSMSTMDRIQ-RFSSGACRPRDDFGMGHRWIDGRDCTTSNSCIDDDRSFGG  102

Query  1461  RGSYGWKRQFRDRPYN--------GVSNR-----------RSFSGGWRNVLFN-------  1360
             + S+ W+R  R              +S R           +SF GG +   F+       
Sbjct  103   KESFPWRRHTRKLSEGEQHLLQNISISGRTSTVSATLRESKSFKGGHKYSTFSNDNGTPH  162

Query  1359  -------GVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPK  1201
                    G+PK+VKIVEVGPRDGLQNEKN VPTSVKVELI++LVS GLPVVE T FVSPK
Sbjct  163   ITHKISKGIPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVSPK  222

Query  1200  WVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANIN  1021
             WVPQL+DAKDVM AV +L+GARLPVLTPNLKGFEAA+++GAKEVA+FASASESFS +NIN
Sbjct  223   WVPQLADAKDVMDAVNSLDGARLPVLTPNLKGFEAAVSAGAKEVAIFASASESFSLSNIN  282

Query  1020  CSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEI  841
             C+I+ESLVRYRAVT+AAK+  +PVRGY+SCVVGCPVEGA+ PSKVAY+ KEL++MGCFEI
Sbjct  283   CTIQESLVRYRAVTTAAKEHGVPVRGYVSCVVGCPVEGAVPPSKVAYVVKELYDMGCFEI  342

Query  840   SLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSV  661
             SLGDTIG+ TPG+V+PMLEAVMAVVP + LAVHFHDTYGQ+L NIL+SLQMG+  VDSS+
Sbjct  343   SLGDTIGIGTPGSVVPMLEAVMAVVPADILAVHFHDTYGQALANILMSLQMGISIVDSSI  402

Query  660   SGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAI  481
             +GLGGCPYAKGA+GNVATEDVVYML+GLGV+TNVDLGKL+ AG+FISKHLGR + SKAA+
Sbjct  403   AGLGGCPYAKGASGNVATEDVVYMLNGLGVQTNVDLGKLIAAGDFISKHLGRPNGSKAAV  462

Query  480   ALT-RVSADASKI  445
             AL  R++ADASKI
Sbjct  463   ALNRRITADASKI  475



>gb|KEH33538.1| hydroxymethylglutaryl-CoA lyase [Medicago truncatula]
Length=454

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/431 (68%), Positives = 338/431 (78%), Gaps = 35/431 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL  D+LP +S +DR+  RFSS  CRP  D+ GMG  +I+GR+CS+SNSC+ED ++Y 
Sbjct  26    EEPLGHDKLPSMSTMDRVQ-RFSSGCCRPQVDNLGMGNCFIEGRSCSTSNSCNEDNEDYT  84

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVL----------------------------  1366
               +Y WKRQ RD       + R+ + G RN L                            
Sbjct  85    AETYPWKRQTRDMSRGDSFSPRTMTTG-RNTLKSGIVDNSFYTSDYQYSQKRNNKDMQDM  143

Query  1365  ----FNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
                   G+P++VKIVEVGPRDGLQNEKN VPT VK+ELI +L S GL V+E T FVSPKW
Sbjct  144   AYKFMKGMPEFVKIVEVGPRDGLQNEKNIVPTDVKIELIHRLASTGLSVIEATSFVSPKW  203

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQL+DAKDVMQAV NL G RLPVLTPNLKGFEAA+A+GA+EVAVFASASESFSK+NINC
Sbjct  204   VPQLADAKDVMQAVHNLRGIRLPVLTPNLKGFEAAVAAGAREVAVFASASESFSKSNINC  263

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             SIEESL RYRAVT AAK+LSIPVRGY+SCVVGCPVEG + PSKVAY+AK L++MGCFEIS
Sbjct  264   SIEESLSRYRAVTRAAKELSIPVRGYVSCVVGCPVEGPVPPSKVAYVAKALYDMGCFEIS  323

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIGV TPGTV+PML AVMA+VP EKLAVHFHDTYGQSLPNILVSLQMG+  VDSSV+
Sbjct  324   LGDTIGVGTPGTVVPMLLAVMAIVPTEKLAVHFHDTYGQSLPNILVSLQMGISAVDSSVA  383

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYAKGA+GNVATEDVVYML+GLG+KTNVD+GKL+ AG+FI K LGR S SK AIA
Sbjct  384   GLGGCPYAKGASGNVATEDVVYMLNGLGIKTNVDIGKLMSAGDFIGKQLGRPSGSKTAIA  443

Query  477   LTRVSADASKI  445
             L RV+ADASKI
Sbjct  444   LNRVTADASKI  454



>ref|XP_010417825.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Camelina sativa]
Length=435

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/432 (67%), Positives = 344/432 (80%), Gaps = 35/432 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSC-DEDFDEYG  1462
             EEPL  D+LP +S IDR+  RFSS ACRP  D GMG RWIDGR+C++SNSC D+D    G
Sbjct  5     EEPLGFDKLPSMSTIDRIQ-RFSSGACRPRDDFGMGHRWIDGRDCTTSNSCIDDDRSFGG  63

Query  1461  RGSYGWKRQFRDRPYN--------GVSNR-----------RSFSGGWRNVLFN-------  1360
             + S+ W+R  R              +S R           +SF G   +   N       
Sbjct  64    KESFPWRRHTRKLSEGELHLLQNISISGRTSTVSATLRESKSFKGHKYSTFSNDNGTPHI  123

Query  1359  ------GVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
                   G+PK+VKIVEVGPRDGLQNEKN VPTSVKVELI++LVS GLPVVE T FVSPKW
Sbjct  124   THKISKGIPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVSPKW  183

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQL+DAKDVM AV +L+GARLPVLTPNLKGFEAA+++GAKEVA+FASASESFS +NINC
Sbjct  184   VPQLADAKDVMDAVNSLDGARLPVLTPNLKGFEAAVSAGAKEVAIFASASESFSLSNINC  243

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             +IEESL+RYRAVT+AAK+  +PVRGY+SCVVGCPVEGA+ PSKVAY+ KEL++MGCFEIS
Sbjct  244   TIEESLLRYRAVTAAAKEHGVPVRGYVSCVVGCPVEGAVPPSKVAYVVKELYDMGCFEIS  303

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIG+ TPG+V+PMLEAVMAVVP + LAVHFHDTYGQ+L NIL+SLQMG+  VDSS++
Sbjct  304   LGDTIGIGTPGSVVPMLEAVMAVVPADILAVHFHDTYGQALANILMSLQMGISIVDSSIA  363

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYAKGA+GNVATEDVVYML+GLGV+TNVDLGKL+ AG+FISKHLGR + SKAA+A
Sbjct  364   GLGGCPYAKGASGNVATEDVVYMLNGLGVQTNVDLGKLIAAGDFISKHLGRPNGSKAAVA  423

Query  477   LT-RVSADASKI  445
             L  R++ADASKI
Sbjct  424   LNRRITADASKI  435



>ref|XP_010510859.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Camelina sativa]
Length=471

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/431 (67%), Positives = 343/431 (80%), Gaps = 34/431 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCDEDFDEYGR  1459
             EEPL  D+LP +S +DR+  RFSS ACRP  D GMG RWIDGR+C++SNSC +D   + +
Sbjct  42    EEPLGFDKLPSMSTMDRIQ-RFSSGACRPRDDFGMGHRWIDGRDCTTSNSCIDDDRSFVK  100

Query  1458  GSYGWKRQFRDRPYN--------GVSNR-----------RSFSGGWRNVLFN--------  1360
              S+ W+R  R              +S R           +SF G   +   N        
Sbjct  101   ESFPWRRHTRKLSEGEQHLLQNISISGRTSTVSATLRESKSFKGHKYSTFSNDNGTPHIT  160

Query  1359  -----GVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
                  G+PK+VKIVEVGPRDGLQNEKN VPTSVKVELI++LVS GLPVVE T FVSPKWV
Sbjct  161   NKISKGIPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVSPKWV  220

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDVM AV +L+GARLPVLTPNLKGFEAA+++GAKEVA+FASASESFS +NINC+
Sbjct  221   PQLADAKDVMDAVNSLDGARLPVLTPNLKGFEAAVSAGAKEVAIFASASESFSLSNINCT  280

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESL+RYRAVT+AAK+  +PVRGY+SCVVGCPVEGA+ PSKVAY+ KEL++MGCFEISL
Sbjct  281   IEESLLRYRAVTTAAKEHGVPVRGYVSCVVGCPVEGAVPPSKVAYVVKELYDMGCFEISL  340

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIG+ TPG+V+PMLEAVMAVVP + LAVHFHDTYGQ+L NIL+SLQMG+  VDSS++G
Sbjct  341   GDTIGIGTPGSVVPMLEAVMAVVPADILAVHFHDTYGQALANILMSLQMGISIVDSSIAG  400

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYML+GLGV+TNVDLGKL+ AG+FISKHLGR + SKAA+AL
Sbjct  401   LGGCPYAKGASGNVATEDVVYMLNGLGVQTNVDLGKLIAAGDFISKHLGRPNGSKAAVAL  460

Query  474   T-RVSADASKI  445
               R++ADASKI
Sbjct  461   NRRITADASKI  471



>ref|XP_010417824.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Camelina sativa]
Length=474

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/432 (67%), Positives = 344/432 (80%), Gaps = 35/432 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSC-DEDFDEYG  1462
             EEPL  D+LP +S IDR+  RFSS ACRP  D GMG RWIDGR+C++SNSC D+D    G
Sbjct  44    EEPLGFDKLPSMSTIDRIQ-RFSSGACRPRDDFGMGHRWIDGRDCTTSNSCIDDDRSFGG  102

Query  1461  RGSYGWKRQFRDRPYN--------GVSNR-----------RSFSGGWRNVLFN-------  1360
             + S+ W+R  R              +S R           +SF G   +   N       
Sbjct  103   KESFPWRRHTRKLSEGELHLLQNISISGRTSTVSATLRESKSFKGHKYSTFSNDNGTPHI  162

Query  1359  ------GVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
                   G+PK+VKIVEVGPRDGLQNEKN VPTSVKVELI++LVS GLPVVE T FVSPKW
Sbjct  163   THKISKGIPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVSPKW  222

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQL+DAKDVM AV +L+GARLPVLTPNLKGFEAA+++GAKEVA+FASASESFS +NINC
Sbjct  223   VPQLADAKDVMDAVNSLDGARLPVLTPNLKGFEAAVSAGAKEVAIFASASESFSLSNINC  282

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             +IEESL+RYRAVT+AAK+  +PVRGY+SCVVGCPVEGA+ PSKVAY+ KEL++MGCFEIS
Sbjct  283   TIEESLLRYRAVTAAAKEHGVPVRGYVSCVVGCPVEGAVPPSKVAYVVKELYDMGCFEIS  342

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIG+ TPG+V+PMLEAVMAVVP + LAVHFHDTYGQ+L NIL+SLQMG+  VDSS++
Sbjct  343   LGDTIGIGTPGSVVPMLEAVMAVVPADILAVHFHDTYGQALANILMSLQMGISIVDSSIA  402

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYAKGA+GNVATEDVVYML+GLGV+TNVDLGKL+ AG+FISKHLGR + SKAA+A
Sbjct  403   GLGGCPYAKGASGNVATEDVVYMLNGLGVQTNVDLGKLIAAGDFISKHLGRPNGSKAAVA  462

Query  477   LT-RVSADASKI  445
             L  R++ADASKI
Sbjct  463   LNRRITADASKI  474



>ref|XP_009133927.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X2 [Brassica rapa]
 ref|XP_009133928.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X2 [Brassica rapa]
Length=437

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/435 (67%), Positives = 345/435 (79%), Gaps = 39/435 (9%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSN-ACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDE-  1468
             EEPL+ D+LP ++ IDR+  RFSS  ACRP  DD GMG RWI GR+C++SN C++D D+ 
Sbjct  5     EEPLAFDKLPSMNTIDRIQ-RFSSGGACRPRDDDVGMGHRWIQGRDCTTSNCCNDDDDKS  63

Query  1467  YGRGSYGWKRQ---------------------------------FRDRPYNGVSNRRSFS  1387
             +G+ S+ WKR                                  F++  ++  SN    S
Sbjct  64    FGKESFPWKRHTRKVSEGEILLRSISFSGRNSSSSTVSGTVSKSFQEHKFHTFSNDNGIS  123

Query  1386  GGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVS  1207
                 N L  GVPK+VK+VEVGPRDGLQNEK  VPTSVKVELI++LVS GLPVVE T FVS
Sbjct  124   HS-SNKLVRGVPKFVKVVEVGPRDGLQNEKIIVPTSVKVELIQRLVSAGLPVVEATSFVS  182

Query  1206  PKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskAN  1027
             PKWVPQL+DAKDVM  V  L+GARLPVLTPNLKGFEAA+++GAKEVA+FASASESFS +N
Sbjct  183   PKWVPQLADAKDVMDGVNALDGARLPVLTPNLKGFEAAVSAGAKEVAIFASASESFSLSN  242

Query  1026  INCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCF  847
             INC+IEESL+RYRAV +AAK+ SIPVRGY+SCVVGCPVEGA+ PSKVA++ KEL++MGCF
Sbjct  243   INCTIEESLLRYRAVVTAAKEHSIPVRGYVSCVVGCPVEGAVPPSKVAHVVKELYDMGCF  302

Query  846   EISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDS  667
             EISLGDTIG+ TPGTV+PMLEAVMAVVP EKLAVHFHDTYGQ+L NILVSLQMG+  VDS
Sbjct  303   EISLGDTIGIGTPGTVVPMLEAVMAVVPAEKLAVHFHDTYGQALANILVSLQMGINIVDS  362

Query  666   SVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKA  487
             SV+GLGGCPYAKGA+GNVA+EDVVYML+GLGV+TNVDLGKL+ AG+FISKHLGR + SKA
Sbjct  363   SVAGLGGCPYAKGASGNVASEDVVYMLNGLGVQTNVDLGKLIAAGDFISKHLGRPNGSKA  422

Query  486   AIALT-RVSADASKI  445
             A+AL  RV+ADASKI
Sbjct  423   AVALNRRVTADASKI  437



>emb|CDX83245.1| BnaA03g22610D [Brassica napus]
Length=436

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/434 (67%), Positives = 345/434 (79%), Gaps = 38/434 (9%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSN-ACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDE-  1468
             EEPL+ D+LP ++ IDR+  RFSS  ACRP  DD GMG RWI GR+C++SN C++D D+ 
Sbjct  5     EEPLAFDKLPSMNTIDRIQ-RFSSGGACRPRDDDVGMGHRWIQGRDCTTSNCCNDDDDKS  63

Query  1467  YGRGSYGWKRQ--------------------------------FRDRPYNGVSNRRSFSG  1384
             +G+ S+ WKR                                 F++  ++  SN    S 
Sbjct  64    FGKESFPWKRHTRKVSEGEILLRSISFSGRNSSSTVSGTVSKSFQEHKFHTFSNDNGISH  123

Query  1383  GWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSP  1204
                N L  GVPK+VK+VEVGPRDGLQNEK  VPTSVKVELI++LVS GLPVVE T FVSP
Sbjct  124   S-SNKLVRGVPKFVKVVEVGPRDGLQNEKIIVPTSVKVELIQRLVSAGLPVVEATSFVSP  182

Query  1203  KWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANI  1024
             KWVPQL+DAKDVM  V  L+GARLPVLTPNLKGFEAA+++GAKEVA+FASASESFS +NI
Sbjct  183   KWVPQLADAKDVMDGVNALDGARLPVLTPNLKGFEAAVSAGAKEVAIFASASESFSLSNI  242

Query  1023  NCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFE  844
             NC+IEESL+RYRAV +AAK+ SIPVRGY+SCVVGCPVEGA+ PSKVA++ KEL++MGCFE
Sbjct  243   NCTIEESLLRYRAVVTAAKEHSIPVRGYVSCVVGCPVEGAVPPSKVAHVVKELYDMGCFE  302

Query  843   ISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSS  664
             ISLGDTIG+ TPGTV+PMLEAVMAVVP EKLAVHFHDTYGQ+L NILVSLQMG+  VDSS
Sbjct  303   ISLGDTIGIGTPGTVVPMLEAVMAVVPAEKLAVHFHDTYGQALANILVSLQMGINIVDSS  362

Query  663   VSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAA  484
             V+GLGGCPYAKGA+GNVA+EDVVYML+GLGV+TNVDLGKL+ AG+FISKHLGR + SKAA
Sbjct  363   VAGLGGCPYAKGASGNVASEDVVYMLNGLGVQTNVDLGKLIAAGDFISKHLGRPNGSKAA  422

Query  483   IALT-RVSADASKI  445
             +AL  RV+ADASKI
Sbjct  423   VALNRRVTADASKI  436



>dbj|BAE71196.1| putative hydroxymethylglutaryl-CoA lyase [Trifolium pratense]
Length=433

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/435 (68%), Positives = 337/435 (77%), Gaps = 43/435 (10%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL  D+LP ++ +DR+  RFSS  CRP  D+ GMG  +I+GR+CS+SNSC ED + Y 
Sbjct  5     EEPLGFDKLPSMNTMDRVQ-RFSSGCCRPQVDNLGMGNCFIEGRSCSTSNSCSEDNEGYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGW----RNVL------------------------  1366
               +Y WKRQ RD     +S R SFS       RN +                        
Sbjct  64    AETYPWKRQTRD-----MSRRDSFSQKTTIKGRNSMKFGIVDNSFYTSDYQYSQKPNNKD  118

Query  1365  --------FNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFV  1210
                       G+P +VKIVEVGPRDGLQNEKN V T VK+ELI +L S GL V+E T FV
Sbjct  119   MQDMAYKVMKGMPGFVKIVEVGPRDGLQNEKNMVSTDVKIELIHRLASTGLSVIEATSFV  178

Query  1209  SPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskA  1030
             SPKWVPQL+DAKDVM+AV NL G RLPVLTPNLKGFEAAIA+GA+EVAVFASASESFSK+
Sbjct  179   SPKWVPQLADAKDVMKAVHNLGGIRLPVLTPNLKGFEAAIAAGAREVAVFASASESFSKS  238

Query  1029  NINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGC  850
             NINCSIEESL RYRAVTSAAK LSIPVRGY+SCVVGCPVEG++ PSKVAY+AKEL++MGC
Sbjct  239   NINCSIEESLARYRAVTSAAKALSIPVRGYVSCVVGCPVEGSVSPSKVAYVAKELYDMGC  298

Query  849   FEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVD  670
             FEISLGDTIGV TPGTV+PML AVMAVVP EKLAVHFHDTYGQSL NILVSLQMG+  VD
Sbjct  299   FEISLGDTIGVGTPGTVVPMLLAVMAVVPTEKLAVHFHDTYGQSLSNILVSLQMGISAVD  358

Query  669   SSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSK  490
             SSV+GLGGCPYAKGA+GNVATEDVVYML+GLGVKTNVD+ KL+ AG+FI KHLGR S SK
Sbjct  359   SSVAGLGGCPYAKGASGNVATEDVVYMLNGLGVKTNVDIEKLMSAGDFIGKHLGRPSGSK  418

Query  489   AAIALTRVSADASKI  445
              AIAL+RV+AD+SKI
Sbjct  419   TAIALSRVTADSSKI  433



>ref|XP_009133925.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Brassica rapa]
 ref|XP_009133926.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Brassica rapa]
Length=470

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/435 (67%), Positives = 345/435 (79%), Gaps = 39/435 (9%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSN-ACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDE-  1468
             EEPL+ D+LP ++ IDR+  RFSS  ACRP  DD GMG RWI GR+C++SN C++D D+ 
Sbjct  38    EEPLAFDKLPSMNTIDRIQ-RFSSGGACRPRDDDVGMGHRWIQGRDCTTSNCCNDDDDKS  96

Query  1467  YGRGSYGWKRQ---------------------------------FRDRPYNGVSNRRSFS  1387
             +G+ S+ WKR                                  F++  ++  SN    S
Sbjct  97    FGKESFPWKRHTRKVSEGEILLRSISFSGRNSSSSTVSGTVSKSFQEHKFHTFSNDNGIS  156

Query  1386  GGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVS  1207
                 N L  GVPK+VK+VEVGPRDGLQNEK  VPTSVKVELI++LVS GLPVVE T FVS
Sbjct  157   HS-SNKLVRGVPKFVKVVEVGPRDGLQNEKIIVPTSVKVELIQRLVSAGLPVVEATSFVS  215

Query  1206  PKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskAN  1027
             PKWVPQL+DAKDVM  V  L+GARLPVLTPNLKGFEAA+++GAKEVA+FASASESFS +N
Sbjct  216   PKWVPQLADAKDVMDGVNALDGARLPVLTPNLKGFEAAVSAGAKEVAIFASASESFSLSN  275

Query  1026  INCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCF  847
             INC+IEESL+RYRAV +AAK+ SIPVRGY+SCVVGCPVEGA+ PSKVA++ KEL++MGCF
Sbjct  276   INCTIEESLLRYRAVVTAAKEHSIPVRGYVSCVVGCPVEGAVPPSKVAHVVKELYDMGCF  335

Query  846   EISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDS  667
             EISLGDTIG+ TPGTV+PMLEAVMAVVP EKLAVHFHDTYGQ+L NILVSLQMG+  VDS
Sbjct  336   EISLGDTIGIGTPGTVVPMLEAVMAVVPAEKLAVHFHDTYGQALANILVSLQMGINIVDS  395

Query  666   SVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKA  487
             SV+GLGGCPYAKGA+GNVA+EDVVYML+GLGV+TNVDLGKL+ AG+FISKHLGR + SKA
Sbjct  396   SVAGLGGCPYAKGASGNVASEDVVYMLNGLGVQTNVDLGKLIAAGDFISKHLGRPNGSKA  455

Query  486   AIALT-RVSADASKI  445
             A+AL  RV+ADASKI
Sbjct  456   AVALNRRVTADASKI  470



>ref|XP_010673785.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Beta 
vulgaris subsp. vulgaris]
Length=417

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/414 (71%), Positives = 339/414 (82%), Gaps = 17/414 (4%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPLS D+LP ++ +DR+  RFSS ACRP G+D GMG RWI+G  CS+SNSC ED  +Y 
Sbjct  5     EEPLSFDKLPSMNTMDRIQ-RFSSGACRPQGEDLGMGARWIEGSRCSTSNSCSEDTQDYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGW---------------RNVLFNGVPKYVKIVEV  1327
               ++ W R+ R++ ++     RS S G                R+ + N +  +VKIVEV
Sbjct  64    EEAFPWGRKNREKSHSNSFVWRSLSLGRNHMAYGNHDKCTRAKRSKVLNDLSNFVKIVEV  123

Query  1326  GPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNL  1147
             GPRDGLQNEKN VPT +KVELI +LVS GL VVE T FVSPKWVPQLSDAKDVM+AV ++
Sbjct  124   GPRDGLQNEKNMVPTHIKVELIHRLVSAGLSVVEATSFVSPKWVPQLSDAKDVMKAVCHV  183

Query  1146  EGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAK  967
             + ARLPVLTPNLKGFEAAIA+GAKE+AVFASASESFSK+NINCSI++SLVRYRAV SAA+
Sbjct  184   DSARLPVLTPNLKGFEAAIAAGAKEIAVFASASESFSKSNINCSIDDSLVRYRAVISAAR  243

Query  966   KLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPML  787
             KLSIPVRGY+SCVVGCPVEG I P+KVAY+AKEL+EMGCFEISLGDTIG+ TPGTVIPML
Sbjct  244   KLSIPVRGYVSCVVGCPVEGPIPPAKVAYVAKELYEMGCFEISLGDTIGIGTPGTVIPML  303

Query  786   EAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVAT  607
             EAV+AVVPVEK+AVHFHDTYGQSLPNIL SLQMG+  +DSSV+GLGGCPYAKGA+GNVAT
Sbjct  304   EAVVAVVPVEKIAVHFHDTYGQSLPNILASLQMGISVIDSSVAGLGGCPYAKGASGNVAT  363

Query  606   EDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSADASKI  445
             EDVVYMLHGLG+ TNVDLGKLL AGEFI KHLGR S SK AIAL R + D SKI
Sbjct  364   EDVVYMLHGLGINTNVDLGKLLSAGEFICKHLGRLSGSKTAIALGRATYDTSKI  417



>ref|XP_010510860.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X2 [Camelina sativa]
Length=467

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/431 (67%), Positives = 340/431 (79%), Gaps = 38/431 (9%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCDEDFDEYGR  1459
             EEPL  D+LP +S +DR+  RFSS ACRP  D GMG RWIDGR+C++SNSC     E   
Sbjct  42    EEPLGFDKLPSMSTMDRIQ-RFSSGACRPRDDFGMGHRWIDGRDCTTSNSCISFVKE---  97

Query  1458  GSYGWKRQFRDRPYN--------GVSNR-----------RSFSGGWRNVLFN--------  1360
              S+ W+R  R              +S R           +SF G   +   N        
Sbjct  98    -SFPWRRHTRKLSEGEQHLLQNISISGRTSTVSATLRESKSFKGHKYSTFSNDNGTPHIT  156

Query  1359  -----GVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
                  G+PK+VKIVEVGPRDGLQNEKN VPTSVKVELI++LVS GLPVVE T FVSPKWV
Sbjct  157   NKISKGIPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVSPKWV  216

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDVM AV +L+GARLPVLTPNLKGFEAA+++GAKEVA+FASASESFS +NINC+
Sbjct  217   PQLADAKDVMDAVNSLDGARLPVLTPNLKGFEAAVSAGAKEVAIFASASESFSLSNINCT  276

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESL+RYRAVT+AAK+  +PVRGY+SCVVGCPVEGA+ PSKVAY+ KEL++MGCFEISL
Sbjct  277   IEESLLRYRAVTTAAKEHGVPVRGYVSCVVGCPVEGAVPPSKVAYVVKELYDMGCFEISL  336

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIG+ TPG+V+PMLEAVMAVVP + LAVHFHDTYGQ+L NIL+SLQMG+  VDSS++G
Sbjct  337   GDTIGIGTPGSVVPMLEAVMAVVPADILAVHFHDTYGQALANILMSLQMGISIVDSSIAG  396

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYML+GLGV+TNVDLGKL+ AG+FISKHLGR + SKAA+AL
Sbjct  397   LGGCPYAKGASGNVATEDVVYMLNGLGVQTNVDLGKLIAAGDFISKHLGRPNGSKAAVAL  456

Query  474   T-RVSADASKI  445
               R++ADASKI
Sbjct  457   NRRITADASKI  467



>ref|XP_008786857.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008786858.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Phoenix dactylifera]
Length=423

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/428 (67%), Positives = 342/428 (80%), Gaps = 39/428 (9%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDG-MGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEP+ LD LP L+ + R+  R SS+ CRP+ D+  +G    +GR CSSSNSC+E+     
Sbjct  5     EEPIGLDNLPNLNYVGRLQ-RCSSSGCRPILDETEIGNCLSEGRECSSSNSCEEE-----  58

Query  1461  RGSYGWKRQFRDR----PYNGVSNRRS---FSG----------------------GWRNV  1369
                Y W+RQ +D+    P    + RRS   F                        G  N 
Sbjct  59    ---YAWRRQPKDKFCRDPLILKATRRSRIVFDSVCDSWHMQDHCYCSSCNDTQIRGLANK  115

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
                G+PK+VKIVEVGPRDGLQNEK  +PTSVK+ELI++LVS GL VVE T FVSPKWVPQ
Sbjct  116   FLRGLPKFVKIVEVGPRDGLQNEKTIIPTSVKIELIQRLVSSGLSVVEATSFVSPKWVPQ  175

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+D+KDVM+A++++EGA+LPVLTPNLKGFEAA+ASGAKEVA+FASASESFS +NINCSIE
Sbjct  176   LADSKDVMKAIQDVEGAQLPVLTPNLKGFEAAVASGAKEVAIFASASESFSLSNINCSIE  235

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ESL RYR VT AA++LSIPVRGY+SCV+GCPVEG++LPSKVAY+AKEL++MGC+EISLGD
Sbjct  236   ESLNRYRDVTLAARRLSIPVRGYVSCVIGCPVEGSVLPSKVAYVAKELYDMGCYEISLGD  295

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTV+PMLEAVM+V+PVEKLAVHFHDTYGQSLPNILVSLQMG+ TVDSSV+GLG
Sbjct  296   TIGVGTPGTVVPMLEAVMSVIPVEKLAVHFHDTYGQSLPNILVSLQMGISTVDSSVAGLG  355

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGA+GNVATEDVVYMLHGLG+KTNVDL KL+ AG+FI KHLGR+S SK AIAL+R
Sbjct  356   GCPYAKGASGNVATEDVVYMLHGLGIKTNVDLSKLMAAGDFICKHLGRQSGSKTAIALSR  415

Query  468   VSADASKI  445
             ++ADASKI
Sbjct  416   ITADASKI  423



>ref|XP_008786856.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Phoenix dactylifera]
Length=455

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/428 (67%), Positives = 342/428 (80%), Gaps = 39/428 (9%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDG-MGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEP+ LD LP L+ + R+  R SS+ CRP+ D+  +G    +GR CSSSNSC+E+     
Sbjct  37    EEPIGLDNLPNLNYVGRLQ-RCSSSGCRPILDETEIGNCLSEGRECSSSNSCEEE-----  90

Query  1461  RGSYGWKRQFRDR----PYNGVSNRRS---FSG----------------------GWRNV  1369
                Y W+RQ +D+    P    + RRS   F                        G  N 
Sbjct  91    ---YAWRRQPKDKFCRDPLILKATRRSRIVFDSVCDSWHMQDHCYCSSCNDTQIRGLANK  147

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
                G+PK+VKIVEVGPRDGLQNEK  +PTSVK+ELI++LVS GL VVE T FVSPKWVPQ
Sbjct  148   FLRGLPKFVKIVEVGPRDGLQNEKTIIPTSVKIELIQRLVSSGLSVVEATSFVSPKWVPQ  207

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+D+KDVM+A++++EGA+LPVLTPNLKGFEAA+ASGAKEVA+FASASESFS +NINCSIE
Sbjct  208   LADSKDVMKAIQDVEGAQLPVLTPNLKGFEAAVASGAKEVAIFASASESFSLSNINCSIE  267

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ESL RYR VT AA++LSIPVRGY+SCV+GCPVEG++LPSKVAY+AKEL++MGC+EISLGD
Sbjct  268   ESLNRYRDVTLAARRLSIPVRGYVSCVIGCPVEGSVLPSKVAYVAKELYDMGCYEISLGD  327

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTV+PMLEAVM+V+PVEKLAVHFHDTYGQSLPNILVSLQMG+ TVDSSV+GLG
Sbjct  328   TIGVGTPGTVVPMLEAVMSVIPVEKLAVHFHDTYGQSLPNILVSLQMGISTVDSSVAGLG  387

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGA+GNVATEDVVYMLHGLG+KTNVDL KL+ AG+FI KHLGR+S SK AIAL+R
Sbjct  388   GCPYAKGASGNVATEDVVYMLHGLGIKTNVDLSKLMAAGDFICKHLGRQSGSKTAIALSR  447

Query  468   VSADASKI  445
             ++ADASKI
Sbjct  448   ITADASKI  455



>ref|XP_010931529.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=423

 Score =   529 bits (1363),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 287/428 (67%), Positives = 339/428 (79%), Gaps = 39/428 (9%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWI-DGRNCSSSNSCDEDFDEYG  1462
             EEP+ LD LP L+ + R+  R +S+ CRP  D+   +  + +GR CSSSNSC+E+     
Sbjct  5     EEPIGLDNLPNLTYVGRLQ-RCTSSGCRPRLDESEMDNCLNEGRECSSSNSCEEE-----  58

Query  1461  RGSYGWKRQ----FRDRPYNGVSNRRS---FSG----------------------GWRNV  1369
                Y W+RQ    FR  P    ++RR+   F                        G  N 
Sbjct  59    ---YAWRRQPKNKFRRDPLILKASRRNRMVFDRACDLWHMQDHCHSSSCNDTEIRGLANK  115

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
                G+PK+VKIVEVGPRDGLQNEK  VPTSVKVELI+KLVS GL V+E T FVSPKWVPQ
Sbjct  116   FLRGLPKFVKIVEVGPRDGLQNEKTIVPTSVKVELIQKLVSSGLSVIEATSFVSPKWVPQ  175

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+DAKDVM+A++++EGA+LPVLTPNLKGFEAA+ASGAKEVA+FASASESFS +NINCSIE
Sbjct  176   LADAKDVMKAIQDVEGAQLPVLTPNLKGFEAAVASGAKEVAIFASASESFSLSNINCSIE  235

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ESL RYR VT AA++LSIPVRGY+SCV+GCPVEG++ PSKVAY+AKEL++MGC+EISLGD
Sbjct  236   ESLNRYRDVTLAARRLSIPVRGYVSCVIGCPVEGSVPPSKVAYVAKELYDMGCYEISLGD  295

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTVIPMLEAVM+V+PVEKLAVHFHDTYGQSLPNI+VSLQMG+ TVDSSV+GLG
Sbjct  296   TIGVGTPGTVIPMLEAVMSVIPVEKLAVHFHDTYGQSLPNIMVSLQMGISTVDSSVAGLG  355

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGATGNVATEDVVYMLHGLG+KTNVDL KL+ AG+FI KHL R+S SK AIAL+R
Sbjct  356   GCPYAKGATGNVATEDVVYMLHGLGIKTNVDLNKLMAAGDFICKHLERQSGSKTAIALSR  415

Query  468   VSADASKI  445
             ++ADASKI
Sbjct  416   IAADASKI  423



>ref|XP_010931528.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=455

 Score =   528 bits (1361),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 287/428 (67%), Positives = 339/428 (79%), Gaps = 39/428 (9%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWI-DGRNCSSSNSCDEDFDEYG  1462
             EEP+ LD LP L+ + R+  R +S+ CRP  D+   +  + +GR CSSSNSC+E+     
Sbjct  37    EEPIGLDNLPNLTYVGRLQ-RCTSSGCRPRLDESEMDNCLNEGRECSSSNSCEEE-----  90

Query  1461  RGSYGWKRQ----FRDRPYNGVSNRRS---FSG----------------------GWRNV  1369
                Y W+RQ    FR  P    ++RR+   F                        G  N 
Sbjct  91    ---YAWRRQPKNKFRRDPLILKASRRNRMVFDRACDLWHMQDHCHSSSCNDTEIRGLANK  147

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
                G+PK+VKIVEVGPRDGLQNEK  VPTSVKVELI+KLVS GL V+E T FVSPKWVPQ
Sbjct  148   FLRGLPKFVKIVEVGPRDGLQNEKTIVPTSVKVELIQKLVSSGLSVIEATSFVSPKWVPQ  207

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+DAKDVM+A++++EGA+LPVLTPNLKGFEAA+ASGAKEVA+FASASESFS +NINCSIE
Sbjct  208   LADAKDVMKAIQDVEGAQLPVLTPNLKGFEAAVASGAKEVAIFASASESFSLSNINCSIE  267

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ESL RYR VT AA++LSIPVRGY+SCV+GCPVEG++ PSKVAY+AKEL++MGC+EISLGD
Sbjct  268   ESLNRYRDVTLAARRLSIPVRGYVSCVIGCPVEGSVPPSKVAYVAKELYDMGCYEISLGD  327

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTVIPMLEAVM+V+PVEKLAVHFHDTYGQSLPNI+VSLQMG+ TVDSSV+GLG
Sbjct  328   TIGVGTPGTVIPMLEAVMSVIPVEKLAVHFHDTYGQSLPNIMVSLQMGISTVDSSVAGLG  387

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGATGNVATEDVVYMLHGLG+KTNVDL KL+ AG+FI KHL R+S SK AIAL+R
Sbjct  388   GCPYAKGATGNVATEDVVYMLHGLGIKTNVDLNKLMAAGDFICKHLERQSGSKTAIALSR  447

Query  468   VSADASKI  445
             ++ADASKI
Sbjct  448   IAADASKI  455



>emb|CDY38533.1| BnaC03g26640D [Brassica napus]
Length=460

 Score =   527 bits (1357),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 290/434 (67%), Positives = 337/434 (78%), Gaps = 46/434 (11%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCD--EDFDEY  1465
             EEPL+ DR+ R          FSS ACRP  D GMG RWI GR+CS+SNSC+  +D   +
Sbjct  37    EEPLAFDRIQR----------FSSGACRPRDDVGMGHRWIRGRDCSTSNSCNDDDDDKSF  86

Query  1464  GRGSYGWKRQ----------FRDRPYNGVSNRRSFSGG-WR-------------------  1375
             G+ S+ WKR            R   ++G ++  + SG  W                    
Sbjct  87    GKESFPWKRHTRKVSEGEILLRSISFSGRNSSSTVSGTLWESKSFQEHKFHTFSSENGIS  146

Query  1374  ---NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSP  1204
                N L  GVPK+VKIVEVGPRDGLQNEKN VPTSVKVELI++LVS GLPVVE T FVSP
Sbjct  147   HSSNKLVRGVPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSAGLPVVEATSFVSP  206

Query  1203  KWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANI  1024
             KWVPQL+DAK VM  V  L+GARLPVLTPNLKGFEAA+++GAKEVA+FASASESFS +NI
Sbjct  207   KWVPQLADAKAVMDGVNALDGARLPVLTPNLKGFEAAVSAGAKEVAIFASASESFSLSNI  266

Query  1023  NCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFE  844
             NC+IEESL+RYRAV +AAK+ SIPVRGY+SCVVGCPVEGA+ PSKVA++ KEL++MGC E
Sbjct  267   NCTIEESLLRYRAVVTAAKEHSIPVRGYVSCVVGCPVEGAVPPSKVAHVVKELYDMGCSE  326

Query  843   ISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSS  664
             ISLGDTIG+ TPGTV+PMLEAVMAVVP EKLAVHFHDTYGQ+L NILVSLQMG+  VDSS
Sbjct  327   ISLGDTIGIGTPGTVVPMLEAVMAVVPAEKLAVHFHDTYGQALANILVSLQMGINIVDSS  386

Query  663   VSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAA  484
             V+GLGGCPYAKGA+GNVATEDVVYML+GLGV+TNVDLGKL+ AG+FISKHLGR + SKAA
Sbjct  387   VAGLGGCPYAKGASGNVATEDVVYMLNGLGVQTNVDLGKLIAAGDFISKHLGRPNGSKAA  446

Query  483   IALT-RVSADASKI  445
             +AL  RV+ADASKI
Sbjct  447   VALNRRVTADASKI  460



>ref|XP_009383249.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Musa 
acuminata subsp. malaccensis]
Length=398

 Score =   523 bits (1348),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 278/406 (68%), Positives = 328/406 (81%), Gaps = 20/406 (5%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDF----  1474
             EEPL LD +PRLS I R+    +S ACRP  D+  M    I+GR CSSSNSC E++    
Sbjct  5     EEPLGLDNMPRLSVIGRLQ-HCTSTACRPRVDEMEMSNCLIEGRECSSSNSCTEEYGWRR  63

Query  1473  ---DEYGRGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQN  1303
                D + R S  WK    DR      N+  F     N  F G+P+YVKIVEVGPRDGLQN
Sbjct  64    KPRDMFSRDSLIWKTSRNDR------NQMIF-----NKFFRGMPRYVKIVEVGPRDGLQN  112

Query  1302  EKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVL  1123
             EK +VPT+VKVELI+KL SCGL V+E + FVSPKWVPQL+DAKDVMQ +K++ GAR PVL
Sbjct  113   EKVSVPTAVKVELIQKLASCGLSVIEASSFVSPKWVPQLADAKDVMQGIKDVHGARFPVL  172

Query  1122  TPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRG  943
             TPNLKGFEAAIA+GAKEVA+FASASESFSK+NINCSIEESL RY  V +AAKKL++PVRG
Sbjct  173   TPNLKGFEAAIAAGAKEVAIFASASESFSKSNINCSIEESLTRYHKVVTAAKKLAVPVRG  232

Query  942   YISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVP  763
             Y+SCVVGCPVEGA+   KVAY+AKEL++MGC EISLGDTIGV TPGTVIPMLEAVM+++P
Sbjct  233   YVSCVVGCPVEGAVPAEKVAYVAKELYDMGCCEISLGDTIGVGTPGTVIPMLEAVMSLIP  292

Query  762   VEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLH  583
             V+K+AVHFHDTYGQSL NILV+LQMG+  +DSSV+GLGGCPYAKGA+GNVATEDVVYML+
Sbjct  293   VDKIAVHFHDTYGQSLSNILVALQMGISVIDSSVAGLGGCPYAKGASGNVATEDVVYMLN  352

Query  582   GLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSADASKI  445
             GLG+KTNVDLGKL+  G+FI  HLGR+S SK A AL++++ADASKI
Sbjct  353   GLGIKTNVDLGKLMAVGDFICTHLGRQSGSKTATALSKITADASKI  398



>ref|XP_008788508.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Phoenix dactylifera]
Length=423

 Score =   524 bits (1350),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 284/423 (67%), Positives = 332/423 (78%), Gaps = 31/423 (7%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRP-VGDDGMGERWIDGRNCSSSNSCDEDF----  1474
             EEP+ LD LP L+ + R+  R +S+ CRP + +  MG   I+G  CSSSNSCDE++    
Sbjct  5     EEPIGLDNLPNLNYVGRLQ-RCTSSGCRPRLNETEMGNCLIEGGECSSSNSCDEEYAWRR  63

Query  1473  ---DEYGRGSY-------------------GWKRQFRDRPYNGVSNRRSFSGGWRNVLFN  1360
                D++GR                       W+ Q  D  Y+   N     G   N    
Sbjct  64    QPRDKFGRDPIILKASCIGKSRMVFDSVCDSWRLQ--DHCYSSSCNNTEIRG-LANKFLR  120

Query  1359  GVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSD  1180
             G+PK+VKIVEVGPRDGLQNEK  + TS+K+ELI+KL S GLPVVE T FVSPKWVPQL+D
Sbjct  121   GLPKFVKIVEVGPRDGLQNEKITISTSIKIELIQKLASSGLPVVEATSFVSPKWVPQLAD  180

Query  1179  AKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESL  1000
             AKDVM+A+K++EGAR PVLTPNLKGFEAA+ASGAKEVAVFASASESFS +NINCSIEESL
Sbjct  181   AKDVMKAIKDVEGARFPVLTPNLKGFEAAVASGAKEVAVFASASESFSLSNINCSIEESL  240

Query  999   VRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIG  820
              RYR VT AAK+LSIPVRGY+SCVVGCPVEG++ PSKVAY+AKEL++MGC+EISLGDTIG
Sbjct  241   NRYRDVTHAAKRLSIPVRGYVSCVVGCPVEGSVPPSKVAYVAKELYDMGCYEISLGDTIG  300

Query  819   VATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCP  640
             V TPGTV PMLEAVM+V+PVEKLAVHFHDTYGQSL NILVSLQMG+ TVDSSV+GLGGCP
Sbjct  301   VGTPGTVTPMLEAVMSVIPVEKLAVHFHDTYGQSLANILVSLQMGISTVDSSVAGLGGCP  360

Query  639   YAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSA  460
             YAKGA+GNVATEDVVYMLHGLG+KTNVDL KL+ AG+FI KHL R+S SK AIAL+R++A
Sbjct  361   YAKGASGNVATEDVVYMLHGLGIKTNVDLSKLMAAGDFICKHLERQSGSKTAIALSRITA  420

Query  459   DAS  451
             DAS
Sbjct  421   DAS  423



>ref|XP_010922056.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X3 [Elaeis guineensis]
 ref|XP_010922057.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X3 [Elaeis guineensis]
 ref|XP_010922058.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X3 [Elaeis guineensis]
 ref|XP_010922059.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X3 [Elaeis guineensis]
Length=425

 Score =   523 bits (1348),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 285/431 (66%), Positives = 329/431 (76%), Gaps = 43/431 (10%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDG-MGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEP+ LD LP LS + R+  R +S+ CRP  D+  MG   I+ R CSSSNSCDE+     
Sbjct  5     EEPIGLDNLPNLSYVGRLQ-RCTSSGCRPRLDETEMGNCSIEDRECSSSNSCDEE-----  58

Query  1461  RGSYGWKRQ--------------------------------FRDRPYNGVSNRRSFSGGW  1378
                Y W+RQ                                 +D  Y+   N     G  
Sbjct  59    ---YAWRRQPGDKFYRDPIILKASRIGRSRMVFDSVCDSWHLQDHCYSSSCNNTEIRG-L  114

Query  1377  RNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
              N    G+PK+VKIVEVGPRDGLQNEK  VPTSVK+ELI+KLVS GL V+E T FVSPKW
Sbjct  115   ANKFLRGLPKFVKIVEVGPRDGLQNEKTTVPTSVKIELIQKLVSSGLSVIEATSFVSPKW  174

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQL+DAKDVM+A++ +EGAR PVLTPNLKGFEAA+ASGAKEVA+FASASESFS +NINC
Sbjct  175   VPQLADAKDVMKAIQGVEGARFPVLTPNLKGFEAAVASGAKEVAIFASASESFSLSNINC  234

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             SIEESL RYR VT AAK L IPVRGY+SCVVGCPVEG++ PSKVAY+AKEL++MGC+EIS
Sbjct  235   SIEESLNRYRNVTLAAKGLKIPVRGYVSCVVGCPVEGSVPPSKVAYVAKELYDMGCYEIS  294

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIGV TPGTVIPMLEAV++V+PVEKLAVHFHDTYGQSLPNILVSLQMG+ TVDSSV+
Sbjct  295   LGDTIGVGTPGTVIPMLEAVVSVIPVEKLAVHFHDTYGQSLPNILVSLQMGISTVDSSVA  354

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYAKGA+GNVATEDVVYMLHGLG+ TNVDL KL+ AG+FI K LGR + SK AIA
Sbjct  355   GLGGCPYAKGASGNVATEDVVYMLHGLGIMTNVDLSKLMAAGDFICKRLGRHTGSKTAIA  414

Query  477   LTRVSADASKI  445
             L+R++ADASKI
Sbjct  415   LSRITADASKI  425



>ref|XP_010922054.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=457

 Score =   524 bits (1349),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 285/431 (66%), Positives = 329/431 (76%), Gaps = 43/431 (10%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDG-MGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEP+ LD LP LS + R+  R +S+ CRP  D+  MG   I+ R CSSSNSCDE+     
Sbjct  37    EEPIGLDNLPNLSYVGRLQ-RCTSSGCRPRLDETEMGNCSIEDRECSSSNSCDEE-----  90

Query  1461  RGSYGWKRQ--------------------------------FRDRPYNGVSNRRSFSGGW  1378
                Y W+RQ                                 +D  Y+   N     G  
Sbjct  91    ---YAWRRQPGDKFYRDPIILKASRIGRSRMVFDSVCDSWHLQDHCYSSSCNNTEIRG-L  146

Query  1377  RNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
              N    G+PK+VKIVEVGPRDGLQNEK  VPTSVK+ELI+KLVS GL V+E T FVSPKW
Sbjct  147   ANKFLRGLPKFVKIVEVGPRDGLQNEKTTVPTSVKIELIQKLVSSGLSVIEATSFVSPKW  206

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQL+DAKDVM+A++ +EGAR PVLTPNLKGFEAA+ASGAKEVA+FASASESFS +NINC
Sbjct  207   VPQLADAKDVMKAIQGVEGARFPVLTPNLKGFEAAVASGAKEVAIFASASESFSLSNINC  266

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             SIEESL RYR VT AAK L IPVRGY+SCVVGCPVEG++ PSKVAY+AKEL++MGC+EIS
Sbjct  267   SIEESLNRYRNVTLAAKGLKIPVRGYVSCVVGCPVEGSVPPSKVAYVAKELYDMGCYEIS  326

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIGV TPGTVIPMLEAV++V+PVEKLAVHFHDTYGQSLPNILVSLQMG+ TVDSSV+
Sbjct  327   LGDTIGVGTPGTVIPMLEAVVSVIPVEKLAVHFHDTYGQSLPNILVSLQMGISTVDSSVA  386

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYAKGA+GNVATEDVVYMLHGLG+ TNVDL KL+ AG+FI K LGR + SK AIA
Sbjct  387   GLGGCPYAKGASGNVATEDVVYMLHGLGIMTNVDLSKLMAAGDFICKRLGRHTGSKTAIA  446

Query  477   LTRVSADASKI  445
             L+R++ADASKI
Sbjct  447   LSRITADASKI  457



>ref|XP_008798376.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X4 [Phoenix dactylifera]
Length=424

 Score =   504 bits (1297),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 273/422 (65%), Positives = 330/422 (78%), Gaps = 26/422 (6%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDG-MGERWIDGRNCSSSNSCDEDF----  1474
             EEPL +D LP  S   +   RF+S+ACRP  DD  M    I+GR+  SS  C+E++    
Sbjct  5     EEPLGIDNLPNWSA--QKLQRFTSSACRPKQDDSEMSNCTIEGRHHISSYICNEEYTGER  62

Query  1473  ---DEYGRGSYGWKRQF---RDRPYNGVSNRRSFSG-------------GWRNVLFNGVP  1351
                ++    S+  +  +     R Y+G+   R   G             G  + L   +P
Sbjct  63    QPWEKIRPKSFTLRTSYFGRYQRVYDGLYGSRDLQGCYFSSSRSDREITGPTSKLLRDLP  122

Query  1350  KYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKD  1171
              +V +VEVGPRDGLQNEKN VPT VK+ELIR+LVS GLPVVE T FVSPKWVPQL+DAKD
Sbjct  123   SFVNVVEVGPRDGLQNEKNIVPTPVKIELIRRLVSSGLPVVEATSFVSPKWVPQLADAKD  182

Query  1170  VMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVRY  991
             VM+A +NLEGAR PVLTPNLKGFEAA+A+GAKEVAVFASASESFSK+NINCSI++SL RY
Sbjct  183   VMEAFRNLEGARFPVLTPNLKGFEAAVAAGAKEVAVFASASESFSKSNINCSIKDSLARY  242

Query  990   RAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVAT  811
             R VT AAK+ ++PVRGY+SCVVGCP+EG + PSKVAY++K+L++MGC EISLGDTIGV T
Sbjct  243   RDVTVAAKRFAMPVRGYVSCVVGCPIEGEVPPSKVAYVSKQLYDMGCSEISLGDTIGVGT  302

Query  810   PGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAK  631
             PGTV+PMLEAVM+VVPV+KLAVHFHDTYGQSLPNILVSLQMG+  VDSS++GLGGCPYAK
Sbjct  303   PGTVLPMLEAVMSVVPVQKLAVHFHDTYGQSLPNILVSLQMGISIVDSSIAGLGGCPYAK  362

Query  630   GATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSADAS  451
             GA+GNVATEDVVYMLHGLG++TNVDLGKL+ AG+FI KHL R+S SK AIALTR++A+AS
Sbjct  363   GASGNVATEDVVYMLHGLGIETNVDLGKLMAAGDFICKHLQRQSGSKTAIALTRITANAS  422

Query  450   KI  445
             K+
Sbjct  423   KM  424



>ref|XP_008798372.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008798373.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008798374.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Phoenix dactylifera]
Length=457

 Score =   504 bits (1298),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 273/422 (65%), Positives = 330/422 (78%), Gaps = 26/422 (6%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDG-MGERWIDGRNCSSSNSCDEDF----  1474
             EEPL +D LP  S   +   RF+S+ACRP  DD  M    I+GR+  SS  C+E++    
Sbjct  38    EEPLGIDNLPNWSA--QKLQRFTSSACRPKQDDSEMSNCTIEGRHHISSYICNEEYTGER  95

Query  1473  ---DEYGRGSYGWKRQF---RDRPYNGVSNRRSFSG-------------GWRNVLFNGVP  1351
                ++    S+  +  +     R Y+G+   R   G             G  + L   +P
Sbjct  96    QPWEKIRPKSFTLRTSYFGRYQRVYDGLYGSRDLQGCYFSSSRSDREITGPTSKLLRDLP  155

Query  1350  KYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKD  1171
              +V +VEVGPRDGLQNEKN VPT VK+ELIR+LVS GLPVVE T FVSPKWVPQL+DAKD
Sbjct  156   SFVNVVEVGPRDGLQNEKNIVPTPVKIELIRRLVSSGLPVVEATSFVSPKWVPQLADAKD  215

Query  1170  VMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVRY  991
             VM+A +NLEGAR PVLTPNLKGFEAA+A+GAKEVAVFASASESFSK+NINCSI++SL RY
Sbjct  216   VMEAFRNLEGARFPVLTPNLKGFEAAVAAGAKEVAVFASASESFSKSNINCSIKDSLARY  275

Query  990   RAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVAT  811
             R VT AAK+ ++PVRGY+SCVVGCP+EG + PSKVAY++K+L++MGC EISLGDTIGV T
Sbjct  276   RDVTVAAKRFAMPVRGYVSCVVGCPIEGEVPPSKVAYVSKQLYDMGCSEISLGDTIGVGT  335

Query  810   PGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAK  631
             PGTV+PMLEAVM+VVPV+KLAVHFHDTYGQSLPNILVSLQMG+  VDSS++GLGGCPYAK
Sbjct  336   PGTVLPMLEAVMSVVPVQKLAVHFHDTYGQSLPNILVSLQMGISIVDSSIAGLGGCPYAK  395

Query  630   GATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSADAS  451
             GA+GNVATEDVVYMLHGLG++TNVDLGKL+ AG+FI KHL R+S SK AIALTR++A+AS
Sbjct  396   GASGNVATEDVVYMLHGLGIETNVDLGKLMAAGDFICKHLQRQSGSKTAIALTRITANAS  455

Query  450   KI  445
             K+
Sbjct  456   KM  457



>ref|XP_008798371.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Phoenix dactylifera]
Length=464

 Score =   504 bits (1297),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 273/422 (65%), Positives = 330/422 (78%), Gaps = 26/422 (6%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDG-MGERWIDGRNCSSSNSCDEDF----  1474
             EEPL +D LP  S   +   RF+S+ACRP  DD  M    I+GR+  SS  C+E++    
Sbjct  45    EEPLGIDNLPNWSA--QKLQRFTSSACRPKQDDSEMSNCTIEGRHHISSYICNEEYTGER  102

Query  1473  ---DEYGRGSYGWKRQF---RDRPYNGVSNRRSFSG-------------GWRNVLFNGVP  1351
                ++    S+  +  +     R Y+G+   R   G             G  + L   +P
Sbjct  103   QPWEKIRPKSFTLRTSYFGRYQRVYDGLYGSRDLQGCYFSSSRSDREITGPTSKLLRDLP  162

Query  1350  KYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKD  1171
              +V +VEVGPRDGLQNEKN VPT VK+ELIR+LVS GLPVVE T FVSPKWVPQL+DAKD
Sbjct  163   SFVNVVEVGPRDGLQNEKNIVPTPVKIELIRRLVSSGLPVVEATSFVSPKWVPQLADAKD  222

Query  1170  VMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVRY  991
             VM+A +NLEGAR PVLTPNLKGFEAA+A+GAKEVAVFASASESFSK+NINCSI++SL RY
Sbjct  223   VMEAFRNLEGARFPVLTPNLKGFEAAVAAGAKEVAVFASASESFSKSNINCSIKDSLARY  282

Query  990   RAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVAT  811
             R VT AAK+ ++PVRGY+SCVVGCP+EG + PSKVAY++K+L++MGC EISLGDTIGV T
Sbjct  283   RDVTVAAKRFAMPVRGYVSCVVGCPIEGEVPPSKVAYVSKQLYDMGCSEISLGDTIGVGT  342

Query  810   PGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAK  631
             PGTV+PMLEAVM+VVPV+KLAVHFHDTYGQSLPNILVSLQMG+  VDSS++GLGGCPYAK
Sbjct  343   PGTVLPMLEAVMSVVPVQKLAVHFHDTYGQSLPNILVSLQMGISIVDSSIAGLGGCPYAK  402

Query  630   GATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSADAS  451
             GA+GNVATEDVVYMLHGLG++TNVDLGKL+ AG+FI KHL R+S SK AIALTR++A+AS
Sbjct  403   GASGNVATEDVVYMLHGLGIETNVDLGKLMAAGDFICKHLQRQSGSKTAIALTRITANAS  462

Query  450   KI  445
             K+
Sbjct  463   KM  464



>ref|XP_009395943.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=454

 Score =   503 bits (1294),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 271/418 (65%), Positives = 326/418 (78%), Gaps = 20/418 (5%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCDEDF-----  1474
             EEPL  D +PRLS + R+    SS++   + +  MGE   +GR CS S  C+E+      
Sbjct  37    EEPLGFDTMPRLSVVGRLQHCASSSSRSRIDEATMGECLSEGRECSLSERCNEEHGSRRQ  96

Query  1473  --DEYGRGSYGWKRQFRDR-------PYNGVSNRRSFS------GGWRNVLFNGVPKYVK  1339
               D + R    WK   R+R       P++  ++R   S      GG     F  +P++VK
Sbjct  97    PRDMFSRDPLIWKSIGRNRMICSVSDPWHLQNHRYKSSCNDMEIGGLAGKFFRSMPRFVK  156

Query  1338  IVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQA  1159
             IVEVGPRDGLQNEK  +PT+VKVELI KLVS GL V+E T FVSPKWVPQL+DAKDVMQA
Sbjct  157   IVEVGPRDGLQNEKLTIPTTVKVELIHKLVSSGLSVIEATSFVSPKWVPQLADAKDVMQA  216

Query  1158  VKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVT  979
             +  L+G + PVLTPNLKGFEAAIA+GAKEVAVFASASESFSK+NINCSIEESL RYR V 
Sbjct  217   IPLLDGVKFPVLTPNLKGFEAAIAAGAKEVAVFASASESFSKSNINCSIEESLNRYREVV  276

Query  978   SAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTV  799
             SAAK+L+IPVRGY+SCVVGCPVEGA+ P +VAY+AKEL+EMGC+EISLGDTIGV TPGTV
Sbjct  277   SAAKELAIPVRGYVSCVVGCPVEGAVPPEQVAYVAKELYEMGCYEISLGDTIGVGTPGTV  336

Query  798   IPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATG  619
             IPMLEA M+++P++KLAVHFHDTYGQSL NILV+LQMG+  +DSSV+GLGGCPYAKGA+G
Sbjct  337   IPMLEAAMSLIPIDKLAVHFHDTYGQSLSNILVALQMGISVIDSSVAGLGGCPYAKGASG  396

Query  618   NVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSADASKI  445
             NVATEDVVYML+GLG KTNVDLG+L+ AG++I KHLGR+S SK AIAL+R +A ASK+
Sbjct  397   NVATEDVVYMLNGLGTKTNVDLGRLMAAGDYICKHLGRQSGSKTAIALSRATAYASKL  454



>ref|XP_009103560.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X2 [Brassica rapa]
Length=402

 Score =   496 bits (1278),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 264/372 (71%), Positives = 310/372 (83%), Gaps = 14/372 (4%)
 Frame = -3

Query  1521  IDGRNCSSSNSCDEDFDEYGRGSYGWKRQFRDRPYNGVSNRRSFSGG--WRNVLFNG---  1357
               GR+CS+SNSC++D   +G+ S+ W RQ R      +  R S   G  W +  F+    
Sbjct  32    FQGRDCSTSNSCNDD-KSFGKESFPWIRQSRKVSQGQLQLRNSTVYGTLWESKHFHTFSN  90

Query  1356  -------VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
                    VPK+VKIVEVGPRDGLQNEKN VPTSVKVELIR+LVS GLPVVE T FVSPKW
Sbjct  91    DKNLLREVPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIRRLVSAGLPVVEATSFVSPKW  150

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQL+DAK+VM AV  L GAR PVLTPNLKGFEAA+A+GAKEVA+FASASESFS +NINC
Sbjct  151   VPQLADAKNVMDAVNTLHGARFPVLTPNLKGFEAAVAAGAKEVAIFASASESFSLSNINC  210

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             SI+ESL+RYRAV +AAK+ SIP+RGY+SCVVGCPVEGA+ PSKVA++ KEL++MGCFEIS
Sbjct  211   SIQESLLRYRAVATAAKEHSIPLRGYVSCVVGCPVEGAVPPSKVAHVVKELYDMGCFEIS  270

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIG+ TPG+V+PMLE VMA VP EKLAVHFHDTYGQ+L NILVSLQMG+  VDSSV+
Sbjct  271   LGDTIGIGTPGSVVPMLETVMAAVPAEKLAVHFHDTYGQALANILVSLQMGINIVDSSVA  330

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYAKGA+GNVATEDVVYML+GLGV+TNVDLGKL+ AG+FISKHLGR + SKAA+A
Sbjct  331   GLGGCPYAKGASGNVATEDVVYMLNGLGVQTNVDLGKLIAAGDFISKHLGRPNGSKAAVA  390

Query  477   LT-RVSADASKI  445
             L+ R++A+ASKI
Sbjct  391   LSRRITAEASKI  402



>ref|XP_009103559.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Brassica rapa]
Length=403

 Score =   496 bits (1277),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 265/374 (71%), Positives = 310/374 (83%), Gaps = 17/374 (5%)
 Frame = -3

Query  1521  IDGRNCSSSNSCDEDFDEYGRGSYGWKRQFRDRPYNGVSNRRS--------------FSG  1384
               GR+CS+SNSC++D   +G+ S+ W RQ R      +  R S              FS 
Sbjct  32    FQGRDCSTSNSCNDD-KSFGKESFPWIRQSRKVSQGQLQLRNSTVYGTLWESKHFHTFSN  90

Query  1383  GWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSP  1204
               +N L   VPK+VKIVEVGPRDGLQNEKN VPTSVKVELIR+LVS GLPVVE T FVSP
Sbjct  91    DKQN-LLREVPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIRRLVSAGLPVVEATSFVSP  149

Query  1203  KWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANI  1024
             KWVPQL+DAK+VM AV  L GAR PVLTPNLKGFEAA+A+GAKEVA+FASASESFS +NI
Sbjct  150   KWVPQLADAKNVMDAVNTLHGARFPVLTPNLKGFEAAVAAGAKEVAIFASASESFSLSNI  209

Query  1023  NCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFE  844
             NCSI+ESL+RYRAV +AAK+ SIP+RGY+SCVVGCPVEGA+ PSKVA++ KEL++MGCFE
Sbjct  210   NCSIQESLLRYRAVATAAKEHSIPLRGYVSCVVGCPVEGAVPPSKVAHVVKELYDMGCFE  269

Query  843   ISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSS  664
             ISLGDTIG+ TPG+V+PMLE VMA VP EKLAVHFHDTYGQ+L NILVSLQMG+  VDSS
Sbjct  270   ISLGDTIGIGTPGSVVPMLETVMAAVPAEKLAVHFHDTYGQALANILVSLQMGINIVDSS  329

Query  663   VSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAA  484
             V+GLGGCPYAKGA+GNVATEDVVYML+GLGV+TNVDLGKL+ AG+FISKHLGR + SKAA
Sbjct  330   VAGLGGCPYAKGASGNVATEDVVYMLNGLGVQTNVDLGKLIAAGDFISKHLGRPNGSKAA  389

Query  483   IALT-RVSADASKI  445
             +AL+ R++A+ASKI
Sbjct  390   VALSRRITAEASKI  403



>ref|XP_010909004.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=425

 Score =   496 bits (1277),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 275/430 (64%), Positives = 327/430 (76%), Gaps = 42/430 (10%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EE + +  LP  S   R+  RF+S+ACRP  D+  M    I+GR+  SS  C+E+     
Sbjct  6     EESVGIYNLPNWSA-PRLQ-RFTSSACRPEQDEMEMSNCTIEGRHYISSYICNEE-----  58

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFS------------GGW-------------------R  1375
                Y W+RQ  +R    +   R+ S            G W                    
Sbjct  59    ---YTWERQTWERILPKLFTLRTSSFGRNQKVYDDLYGSWYLQGRHYSPSCSDREITGPT  115

Query  1374  NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
             N L + +P +VKIVE GPRDGLQNEKN VPT VK+ELIR+LVS GLPVVE T FVSPKWV
Sbjct  116   NKLLSNLPSFVKIVEGGPRDGLQNEKNIVPTFVKIELIRRLVSSGLPVVEATSFVSPKWV  175

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDVM+A++NLEGAR PVLTPNLKGFEAA+A+GAKEVAVFA+ASESFSK+NINCS
Sbjct  176   PQLADAKDVMEAIQNLEGARFPVLTPNLKGFEAAVAAGAKEVAVFAAASESFSKSNINCS  235

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             I++SL RYR V  AA +L++PVRGY+SCVVGCPVEG + PSKVAY+ KEL++MGC EISL
Sbjct  236   IKDSLARYRDVILAANRLAMPVRGYVSCVVGCPVEGEVPPSKVAYVVKELYDMGCSEISL  295

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGV TPGTV+PMLEAVM+VVPV+KLAVHFHDTYGQSLPNIL+SLQMG+  VDSS++G
Sbjct  296   GDTIGVGTPGTVVPMLEAVMSVVPVQKLAVHFHDTYGQSLPNILISLQMGISIVDSSIAG  355

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYMLHGLG+KTNVDLGKL+ AG+FI KHL R+S SK AIAL
Sbjct  356   LGGCPYAKGASGNVATEDVVYMLHGLGIKTNVDLGKLIAAGDFICKHLQRQSGSKTAIAL  415

Query  474   TRVSADASKI  445
             TR++ADASK+
Sbjct  416   TRITADASKM  425



>ref|XP_010909003.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=457

 Score =   496 bits (1277),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 275/430 (64%), Positives = 327/430 (76%), Gaps = 42/430 (10%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EE + +  LP  S   R+  RF+S+ACRP  D+  M    I+GR+  SS  C+E+     
Sbjct  38    EESVGIYNLPNWSA-PRLQ-RFTSSACRPEQDEMEMSNCTIEGRHYISSYICNEE-----  90

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFS------------GGW-------------------R  1375
                Y W+RQ  +R    +   R+ S            G W                    
Sbjct  91    ---YTWERQTWERILPKLFTLRTSSFGRNQKVYDDLYGSWYLQGRHYSPSCSDREITGPT  147

Query  1374  NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
             N L + +P +VKIVE GPRDGLQNEKN VPT VK+ELIR+LVS GLPVVE T FVSPKWV
Sbjct  148   NKLLSNLPSFVKIVEGGPRDGLQNEKNIVPTFVKIELIRRLVSSGLPVVEATSFVSPKWV  207

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDVM+A++NLEGAR PVLTPNLKGFEAA+A+GAKEVAVFA+ASESFSK+NINCS
Sbjct  208   PQLADAKDVMEAIQNLEGARFPVLTPNLKGFEAAVAAGAKEVAVFAAASESFSKSNINCS  267

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             I++SL RYR V  AA +L++PVRGY+SCVVGCPVEG + PSKVAY+ KEL++MGC EISL
Sbjct  268   IKDSLARYRDVILAANRLAMPVRGYVSCVVGCPVEGEVPPSKVAYVVKELYDMGCSEISL  327

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGV TPGTV+PMLEAVM+VVPV+KLAVHFHDTYGQSLPNIL+SLQMG+  VDSS++G
Sbjct  328   GDTIGVGTPGTVVPMLEAVMSVVPVQKLAVHFHDTYGQSLPNILISLQMGISIVDSSIAG  387

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYMLHGLG+KTNVDLGKL+ AG+FI KHL R+S SK AIAL
Sbjct  388   LGGCPYAKGASGNVATEDVVYMLHGLGIKTNVDLGKLIAAGDFICKHLQRQSGSKTAIAL  447

Query  474   TRVSADASKI  445
             TR++ADASK+
Sbjct  448   TRITADASKM  457



>ref|XP_010247162.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Nelumbo nucifera]
Length=426

 Score =   492 bits (1266),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 280/416 (67%), Positives = 328/416 (79%), Gaps = 32/416 (8%)
 Frame = -3

Query  1608  RLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYGRGSYGWKRQF  1432
              +++IDR+  R S + CRP+ DD GM    I GR+CSSSNS      E+ R +  W+R  
Sbjct  15    HMNSIDRIQ-RSSLSGCRPISDDMGMESCLIVGRSCSSSNS---CNGEFARETLRWRRLR  70

Query  1431  RD---------------RPYNGV-----SNRRSFS-------GGWRNVLFNGVPKYVKIV  1333
             RD               R Y  V     SN+   S        G  N    G+PK+VKIV
Sbjct  71    RDGCSLNQKMLSSGRSHRVYGSVCDSYMSNQHFISQCNYKDISGLTNKFLRGIPKFVKIV  130

Query  1332  EVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVK  1153
             EVGPRDGLQNEK+ VPT+VK+ELI++LVS GL VVE T FVSPKWVPQL+DAK VM+AV+
Sbjct  131   EVGPRDGLQNEKSMVPTTVKIELIQRLVSSGLSVVEATSFVSPKWVPQLADAKGVMEAVR  190

Query  1152  NLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSA  973
              +EG R PVLTPNLKGFEAAIA+GAKEVA+FASASESFSK+NINCSIE+SL+ YRA+T A
Sbjct  191   KIEGVRFPVLTPNLKGFEAAIAAGAKEVAIFASASESFSKSNINCSIEDSLIHYRAITLA  250

Query  972   AKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIP  793
             AKKLSIPVRGY+SCVVGCPVEG +LPSKVAY+AKEL++MGCFEISLGDTIGV TPG+V+P
Sbjct  251   AKKLSIPVRGYVSCVVGCPVEGPVLPSKVAYVAKELYDMGCFEISLGDTIGVGTPGSVVP  310

Query  792   MLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNV  613
             MLEAVMAVVP EKLAVHFHDTYGQ+L NILVSLQ+G+ T+DSSVSGLGGCPYAKGA+GNV
Sbjct  311   MLEAVMAVVPSEKLAVHFHDTYGQALANILVSLQIGIGTIDSSVSGLGGCPYAKGASGNV  370

Query  612   ATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSADASKI  445
             ATEDVVY+L+GLGVKT+VDL K++ AGEFISKHL R S SK A AL+R++ADASKI
Sbjct  371   ATEDVVYLLNGLGVKTDVDLRKVILAGEFISKHLCRPSGSKVATALSRITADASKI  426



>ref|XP_006836266.1| hypothetical protein AMTR_s00101p00146100 [Amborella trichopoda]
 gb|ERM99119.1| hypothetical protein AMTR_s00101p00146100 [Amborella trichopoda]
Length=428

 Score =   491 bits (1264),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 271/422 (64%), Positives = 319/422 (76%), Gaps = 36/422 (9%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDG-MGERWIDGRNCSSSNSCDEDFDEYG  1462
             +EP+S D LP L ++ R+  RF+S+ C    D+G  G    + R C SSN C    DEY 
Sbjct  5     QEPISFDTLPTLRDVSRLR-RFASSDCSQRFDEGESGNCLAEERACCSSNGC---IDEYT  60

Query  1461  RGSYGWKRQFRD--------------RPYNGVSNR---------RSFS--------GGWR  1375
               ++ W+R+ RD              R    +S+R         R +S            
Sbjct  61    GDNFPWRRRTRDIFRGEPLHSRNCHSRKCMQISDRICDTWFLQDRQYSVPCADKEIRDLT  120

Query  1374  NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
             N    G+PKYVKIVEVGPRDGLQNEK  VPT+VKVE+I++L + GL VVE T FVSPKWV
Sbjct  121   NKFLRGIPKYVKIVEVGPRDGLQNEKAIVPTAVKVEMIQRLAASGLQVVEATSFVSPKWV  180

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDV+ A+ ++ G RLPVLTPNLKGFEAAIA+GAKEVA+FASASE+FSK+NINCS
Sbjct  181   PQLADAKDVIDAISDIRGVRLPVLTPNLKGFEAAIAAGAKEVAIFASASEAFSKSNINCS  240

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IE+SL R+  VT AAKKLSIPVRGY+SCV GCPVEG + PSKVAY+AKEL++MGCFEISL
Sbjct  241   IEDSLSRFCDVTDAAKKLSIPVRGYVSCVAGCPVEGYVPPSKVAYVAKELYDMGCFEISL  300

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGV TPG++IPMLEAVMAVVPVEKLAVHFHDTYGQSL NILVSLQMG+  VDSS+SG
Sbjct  301   GDTIGVGTPGSIIPMLEAVMAVVPVEKLAVHFHDTYGQSLANILVSLQMGISVVDSSISG  360

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVY+LHGLGVKTNVDLGKL+ AGE+I  HLGR S SKAA+AL
Sbjct  361   LGGCPYAKGASGNVATEDVVYLLHGLGVKTNVDLGKLISAGEYICNHLGRHSGSKAAVAL  420

Query  474   TR  469
              +
Sbjct  421   AK  422



>ref|XP_010247161.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Nelumbo nucifera]
Length=458

 Score =   491 bits (1265),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 280/416 (67%), Positives = 328/416 (79%), Gaps = 32/416 (8%)
 Frame = -3

Query  1608  RLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYGRGSYGWKRQF  1432
              +++IDR+  R S + CRP+ DD GM    I GR+CSSSNS      E+ R +  W+R  
Sbjct  47    HMNSIDRIQ-RSSLSGCRPISDDMGMESCLIVGRSCSSSNS---CNGEFARETLRWRRLR  102

Query  1431  RD---------------RPYNGV-----SNRRSFS-------GGWRNVLFNGVPKYVKIV  1333
             RD               R Y  V     SN+   S        G  N    G+PK+VKIV
Sbjct  103   RDGCSLNQKMLSSGRSHRVYGSVCDSYMSNQHFISQCNYKDISGLTNKFLRGIPKFVKIV  162

Query  1332  EVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVK  1153
             EVGPRDGLQNEK+ VPT+VK+ELI++LVS GL VVE T FVSPKWVPQL+DAK VM+AV+
Sbjct  163   EVGPRDGLQNEKSMVPTTVKIELIQRLVSSGLSVVEATSFVSPKWVPQLADAKGVMEAVR  222

Query  1152  NLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSA  973
              +EG R PVLTPNLKGFEAAIA+GAKEVA+FASASESFSK+NINCSIE+SL+ YRA+T A
Sbjct  223   KIEGVRFPVLTPNLKGFEAAIAAGAKEVAIFASASESFSKSNINCSIEDSLIHYRAITLA  282

Query  972   AKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIP  793
             AKKLSIPVRGY+SCVVGCPVEG +LPSKVAY+AKEL++MGCFEISLGDTIGV TPG+V+P
Sbjct  283   AKKLSIPVRGYVSCVVGCPVEGPVLPSKVAYVAKELYDMGCFEISLGDTIGVGTPGSVVP  342

Query  792   MLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNV  613
             MLEAVMAVVP EKLAVHFHDTYGQ+L NILVSLQ+G+ T+DSSVSGLGGCPYAKGA+GNV
Sbjct  343   MLEAVMAVVPSEKLAVHFHDTYGQALANILVSLQIGIGTIDSSVSGLGGCPYAKGASGNV  402

Query  612   ATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSADASKI  445
             ATEDVVY+L+GLGVKT+VDL K++ AGEFISKHL R S SK A AL+R++ADASKI
Sbjct  403   ATEDVVYLLNGLGVKTDVDLRKVILAGEFISKHLCRPSGSKVATALSRITADASKI  458



>emb|CDY04467.1| BnaA07g12930D [Brassica napus]
Length=444

 Score =   490 bits (1262),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 263/374 (70%), Positives = 307/374 (82%), Gaps = 17/374 (5%)
 Frame = -3

Query  1521  IDGRNCSSSNSCDEDFDEYGRGSYGWKRQFR--------------DRPYNGVSNRRSFSG  1384
               GR+CS+SNSC++D    G+ S+ W RQ R               R      +  +FS 
Sbjct  73    FQGRDCSTSNSCNDD-KSSGKESFPWIRQSRRVSQGQLLHGNSAVSRTLWEPKHFHTFSN  131

Query  1383  GWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSP  1204
               +  L   VPK+VKIVEVGPRDGLQNEKN VPTSVKVELIR+LVS GLPVVE T FVSP
Sbjct  132   D-KQKLLREVPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIRRLVSAGLPVVEATSFVSP  190

Query  1203  KWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANI  1024
             KWVPQL+DAK+VM AV  L GAR PVLTPNLKGFEAA+A+GAKEVA+FASASESFS +NI
Sbjct  191   KWVPQLADAKNVMDAVNTLHGARFPVLTPNLKGFEAAVAAGAKEVAIFASASESFSLSNI  250

Query  1023  NCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFE  844
             NCSI+ESL+RYRAV +AA   SIP+RGY+SCVVGCPVEGA+ PSKVA++ KEL++MGCFE
Sbjct  251   NCSIQESLLRYRAVATAANDHSIPLRGYVSCVVGCPVEGAVPPSKVAHVVKELYDMGCFE  310

Query  843   ISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSS  664
             ISLGDTIG+ TPG+V+PMLEAVMA VP EKLAVHFHDTYGQ+L NILVSLQMG+  VDSS
Sbjct  311   ISLGDTIGIGTPGSVVPMLEAVMAAVPAEKLAVHFHDTYGQALANILVSLQMGINIVDSS  370

Query  663   VSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAA  484
             V+GLGGCPYAKGA+GNVATEDVVYML+GLGV+TNVDLGKL+ AG+FISKHLGR + SKAA
Sbjct  371   VAGLGGCPYAKGASGNVATEDVVYMLNGLGVQTNVDLGKLIAAGDFISKHLGRPNGSKAA  430

Query  483   IALT-RVSADASKI  445
             +AL+ R++A+ASKI
Sbjct  431   VALSRRITAEASKI  444



>ref|XP_003599681.1| Hydroxymethylglutaryl-CoA lyase [Medicago truncatula]
 gb|AES69932.1| hydroxymethylglutaryl-CoA lyase [Medicago truncatula]
Length=358

 Score =   484 bits (1246),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 260/368 (71%), Positives = 292/368 (79%), Gaps = 13/368 (4%)
 Frame = -3

Query  1548  GDDGMGERWIDGRNCSSSNSCDEDFDEYGRGSYGWKRQFRDRPYNGVSNRRSFSGGWRNV  1369
             GD         GRN   S   D  F       Y    Q+  +  N      ++       
Sbjct  4     GDSFSPRTMTTGRNTLKSGIVDNSF-------YTSDYQYSQKRNNKDMQDMAYK------  50

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
                G+P++VKIVEVGPRDGLQNEKN VPT VK+ELI +L S GL V+E T FVSPKWVPQ
Sbjct  51    FMKGMPEFVKIVEVGPRDGLQNEKNIVPTDVKIELIHRLASTGLSVIEATSFVSPKWVPQ  110

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+DAKDVMQAV NL G RLPVLTPNLKGFEAA+A+GA+EVAVFASASESFSK+NINCSIE
Sbjct  111   LADAKDVMQAVHNLRGIRLPVLTPNLKGFEAAVAAGAREVAVFASASESFSKSNINCSIE  170

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ESL RYRAVT AAK+LSIPVRGY+SCVVGCPVEG + PSKVAY+AK L++MGCFEISLGD
Sbjct  171   ESLSRYRAVTRAAKELSIPVRGYVSCVVGCPVEGPVPPSKVAYVAKALYDMGCFEISLGD  230

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTV+PML AVMA+VP EKLAVHFHDTYGQSLPNILVSLQMG+  VDSSV+GLG
Sbjct  231   TIGVGTPGTVVPMLLAVMAIVPTEKLAVHFHDTYGQSLPNILVSLQMGISAVDSSVAGLG  290

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGA+GNVATEDVVYML+GLG+KTNVD+GKL+ AG+FI K LGR S SK AIAL R
Sbjct  291   GCPYAKGASGNVATEDVVYMLNGLGIKTNVDIGKLMSAGDFIGKQLGRPSGSKTAIALNR  350

Query  468   VSADASKI  445
             V+ADASKI
Sbjct  351   VTADASKI  358



>ref|XP_010922055.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=441

 Score =   486 bits (1252),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 272/431 (63%), Positives = 313/431 (73%), Gaps = 59/431 (14%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDG-MGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEP+ LD LP LS + R+  R +S+ CRP  D+  MG   I+ R CSSSNSCDE+     
Sbjct  37    EEPIGLDNLPNLSYVGRLQ-RCTSSGCRPRLDETEMGNCSIEDRECSSSNSCDEE-----  90

Query  1461  RGSYGWKRQ--------------------------------FRDRPYNGVSNRRSFSGGW  1378
                Y W+RQ                                 +D  Y+   N     G  
Sbjct  91    ---YAWRRQPGDKFYRDPIILKASRIGRSRMVFDSVCDSWHLQDHCYSSSCNNTEIRG-L  146

Query  1377  RNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
              N    G+PK+VKIVEVGPRDGLQNEK  VPTSVK+ELI+KLVS GL V+E T FVSPKW
Sbjct  147   ANKFLRGLPKFVKIVEVGPRDGLQNEKTTVPTSVKIELIQKLVSSGLSVIEATSFVSPKW  206

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQL+DAKDVM+A++ +EGAR PVLTPNLKGFEAA+ASGAKEVA+FASASESFS +NINC
Sbjct  207   VPQLADAKDVMKAIQGVEGARFPVLTPNLKGFEAAVASGAKEVAIFASASESFSLSNINC  266

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             SIEESL RYR VT AAK L IPVRGY+SCVVGCPVEG++ PSKVAY+AKEL++MGC+EIS
Sbjct  267   SIEESLNRYRNVTLAAKGLKIPVRGYVSCVVGCPVEGSVPPSKVAYVAKELYDMGCYEIS  326

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIGV TP                EKLAVHFHDTYGQSLPNILVSLQMG+ TVDSSV+
Sbjct  327   LGDTIGVGTP----------------EKLAVHFHDTYGQSLPNILVSLQMGISTVDSSVA  370

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYAKGA+GNVATEDVVYMLHGLG+ TNVDL KL+ AG+FI K LGR + SK AIA
Sbjct  371   GLGGCPYAKGASGNVATEDVVYMLHGLGIMTNVDLSKLMAAGDFICKRLGRHTGSKTAIA  430

Query  477   LTRVSADASKI  445
             L+R++ADASKI
Sbjct  431   LSRITADASKI  441



>ref|XP_010521562.1| PREDICTED: LOW QUALITY PROTEIN: hydroxymethylglutaryl-CoA lyase, 
mitochondrial [Tarenaya hassleriana]
Length=799

 Score =   498 bits (1283),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 273/431 (63%), Positives = 329/431 (76%), Gaps = 38/431 (9%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL  D+LPR++  DR+  RFSS ACRP+ DD GMG  W +G +C +SN+C++D ++ G
Sbjct  374   EEPLGFDKLPRMTT-DRIQ-RFSSGACRPMADDLGMGGCWNEGSDCFTSNNCNDDDEDCG  431

Query  1461  RGSYGWKRQFR--------------------------------DRPYNGVSNRRSFSGGW  1378
             R  + W+R  R                                D  Y+ +SN RS     
Sbjct  432   RKGFPWRRHTRKMSEEELILLRTSTLGRYYTTSQTLWENQYLQDHKYSTISNERSIHHS-  490

Query  1377  RNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
              N +F  V ++VKIVEVGPRDGLQNEKN V TSVKVELI++LVS GLP VE T FVSPKW
Sbjct  491   TNKIFVDVQEFVKIVEVGPRDGLQNEKNIVXTSVKVELIQRLVSSGLPAVEATSFVSPKW  550

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQL+DA DV+ AV+ L+GARLPVLTPNLKGF+AA+A+GAKEVAVFASASESFS++NINC
Sbjct  551   VPQLADATDVLAAVRTLDGARLPVLTPNLKGFDAAVAAGAKEVAVFASASESFSRSNINC  610

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             +IEESL RY  V +AAK+ SIPVRGY+SC VGCP EGA+ P+KV Y+AK+L++MGCFEIS
Sbjct  611   TIEESLSRYHVVANAAKERSIPVRGYVSCAVGCPEEGAVPPTKVVYVAKKLYDMGCFEIS  670

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIGV TPGTV+ MLEAVM VVP +KLAVHFHDTYGQ+L NIL+SLQMG+  VDSSV+
Sbjct  671   LGDTIGVGTPGTVVAMLEAVMEVVPADKLAVHFHDTYGQALANILISLQMGIRIVDSSVA  730

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYAKGA+GNVA EDVVYM++GLG++TNVDLGKLL AG+FI  HLGR S SKAA A
Sbjct  731   GLGGCPYAKGASGNVAMEDVVYMMNGLGIQTNVDLGKLLSAGKFICNHLGRPSGSKAAFA  790

Query  477   LTRVSADASKI  445
             L  ++AD+S I
Sbjct  791   L--ITADSSNI  799



>emb|CDX71485.1| BnaC04g17200D [Brassica napus]
Length=401

 Score =   483 bits (1244),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 264/378 (70%), Positives = 309/378 (82%), Gaps = 25/378 (7%)
 Frame = -3

Query  1521  IDGRN-CSSSNSCDEDFDEYGRGSYGWKRQFRDRPYNGVSNRR------SFSGG-WRNVL  1366
               GR+ CS+SNSC++D   +G+ S+ WKR  R      VS R+      + SG  W    
Sbjct  30    FQGRDYCSTSNSCNDD-KSFGKESFPWKRHSRK-----VSQRQLLFWNSTVSGTLWEPKH  83

Query  1365  FNG----------VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTG  1216
             F+           VPK+VKIVEVGPRDGLQNEKN VPTSVKVELIR+LVS GLPVVE T 
Sbjct  84    FHTFSNDKKLLREVPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIRRLVSAGLPVVEATS  143

Query  1215  FVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfs  1036
             FVSPKWVPQL+DAK+VM AV  L GAR PVL PNLKGFEAA+++GAKEVA+FASASESFS
Sbjct  144   FVSPKWVPQLADAKNVMDAVNTLHGARFPVLAPNLKGFEAAVSAGAKEVAIFASASESFS  203

Query  1035  kANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEM  856
               NIN +I+ESL+RYRAV +AAK+ SIPVRGY+SCVVGCPVEGA+ PSKVA++ KEL++M
Sbjct  204   LTNINSTIQESLLRYRAVATAAKEHSIPVRGYVSCVVGCPVEGAVPPSKVAHVVKELYDM  263

Query  855   GCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCT  676
             GCFEISLGDTIG+ TPG+V+P+LEAVMA VP EKLAVHFHDTYGQ+L NILVSLQMG+  
Sbjct  264   GCFEISLGDTIGIGTPGSVVPILEAVMAAVPAEKLAVHFHDTYGQALANILVSLQMGINI  323

Query  675   VDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESS  496
             VDSSV+GLGGCPYAKGA+GNVATEDVVYML+GLGV+TNVDLGKL+ AG+FISKHLGR + 
Sbjct  324   VDSSVAGLGGCPYAKGASGNVATEDVVYMLNGLGVQTNVDLGKLIAAGDFISKHLGRPNG  383

Query  495   SKAAIALT-RVSADASKI  445
             SKAA+AL  R++ADASKI
Sbjct  384   SKAAVALNRRITADASKI  401



>ref|XP_010653622.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Vitis vinifera]
 ref|XP_010653623.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Vitis vinifera]
 ref|XP_002282814.3| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Vitis vinifera]
Length=451

 Score =   474 bits (1221),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 270/429 (63%), Positives = 316/429 (74%), Gaps = 37/429 (9%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNAC--RPVGDDGMGERWIDGRNCSSSNSCDEDFDEY  1465
             EEP    +L R    D++   FSSN C  R  G  G+G+ W++G   SS +S      EY
Sbjct  29    EEPAVFGKLSRFGG-DKVK-MFSSNPCMIRENGT-GIGDCWVEG---SSLHSPKNSNYEY  82

Query  1464  GRGSYGWKRQFRD---------RPYNGVSNRRSFSG--------------------GWRN  1372
                   W+RQ R+          P N   N R F                         N
Sbjct  83    TEEVCPWRRQMRNVSRGDFLNRTPANMSRNHRVFRSVPDACYLTDRPYSSHCNDECTRDN  142

Query  1371  VLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVP  1192
              L   +P +VKIVEVGPRDGLQNEK+ VPT VKVELI+ LVS GLP+VE T FVSPKWVP
Sbjct  143   KLLRSMPGFVKIVEVGPRDGLQNEKDIVPTVVKVELIKMLVSSGLPIVEATSFVSPKWVP  202

Query  1191  QLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSI  1012
             QL+DAKDVM+A++ +EG R PVLTPNLKGFEAA+A+GAKEVA+FASASESFSK+NINCSI
Sbjct  203   QLADAKDVMEAIRTVEGGRFPVLTPNLKGFEAAVAAGAKEVAIFASASESFSKSNINCSI  262

Query  1011  EESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLG  832
             E+SL RYR V  AA+KLSIPVRGYISCVVGCP+EG + PSKV Y+ KEL++MGC+EISLG
Sbjct  263   EDSLTRYRDVALAARKLSIPVRGYISCVVGCPLEGVVSPSKVTYVGKELYDMGCYEISLG  322

Query  831   DTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGL  652
             DTIGV TPGTVIPMLE V+ VVP++KLAVHFHDTYGQ+L NIL SLQMG+ TVDSSVSGL
Sbjct  323   DTIGVGTPGTVIPMLEDVIDVVPIDKLAVHFHDTYGQALSNILASLQMGITTVDSSVSGL  382

Query  651   GGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALT  472
             GGCPYAKGA+GNVATEDVVYML+GLGVKTNVDLGKL+ AG+FI +HLGR+S SK AIAL+
Sbjct  383   GGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLGKLMLAGDFICQHLGRQSGSKTAIALS  442

Query  471   RVSADASKI  445
             R+   ASK+
Sbjct  443   RIRGHASKL  451



>ref|XP_009760355.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X2 [Nicotiana sylvestris]
Length=374

 Score =   471 bits (1212),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 257/349 (74%), Positives = 289/349 (83%), Gaps = 36/349 (10%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL+LDRLP LSNID ++ RFSS ACRP+G+D  +G+ W DGR+CSSSNSC ED DEYG
Sbjct  5     EEPLNLDRLPSLSNIDWLE-RFSSGACRPIGEDMAIGDSWTDGRSCSSSNSCVEDDDEYG  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRS--FSGGWRNV---------------------------  1369
             R ++ W+R       NG+S+RRS  FS  +R                             
Sbjct  64    RENFKWRRH---GSRNGISSRRSKSFSTNYRVCGTLSHSQYLTDHQSKSYRNNRSTVSKP  120

Query  1368  --LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
               LF+G+PKYVKIVEVGPRDGLQNEKN VPTSVKVEL++KLVSCGLPVVEVTGFVSPKWV
Sbjct  121   FKLFDGMPKYVKIVEVGPRDGLQNEKNIVPTSVKVELVQKLVSCGLPVVEVTGFVSPKWV  180

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQLSDAKDVM+AVK+LE ARLPVLTPN+KGFEAA+A+GAKEVAVFASASESFSK+NINCS
Sbjct  181   PQLSDAKDVMEAVKDLESARLPVLTPNMKGFEAAVAAGAKEVAVFASASESFSKSNINCS  240

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IEESLVRYRAVTSAA+KLSIPVRGY+SC +GCP EGAI PSKVAY+AKELH+MGCFEISL
Sbjct  241   IEESLVRYRAVTSAARKLSIPVRGYVSCAIGCPTEGAISPSKVAYVAKELHDMGCFEISL  300

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQM  688
             GDTIGVATPG+V+PMLEAVMAVVPVEKLAVHFHDTYGQSL NILVSLQ+
Sbjct  301   GDTIGVATPGSVVPMLEAVMAVVPVEKLAVHFHDTYGQSLSNILVSLQV  349



>ref|XP_010238769.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Brachypodium distachyon]
Length=387

 Score =   471 bits (1211),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 264/395 (67%), Positives = 310/395 (78%), Gaps = 14/395 (4%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCDEDFDEYGR  1459
             EEPL L  LP+LS I+R+ GRF  + CR   DD          N + SN  D     +  
Sbjct  5     EEPLGLGDLPKLS-INRL-GRFCQSGCRARADDR------SNGNYTHSNGNDNQ-TLFHS  55

Query  1458  GSYGWKRQ--FRDRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVP  1285
              S+ W  Q  + D   NG+     F    R V ++ +P++VK+VEVGPRDGLQNEKN VP
Sbjct  56    SSHSWHLQGNYTDSSCNGID--MEFRALPRKVSWD-LPRFVKVVEVGPRDGLQNEKNIVP  112

Query  1284  TSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKG  1105
             TSVK+ELI KLV+ GL VVE T FVSPKWVPQL+DAKDV++ V+     RLPVLTPNL+G
Sbjct  113   TSVKIELIHKLVASGLSVVEATSFVSPKWVPQLADAKDVLEGVQYAPDVRLPVLTPNLRG  172

Query  1104  FEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVV  925
             FEAA+A+GAKEVAVFASASESFSK+NINC+IEESLVRYR VTSAAKK  + VRGY+SCVV
Sbjct  173   FEAAVAAGAKEVAVFASASESFSKSNINCTIEESLVRYRDVTSAAKKHGVRVRGYVSCVV  232

Query  924   GCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAV  745
             GCPVEGA+ PSKVAY+AKEL++MGC EISLGDTIGV TPG V+PMLEAVM+VVPV+KLAV
Sbjct  233   GCPVEGAVHPSKVAYVAKELYDMGCAEISLGDTIGVGTPGRVVPMLEAVMSVVPVDKLAV  292

Query  744   HFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKT  565
             HFHDTYGQ+L NILVSLQMGV  VDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLG++T
Sbjct  293   HFHDTYGQALANILVSLQMGVSIVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGIET  352

Query  564   NVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSA  460
             N++LGKL+ AG++I KHL R S SK A AL +++A
Sbjct  353   NINLGKLMDAGDYICKHLNRTSGSKTATALCKLTA  387



>emb|CBI32791.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   468 bits (1204),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 257/394 (65%), Positives = 300/394 (76%), Gaps = 32/394 (8%)
 Frame = -3

Query  1539  GMGERWIDGRNCSSSNSCDEDFDEYGRGSYGWKRQFRD---------RPYNGVSNRRSFS  1387
             G+G+ W++G   SS +S      EY      W+RQ R+          P N   N R F 
Sbjct  8     GIGDCWVEG---SSLHSPKNSNYEYTEEVCPWRRQMRNVSRGDFLNRTPANMSRNHRVFR  64

Query  1386  G--------------------GWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVE  1267
                                     N L   +P +VKIVEVGPRDGLQNEK+ VPT VKVE
Sbjct  65    SVPDACYLTDRPYSSHCNDECTRDNKLLRSMPGFVKIVEVGPRDGLQNEKDIVPTVVKVE  124

Query  1266  LIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIA  1087
             LI+ LVS GLP+VE T FVSPKWVPQL+DAKDVM+A++ +EG R PVLTPNLKGFEAA+A
Sbjct  125   LIKMLVSSGLPIVEATSFVSPKWVPQLADAKDVMEAIRTVEGGRFPVLTPNLKGFEAAVA  184

Query  1086  SGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEG  907
             +GAKEVA+FASASESFSK+NINCSIE+SL RYR V  AA+KLSIPVRGYISCVVGCP+EG
Sbjct  185   AGAKEVAIFASASESFSKSNINCSIEDSLTRYRDVALAARKLSIPVRGYISCVVGCPLEG  244

Query  906   AILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTY  727
              + PSKV Y+ KEL++MGC+EISLGDTIGV TPGTVIPMLE V+ VVP++KLAVHFHDTY
Sbjct  245   VVSPSKVTYVGKELYDMGCYEISLGDTIGVGTPGTVIPMLEDVIDVVPIDKLAVHFHDTY  304

Query  726   GQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGK  547
             GQ+L NIL SLQMG+ TVDSSVSGLGGCPYAKGA+GNVATEDVVYML+GLGVKTNVDLGK
Sbjct  305   GQALSNILASLQMGITTVDSSVSGLGGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLGK  364

Query  546   LLQAGEFISKHLGRESSSKAAIALTRVSADASKI  445
             L+ AG+FI +HLGR+S SK AIAL+R+   ASK+
Sbjct  365   LMLAGDFICQHLGRQSGSKTAIALSRIRGHASKL  398



>ref|XP_011040755.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Populus euphratica]
Length=391

 Score =   467 bits (1202),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 242/310 (78%), Positives = 276/310 (89%), Gaps = 0/310 (0%)
 Frame = -3

Query  1374  NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
             N LF+ +P YVKIVEVGPRDGLQNEK+ VPT++KVELI+ L S GLPVVE T FVSPKWV
Sbjct  82    NKLFSSIPGYVKIVEVGPRDGLQNEKDIVPTAIKVELIKMLASSGLPVVEATSFVSPKWV  141

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDVM+A+++ +GAR PVLTPNLKGFEAAIA+GAKEVAVFASASE FSK+NINCS
Sbjct  142   PQLADAKDVMEAIRDFKGARFPVLTPNLKGFEAAIAAGAKEVAVFASASEGFSKSNINCS  201

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IE+SLVRY  V  +A KLSIPVRGYISCVVGCPVEG + PSKVAY+AK+L +MGC+EISL
Sbjct  202   IEDSLVRYHEVALSASKLSIPVRGYISCVVGCPVEGMVSPSKVAYVAKKLCDMGCYEISL  261

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGV TPGTVIPMLEAV+ VVP+EKLAVHFHDTYGQ+L NIL SLQMG+ TVDSSVSG
Sbjct  262   GDTIGVGTPGTVIPMLEAVIDVVPIEKLAVHFHDTYGQALSNILASLQMGISTVDSSVSG  321

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYML+GLGVKTNVDL K++ AG FI KHLG  S SK AIAL
Sbjct  322   LGGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLQKIMLAGNFIRKHLGHSSGSKTAIAL  381

Query  474   TRVSADASKI  445
             ++++A ASK+
Sbjct  382   SKITAHASKL  391



>gb|EMT18732.1| Hydroxymethylglutaryl-CoA lyase, mitochondrial [Aegilops tauschii]
Length=508

 Score =   471 bits (1212),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 260/393 (66%), Positives = 309/393 (79%), Gaps = 10/393 (3%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCDEDFDEYGR  1459
             EEPL L  LP+LS I+R+ GRF  +ACR   DD        G    S++  ++       
Sbjct  126   EEPLGLGDLPKLS-INRL-GRFCQSACRSTADDRS-----TGNYTPSNSGNNQTLFHSTS  178

Query  1458  GSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTS  1279
              S+  + Q+ D   NGV     F    + V ++ +P++VK+VEVGPRDGLQNEKN VPTS
Sbjct  179   HSWHLQGQYTDSSCNGVD--MEFRTLPQKVSWD-LPRFVKVVEVGPRDGLQNEKNIVPTS  235

Query  1278  VKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFE  1099
             VK+ELI KLV+ GL VVE T FVSP+WVPQL+DAKDV++ +++    R PVLTPNL+GFE
Sbjct  236   VKIELIHKLVASGLSVVEATSFVSPRWVPQLADAKDVLEGIQHAPNVRFPVLTPNLRGFE  295

Query  1098  AAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGC  919
             AA+A+GAKEVAVFASASESFSK+NINC+IEESL RYR VTSAAKK  I +RGY+SCVVGC
Sbjct  296   AAVAAGAKEVAVFASASESFSKSNINCTIEESLARYRDVTSAAKKHGIRIRGYVSCVVGC  355

Query  918   PVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHF  739
             PVEGA+ PSKVAY+AKEL++MGC EISLGDTIGV TPG V+PMLEAVMAVVP +KLAVHF
Sbjct  356   PVEGAVHPSKVAYVAKELYDMGCVEISLGDTIGVGTPGRVVPMLEAVMAVVPADKLAVHF  415

Query  738   HDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNV  559
             HDTYGQ+L NILVSLQMG+  VDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLG++TNV
Sbjct  416   HDTYGQALANILVSLQMGIGVVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGIETNV  475

Query  558   DLGKLLQAGEFISKHLGRESSSKAAIALTRVSA  460
             DLGKL+ AG++I KHL R S SK A AL R++A
Sbjct  476   DLGKLMDAGDYICKHLDRPSGSKTATALCRLTA  508



>ref|XP_010653624.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X2 [Vitis vinifera]
 ref|XP_010653625.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X2 [Vitis vinifera]
 ref|XP_010653626.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X2 [Vitis vinifera]
 ref|XP_010653627.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X2 [Vitis vinifera]
Length=359

 Score =   466 bits (1198),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 244/330 (74%), Positives = 281/330 (85%), Gaps = 3/330 (1%)
 Frame = -3

Query  1434  FRDRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRK  1255
               DRPY+   N         N L   +P +VKIVEVGPRDGLQNEK+ VPT VKVELI+ 
Sbjct  33    LTDRPYSSHCNDECTRD---NKLLRSMPGFVKIVEVGPRDGLQNEKDIVPTVVKVELIKM  89

Query  1254  LVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGak  1075
             LVS GLP+VE T FVSPKWVPQL+DAKDVM+A++ +EG R PVLTPNLKGFEAA+A+GAK
Sbjct  90    LVSSGLPIVEATSFVSPKWVPQLADAKDVMEAIRTVEGGRFPVLTPNLKGFEAAVAAGAK  149

Query  1074  evavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILP  895
             EVA+FASASESFSK+NINCSIE+SL RYR V  AA+KLSIPVRGYISCVVGCP+EG + P
Sbjct  150   EVAIFASASESFSKSNINCSIEDSLTRYRDVALAARKLSIPVRGYISCVVGCPLEGVVSP  209

Query  894   SKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSL  715
             SKV Y+ KEL++MGC+EISLGDTIGV TPGTVIPMLE V+ VVP++KLAVHFHDTYGQ+L
Sbjct  210   SKVTYVGKELYDMGCYEISLGDTIGVGTPGTVIPMLEDVIDVVPIDKLAVHFHDTYGQAL  269

Query  714   PNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQA  535
              NIL SLQMG+ TVDSSVSGLGGCPYAKGA+GNVATEDVVYML+GLGVKTNVDLGKL+ A
Sbjct  270   SNILASLQMGITTVDSSVSGLGGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLGKLMLA  329

Query  534   GEFISKHLGRESSSKAAIALTRVSADASKI  445
             G+FI +HLGR+S SK AIAL+R+   ASK+
Sbjct  330   GDFICQHLGRQSGSKTAIALSRIRGHASKL  359



>ref|XP_011040754.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Populus euphratica]
Length=418

 Score =   467 bits (1202),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 242/310 (78%), Positives = 276/310 (89%), Gaps = 0/310 (0%)
 Frame = -3

Query  1374  NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
             N LF+ +P YVKIVEVGPRDGLQNEK+ VPT++KVELI+ L S GLPVVE T FVSPKWV
Sbjct  109   NKLFSSIPGYVKIVEVGPRDGLQNEKDIVPTAIKVELIKMLASSGLPVVEATSFVSPKWV  168

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDVM+A+++ +GAR PVLTPNLKGFEAAIA+GAKEVAVFASASE FSK+NINCS
Sbjct  169   PQLADAKDVMEAIRDFKGARFPVLTPNLKGFEAAIAAGAKEVAVFASASEGFSKSNINCS  228

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             IE+SLVRY  V  +A KLSIPVRGYISCVVGCPVEG + PSKVAY+AK+L +MGC+EISL
Sbjct  229   IEDSLVRYHEVALSASKLSIPVRGYISCVVGCPVEGMVSPSKVAYVAKKLCDMGCYEISL  288

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGV TPGTVIPMLEAV+ VVP+EKLAVHFHDTYGQ+L NIL SLQMG+ TVDSSVSG
Sbjct  289   GDTIGVGTPGTVIPMLEAVIDVVPIEKLAVHFHDTYGQALSNILASLQMGISTVDSSVSG  348

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYML+GLGVKTNVDL K++ AG FI KHLG  S SK AIAL
Sbjct  349   LGGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLQKIMLAGNFIRKHLGHSSGSKTAIAL  408

Query  474   TRVSADASKI  445
             ++++A ASK+
Sbjct  409   SKITAHASKL  418



>gb|KDP37694.1| hypothetical protein JCGZ_06351 [Jatropha curcas]
Length=417

 Score =   466 bits (1200),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 248/336 (74%), Positives = 284/336 (85%), Gaps = 3/336 (1%)
 Frame = -3

Query  1452  YGWKRQFRDRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVK  1273
             + W      R YN   N +  S  + N L   +P+YVKIVEVGPRDGLQNEK  VPT+VK
Sbjct  85    HDW--HLSKRYYNSNPNDK-HSREFANKLLKSIPEYVKIVEVGPRDGLQNEKEIVPTAVK  141

Query  1272  VELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAA  1093
             VELIR LVS GLPVVE T FVSPKWVPQL+DAKDVM AV+N EGARLPVLTPNLKGFEAA
Sbjct  142   VELIRMLVSSGLPVVEATSFVSPKWVPQLADAKDVMAAVRNFEGARLPVLTPNLKGFEAA  201

Query  1092  IASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPV  913
             +A+GAKEVA+FASASESFSK+NINC+IE+SLVRY  V+ AA KLSIPVRGYISCVVGCPV
Sbjct  202   VAAGAKEVAIFASASESFSKSNINCTIEDSLVRYNDVSLAANKLSIPVRGYISCVVGCPV  261

Query  912   EGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHD  733
             EG + PS VAY+AK L+EMGC EISLGDTIGV TPGTVIPMLEAV+ VVP++KLAVHFHD
Sbjct  262   EGMVSPSNVAYVAKRLYEMGCSEISLGDTIGVGTPGTVIPMLEAVLDVVPIDKLAVHFHD  321

Query  732   TYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDL  553
             TYGQ+L NIL SLQMG+ TVDSSVSGLGGCPYAKGA+GNVATEDV+YML+GLGV+TNVDL
Sbjct  322   TYGQALSNILASLQMGINTVDSSVSGLGGCPYAKGASGNVATEDVIYMLNGLGVETNVDL  381

Query  552   GKLLQAGEFISKHLGRESSSKAAIALTRVSADASKI  445
              +++ AG +I KHLGR S SK A AL++++A ASK+
Sbjct  382   QQVMLAGNYICKHLGRSSGSKTATALSKITAHASKL  417



>ref|XP_004229450.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Solanum lycopersicum]
Length=420

 Score =   465 bits (1197),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 248/326 (76%), Positives = 280/326 (86%), Gaps = 4/326 (1%)
 Frame = -3

Query  1410  VSNRRSFSGGW----RNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSC  1243
             +SNR   S G     ++     VP+ VKIVEVGPRDGLQNEK  +PT VKVELIR LVS 
Sbjct  95    LSNRYYRSHGHLKDIKDKFLGSVPEVVKIVEVGPRDGLQNEKTIIPTEVKVELIRLLVSS  154

Query  1242  GLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevav  1063
             GLPVVE T FVSPKWVPQL+D KDV++AV+NL G RLPVLTPNLKGF+AA+A+GAKEVA+
Sbjct  155   GLPVVEATSFVSPKWVPQLADGKDVIEAVRNLTGVRLPVLTPNLKGFDAAVAAGAKEVAI  214

Query  1062  fasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVA  883
             FA+ASESFS++NINCSIE+SL RYR V  AAK  SIPVRGYISCVVGCP+EGA+ PSKVA
Sbjct  215   FAAASESFSRSNINCSIEDSLSRYRDVALAAKNHSIPVRGYISCVVGCPIEGAVSPSKVA  274

Query  882   YLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNIL  703
             Y+AKEL +MGCFEISLGDTIGV TPGTVIPML+AV  VVPVE+LAVHFHDTYGQ+L NIL
Sbjct  275   YVAKELVDMGCFEISLGDTIGVGTPGTVIPMLDAVTQVVPVERLAVHFHDTYGQALSNIL  334

Query  702   VSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFI  523
             VSLQMG+  VDSSVSGLGGCPYAKGA+GNVATEDV+YML+GLGVKTNVDL KLL AG+FI
Sbjct  335   VSLQMGISIVDSSVSGLGGCPYAKGASGNVATEDVIYMLNGLGVKTNVDLRKLLLAGDFI  394

Query  522   SKHLGRESSSKAAIALTRVSADASKI  445
              KHLGR S SKAAIAL+R +A ASK+
Sbjct  395   CKHLGRPSGSKAAIALSRTTATASKL  420



>ref|XP_002517305.1| hydroxymethylglutaryl-CoA lyase, putative [Ricinus communis]
 gb|EEF45098.1| hydroxymethylglutaryl-CoA lyase, putative [Ricinus communis]
Length=377

 Score =   463 bits (1191),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 252/362 (70%), Positives = 292/362 (81%), Gaps = 6/362 (2%)
 Frame = -3

Query  1515  GRNCSSSNSCDEDFDEYGRGSYGWKRQFR-----DRPYNGVSNRRSFSGGWRNVLFNGVP  1351
             GRN S  +  +     +G  S      F      +R Y   SN +S  G + + L   VP
Sbjct  17    GRNVSQDDIFNRTRASFGSNSMNIDNVFHSWHLSNRHYTSHSNDKSV-GDFVDKLLRYVP  75

Query  1350  KYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKD  1171
             +YVKIVEVGPRDGLQNEK+ VPT++KVELI+ LVS GLPVVE T FVSPKWVPQL+DAKD
Sbjct  76    EYVKIVEVGPRDGLQNEKDVVPTAIKVELIKMLVSSGLPVVEATSFVSPKWVPQLADAKD  135

Query  1170  VMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVRY  991
             VM A++++EGAR PVLTPNLKGFEAA+A+GAKEVAVFASASESFSK+NINCSIE+SLVRY
Sbjct  136   VMAAIRDVEGARFPVLTPNLKGFEAAVAAGAKEVAVFASASESFSKSNINCSIEDSLVRY  195

Query  990   RAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVAT  811
               V  AA KLSIP+RGYISCVVGCP+EG I PSKVAY+AK L +MGC EISLGDTIGV T
Sbjct  196   SDVALAASKLSIPMRGYISCVVGCPIEGMISPSKVAYVAKRLCDMGCSEISLGDTIGVGT  255

Query  810   PGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAK  631
             PGTVI MLEAVM VV ++KLAVHFHDTYGQ+L NIL SLQ+G+ TVDSSVSGLGGCPYA 
Sbjct  256   PGTVITMLEAVMEVVAIDKLAVHFHDTYGQALSNILASLQIGIKTVDSSVSGLGGCPYAI  315

Query  630   GATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSADAS  451
             GA+GNVATEDVVYML+GLGVKTNVDL K++ AG FI KHLGR + SK AIAL++++A AS
Sbjct  316   GASGNVATEDVVYMLNGLGVKTNVDLQKVMLAGNFICKHLGRTTGSKTAIALSKITAHAS  375

Query  450   KI  445
             K+
Sbjct  376   KL  377



>gb|ABA95738.2| Hydroxymethylglutaryl-CoA lyase, mitochondrial precursor, putative, 
expressed [Oryza sativa Japonica Group]
 gb|EAY82185.1| hypothetical protein OsI_37387 [Oryza sativa Indica Group]
 gb|EAZ17365.1| hypothetical protein OsJ_32888 [Oryza sativa Japonica Group]
Length=387

 Score =   463 bits (1192),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 254/394 (64%), Positives = 312/394 (79%), Gaps = 14/394 (4%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCDEDFDEYGR  1459
             EEPL L  LP+LS I+R++ RFS +ACR   DD     +   RN  ++ +       +  
Sbjct  5     EEPLGLGDLPKLS-INRLE-RFSPSACRASVDDSNTNNY-KHRNGGNNQTI------FHS  55

Query  1458  GSYGW--KRQFRDRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVP  1285
              ++ W  + Q+ D   NGV     F    R VL++ +P++VKIVEVGPRDGLQNEKN VP
Sbjct  56    SAHSWHMQGQYTDSSCNGVD--MEFRALPRKVLWD-LPRFVKIVEVGPRDGLQNEKNTVP  112

Query  1284  TSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKG  1105
             TSVK+ELI KLV+ GL VVE T FVSPKWVPQL+DAKDV++ +K++   R PVLTPNL+G
Sbjct  113   TSVKIELIHKLVASGLSVVEATSFVSPKWVPQLADAKDVVEGIKHVPDVRFPVLTPNLRG  172

Query  1104  FEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVV  925
             FEAA+A+GAKEVAVFASASESFSK+N+NC+I+ESLVRY  V ++AKK  I +RGY+SCVV
Sbjct  173   FEAAVAAGAKEVAVFASASESFSKSNLNCTIKESLVRYHDVVTSAKKHGIRIRGYVSCVV  232

Query  924   GCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAV  745
             GCPVEG I PSKVAY+AKEL++MGC EISLGDTIGV TPG+V+ MLEAVM+ VPV+K+AV
Sbjct  233   GCPVEGTIHPSKVAYVAKELYDMGCSEISLGDTIGVGTPGSVLAMLEAVMSFVPVDKIAV  292

Query  744   HFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKT  565
             HFHDTYGQ+L NILVSLQ+G+  VDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLG++T
Sbjct  293   HFHDTYGQALANILVSLQLGINIVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGIET  352

Query  564   NVDLGKLLQAGEFISKHLGRESSSKAAIALTRVS  463
             NVDL KL+ AG++ISKHLGR+S SK   AL +++
Sbjct  353   NVDLNKLMDAGDYISKHLGRQSGSKTTTALRKLT  386



>ref|XP_010653628.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X3 [Vitis vinifera]
Length=304

 Score =   460 bits (1183),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 237/304 (78%), Positives = 273/304 (90%), Gaps = 0/304 (0%)
 Frame = -3

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             +P +VKIVEVGPRDGLQNEK+ VPT VKVELI+ LVS GLP+VE T FVSPKWVPQL+DA
Sbjct  1     MPGFVKIVEVGPRDGLQNEKDIVPTVVKVELIKMLVSSGLPIVEATSFVSPKWVPQLADA  60

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
             KDVM+A++ +EG R PVLTPNLKGFEAA+A+GAKEVA+FASASESFSK+NINCSIE+SL 
Sbjct  61    KDVMEAIRTVEGGRFPVLTPNLKGFEAAVAAGAKEVAIFASASESFSKSNINCSIEDSLT  120

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             RYR V  AA+KLSIPVRGYISCVVGCP+EG + PSKV Y+ KEL++MGC+EISLGDTIGV
Sbjct  121   RYRDVALAARKLSIPVRGYISCVVGCPLEGVVSPSKVTYVGKELYDMGCYEISLGDTIGV  180

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
              TPGTVIPMLE V+ VVP++KLAVHFHDTYGQ+L NIL SLQMG+ TVDSSVSGLGGCPY
Sbjct  181   GTPGTVIPMLEDVIDVVPIDKLAVHFHDTYGQALSNILASLQMGITTVDSSVSGLGGCPY  240

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSAD  457
             AKGA+GNVATEDVVYML+GLGVKTNVDLGKL+ AG+FI +HLGR+S SK AIAL+R+   
Sbjct  241   AKGASGNVATEDVVYMLNGLGVKTNVDLGKLMLAGDFICQHLGRQSGSKTAIALSRIRGH  300

Query  456   ASKI  445
             ASK+
Sbjct  301   ASKL  304



>gb|ABA91354.1| Hydroxymethylglutaryl-CoA lyase, mitochondrial precursor, putative, 
expressed [Oryza sativa Japonica Group]
 gb|EAY79856.1| hypothetical protein OsI_35017 [Oryza sativa Indica Group]
 gb|EAZ17357.1| hypothetical protein OsJ_32880 [Oryza sativa Japonica Group]
Length=387

 Score =   462 bits (1190),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 254/396 (64%), Positives = 312/396 (79%), Gaps = 18/396 (5%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCDEDFDE--Y  1465
             EEPL L  LP+LS I+R++ RFS NACR   DD         R+ S+    +   ++  +
Sbjct  5     EEPLGLGDLPKLS-INRLE-RFSPNACRASADD---------RSTSNYKHHNGGNNQTIF  53

Query  1464  GRGSYGW--KRQFRDRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNN  1291
                S+ W  + Q+ D   NGV     F    R VL+  +P++VKIVEVGPRDGLQNEK+ 
Sbjct  54    HSSSHSWHMQGQYTDSSCNGVD--MEFRALPRKVLWE-LPRFVKIVEVGPRDGLQNEKST  110

Query  1290  VPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNL  1111
             VP SVK+ELI KLV+ GL VVE T FVSPKWVPQL+DAKDV+Q ++++   R PVLTPNL
Sbjct  111   VPASVKIELIHKLVASGLSVVEATSFVSPKWVPQLADAKDVLQGIRHVPDVRFPVLTPNL  170

Query  1110  KGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISC  931
             +GFEAA+A+GAKEVAVFASASESFSK+N+NC+I+ESLVRYR V ++AKK  + +RGY+SC
Sbjct  171   RGFEAALAAGAKEVAVFASASESFSKSNLNCTIKESLVRYRDVVTSAKKHGMRIRGYVSC  230

Query  930   VVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKL  751
             VVGCPVEG I PSKVAY+AKEL++MGC EISLGDTIGV TPG+++ MLEAVM+ VPV+KL
Sbjct  231   VVGCPVEGTIHPSKVAYVAKELYDMGCSEISLGDTIGVGTPGSILAMLEAVMSFVPVDKL  290

Query  750   AVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGV  571
             AVHFHDTYGQ+L NILVSLQ+G+  VDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLG+
Sbjct  291   AVHFHDTYGQALANILVSLQLGINIVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGI  350

Query  570   KTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVS  463
             +TNVDL KL+ AG++ISKHLGR+S SK   AL +++
Sbjct  351   ETNVDLNKLMDAGDYISKHLGRQSGSKTTTALRKLT  386



>ref|XP_009763934.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Nicotiana sylvestris]
Length=351

 Score =   461 bits (1186),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 245/304 (81%), Positives = 273/304 (90%), Gaps = 1/304 (0%)
 Frame = -3

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             VP+ VKIVEVGPRDGLQNEK  VPT VKVELI+ LVS GLPVVE T FVSPKWVPQL+DA
Sbjct  49    VPEVVKIVEVGPRDGLQNEKTIVPTEVKVELIKLLVSSGLPVVEATSFVSPKWVPQLADA  108

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
             KDV++AVK+L G RLPVLTPNLKGFEAA+A+GAKEVA+FA+ASESFS++NINCSIE+SL 
Sbjct  109   KDVIEAVKSLTGVRLPVLTPNLKGFEAAVAAGAKEVAIFAAASESFSRSNINCSIEDSLA  168

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             RYR V  AAK  SIP+RGYISCVVGCPVEGA+ PSKVAY+AKEL +MGCFEISLGDTIGV
Sbjct  169   RYRDVALAAKNHSIPIRGYISCVVGCPVEGAVSPSKVAYVAKELVDMGCFEISLGDTIGV  228

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
              TPGTVIPML+AV  VVPVE+LAVHFHDTYGQ+L NI+VSLQMG+ TVDSSVSGLGGCPY
Sbjct  229   GTPGTVIPMLDAVTQVVPVERLAVHFHDTYGQALSNIIVSLQMGISTVDSSVSGLGGCPY  288

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSAD  457
             AKGA+GNVATEDVVYML+GLGVKTNVD+ KLL AG+FI KHLGR S SKAAIAL+R S  
Sbjct  289   AKGASGNVATEDVVYMLNGLGVKTNVDMRKLLSAGDFICKHLGRPSGSKAAIALSRTST-  347

Query  456   ASKI  445
             ASK+
Sbjct  348   ASKL  351



>ref|XP_008240671.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Prunus mume]
Length=370

 Score =   461 bits (1187),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 240/329 (73%), Positives = 281/329 (85%), Gaps = 8/329 (2%)
 Frame = -3

Query  1407  SNRRSFSGGWRNV--------LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKL  1252
             S+ R  S  W           L   +P++VKIVEVGPRDGLQNEK+ VPT+VKV+LI  L
Sbjct  42    SSIRRLSSNWNQSSTKEPISNLLKNIPEFVKIVEVGPRDGLQNEKHIVPTAVKVKLIEML  101

Query  1251  VSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGake  1072
             V+ GL VVE T FVSPKWVPQL+DAKDVM+A++N+EG R PVLTPNLKGFEAA+A+GAKE
Sbjct  102   VASGLDVVEATSFVSPKWVPQLADAKDVMKAIRNVEGVRFPVLTPNLKGFEAAVAAGAKE  161

Query  1071  vavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPS  892
             VA+FA+ASESFSK+NINCSIE+SL+RY  V +AA KLSIPVRGYISCVVGCPVEG +LPS
Sbjct  162   VAIFAAASESFSKSNINCSIEDSLIRYHDVATAATKLSIPVRGYISCVVGCPVEGTVLPS  221

Query  891   KVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLP  712
             +VAY+AK+L++MGC EISLGDTIGV TPGTVIPMLEAV  VVP +KLAVH+HDTYGQ+L 
Sbjct  222   QVAYVAKKLYDMGCSEISLGDTIGVGTPGTVIPMLEAVTDVVPTDKLAVHYHDTYGQALS  281

Query  711   NILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAG  532
             NIL SLQMG+ TVDSSVSGLGGCPYAKGA+GNVATEDVVYML+GLGVKTNVDL KL+ AG
Sbjct  282   NILASLQMGISTVDSSVSGLGGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLKKLMLAG  341

Query  531   EFISKHLGRESSSKAAIALTRVSADASKI  445
             +FI KHLGR S SK A+A+++V+A ASK+
Sbjct  342   DFICKHLGRSSGSKTAVAMSKVTAHASKL  370



>ref|XP_010673052.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=445

 Score =   464 bits (1193),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 239/312 (77%), Positives = 278/312 (89%), Gaps = 0/312 (0%)
 Frame = -3

Query  1380  WRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPK  1201
             ++N L   +PKYVKIVEVGPRDGLQNEKN VPT VK+ELI+ L S GLPVVE T FVSPK
Sbjct  134   YKNKLLERIPKYVKIVEVGPRDGLQNEKNIVPTDVKIELIKMLASSGLPVVEATSFVSPK  193

Query  1200  WVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANIN  1021
             WVPQL+DAK V+QAV+N++G+R PVLTPNLKG EAA+A+GAKEVAVFASASESFSK+NIN
Sbjct  194   WVPQLADAKFVIQAVQNVQGSRFPVLTPNLKGLEAAVAAGAKEVAVFASASESFSKSNIN  253

Query  1020  CSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEI  841
             C++EESL +YR V SAA+KLS+PVRGYISCVVGCP+EGA+ PS+VAY+AKEL  +GC+EI
Sbjct  254   CTVEESLAQYRDVASAAEKLSLPVRGYISCVVGCPIEGAVSPSQVAYVAKELSNIGCYEI  313

Query  840   SLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSV  661
             SLGDTIG+ TPGTVIPMLEAV+ VVPVEKLAVHFHDTYGQ+L NIL+SLQMG+ TVDSS+
Sbjct  314   SLGDTIGIGTPGTVIPMLEAVIDVVPVEKLAVHFHDTYGQALSNILLSLQMGISTVDSSI  373

Query  660   SGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAI  481
             +GLGGCPYAKGATGNVATEDVVYML+GLGV+TNVDL KLL AG+FISKHL R S SKAA 
Sbjct  374   AGLGGCPYAKGATGNVATEDVVYMLNGLGVETNVDLQKLLLAGDFISKHLSRASGSKAAT  433

Query  480   ALTRVSADASKI  445
             AL++    +SK+
Sbjct  434   ALSKTLIHSSKL  445



>ref|XP_009763933.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Nicotiana sylvestris]
Length=404

 Score =   462 bits (1189),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 245/304 (81%), Positives = 273/304 (90%), Gaps = 1/304 (0%)
 Frame = -3

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             VP+ VKIVEVGPRDGLQNEK  VPT VKVELI+ LVS GLPVVE T FVSPKWVPQL+DA
Sbjct  102   VPEVVKIVEVGPRDGLQNEKTIVPTEVKVELIKLLVSSGLPVVEATSFVSPKWVPQLADA  161

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
             KDV++AVK+L G RLPVLTPNLKGFEAA+A+GAKEVA+FA+ASESFS++NINCSIE+SL 
Sbjct  162   KDVIEAVKSLTGVRLPVLTPNLKGFEAAVAAGAKEVAIFAAASESFSRSNINCSIEDSLA  221

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             RYR V  AAK  SIP+RGYISCVVGCPVEGA+ PSKVAY+AKEL +MGCFEISLGDTIGV
Sbjct  222   RYRDVALAAKNHSIPIRGYISCVVGCPVEGAVSPSKVAYVAKELVDMGCFEISLGDTIGV  281

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
              TPGTVIPML+AV  VVPVE+LAVHFHDTYGQ+L NI+VSLQMG+ TVDSSVSGLGGCPY
Sbjct  282   GTPGTVIPMLDAVTQVVPVERLAVHFHDTYGQALSNIIVSLQMGISTVDSSVSGLGGCPY  341

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSAD  457
             AKGA+GNVATEDVVYML+GLGVKTNVD+ KLL AG+FI KHLGR S SKAAIAL+R S  
Sbjct  342   AKGASGNVATEDVVYMLNGLGVKTNVDMRKLLSAGDFICKHLGRPSGSKAAIALSRTST-  400

Query  456   ASKI  445
             ASK+
Sbjct  401   ASKL  404



>ref|XP_006339410.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Solanum tuberosum]
Length=420

 Score =   462 bits (1189),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 246/326 (75%), Positives = 279/326 (86%), Gaps = 4/326 (1%)
 Frame = -3

Query  1410  VSNRRSFSGGW----RNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSC  1243
             +SNR   S G     ++     VP+ VKIVEVGPRDGLQNEK  +PT VKVELI+ LVS 
Sbjct  95    LSNRYYRSHGHLEDIKDKFLGSVPEVVKIVEVGPRDGLQNEKTIIPTEVKVELIKLLVSS  154

Query  1242  GLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevav  1063
             GLPVVE T FVSPKWVPQL+D KDV++AV+NL G RLPVLTPNLKGFEAA+A+GAKEVA+
Sbjct  155   GLPVVEATSFVSPKWVPQLADGKDVIEAVRNLTGVRLPVLTPNLKGFEAAVAAGAKEVAI  214

Query  1062  fasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVA  883
             FA+ASESFS++NINCSIE+SL RYR V  AAK  SIPVRGY+SCVVGCP+EGA+ PSKVA
Sbjct  215   FAAASESFSRSNINCSIEDSLSRYRDVALAAKSHSIPVRGYVSCVVGCPIEGAVSPSKVA  274

Query  882   YLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNIL  703
              +AKEL +MGCFEISLGDTIGV TPGTVIPML+AV  VVPVE+LAVHFHDTYGQ+L NIL
Sbjct  275   QVAKELVDMGCFEISLGDTIGVGTPGTVIPMLDAVTQVVPVERLAVHFHDTYGQALSNIL  334

Query  702   VSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFI  523
             VSLQMG+  VDSSVSGLGGCPYAKGA+GNVATEDV+YML+GLGVKTNVDL KLL AG+FI
Sbjct  335   VSLQMGISIVDSSVSGLGGCPYAKGASGNVATEDVIYMLNGLGVKTNVDLRKLLLAGDFI  394

Query  522   SKHLGRESSSKAAIALTRVSADASKI  445
              KHLGR S SKAAIAL+R +A ASK+
Sbjct  395   CKHLGRPSGSKAAIALSRTTATASKL  420



>emb|CBX24399.1| hypothetical_protein [Oryza glaberrima]
Length=411

 Score =   461 bits (1186),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 256/409 (63%), Positives = 317/409 (78%), Gaps = 20/409 (5%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWID---GRNCSSSNSCDEDFDE  1468
             EEPL L  LP+LS I+R++ RFS +ACR   DD     +     G N +  +S    +  
Sbjct  5     EEPLGLGDLPKLS-INRLE-RFSPSACRASVDDSNTNNYKHRNGGNNQTIFHSSAHSWHM  62

Query  1467  YGRGS----YGWKRQFRDRP----YNGVSNRRS------FSGGWRNVLFNGVPKYVKIVE  1330
              G+ +     G   +FR  P    +   SNRR+       +   ++VL++ +P++VKIVE
Sbjct  63    QGQYTDSSCNGVDMEFRALPRKRFHQTASNRRNELTCSIMTVAMQHVLWD-LPRFVKIVE  121

Query  1329  VGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKN  1150
             VGPRDGLQNEKN VPTSVK+ELI KLV+ GL VVE T FVSPKWVPQL+DAKDV++ +K+
Sbjct  122   VGPRDGLQNEKNTVPTSVKIELIHKLVASGLSVVEATSFVSPKWVPQLADAKDVVEGIKH  181

Query  1149  LEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAA  970
             +   R PVLTPNL+GFEAA+A+GAKEVAVFASASESFSK+N+NC+I+ESLVRY  V ++A
Sbjct  182   VPDVRFPVLTPNLRGFEAAVAAGAKEVAVFASASESFSKSNLNCTIKESLVRYHDVVTSA  241

Query  969   KKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPM  790
             KK  I +RGY+SCVVGCPVEG I PSKVAY+AKEL++MGC EISLGDTIGV TPG+V+ M
Sbjct  242   KKHGIRIRGYVSCVVGCPVEGTIHPSKVAYVAKELYDMGCSEISLGDTIGVGTPGSVLAM  301

Query  789   LEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVA  610
             LEAVM+ VPV+K+AVHFHDTYGQ+L NILVSLQ+G+  VDSSVSGLGGCPYAKGATGNVA
Sbjct  302   LEAVMSFVPVDKIAVHFHDTYGQALANILVSLQLGINIVDSSVSGLGGCPYAKGATGNVA  361

Query  609   TEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVS  463
             TEDVVYMLHGLG++TNVDL KL+ AG++ISKHLGR+S SK   AL +++
Sbjct  362   TEDVVYMLHGLGIETNVDLNKLMDAGDYISKHLGRQSGSKTTTALRKLT  410



>ref|XP_006663802.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Oryza brachyantha]
Length=386

 Score =   460 bits (1183),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 255/397 (64%), Positives = 312/397 (79%), Gaps = 21/397 (5%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSN--SCDEDFDE-  1468
             E+PL L  LP+LS I+R++ RFS +ACR   DD           CS SN   C+   D+ 
Sbjct  5     EQPLGLGDLPKLS-INRLE-RFSPSACRASADD-----------CSPSNYKHCNGGNDQT  51

Query  1467  --YGRGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKN  1294
               +G  S+  +  + +   NGV     F    R VL++ +P++VKIVEVGPRDGLQNEKN
Sbjct  52    IFHGSSSWHMQGHYTNSSCNGVD--MEFRALPRKVLWD-LPRFVKIVEVGPRDGLQNEKN  108

Query  1293  NVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPN  1114
              VPTSVK+ELI KLV+ GL V+E T FVSPKWVPQL+DAKDV++ ++++   R PVLTPN
Sbjct  109   TVPTSVKIELIHKLVASGLSVIEATSFVSPKWVPQLADAKDVVEGIRHVPDVRFPVLTPN  168

Query  1113  LKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYIS  934
             L+GFEAA+A+GAKEVAVFASASESFSK+N+NC+I+ESLVRYR V ++AKK  I +RGY+S
Sbjct  169   LRGFEAAVAAGAKEVAVFASASESFSKSNLNCTIKESLVRYRDVITSAKKHGIGLRGYVS  228

Query  933   CVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEK  754
             CVVGCPVEGAI PSKVAY+AKEL++MGC EISLGDTIGV TPG+V+ MLEAVM+ V V+K
Sbjct  229   CVVGCPVEGAIHPSKVAYVAKELYDMGCSEISLGDTIGVGTPGSVLAMLEAVMSFVSVDK  288

Query  753   LAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLG  574
             LAVHFHDTYGQ+L NI+VSLQMG+  VDSSVSGLGGCPYA GATGNVATEDVVYMLHGLG
Sbjct  289   LAVHFHDTYGQALANIMVSLQMGINIVDSSVSGLGGCPYANGATGNVATEDVVYMLHGLG  348

Query  573   VKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVS  463
             ++TNVDL KL+ AG++ISKHLGR S SK   AL +++
Sbjct  349   IETNVDLNKLMDAGDYISKHLGRPSGSKTTTALRKLT  385



>ref|XP_011075457.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Sesamum indicum]
Length=412

 Score =   461 bits (1185),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 261/419 (62%), Positives = 314/419 (75%), Gaps = 39/419 (9%)
 Frame = -3

Query  1623  LDRLPRLSNI------------DRMDGRFSSNACRPVGDDGMGERWI---DGRNCSSSNS  1489
             ++RL RL ++            D M+G+  SN     G+D    + +   +G+  S  NS
Sbjct  7     VNRLSRLGSLEPGKYFLVSSLCDEMEGKVISNG----GEDHRVSKHVIKGNGKEASLLNS  62

Query  1488  CDEDFDEYGRGSYGWKRQFRDRP-----------YNGVSNRRSFSGGWRNVLFNGVPKYV  1342
                   E  R S+ +   F   P           Y   S++ + +   ++ L   +PK+V
Sbjct  63    ------ETKRSSFSF--LFNQEPQLVGTGTSRALYRHYSSQHNIAD-VKHKLLGSIPKFV  113

Query  1341  KIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQ  1162
             KIVEVGPRDGLQNEK  VPTSVKVELI+ LV+ GLPVVE T FVSPKWVPQL+DAKDVM 
Sbjct  114   KIVEVGPRDGLQNEKEIVPTSVKVELIKMLVASGLPVVEATSFVSPKWVPQLADAKDVMS  173

Query  1161  AVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAV  982
             A++ +E +R PVLTPN+KGFEAA+A+GAKEVAVFA+ASESFSK+NINCSIE+SL RYR V
Sbjct  174   AIQGIEHSRFPVLTPNIKGFEAAMAAGAKEVAVFAAASESFSKSNINCSIEDSLARYRDV  233

Query  981   TSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGT  802
               AA+  +IPVRGYISCVVGCPVEGA+ PSKVAY+A+EL+ MGC EISLGDTIGV TPGT
Sbjct  234   ALAAQNHAIPVRGYISCVVGCPVEGAVPPSKVAYVAEELYRMGCAEISLGDTIGVGTPGT  293

Query  801   VIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGAT  622
             VIPML+AV+ VVPVEKLAVHFHDTYGQ+L NIL+SLQMG+  VDSS+SGLGGCPYAKGA+
Sbjct  294   VIPMLQAVLEVVPVEKLAVHFHDTYGQALSNILLSLQMGISVVDSSISGLGGCPYAKGAS  353

Query  621   GNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSADASKI  445
             GNVATEDVVYML+GLGV TNVDLGKL+ AG++I KHL R S SKAAIAL+R  ADASK+
Sbjct  354   GNVATEDVVYMLNGLGVNTNVDLGKLIFAGDYICKHLARPSGSKAAIALSRTFADASKL  412



>gb|ABR16866.1| unknown [Picea sitchensis]
Length=463

 Score =   462 bits (1188),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 264/431 (61%), Positives = 316/431 (73%), Gaps = 37/431 (9%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDG-RNCSSSNSCDEDFDEYG  1462
             EEP+  D   +L+   R+  R SS+  R   D+    + + G R CS S     D +EY 
Sbjct  37    EEPVRFDSFSKLNGTGRLS-RLSSDDSRKRFDERNSAQDLAGERECSCS---PMDVEEYV  92

Query  1461  RGSYGWKRQFRDR---------PYNGVSNRRSFSGGWRNV--------------------  1369
              GS  W+++  DR         P +   + R    G R +                    
Sbjct  93    VGSVSWRKEVHDRNGIGSSCMRPLSCCRSYRLLPSGKREIWTLPERHYSSLREETEIRQL  152

Query  1368  ---LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
                L  G P +VK+VEVGPRDGLQNEKN VPT+VK+ELI++L + GL VVE T FVSPKW
Sbjct  153   TQKLLRGTPMFVKLVEVGPRDGLQNEKNTVPTNVKIELIKRLAASGLQVVEATSFVSPKW  212

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQL+DAKDVM  +K++ G RLPVLTPNLKGF AAI +GAKEVAVFASASESFSK+NINC
Sbjct  213   VPQLADAKDVMDGIKSVAGTRLPVLTPNLKGFHAAIDAGAKEVAVFASASESFSKSNINC  272

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             +IEESL RY+ + +AAK+L +PVRGY+SCVVGCPVEG I PS VAY+AKEL++MGC+EIS
Sbjct  273   TIEESLCRYKDILNAAKRLCVPVRGYVSCVVGCPVEGPISPSSVAYVAKELYDMGCYEIS  332

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIGV TPGTV+PML+AVM+VVPVEKLAVHFHDTYGQSL NILVSLQMG+  +DSS+S
Sbjct  333   LGDTIGVGTPGTVVPMLDAVMSVVPVEKLAVHFHDTYGQSLANILVSLQMGISIIDSSIS  392

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYAKGATGNVATEDVVY+L+GLGVKTNVDLGKLL A +FI KHLGR+S SKA IA
Sbjct  393   GLGGCPYAKGATGNVATEDVVYLLNGLGVKTNVDLGKLLSAADFICKHLGRQSGSKAGIA  452

Query  477   LTRVSADASKI  445
             L+R + D SK+
Sbjct  453   LSRGTRDHSKM  463



>gb|EPS65155.1| hypothetical protein M569_09626 [Genlisea aurea]
Length=410

 Score =   459 bits (1182),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 265/414 (64%), Positives = 312/414 (75%), Gaps = 29/414 (7%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNAC-RPV--GDD-GMGERWIDGR-NCSSSNSC---D  1483
             E+PL  D+ P          RFSSN C +P+  G++ G G  WI+GR +  SSN+C   D
Sbjct  5     EQPLGFDKFP--------GSRFSSNGCLQPIRGGENAGTGNCWIEGRRSFRSSNTCNCND  56

Query  1482  EDFDEYGRGSYGWKRQFRDRPYNGVSNRRSFSGG---------WRNVLFNGVPKYVKIVE  1330
             E     GR S   +     R Y  +++ ++             +R  LF  VPK+VKIVE
Sbjct  57    EPVVITGRRS--LRTSSMPRTYGTMNDSQADDSSNCHDGDPKYYR--LFRDVPKFVKIVE  112

Query  1329  VGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKN  1150
             V PRDGLQNEK  VPT+VKV LIRKL S GL ++E T FVSP  VPQL+DA  VM A+K+
Sbjct  113   VSPRDGLQNEKTVVPTAVKVNLIRKLASAGLSIIEATSFVSPHRVPQLADADLVMTALKD  172

Query  1149  LEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAA  970
             LEG RLPVLTPNLKG  AA+A+GAKEVAVFASASE FSKANINCSIEESL RY AV SAA
Sbjct  173   LEGVRLPVLTPNLKGLNAAVAAGAKEVAVFASASEGFSKANINCSIEESLARYGAVVSAA  232

Query  969   KKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPM  790
             +KLSIPVRGY+SCVVGCPVEG + P +VAY+AK+LH MGCFEISLGDTIGVATPG+++PM
Sbjct  233   QKLSIPVRGYVSCVVGCPVEGYVPPPRVAYVAKKLHRMGCFEISLGDTIGVATPGSILPM  292

Query  789   LEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVA  610
             LEAVM VVPVEK+AVHFHDTYGQSLPNIL+SLQMG+ TVDSSVSGLGGCPYAKGA+GNVA
Sbjct  293   LEAVMGVVPVEKIAVHFHDTYGQSLPNILLSLQMGIRTVDSSVSGLGGCPYAKGASGNVA  352

Query  609   TEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSADASK  448
             TEDVVYMLHGLG+ TNVD+ +LL AG++I+ +LGR+S SK A AL  V    S+
Sbjct  353   TEDVVYMLHGLGIATNVDMDRLLAAGDYINAYLGRKSGSKTAGALAAVCGGGSR  406



>ref|XP_006430529.1| hypothetical protein CICLE_v10011898mg [Citrus clementina]
 ref|XP_006430530.1| hypothetical protein CICLE_v10011898mg [Citrus clementina]
 gb|ESR43769.1| hypothetical protein CICLE_v10011898mg [Citrus clementina]
 gb|ESR43770.1| hypothetical protein CICLE_v10011898mg [Citrus clementina]
Length=398

 Score =   459 bits (1180),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 240/309 (78%), Positives = 276/309 (89%), Gaps = 1/309 (0%)
 Frame = -3

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
             L   VP +VKIVEVGPRDGLQNEKN VP  VKVELI+ LVS GLPVVE T FVSPKWVPQ
Sbjct  90    LLGRVPGFVKIVEVGPRDGLQNEKNIVPAVVKVELIKLLVSSGLPVVEATSFVSPKWVPQ  149

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+DAKDVM A++N+EGAR PVLTPNLKGFEAA+A+GAKEVA+FASASESFSK+NINC+IE
Sbjct  150   LADAKDVMAAIQNVEGARFPVLTPNLKGFEAAVAAGAKEVAIFASASESFSKSNINCTIE  209

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             +SL+RYR V  AA++LSIPVRGY+SCVVGCPVEG + PSKVAY++K+L++MGC EISLGD
Sbjct  210   DSLIRYRDVALAARELSIPVRGYLSCVVGCPVEGMVPPSKVAYVSKQLYDMGCSEISLGD  269

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTVIPMLEAV+  VPV+KLAVHFHDTYGQ+L NIL SLQMG+ TVDSSVSGLG
Sbjct  270   TIGVGTPGTVIPMLEAVLDAVPVDKLAVHFHDTYGQALSNILASLQMGISTVDSSVSGLG  329

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGA+GNVATEDVVYML+GLGV+TNVD+ KL+ AG+FI KHLGR S SK AIAL++
Sbjct  330   GCPYAKGASGNVATEDVVYMLNGLGVRTNVDIRKLMIAGDFICKHLGRTSGSKTAIALSK  389

Query  468   VS-ADASKI  445
              S A+ASK+
Sbjct  390   TSTANASKL  398



>ref|XP_004288605.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform 1 [Fragaria vesca subsp. vesca]
Length=339

 Score =   456 bits (1172),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 239/318 (75%), Positives = 274/318 (86%), Gaps = 0/318 (0%)
 Frame = -3

Query  1398  RSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVT  1219
             R FS          +P++VKIVEVGPRDGLQNEK  VPT VKV LI+ LVS GL VVE T
Sbjct  22    RGFSCSINKPALANIPEFVKIVEVGPRDGLQNEKQIVPTHVKVRLIQMLVSSGLTVVEAT  81

Query  1218  GFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesf  1039
              FVSPKWVPQL+DAKDVM+A++N+ GAR PVLTPNLKGFEAA+ +GAKEVA+FASASESF
Sbjct  82    SFVSPKWVPQLADAKDVMEAIRNMGGARFPVLTPNLKGFEAAVDAGAKEVAIFASASESF  141

Query  1038  skANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHE  859
             SK+NINCSIE+SL RYR V SAA+KLSIPVRGYISCVVGCP EGA+ PS+VAY+AKEL++
Sbjct  142   SKSNINCSIEDSLRRYRDVASAARKLSIPVRGYISCVVGCPTEGAVPPSQVAYVAKELYD  201

Query  858   MGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVC  679
             MGCF+ISLGDTIGV TPGTV+PML+ V+ VVP E LAVHFHDTYGQ+L NILVSLQMG+ 
Sbjct  202   MGCFDISLGDTIGVGTPGTVVPMLKEVIDVVPAENLAVHFHDTYGQALSNILVSLQMGIS  261

Query  678   TVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRES  499
             TVDSSVSGLGGCPYAKGA+GNVATEDVVYML+GLGVKTN+DL  L+ AG+FI KHLGR S
Sbjct  262   TVDSSVSGLGGCPYAKGASGNVATEDVVYMLNGLGVKTNIDLKTLMLAGDFICKHLGRSS  321

Query  498   SSKAAIALTRVSADASKI  445
              SK A+AL++V A ASK+
Sbjct  322   GSKTAVALSKVPAHASKL  339



>ref|XP_010112831.1| Hydroxymethylglutaryl-CoA lyase [Morus notabilis]
 gb|EXC34954.1| Hydroxymethylglutaryl-CoA lyase [Morus notabilis]
Length=358

 Score =   456 bits (1173),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 240/315 (76%), Positives = 280/315 (89%), Gaps = 1/315 (0%)
 Frame = -3

Query  1389  SGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFV  1210
             SG   N +   +P+YVKIVEVGPRDGLQNEK+ +PT++KVELI+KLVS GL V+E + FV
Sbjct  45    SGKSTNKIVGNIPEYVKIVEVGPRDGLQNEKHIIPTAIKVELIKKLVSSGLRVIEASSFV  104

Query  1209  SPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskA  1030
             SPKWVPQL+DAKDVM+A++++EGAR PVLTPNLKGFEAA+A+GAKEVA+FASASESFSK+
Sbjct  105   SPKWVPQLADAKDVMEAIRDVEGARFPVLTPNLKGFEAAVAAGAKEVAIFASASESFSKS  164

Query  1029  NINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGC  850
             NINCSIE+SL+RYR V  AAKKL+IPVRGYISCVVGCPVEG + PS+VA++AKEL+ MGC
Sbjct  165   NINCSIEDSLIRYRDVALAAKKLTIPVRGYISCVVGCPVEGKVPPSQVAHVAKELYAMGC  224

Query  849   FEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVD  670
              EISLGDTIGV TPGTVIPMLEAV   VP++KLAVHFHDTYGQ+L N+LVSLQ+G+ TVD
Sbjct  225   SEISLGDTIGVGTPGTVIPMLEAVTDAVPIKKLAVHFHDTYGQALSNMLVSLQVGITTVD  284

Query  669   SSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSK  490
             SSVSGLGGCPYAKGA+GNVA+EDVVYML+GLGVKTNVDLGKL+ AGEFIS HLGR S SK
Sbjct  285   SSVSGLGGCPYAKGASGNVASEDVVYMLNGLGVKTNVDLGKLILAGEFISNHLGRSSGSK  344

Query  489   AAIALTRVSADASKI  445
              AIAL R +  ASK+
Sbjct  345   VAIAL-RKNTCASKL  358



>ref|XP_009588073.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Nicotiana tomentosiformis]
 ref|XP_009588074.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Nicotiana tomentosiformis]
 ref|XP_009588076.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Nicotiana tomentosiformis]
 ref|XP_009588077.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=404

 Score =   457 bits (1176),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 248/337 (74%), Positives = 279/337 (83%), Gaps = 19/337 (6%)
 Frame = -3

Query  1455  SYGWKRQFRDRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSV  1276
             S+G+ R  +D+                      +P+ VKIVEVGPRDGLQNEK  VPT V
Sbjct  87    SHGYLRDVKDKS------------------LGSLPEVVKIVEVGPRDGLQNEKTIVPTEV  128

Query  1275  KVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEA  1096
             KVELI  LVS GLPVVE T FVSPKWVPQL+DAKDV++AV++L G RLPVLTPNLKGFEA
Sbjct  129   KVELINLLVSSGLPVVEATSFVSPKWVPQLADAKDVIEAVRSLTGVRLPVLTPNLKGFEA  188

Query  1095  AIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCP  916
             A+A+GAKEVA+FA+ASESFS++NINCSI +SL RYR V  AAK  SIP+RGYISCVVGCP
Sbjct  189   AVAAGAKEVAIFAAASESFSRSNINCSIADSLARYRDVALAAKNHSIPIRGYISCVVGCP  248

Query  915   VEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFH  736
             VEGA+ PSKVAY+AKEL +MGCFEISLGDTIGV TPGTVIPML+AV  VVPVE+LAVHFH
Sbjct  249   VEGAVSPSKVAYVAKELVDMGCFEISLGDTIGVGTPGTVIPMLDAVTQVVPVERLAVHFH  308

Query  735   DTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVD  556
             DTYGQ+L NILVSLQMG+ TVDSSVSGLGGCPYAKGA+GNVATEDVVYML+GLGVKTNVD
Sbjct  309   DTYGQALSNILVSLQMGISTVDSSVSGLGGCPYAKGASGNVATEDVVYMLNGLGVKTNVD  368

Query  555   LGKLLQAGEFISKHLGRESSSKAAIALTRVSADASKI  445
             L KLL AG+FI KHLGR S SKAAIAL+R S  ASK+
Sbjct  369   LRKLLLAGDFICKHLGRPSGSKAAIALSRTST-ASKL  404



>emb|CDM82754.1| unnamed protein product [Triticum aestivum]
Length=434

 Score =   457 bits (1176),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 249/369 (67%), Positives = 294/369 (80%), Gaps = 32/369 (9%)
 Frame = -3

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLF---------------------------  1363
             RG +  +R  R    + VSNR + +GG R+VL+                           
Sbjct  68    RGEHACRR--RTYQIHPVSNRVTLAGGNRHVLYASYLSQNQQNYRSFSASSDQERIEAAN  125

Query  1362  ---NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVP  1192
                +G+P+ VKIVEVGPRDGLQNEKN VPT VK+ELI++L + GL VVE T FVSPKWVP
Sbjct  126   RIIHGLPRCVKIVEVGPRDGLQNEKNTVPTPVKIELIKRLATSGLSVVEATSFVSPKWVP  185

Query  1191  QLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSI  1012
             QL+DAKDVM+ V+N+ G   PVLTPNLKGFEAA A+GAKEVA+FASASE+FSK+NINCSI
Sbjct  186   QLADAKDVMEVVRNITGVSFPVLTPNLKGFEAAAAAGAKEVAIFASASEAFSKSNINCSI  245

Query  1011  EESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLG  832
             +ESLVRY  V  AAKKL IPVRGY+SCVVGCPVEG++ PS VAY+AKEL++MGC+E+SLG
Sbjct  246   KESLVRYNDVALAAKKLEIPVRGYVSCVVGCPVEGSVPPSDVAYVAKELYDMGCYEVSLG  305

Query  831   DTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGL  652
             DTIGV TPGTV+PMLEAVM+VVPVEKLAVHFHDTYGQSL NILVSLQMG+  VDSS+SGL
Sbjct  306   DTIGVGTPGTVVPMLEAVMSVVPVEKLAVHFHDTYGQSLSNILVSLQMGISVVDSSISGL  365

Query  651   GGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALT  472
             GGCPYAKGA+GNVATEDVVYML+GLG+KT VDL K++ AGEFI KHLGR+S SKAA AL+
Sbjct  366   GGCPYAKGASGNVATEDVVYMLNGLGIKTGVDLSKVIAAGEFICKHLGRQSGSKAATALS  425

Query  471   RVSADASKI  445
             +V+A ASK+
Sbjct  426   KVTASASKL  434



>ref|XP_006482060.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Citrus sinensis]
 ref|XP_006482061.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=398

 Score =   456 bits (1172),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 239/309 (77%), Positives = 275/309 (89%), Gaps = 1/309 (0%)
 Frame = -3

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
             L   VP +VKIVEVGPRDGLQNEKN VP  VKVELI+ LVS GL VVE T FVSPKWVPQ
Sbjct  90    LLGRVPGFVKIVEVGPRDGLQNEKNIVPAVVKVELIKLLVSSGLAVVEATSFVSPKWVPQ  149

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+DAKDVM A++N+EGAR PVLTPNLKGFEAA+A+GAKEVA+FASASESFSK+NINC+IE
Sbjct  150   LADAKDVMAAIQNVEGARFPVLTPNLKGFEAAVAAGAKEVAIFASASESFSKSNINCTIE  209

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             +SL+RYR V  AA++LSIPVRGY+SCVVGCPVEG + PSKVAY++K+L++MGC EISLGD
Sbjct  210   DSLIRYRDVALAARELSIPVRGYLSCVVGCPVEGMVPPSKVAYVSKQLYDMGCSEISLGD  269

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTVIPMLEAV+  VPV+KLAVHFHDTYGQ+L NIL SLQMG+ TVDSSVSGLG
Sbjct  270   TIGVGTPGTVIPMLEAVLDAVPVDKLAVHFHDTYGQALSNILASLQMGISTVDSSVSGLG  329

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGA+GNVATEDVVYML+GLGV+TNVD+ KL+ AG+FI KHLGR S SK AIAL++
Sbjct  330   GCPYAKGASGNVATEDVVYMLNGLGVRTNVDIRKLMIAGDFICKHLGRTSGSKTAIALSK  389

Query  468   VS-ADASKI  445
              S A+ASK+
Sbjct  390   TSTANASKL  398



>ref|XP_006419478.1| hypothetical protein CICLE_v10005026mg [Citrus clementina]
 gb|ESR32718.1| hypothetical protein CICLE_v10005026mg [Citrus clementina]
Length=359

 Score =   454 bits (1168),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 244/342 (71%), Positives = 278/342 (81%), Gaps = 26/342 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP +S IDR+  RFSSNACRP GD  GMG  WI+G +CS+SNS DE++DEY 
Sbjct  5     EEPLGLDKLPSMSTIDRIQ-RFSSNACRPSGDGMGMGSCWIEGSSCSTSNSYDEEYDEYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLF------------------------NGV  1354
             R ++ W+R  RD  +    +RR+ S G  + +F                         G+
Sbjct  64    REAFPWRRHTRDMSHGDSFSRRTVSLGRNHKMFGSACDIYSSNCNDKDIRDITNKFLKGI  123

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             P+ VKIVEVGPRDGLQNEKN VPT VKVELIR+LVS GLPVVE T FVSPKWVPQL+DA+
Sbjct  124   PRSVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADAR  183

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             DVM+AV++LEGARLPVLTPNLKGFEAAIA+GAKEVA+FASASE+FSK+NINCSIEESLVR
Sbjct  184   DVMEAVRDLEGARLPVLTPNLKGFEAAIAAGAKEVAIFASASEAFSKSNINCSIEESLVR  243

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
             YRAV  AAK LSIPVRGY+SCVVGCPVEGAI PSKVAY+AKELH+MGCFEISLGDTIGV 
Sbjct  244   YRAVARAAKDLSIPVRGYVSCVVGCPVEGAIPPSKVAYVAKELHDMGCFEISLGDTIGVG  303

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQM  688
             TPGTV+PMLEAVMAVVPVEKLAVHFHDTYGQSLPNIL+SLQ+
Sbjct  304   TPGTVVPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILISLQV  345



>gb|ACG45252.1| hydroxymethylglutaryl-CoA lyase [Zea mays]
Length=435

 Score =   456 bits (1174),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 238/334 (71%), Positives = 287/334 (86%), Gaps = 4/334 (1%)
 Frame = -3

Query  1443  KRQFRDRPYNGVSNRRSFSGGW-RNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVE  1267
             ++Q   R ++  S++ S    W R+ + + +P YVKIVEVGPRDGLQNEK+ VPT VKVE
Sbjct  105   RKQHIYRYFSSSSHQGSI---WARSKILHDLPGYVKIVEVGPRDGLQNEKDIVPTPVKVE  161

Query  1266  LIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIA  1087
             LIR+L + GLPVVE T FVSPKWVPQL+DAKDVM+AV+ + G R PVLTPNLKGFEAAIA
Sbjct  162   LIRRLATSGLPVVEATSFVSPKWVPQLADAKDVMEAVRTIGGVRFPVLTPNLKGFEAAIA  221

Query  1086  SGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEG  907
             +GAKE+A+FASASE FSK+NINC+I+ES+ RY  V  AAK+  IPVRGY+SCVVGCPV+G
Sbjct  222   AGAKEIAIFASASEGFSKSNINCTIKESIARYNDVALAAKEKEIPVRGYVSCVVGCPVDG  281

Query  906   AILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTY  727
              + PS VAY+AKEL++MGC+E+SLGDTIGV TPGTV+PMLEA ++VVPVEKLAVHFHDTY
Sbjct  282   PVPPSNVAYVAKELYDMGCYEVSLGDTIGVGTPGTVVPMLEAAISVVPVEKLAVHFHDTY  341

Query  726   GQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGK  547
             GQSL NIL+SLQMGV  VDSSV+GLGGCPYAKGA+GNVATEDVVYML+GLGVKT VDLGK
Sbjct  342   GQSLSNILISLQMGVSVVDSSVAGLGGCPYAKGASGNVATEDVVYMLNGLGVKTGVDLGK  401

Query  546   LLQAGEFISKHLGRESSSKAAIALTRVSADASKI  445
             ++ AGEFI +HLGR+S SKAA AL++V+A+ASK+
Sbjct  402   VMAAGEFICRHLGRQSGSKAATALSKVTANASKL  435



>gb|KDO71785.1| hypothetical protein CISIN_1g012949mg [Citrus sinensis]
Length=359

 Score =   453 bits (1166),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 243/342 (71%), Positives = 278/342 (81%), Gaps = 26/342 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP +S IDR+  RFSSNACRP GD  GMG  WI+G +CS+SNS DED+DEY 
Sbjct  5     EEPLGLDKLPSMSTIDRIQ-RFSSNACRPSGDGMGMGSCWIEGSSCSTSNSYDEDYDEYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLF------------------------NGV  1354
             R ++ W+R  RD  +    +RR+ S G  + +F                         G+
Sbjct  64    REAFPWRRHTRDMSHGDSFSRRTVSLGRNHKMFGSACDIYNSNCNDKDIRDITNKFLKGI  123

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             P++VKIVEVGPRDGLQNEKN VPT VKVELIR+LVS GLPVVE T FVSPKWVPQL+DA+
Sbjct  124   PRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADAR  183

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             DVM+AV++LEGARLPVLTPNLKGFEAAIA+GAKEVA+FASASE+FSK+NINCSIE+SLVR
Sbjct  184   DVMEAVRDLEGARLPVLTPNLKGFEAAIAAGAKEVAIFASASEAFSKSNINCSIEDSLVR  243

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
             YRAV  AAK LSIPVRGY+SCVVGCPVEGAI PSKVAY+AKELH+MGCFEISLGDTIGV 
Sbjct  244   YRAVAHAAKVLSIPVRGYVSCVVGCPVEGAIPPSKVAYVAKELHDMGCFEISLGDTIGVG  303

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQM  688
             TPGTV+PMLEAVMAVVPVEKLAVH HDTYGQSLPNIL+SLQ+
Sbjct  304   TPGTVVPMLEAVMAVVPVEKLAVHLHDTYGQSLPNILISLQV  345



>ref|NP_001132253.1| hydroxymethylglutaryl-CoA lyase [Zea mays]
 gb|ACF81026.1| unknown [Zea mays]
 gb|AFW79586.1| hydroxymethylglutaryl-CoA lyase [Zea mays]
Length=434

 Score =   455 bits (1170),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 251/382 (66%), Positives = 295/382 (77%), Gaps = 36/382 (9%)
 Frame = -3

Query  1506  CSSSNSCDEDFDEYGRGSYGWKRQFRDRPYN-----------------GVSNR-----RS  1393
             CSSS     D  EY    Y WKR    R                    G S+R     R 
Sbjct  61    CSSSG----DSREY----YQWKRLVNQRQSTLDGGKVPAALGHHVFGAGCSSRNQHIYRY  112

Query  1392  FSGGWRNVLFNG------VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPV  1231
             FS   +  ++ G      +P YVKIVEVGPRDGLQNEK+ VPT VKVELIR+L + GLPV
Sbjct  113   FSSSHQGSIWAGSKVLHDLPGYVKIVEVGPRDGLQNEKDIVPTPVKVELIRRLATSGLPV  172

Query  1230  VEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasa  1051
             VE T FVSPKWVPQL+DAKDVM+AV+ + G R PVLTPNLKGFEAAIA+GAKE+A+FASA
Sbjct  173   VEATSFVSPKWVPQLADAKDVMEAVRTMGGVRFPVLTPNLKGFEAAIAAGAKEIAIFASA  232

Query  1050  sesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAK  871
             SE FSK+NINC+I+ES+ RY  V  AAK+  IPVRGY+SCVVGCPV+G + PS VAY+AK
Sbjct  233   SEGFSKSNINCTIKESIARYNDVALAAKEKEIPVRGYVSCVVGCPVDGPVPPSNVAYVAK  292

Query  870   ELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQ  691
             EL++MGC+E+SLGDTIGV TPGTV+PMLEA ++VVPVEKLAVHFHDTYGQSL NIL+SLQ
Sbjct  293   ELYDMGCYEVSLGDTIGVGTPGTVVPMLEAAISVVPVEKLAVHFHDTYGQSLSNILISLQ  352

Query  690   MGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHL  511
             MGV  VDSSV+GLGGCPYAKGA+GNVATEDVVYML+GLGVKT VDLGK++ AGEFI +HL
Sbjct  353   MGVSVVDSSVAGLGGCPYAKGASGNVATEDVVYMLNGLGVKTGVDLGKVMAAGEFICRHL  412

Query  510   GRESSSKAAIALTRVSADASKI  445
             GR+S SKAA AL++V+A+ASK+
Sbjct  413   GRQSGSKAATALSKVTANASKL  434



>ref|XP_004967725.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Setaria italica]
Length=448

 Score =   454 bits (1168),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 235/327 (72%), Positives = 284/327 (87%), Gaps = 2/327 (1%)
 Frame = -3

Query  1425  RPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVS  1246
             R ++  S+++    G +++    +P+ VKIVEVGPRDGLQNEK+ VPT VKVELIR+L +
Sbjct  124   RYFSSSSDQQRIWAGNKHIC--DLPRCVKIVEVGPRDGLQNEKDIVPTPVKVELIRRLAA  181

Query  1245  CGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakeva  1066
              GLPVVE T FVSPKWVPQL+DAK+VM+AV+N+EG RLPVLTPNLKGFEAAIA+GAKE+A
Sbjct  182   SGLPVVEATSFVSPKWVPQLADAKNVMEAVRNIEGVRLPVLTPNLKGFEAAIAAGAKEIA  241

Query  1065  vfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKV  886
             +FASASE FSK+NINC+I+ESL RY  V  AAK+  IPVRGY+SCVVGCPV+G + PS V
Sbjct  242   IFASASEGFSKSNINCTIKESLARYNDVALAAKEREIPVRGYVSCVVGCPVDGPVPPSNV  301

Query  885   AYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNI  706
             AY+AKEL++MGC+E+SLGDTIGV TPGTV+PMLEA M+ VPVEKLAVHFHDTYGQSL NI
Sbjct  302   AYVAKELYDMGCYEVSLGDTIGVGTPGTVVPMLEATMSAVPVEKLAVHFHDTYGQSLSNI  361

Query  705   LVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEF  526
             L+SLQMG+  VDSSV+GLGGCPYAKGA+GNVATEDVVYML+GLG+K  VDLGK++ AGEF
Sbjct  362   LISLQMGISVVDSSVAGLGGCPYAKGASGNVATEDVVYMLNGLGIKMGVDLGKVMAAGEF  421

Query  525   ISKHLGRESSSKAAIALTRVSADASKI  445
             I KHLGR+S SKAA AL++V+A+ASK+
Sbjct  422   ICKHLGRQSGSKAATALSKVTANASKL  448



>ref|XP_010055785.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW90024.1| hypothetical protein EUGRSUZ_A02227 [Eucalyptus grandis]
Length=453

 Score =   454 bits (1167),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 237/308 (77%), Positives = 271/308 (88%), Gaps = 0/308 (0%)
 Frame = -3

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
             L   +P+YVKIVEVGPRDGLQNEK  VPT VKV LI+ LVS GLPVVE T FVSPKWVPQ
Sbjct  146   LLGSIPRYVKIVEVGPRDGLQNEKEIVPTKVKVGLIKMLVSSGLPVVEATSFVSPKWVPQ  205

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L DAKDVM+A++N+EGAR PVLTPNLKGFEAA+A+GAKEVA+FASASESFSK+NINCSIE
Sbjct  206   LGDAKDVMEAIRNVEGARFPVLTPNLKGFEAAVAAGAKEVAIFASASESFSKSNINCSIE  265

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ESL RY  V+ AA+K S+P+RGYISCVVGCPVEG + P+KVAY+A++L++MGC EISLGD
Sbjct  266   ESLKRYHDVSLAAEKASVPIRGYISCVVGCPVEGKVPPTKVAYVAEKLYDMGCSEISLGD  325

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTV+PMLEAVM VVPV+KLAVHFHDTYGQ+L NIL SLQMG+ TVDSSV+GLG
Sbjct  326   TIGVGTPGTVVPMLEAVMNVVPVDKLAVHFHDTYGQALSNILASLQMGIATVDSSVAGLG  385

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGATGNVATEDVVYML+GLGVKTNVDLGK++ AG+FI KHL R S SK A AL+ 
Sbjct  386   GCPYAKGATGNVATEDVVYMLNGLGVKTNVDLGKVMLAGDFICKHLERPSHSKTATALST  445

Query  468   VSADASKI  445
              +A  SK+
Sbjct  446   STAHVSKL  453



>gb|KHN08894.1| Hydroxymethylglutaryl-CoA lyase, mitochondrial [Glycine soja]
Length=311

 Score =   448 bits (1152),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 235/308 (76%), Positives = 269/308 (87%), Gaps = 0/308 (0%)
 Frame = -3

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
             L   +P YVKIVEVG RDGLQNEK  +PT+VKVELI+ LVS GL VVE T FVSPKWVPQ
Sbjct  4     LLTSIPDYVKIVEVGARDGLQNEKAIIPTNVKVELIKLLVSSGLSVVEATSFVSPKWVPQ  63

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+DAKDV+ A++N+EGAR PVLTPNLKGFEAA+A+GAKEVAVF +ASESFSKAN+N SIE
Sbjct  64    LADAKDVLAAIQNVEGARFPVLTPNLKGFEAAVAAGAKEVAVFPAASESFSKANLNSSIE  123

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ++L R   + SAA+ LSIPVRGYISCVVGCP+EG I P+KVAY+AK L+EMGC EISLGD
Sbjct  124   DNLARCHDIASAARSLSIPVRGYISCVVGCPLEGNIAPAKVAYVAKSLYEMGCSEISLGD  183

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTVI MLEAV+ VVP + LAVHFHDTYGQ+L NIL+SLQMG+ TVDSSVSGLG
Sbjct  184   TIGVGTPGTVISMLEAVLDVVPTDMLAVHFHDTYGQALSNILISLQMGISTVDSSVSGLG  243

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGATGNVATEDVVYML+GLGVKTNVDLGKL+ AG+FI KHLGR S SKAA AL++
Sbjct  244   GCPYAKGATGNVATEDVVYMLNGLGVKTNVDLGKLMLAGDFICKHLGRASGSKAATALSK  303

Query  468   VSADASKI  445
             V++ ASK+
Sbjct  304   VTSHASKL  311



>gb|EYU18607.1| hypothetical protein MIMGU_mgv1a007389mg [Erythranthe guttata]
 gb|EYU18608.1| hypothetical protein MIMGU_mgv1a007389mg [Erythranthe guttata]
Length=409

 Score =   452 bits (1162),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 249/374 (67%), Positives = 293/374 (78%), Gaps = 10/374 (3%)
 Frame = -3

Query  1548  GDDGMGERWIDGRNCSSSNSCDEDFDEYGRGSYGWKRQFR------DRPYNGVSNRRSFS  1387
             GDD    + ++G+  S  N  +     YG   Y + R+ R       R  N   + +  +
Sbjct  40    GDDRSFPKHLNGKEASLLNK-ESKTTPYG---YLFNREPRLVGFGVARMLNRHYSSQHHT  95

Query  1386  GGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVS  1207
                 + L   +P YVKIVEVGPRDGLQNEK  VPT+VKVELI+ L S GLPVVE T FVS
Sbjct  96    KNAEHKLLGSIPNYVKIVEVGPRDGLQNEKEIVPTAVKVELIKMLASSGLPVVEATSFVS  155

Query  1206  PKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskAN  1027
             PKWVPQL+DAKDVM A++ +  +R PVLTPNLKGFEAA+ +GAKEVAVFA+ASESFS++N
Sbjct  156   PKWVPQLADAKDVMSAIQGIGHSRFPVLTPNLKGFEAAVEAGAKEVAVFAAASESFSRSN  215

Query  1026  INCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCF  847
             +NCSIE+SL RYR V  AAK  +IPVRGYISCVVGCPVEGA+ PSKVAY+A+EL  MGC 
Sbjct  216   LNCSIEDSLARYRDVALAAKDHAIPVRGYISCVVGCPVEGAVPPSKVAYVAEELFNMGCA  275

Query  846   EISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDS  667
             EISLGDTIGV TPGTVIPMLEAV+ VVPVEKLAVHFHDTYGQ+L NIL+SLQMG+  VDS
Sbjct  276   EISLGDTIGVGTPGTVIPMLEAVLDVVPVEKLAVHFHDTYGQALSNILLSLQMGISVVDS  335

Query  666   SVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKA  487
             S+SGLGGCPYAKGA+GNVATEDVVYML+GLGVKTNVDL KL+ AG++I +HLGR S SKA
Sbjct  336   SISGLGGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLMKLVLAGDYICQHLGRSSGSKA  395

Query  486   AIALTRVSADASKI  445
             AIAL+R  A+ASK+
Sbjct  396   AIALSRRLANASKL  409



>ref|XP_004973309.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Setaria italica]
Length=448

 Score =   452 bits (1164),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 235/327 (72%), Positives = 283/327 (87%), Gaps = 2/327 (1%)
 Frame = -3

Query  1425  RPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVS  1246
             R ++  S+++    G +++    +P+ VKIVEVGPRDGLQNEK+ VPT VKVELIR+L +
Sbjct  124   RYFSSSSDQQRIWAGNKHIC--DLPRCVKIVEVGPRDGLQNEKDIVPTPVKVELIRRLAA  181

Query  1245  CGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakeva  1066
              GLPVVE T FVSPKWVPQL+DAK+VM+AV+N+EG RLPVLTPNLKGFEAAIA+GAKE+A
Sbjct  182   SGLPVVEATSFVSPKWVPQLADAKNVMEAVRNIEGVRLPVLTPNLKGFEAAIAAGAKEIA  241

Query  1065  vfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKV  886
             +FASASE FSK+NINC+I+ESL RY  V  AAK+  IPVRGY+SCVVGCPV+G + PS V
Sbjct  242   IFASASEGFSKSNINCTIKESLARYNDVALAAKEREIPVRGYVSCVVGCPVDGPVPPSNV  301

Query  885   AYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNI  706
             AY+AKEL++MGC+E+SLGDTIGV TPGTV+PMLEA M+ VPVEKLAVHFHDTYGQSL NI
Sbjct  302   AYVAKELYDMGCYEVSLGDTIGVGTPGTVVPMLEATMSAVPVEKLAVHFHDTYGQSLSNI  361

Query  705   LVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEF  526
             L+SLQMG+  VDSSV+GLGGCPYAKGA+GNVATEDVVYML+GLG+K  VDLGK++ AGEF
Sbjct  362   LMSLQMGISVVDSSVAGLGGCPYAKGASGNVATEDVVYMLNGLGIKMGVDLGKVMAAGEF  421

Query  525   ISKHLGRESSSKAAIALTRVSADASKI  445
             I KHLGR+S SKAA AL +V+A+ASK+
Sbjct  422   ICKHLGRQSGSKAATALRKVTANASKL  448



>ref|XP_004973199.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Setaria italica]
Length=448

 Score =   452 bits (1163),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 234/327 (72%), Positives = 283/327 (87%), Gaps = 2/327 (1%)
 Frame = -3

Query  1425  RPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVS  1246
             R ++  S+++    G +++    +P+ VKIVEVGPRDGLQNEK+ VPT VKVELIR+L +
Sbjct  124   RYFSSSSDQQRIWAGNKHIC--DLPRCVKIVEVGPRDGLQNEKDIVPTPVKVELIRRLAA  181

Query  1245  CGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakeva  1066
              GLPVVE T FVSPKWVPQL+DAK+VM+AV+N+EG RLP+LTPNLKGFEAAIA+GAKE+A
Sbjct  182   SGLPVVEATSFVSPKWVPQLADAKNVMEAVRNIEGVRLPILTPNLKGFEAAIAAGAKEIA  241

Query  1065  vfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKV  886
             +FASASE FSK+NINC+I+ESL RY  V  AAK+  IPVRGY+SCVVGCPV+G + PS V
Sbjct  242   IFASASEGFSKSNINCTIKESLARYNDVALAAKEREIPVRGYVSCVVGCPVDGPVPPSNV  301

Query  885   AYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNI  706
             AY+AKEL++MGC+E+SLGDTIGV TPGTV+PMLEA M+ VPVEKLAVHFHDTYGQSL NI
Sbjct  302   AYVAKELYDMGCYEVSLGDTIGVGTPGTVVPMLEATMSAVPVEKLAVHFHDTYGQSLSNI  361

Query  705   LVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEF  526
             L+SLQMG+  VDSSV+GLGGCPYAKGA+GNVATEDVVYML+GLG+K  VDLGK++ AGEF
Sbjct  362   LMSLQMGISVVDSSVAGLGGCPYAKGASGNVATEDVVYMLNGLGIKMGVDLGKVMAAGEF  421

Query  525   ISKHLGRESSSKAAIALTRVSADASKI  445
             I KHLGR+S SKAA AL +V+A+ASK+
Sbjct  422   ICKHLGRQSGSKAATALRKVTANASKL  448



>ref|XP_007028281.1| Aldolase superfamily protein [Theobroma cacao]
 gb|EOY08783.1| Aldolase superfamily protein [Theobroma cacao]
Length=393

 Score =   449 bits (1156),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 237/322 (74%), Positives = 278/322 (86%), Gaps = 5/322 (2%)
 Frame = -3

Query  1419  YNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCG  1240
             Y+ + N R  +   RN+     P YVKIVEVGPRDGLQNEK  VPT+VKV+LI+ LVS G
Sbjct  75    YSSICNHRPTNKVLRNL-----PGYVKIVEVGPRDGLQNEKEIVPTTVKVQLIKMLVSSG  129

Query  1239  LPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavf  1060
             L VVE T FVSPKWVPQL+DAKDVM A++N++G R PVLTPNLKGFEAA+A+GAKEVA+F
Sbjct  130   LTVVEATSFVSPKWVPQLADAKDVMDAIQNIQGGRFPVLTPNLKGFEAAVAAGAKEVAIF  189

Query  1059  asasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAY  880
             ASASESFSK+NINCSI++SL RYR V SAA++LS+PVRGYISCVVGCPVEG + PSKVAY
Sbjct  190   ASASESFSKSNINCSIKDSLARYRDVASAARELSLPVRGYISCVVGCPVEGTVPPSKVAY  249

Query  879   LAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILV  700
             +AK+L +MGC EISLGDTIGV TPGTVIPMLE V+ VVP++KLAVHFHDTYGQ+L NIL+
Sbjct  250   VAKQLFDMGCSEISLGDTIGVGTPGTVIPMLENVIHVVPIDKLAVHFHDTYGQALSNILI  309

Query  699   SLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFIS  520
             SLQMG+ TVDSSVSGLGGCPYAKGA+GNVATEDVVYML+GLGV+T+VDL KL+ AG+FI 
Sbjct  310   SLQMGISTVDSSVSGLGGCPYAKGASGNVATEDVVYMLNGLGVETHVDLEKLMLAGDFIC  369

Query  519   KHLGRESSSKAAIALTRVSADA  454
             KHLGR SSSK A+AL+   A++
Sbjct  370   KHLGRPSSSKTAVALSSKKANS  391



>ref|XP_008443338.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Cucumis melo]
Length=388

 Score =   449 bits (1155),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 233/303 (77%), Positives = 271/303 (89%), Gaps = 0/303 (0%)
 Frame = -3

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             +P +VKIVEVGPRDGLQNEK+ VPT+VKV+LI+ LV  GLPVVE T FVSPKWVPQL+DA
Sbjct  78    IPPFVKIVEVGPRDGLQNEKHIVPTAVKVDLIKMLVFSGLPVVEATSFVSPKWVPQLADA  137

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
             KDVM+ ++N+EGAR PVLTPNLKGFEAA+A+GAKEVA+FASASESFSK+NINCSIEESL 
Sbjct  138   KDVMEGIRNVEGARFPVLTPNLKGFEAAVAAGAKEVAIFASASESFSKSNINCSIEESLH  197

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             RYR V  AA+K S+PVRGY+SCVVGCP+EG +  S VAY+AKEL+ MGC EISLGDTIGV
Sbjct  198   RYRQVADAARKHSLPVRGYVSCVVGCPIEGMVPASNVAYVAKELYSMGCSEISLGDTIGV  257

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
              TPGTVIPMLE+V+ VVP+E LAVHFHDTYGQ+L NILVSLQMG+ TVDSSVSGLGGCPY
Sbjct  258   GTPGTVIPMLESVINVVPIENLAVHFHDTYGQALSNILVSLQMGIGTVDSSVSGLGGCPY  317

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSAD  457
             AKGA+GNVATEDVVYML+G+G KTNVDL KL+ AG+FI KHLGR S+SK AIAL +V+++
Sbjct  318   AKGASGNVATEDVVYMLNGIGAKTNVDLEKLMLAGDFICKHLGRPSASKVAIALRKVTSN  377

Query  456   ASK  448
             A+K
Sbjct  378   ANK  380



>gb|KCW90023.1| hypothetical protein EUGRSUZ_A02227 [Eucalyptus grandis]
Length=481

 Score =   452 bits (1164),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 237/308 (77%), Positives = 271/308 (88%), Gaps = 0/308 (0%)
 Frame = -3

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
             L   +P+YVKIVEVGPRDGLQNEK  VPT VKV LI+ LVS GLPVVE T FVSPKWVPQ
Sbjct  174   LLGSIPRYVKIVEVGPRDGLQNEKEIVPTKVKVGLIKMLVSSGLPVVEATSFVSPKWVPQ  233

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L DAKDVM+A++N+EGAR PVLTPNLKGFEAA+A+GAKEVA+FASASESFSK+NINCSIE
Sbjct  234   LGDAKDVMEAIRNVEGARFPVLTPNLKGFEAAVAAGAKEVAIFASASESFSKSNINCSIE  293

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ESL RY  V+ AA+K S+P+RGYISCVVGCPVEG + P+KVAY+A++L++MGC EISLGD
Sbjct  294   ESLKRYHDVSLAAEKASVPIRGYISCVVGCPVEGKVPPTKVAYVAEKLYDMGCSEISLGD  353

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTV+PMLEAVM VVPV+KLAVHFHDTYGQ+L NIL SLQMG+ TVDSSV+GLG
Sbjct  354   TIGVGTPGTVVPMLEAVMNVVPVDKLAVHFHDTYGQALSNILASLQMGIATVDSSVAGLG  413

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGATGNVATEDVVYML+GLGVKTNVDLGK++ AG+FI KHL R S SK A AL+ 
Sbjct  414   GCPYAKGATGNVATEDVVYMLNGLGVKTNVDLGKVMLAGDFICKHLERPSHSKTATALST  473

Query  468   VSADASKI  445
              +A  SK+
Sbjct  474   STAHVSKL  481



>ref|XP_006604320.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Glycine max]
Length=343

 Score =   447 bits (1150),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 235/308 (76%), Positives = 269/308 (87%), Gaps = 0/308 (0%)
 Frame = -3

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
             L   +P YVKIVEVG RDGLQNEK  +PT+VKVELI+ LVS GL VVE T FVSPKWVPQ
Sbjct  36    LLTSIPDYVKIVEVGARDGLQNEKAIIPTNVKVELIKLLVSSGLSVVEATSFVSPKWVPQ  95

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+DAKDV+ A++N+EGAR PVLTPNLKGFEAA+A+GAKEVAVF +ASESFSKAN+N SIE
Sbjct  96    LADAKDVLAAIQNVEGARFPVLTPNLKGFEAAVAAGAKEVAVFPAASESFSKANLNSSIE  155

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ++L R   + SAA+ LSIPVRGYISCVVGCP+EG I P+KVAY+AK L+EMGC EISLGD
Sbjct  156   DNLARCHDIASAARSLSIPVRGYISCVVGCPLEGNIAPAKVAYVAKSLYEMGCSEISLGD  215

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTVI MLEAV+ VVP + LAVHFHDTYGQ+L NIL+SLQMG+ TVDSSVSGLG
Sbjct  216   TIGVGTPGTVISMLEAVLDVVPTDMLAVHFHDTYGQALSNILISLQMGISTVDSSVSGLG  275

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGATGNVATEDVVYML+GLGVKTNVDLGKL+ AG+FI KHLGR S SKAA AL++
Sbjct  276   GCPYAKGATGNVATEDVVYMLNGLGVKTNVDLGKLMLAGDFICKHLGRASGSKAATALSK  335

Query  468   VSADASKI  445
             V++ ASK+
Sbjct  336   VTSHASKL  343



>ref|XP_003566872.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Brachypodium distachyon]
Length=443

 Score =   451 bits (1159),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 244/355 (69%), Positives = 288/355 (81%), Gaps = 9/355 (3%)
 Frame = -3

Query  1482  EDFDEYGRGSYGWKRQFRDRPY--NGVSNRRSFSGG----WRNV---LFNGVPKYVKIVE  1330
             +    +G  S G  R      Y      N R FS      W  +   + + +P++VKIVE
Sbjct  89    QQVPNWGNSSVGGNRHVLYASYLSQNKQNYRCFSSSSDQEWIGIGSRMIHNLPRFVKIVE  148

Query  1329  VGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKN  1150
             VGPRDGLQNEK+ VPT VK++LI++L + GL VVE T FVSPKWVPQL+DAKDVM+ V+N
Sbjct  149   VGPRDGLQNEKSTVPTHVKIKLIQRLATSGLSVVEATSFVSPKWVPQLADAKDVMEVVRN  208

Query  1149  LEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAA  970
             + G   PVLTPNLKGFEAA A+GAKEVA+FASASE+FSK+NINCSI+ESL RY  V  AA
Sbjct  209   IAGVHFPVLTPNLKGFEAAAAAGAKEVAIFASASEAFSKSNINCSIKESLARYNDVACAA  268

Query  969   KKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPM  790
             KK  IPVRGY+SCVVGCPVEG++ PS VAY+AKEL++MGC+E+SLGDTIGV TPGTV+PM
Sbjct  269   KKHEIPVRGYVSCVVGCPVEGSVPPSNVAYVAKELYDMGCYEVSLGDTIGVGTPGTVVPM  328

Query  789   LEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVA  610
             LEAVM+VVPVEKLAVHFHDTYGQSL NIL+SLQMGV  VDSSV+GLGGCPYAKGA+GNVA
Sbjct  329   LEAVMSVVPVEKLAVHFHDTYGQSLSNILISLQMGVNVVDSSVAGLGGCPYAKGASGNVA  388

Query  609   TEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSADASKI  445
             TEDVVYMLHGLG+KT VDLGK++ AGEFI KHLGR+S SKAAIAL+ V+A+ASK+
Sbjct  389   TEDVVYMLHGLGIKTGVDLGKVMSAGEFICKHLGRQSGSKAAIALSNVTANASKL  443



>ref|XP_010230759.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Brachypodium distachyon]
Length=451

 Score =   451 bits (1159),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 237/328 (72%), Positives = 284/328 (87%), Gaps = 2/328 (1%)
 Frame = -3

Query  1428  DRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLV  1249
             D+ + G+ +R      ++  + + +P++VKIVEVGPRDGLQNEK+ VPT VK++LI++L 
Sbjct  126   DQEWIGIGSRERMPFSFQ--MIHNLPRFVKIVEVGPRDGLQNEKSTVPTHVKIKLIQRLA  183

Query  1248  SCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakev  1069
             + GL VVE T FVSPKWVPQL+DAKDVM+ V+N+ G   PVLTPNLKGFEAA A+GAKEV
Sbjct  184   TSGLSVVEATSFVSPKWVPQLADAKDVMEVVRNIAGVHFPVLTPNLKGFEAAAAAGAKEV  243

Query  1068  avfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSK  889
             A+FASASE+FSK+NINCSI+ESL RY  V  AAKK  IPVRGY+SCVVGCPVEG++ PS 
Sbjct  244   AIFASASEAFSKSNINCSIKESLARYNDVACAAKKHEIPVRGYVSCVVGCPVEGSVPPSN  303

Query  888   VAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPN  709
             VAY+AKEL++MGC+E+SLGDTIGV TPGTV+PMLEAVM+VVPVEKLAVHFHDTYGQSL N
Sbjct  304   VAYVAKELYDMGCYEVSLGDTIGVGTPGTVVPMLEAVMSVVPVEKLAVHFHDTYGQSLSN  363

Query  708   ILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGE  529
             IL+SLQMGV  VDSSV+GLGGCPYAKGA+GNVATEDVVYMLHGLG+KT VDLGK++ AGE
Sbjct  364   ILISLQMGVNVVDSSVAGLGGCPYAKGASGNVATEDVVYMLHGLGIKTGVDLGKVMSAGE  423

Query  528   FISKHLGRESSSKAAIALTRVSADASKI  445
             FI KHLGR+S SKAAIAL+ V+A+ASK+
Sbjct  424   FICKHLGRQSGSKAAIALSNVTANASKL  451



>ref|XP_002448945.1| hypothetical protein SORBIDRAFT_05g002170 [Sorghum bicolor]
 gb|EES07933.1| hypothetical protein SORBIDRAFT_05g002170 [Sorghum bicolor]
Length=384

 Score =   447 bits (1150),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 255/397 (64%), Positives = 303/397 (76%), Gaps = 23/397 (6%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACR---PVGDDGMGERWIDGRNCSSSNSCDEDFDE  1468
             EEPL L  LP+LS I+R+ GRF S   R   P  D   G+          SNSC+     
Sbjct  5     EEPLGLGDLPKLS-INRL-GRFLSPTARRSSPSDDHSTGKY---------SNSCNGS--P  51

Query  1467  YGRGSYGWKRQFR--DRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKN  1294
             +   SY W  Q R  D   + V  R       R V++  +P++VKIVEVGPRDGLQNEK 
Sbjct  52    FHGNSYPWHPQCRQADSSCDAVELRDL----PRKVMWE-LPRFVKIVEVGPRDGLQNEKG  106

Query  1293  NVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPN  1114
             NVPTSVK++LI KLV  GL VVE T FVSPKWVPQL+DAK+V++ ++   G R PVLTPN
Sbjct  107   NVPTSVKIQLIHKLVGAGLSVVEATSFVSPKWVPQLADAKEVLKGIQQEPGVRYPVLTPN  166

Query  1113  LKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYIS  934
             L+GFEAAIA+GAKE+AVFASASESFSK+NINC+IEESLVRYR VT+AAKK  + +RGY+S
Sbjct  167   LRGFEAAIAAGAKEIAVFASASESFSKSNINCTIEESLVRYRGVTAAAKKHGLTIRGYVS  226

Query  933   CVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEK  754
             CV+GCPVEG I P KVAY+AKEL+ MGC EISLGDT GV TPG+V+ ML+AVMA VPV+K
Sbjct  227   CVIGCPVEGTINPPKVAYVAKELYNMGCSEISLGDTTGVGTPGSVVAMLQAVMAFVPVDK  286

Query  753   LAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLG  574
             +AVHFHDTYGQ+L NILVSLQMG+  VDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLG
Sbjct  287   IAVHFHDTYGQALANILVSLQMGINVVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLG  346

Query  573   VKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVS  463
             ++TNVDL KL++AG++ISK LGR   SK A AL +++
Sbjct  347   IETNVDLNKLMEAGDYISKELGRPLGSKTATALRKLT  383



>ref|NP_001150050.1| LOC100283677 [Zea mays]
 gb|ACG37628.1| hydroxymethylglutaryl-CoA lyase [Zea mays]
Length=394

 Score =   447 bits (1150),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 254/399 (64%), Positives = 302/399 (76%), Gaps = 15/399 (4%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSS-NACRPVGDDGMGERWIDGRNCSSS---NSCDEDFD  1471
             EEPL L  LP+LS I+R+ GRF S  A RP  DD   +    G+  SSS    S    F 
Sbjct  5     EEPLGLGDLPKLS-INRL-GRFVSLGARRPPADD---DDHSTGKYSSSSCNNGSPQMAFH  59

Query  1470  EYGRGSYGWKRQFRDR--PYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEK  1297
                  SY W  Q R    P       R      R V++  +P++VKIVEVGPRDGLQNEK
Sbjct  60    HGSNSSYPWHPQCRQAADPSRDAVELRDLP---RKVMWE-LPRFVKIVEVGPRDGLQNEK  115

Query  1296  NNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTP  1117
              NVP SVK++LI KLV  GL VVE T FVSPKWVPQL+DA++V++ +K   G R PVLTP
Sbjct  116   GNVPASVKIQLIHKLVGAGLSVVEATSFVSPKWVPQLADAEEVLKGIKQEPGVRYPVLTP  175

Query  1116  NLKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYI  937
             NL+GFEAAIA+GAKE+AVFASASESFS++NINCSIEESL RYR VT+AAKK  + +RGY+
Sbjct  176   NLRGFEAAIAAGAKEIAVFASASESFSRSNINCSIEESLARYRGVTAAAKKHGLSIRGYV  235

Query  936   SCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVE  757
             SCV+ CPV GA  P+KVAY+AKEL+ MGC EISLGDT GV TPG+V+ ML+AVM+ VPV+
Sbjct  236   SCVIACPVGGATDPAKVAYVAKELYTMGCSEISLGDTTGVGTPGSVVAMLQAVMSFVPVD  295

Query  756   KLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGL  577
             K+AVHFHDTYGQ+L NILVSLQMG+  VDSSVSGLGGCPYAKGATGNVATEDVVYMLHGL
Sbjct  296   KIAVHFHDTYGQALANILVSLQMGINIVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGL  355

Query  576   GVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSA  460
             G++TNVDL KL++AG++ISKHLGR   SK A AL +++A
Sbjct  356   GIETNVDLNKLMEAGDYISKHLGRPLGSKTATALRKLTA  394



>gb|ACL53018.1| unknown [Zea mays]
 gb|ACN34647.1| unknown [Zea mays]
 gb|AFW64746.1| hydroxymethylglutaryl-CoA lyase isoform 1 [Zea mays]
 gb|AFW64747.1| hydroxymethylglutaryl-CoA lyase isoform 2 [Zea mays]
Length=394

 Score =   447 bits (1149),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 253/399 (63%), Positives = 302/399 (76%), Gaps = 15/399 (4%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSS-NACRPVGDDGMGERWIDGRNCSSS---NSCDEDFD  1471
             EEPL L  LP+LS I+R+ GRF S  A RP  DD   +    G+  SSS    S    F 
Sbjct  5     EEPLGLGDLPKLS-INRL-GRFVSLGARRPPADD---DDHSTGKYSSSSCNNGSHQMAFH  59

Query  1470  EYGRGSYGWKRQFRDR--PYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEK  1297
                  SY W  Q R    P       R      R V++  +P++VKIVEVGPRDGLQNEK
Sbjct  60    HGSNSSYPWHPQCRQAADPSRDAVELRDLP---RKVMWE-LPRFVKIVEVGPRDGLQNEK  115

Query  1296  NNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTP  1117
              NVP SVK++LI KLV  GL VVE T FVSPKWVPQL+DA++V++ +K   G R PVLTP
Sbjct  116   GNVPASVKIQLIHKLVGAGLSVVEATSFVSPKWVPQLADAEEVLKGIKQEPGVRYPVLTP  175

Query  1116  NLKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYI  937
             NL+GFEAAIA+GAKE+AVFASASESFS++NINC+IEESL RYR VT+AAKK  + +RGY+
Sbjct  176   NLRGFEAAIAAGAKEIAVFASASESFSRSNINCTIEESLARYRGVTAAAKKHGLSIRGYV  235

Query  936   SCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVE  757
             SCV+ CPV GA  P+KVAY+AKEL+ MGC EISLGDT GV TPG+V+ ML+AVM+ VPV+
Sbjct  236   SCVIACPVGGATDPAKVAYVAKELYTMGCSEISLGDTTGVGTPGSVVAMLQAVMSFVPVD  295

Query  756   KLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGL  577
             K+AVHFHDTYGQ+L NILVSLQMG+  VDSSVSGLGGCPYAKGATGNVATEDVVYMLHGL
Sbjct  296   KIAVHFHDTYGQALANILVSLQMGINIVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGL  355

Query  576   GVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSA  460
             G++TNVDL KL++AG++ISKHLGR   SK A AL +++A
Sbjct  356   GIETNVDLNKLMEAGDYISKHLGRPLGSKTATALRKLTA  394



>ref|XP_006644039.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like, 
partial [Oryza brachyantha]
Length=386

 Score =   446 bits (1148),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 238/323 (74%), Positives = 277/323 (86%), Gaps = 6/323 (2%)
 Frame = -3

Query  1395  SFSGGWRNV-----LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPV  1231
             S+S G RN      +   +P+ VKIVEVGPRDGLQNEKN VPT VK+ELI +L S GL V
Sbjct  64    SYSSGQRNTGIGNKIVQDLPRNVKIVEVGPRDGLQNEKNIVPTHVKIELIHRLASSGLSV  123

Query  1230  VEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasa  1051
             VE T FVSPKWVPQL+DAKDVM+ V+N+EG  LPVLTPNLKGFE AIA+GAKEVAVFASA
Sbjct  124   VEATSFVSPKWVPQLADAKDVMEVVRNIEGVCLPVLTPNLKGFEGAIAAGAKEVAVFASA  183

Query  1050  sesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAK  871
             SE+FSK+NINC+I+ESL RY  V  AAK+  IP+RGY+SCVVGCPVEG +  S VA++AK
Sbjct  184   SEAFSKSNINCTIKESLARYNDVALAAKEQKIPMRGYVSCVVGCPVEGYVPLSNVAHVAK  243

Query  870   ELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQ  691
             EL++MGC+E+SLGDTIGV TPGTV+PMLEAVMAVVP EKLAVHFHDTYGQSL NIL+SLQ
Sbjct  244   ELYDMGCYEVSLGDTIGVGTPGTVVPMLEAVMAVVPKEKLAVHFHDTYGQSLSNILISLQ  303

Query  690   MGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHL  511
             MGV  VDSSV+GLGGCPYAKGA+GNVATEDVVYML+GLG++TNVDLGK++ AGEFI  HL
Sbjct  304   MGVSVVDSSVAGLGGCPYAKGASGNVATEDVVYMLNGLGIETNVDLGKVMAAGEFICNHL  363

Query  510   GRESSSKAAIALT-RVSADASKI  445
             GR+S SKAAIALT +V+A+ SK+
Sbjct  364   GRQSGSKAAIALTGKVTANVSKL  386



>ref|XP_004136670.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Cucumis sativus]
 gb|KGN59506.1| hypothetical protein Csa_3G823050 [Cucumis sativus]
Length=392

 Score =   446 bits (1148),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 236/317 (74%), Positives = 273/317 (86%), Gaps = 1/317 (0%)
 Frame = -3

Query  1398  RSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVT  1219
             R   GG    L   +P +VKIVEVGPRDGLQNEK+ VPT+VKV+LI+ LVS GLPVVE T
Sbjct  69    RENKGGLSQYLCR-IPPFVKIVEVGPRDGLQNEKHIVPTAVKVDLIKMLVSSGLPVVEAT  127

Query  1218  GFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesf  1039
              FVSPKWVPQL+DAK+VM+ ++N+EGAR PVLTPNLKGFEAA+A+GAKEVA+FASASESF
Sbjct  128   SFVSPKWVPQLADAKEVMEGIRNVEGARFPVLTPNLKGFEAAVAAGAKEVAIFASASESF  187

Query  1038  skANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHE  859
             SK+NINCSIEESL RYR V  AA+K S+PVRGY+SCVVGCP+EG +  S VAY+AKEL+ 
Sbjct  188   SKSNINCSIEESLHRYRQVADAARKHSLPVRGYVSCVVGCPIEGMVPASNVAYVAKELYS  247

Query  858   MGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVC  679
             MGC EISLGDTIGV TPGTVIPMLE+V  VVP E LAVHFHDTYGQ+L NILVSLQMG+ 
Sbjct  248   MGCSEISLGDTIGVGTPGTVIPMLESVANVVPTENLAVHFHDTYGQALSNILVSLQMGIG  307

Query  678   TVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRES  499
             TVDSSVSGLGGCPYAKGA+GNVATEDVVYML+G+G KTNVDLGKL+ AG+FI K LGR S
Sbjct  308   TVDSSVSGLGGCPYAKGASGNVATEDVVYMLNGIGAKTNVDLGKLMLAGDFICKQLGRPS  367

Query  498   SSKAAIALTRVSADASK  448
             +SK AIAL +V+++ +K
Sbjct  368   ASKVAIALRKVASNTNK  384



>ref|XP_003554113.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Glycine max]
Length=412

 Score =   447 bits (1150),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 235/308 (76%), Positives = 269/308 (87%), Gaps = 0/308 (0%)
 Frame = -3

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
             L   +P YVKIVEVG RDGLQNEK  +PT+VKVELI+ LVS GL VVE T FVSPKWVPQ
Sbjct  105   LLTSIPDYVKIVEVGARDGLQNEKAIIPTNVKVELIKLLVSSGLSVVEATSFVSPKWVPQ  164

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+DAKDV+ A++N+EGAR PVLTPNLKGFEAA+A+GAKEVAVF +ASESFSKAN+N SIE
Sbjct  165   LADAKDVLAAIQNVEGARFPVLTPNLKGFEAAVAAGAKEVAVFPAASESFSKANLNSSIE  224

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ++L R   + SAA+ LSIPVRGYISCVVGCP+EG I P+KVAY+AK L+EMGC EISLGD
Sbjct  225   DNLARCHDIASAARSLSIPVRGYISCVVGCPLEGNIAPAKVAYVAKSLYEMGCSEISLGD  284

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTVI MLEAV+ VVP + LAVHFHDTYGQ+L NIL+SLQMG+ TVDSSVSGLG
Sbjct  285   TIGVGTPGTVISMLEAVLDVVPTDMLAVHFHDTYGQALSNILISLQMGISTVDSSVSGLG  344

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGATGNVATEDVVYML+GLGVKTNVDLGKL+ AG+FI KHLGR S SKAA AL++
Sbjct  345   GCPYAKGATGNVATEDVVYMLNGLGVKTNVDLGKLMLAGDFICKHLGRASGSKAATALSK  404

Query  468   VSADASKI  445
             V++ ASK+
Sbjct  405   VTSHASKL  412



>ref|XP_007162069.1| hypothetical protein PHAVU_001G121000g [Phaseolus vulgaris]
 gb|ESW34063.1| hypothetical protein PHAVU_001G121000g [Phaseolus vulgaris]
Length=409

 Score =   447 bits (1149),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 245/361 (68%), Positives = 285/361 (79%), Gaps = 19/361 (5%)
 Frame = -3

Query  1524  WIDGRNCSSSNSCDEDFDEYGRGSYGWKRQFRDRPYNGVSNRRSF-SGGWRNVLFNGVPK  1348
             W    N  S +SC           Y   R F        S+R    + G+ + L   +P 
Sbjct  67    WTSRPNYCSHDSC-----------YVINRHF-------TSDRNDICTKGFSSKLLKTIPY  108

Query  1347  YVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDV  1168
             YVKIVEVG RDGLQNEK  +PT+VKVELI+ LVS GL VVE T FVSPKWVPQL+DAKDV
Sbjct  109   YVKIVEVGARDGLQNEKAIIPTNVKVELIQLLVSSGLSVVEATSFVSPKWVPQLADAKDV  168

Query  1167  MQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVRYR  988
             + A++N+EGAR PVLTPN+KGFEAA+A+GAKEVAVF +ASESFSKAN+NC IEE+L R R
Sbjct  169   LAAIQNVEGARFPVLTPNIKGFEAAVAAGAKEVAVFPAASESFSKANLNCGIEENLARCR  228

Query  987   AVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATP  808
              + SAA  LSIPVRGYISCVVGCP+EG I P KVAY+AK L+EMGC EISLGDTIGV TP
Sbjct  229   DIASAAGSLSIPVRGYISCVVGCPLEGNIAPEKVAYVAKSLYEMGCAEISLGDTIGVGTP  288

Query  807   GTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKG  628
             GTVI MLEAV+ VVP++ LAVHFHDTYGQ+L NIL+SLQMG+ TVDSSV+GLGGCPYAKG
Sbjct  289   GTVIRMLEAVVDVVPIDMLAVHFHDTYGQALSNILISLQMGISTVDSSVAGLGGCPYAKG  348

Query  627   ATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSADASK  448
             ATGNVATEDVVYML+GLGVKTNVDLGKL+ AG+FI +HLGR S SKAA AL++V++ ASK
Sbjct  349   ATGNVATEDVVYMLNGLGVKTNVDLGKLMLAGDFICRHLGRASGSKAATALSKVTSHASK  408

Query  447   I  445
             +
Sbjct  409   L  409



>gb|ABN08537.1| Pyruvate carboxyltransferase [Medicago truncatula]
 gb|AES81167.2| hydroxymethylglutaryl-CoA lyase [Medicago truncatula]
Length=402

 Score =   446 bits (1148),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 242/344 (70%), Positives = 281/344 (82%), Gaps = 7/344 (2%)
 Frame = -3

Query  1473  DEYGRGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKN  1294
             D +   SY   R FR    NG+  +  FS   R      +P +VKIVEVG RDGLQNEK 
Sbjct  65    DNHHAASYVVNRHFR-ADNNGICTKE-FSSKLRK----NIPDFVKIVEVGARDGLQNEKA  118

Query  1293  NVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPN  1114
              VPT VK+ELI+ LVS GL VVE T FVSPKWVPQL+DAKDV+ AV+++EGA  PVLTPN
Sbjct  119   IVPTDVKIELIKLLVSSGLSVVEATSFVSPKWVPQLADAKDVLAAVRDVEGASFPVLTPN  178

Query  1113  LKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYIS  934
             LKGFEAA+A+GAKEVAVF +ASESFSKAN+NC IE++L R R + SA++ L+IPVRGYIS
Sbjct  179   LKGFEAAVAAGAKEVAVFPAASESFSKANLNCGIEDNLARCRDIASASRSLTIPVRGYIS  238

Query  933   CVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEK  754
             CVVGCP+EG I P KVAY+AK L+EMG  EISLGDTIGV TPGTVIPMLEAV+ VVP++K
Sbjct  239   CVVGCPLEGRIAPVKVAYVAKSLYEMGISEISLGDTIGVGTPGTVIPMLEAVLDVVPIDK  298

Query  753   LAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLG  574
             LAVHFHDTYGQ+L NIL+SLQMG+ TVDSSVSGLGGCPYAKGATGNVATEDVVYML+GLG
Sbjct  299   LAVHFHDTYGQALSNILISLQMGISTVDSSVSGLGGCPYAKGATGNVATEDVVYMLNGLG  358

Query  573   VKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSA-DASKI  445
             VKTNVDLGKL+ AG+FI KHLGR + SKAA AL +V+  +ASK+
Sbjct  359   VKTNVDLGKLMHAGDFICKHLGRPTGSKAATALNKVTTCNASKL  402



>ref|XP_004493382.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Cicer arietinum]
Length=429

 Score =   446 bits (1148),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 245/376 (65%), Positives = 290/376 (77%), Gaps = 21/376 (6%)
 Frame = -3

Query  1521  IDGRNCSSSNSCDEDFDEYG----RGSYGWKRQFRDRPY--NGVSNR-----------RS  1393
             +D R  ++       FD+Y      G   W  +  D  +  N V NR           + 
Sbjct  58    LDFREITNRRELTNAFDKYNINILSGWLNWTSRANDNHHGANYVVNRHFKTDRKDRCTKE  117

Query  1392  FSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGF  1213
             FS   R  L N VP +VKIVEVGPRDGLQNEK  VPT VK+ELI+ LVS GL VVE T F
Sbjct  118   FS---RKFLEN-VPDFVKIVEVGPRDGLQNEKVIVPTDVKIELIKLLVSSGLSVVEATSF  173

Query  1212  VSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfsk  1033
             VSPKWVPQL+DAKDV+ A++N+EGA  PVLTPNLKGFEAA+A+GAKEVA+F +ASESFSK
Sbjct  174   VSPKWVPQLADAKDVLAAIRNVEGASFPVLTPNLKGFEAAVAAGAKEVAIFPAASESFSK  233

Query  1032  ANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMG  853
             AN+NC IE++L R R + SA++ L+IPVRGY+SCVVGCP+EG I P+KVAY+AK L+EMG
Sbjct  234   ANLNCGIEDNLTRCRDIASASRSLAIPVRGYVSCVVGCPLEGKIAPAKVAYVAKSLYEMG  293

Query  852   CFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTV  673
             C EISLGDTIGV TP TVI MLEAV+ VVP++KLAVHFHDTYGQ+L N L+SLQMG+ TV
Sbjct  294   CSEISLGDTIGVGTPATVISMLEAVLDVVPIDKLAVHFHDTYGQALSNTLISLQMGISTV  353

Query  672   DSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSS  493
             DSSVSGLGGCPYAKGATGNVATEDVVYML+GLGV+TNVDLGKL+ AG+FI  HLGR S S
Sbjct  354   DSSVSGLGGCPYAKGATGNVATEDVVYMLNGLGVQTNVDLGKLMLAGDFICNHLGRASGS  413

Query  492   KAAIALTRVSADASKI  445
             KAA AL +V+ +ASK+
Sbjct  414   KAATALNKVTNNASKV  429



>ref|XP_004289586.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=339

 Score =   442 bits (1138),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 233/315 (74%), Positives = 272/315 (86%), Gaps = 1/315 (0%)
 Frame = -3

Query  1404  NRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVE  1225
             N  + SG + +   N +P++VKIVEVGPRDGLQNEK  +PT VK++LI  LVS GL VVE
Sbjct  23    NNGAVSGAFSST-NNKIPEFVKIVEVGPRDGLQNEKQVIPTHVKIKLIEMLVSSGLTVVE  81

Query  1224  VTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasase  1045
              T FVSPKW+PQL+DAKDVM+A++N+ G R PVLTPNLKGFEAA+A+GAKEVA+FASASE
Sbjct  82    ATSFVSPKWIPQLADAKDVMKAIRNMGGVRFPVLTPNLKGFEAAVAAGAKEVAIFASASE  141

Query  1044  sfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKEL  865
             SFSK+NINCSIE+SL RYR V  AA+KL IPVRGYIS VVGCP++GA+ PS+VAY+AKEL
Sbjct  142   SFSKSNINCSIEDSLRRYRDVAIAARKLCIPVRGYISRVVGCPIQGAVPPSQVAYVAKEL  201

Query  864   HEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMG  685
              +MGCF+ISLGDTIGV TPGT++PMLE V+ VVP EKLAVHFHDTYGQ+L NILVSLQMG
Sbjct  202   LDMGCFDISLGDTIGVGTPGTIVPMLEEVIDVVPTEKLAVHFHDTYGQALSNILVSLQMG  261

Query  684   VCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGR  505
             + TVDSSVSGLGGCPYAKGA+GNVATEDVVYML+GLGVKTNVDL KL+ AG+FI KHLGR
Sbjct  262   ISTVDSSVSGLGGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLQKLMLAGDFICKHLGR  321

Query  504   ESSSKAAIALTRVSA  460
              S SK AIAL +V +
Sbjct  322   SSCSKTAIALNKVHS  336



>ref|XP_004159633.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Cucumis sativus]
Length=392

 Score =   444 bits (1143),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 235/317 (74%), Positives = 272/317 (86%), Gaps = 1/317 (0%)
 Frame = -3

Query  1398  RSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVT  1219
             R   GG    L   +P +VKIVEVGPRDGLQNEK+ VPT+VKV+LI+ LVS GLPVVE T
Sbjct  69    RENKGGLSQYLCR-IPPFVKIVEVGPRDGLQNEKHIVPTAVKVDLIKMLVSSGLPVVEAT  127

Query  1218  GFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesf  1039
              FVSPKWVPQL+DAK+VM+ ++N+EGAR PVLTPNLKGFEAA+A+GAKEVA+FASASESF
Sbjct  128   SFVSPKWVPQLADAKEVMEGIRNVEGARFPVLTPNLKGFEAAVAAGAKEVAIFASASESF  187

Query  1038  skANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHE  859
             SK+NINCSIEESL RYR V  AA+K S+PVRGY+SCVVGCP+EG +  S VAY+AKEL+ 
Sbjct  188   SKSNINCSIEESLHRYRQVADAARKHSLPVRGYVSCVVGCPIEGMVPASNVAYVAKELYS  247

Query  858   MGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVC  679
             MGC EISLGDTIGV TPGTVIPMLE+V  VVP E LAVHFHDTYGQ+L NILVSLQMG+ 
Sbjct  248   MGCSEISLGDTIGVGTPGTVIPMLESVANVVPTENLAVHFHDTYGQALSNILVSLQMGIG  307

Query  678   TVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRES  499
              VDSSVSGLGGCPYAKGA+GNVATEDVVYML+G+G KTNVDLGKL+ AG+FI K LGR S
Sbjct  308   AVDSSVSGLGGCPYAKGASGNVATEDVVYMLNGIGAKTNVDLGKLMLAGDFICKQLGRPS  367

Query  498   SSKAAIALTRVSADASK  448
             +SK AIAL +V+++ +K
Sbjct  368   ASKVAIALRKVASNTNK  384



>ref|XP_004977480.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Setaria italica]
Length=389

 Score =   443 bits (1140),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 252/392 (64%), Positives = 300/392 (77%), Gaps = 13/392 (3%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCDEDFDEYGR  1459
             EEPL L  LP+LS IDR+ G  SS                D  N   +NSC+        
Sbjct  5     EEPLGLGDLPKLS-IDRL-GSLSSPRAY-----RRAAAADDINNRKYNNSCNGSTQMVFH  57

Query  1458  G-SYGWKRQFRDRPYN-GVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVP  1285
             G S+ W  Q R    +  V   R      R V+++ +P +VKIVEV PRDGLQNEK NVP
Sbjct  58    GNSHAWHPQCRQADSSCDVVELRDLP---RKVMWD-LPSFVKIVEVAPRDGLQNEKGNVP  113

Query  1284  TSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKG  1105
             TSVK++LI KLV+ GL VVE T FVSPKWVPQL+DAK+V++ ++ + G R PVLTPNL+G
Sbjct  114   TSVKIQLIHKLVAAGLSVVEATSFVSPKWVPQLADAKEVLKGIQQVPGVRHPVLTPNLRG  173

Query  1104  FEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVV  925
             FEAA+A+GAKE+AVFASASESFSK+NINC+IEESLVRYR VT+AAKK  + +RGY+SCV+
Sbjct  174   FEAAVAAGAKEIAVFASASESFSKSNINCTIEESLVRYRDVTAAAKKHGLLIRGYVSCVI  233

Query  924   GCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAV  745
             GCPVEGAI PSKVAY+AKEL+ MGC EISLGDTIGV TPG+V  MLEAVM+ VPV+K+AV
Sbjct  234   GCPVEGAIDPSKVAYVAKELYNMGCSEISLGDTIGVGTPGSVAAMLEAVMSFVPVDKIAV  293

Query  744   HFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKT  565
             HFHDTYGQ+L NILVSLQMG+  VDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLG++T
Sbjct  294   HFHDTYGQALANILVSLQMGISIVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGIET  353

Query  564   NVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             NVDL KL++AG++IS+HLGR   SK A AL +
Sbjct  354   NVDLNKLMEAGDYISRHLGRPVGSKTAAALRK  385



>ref|NP_001066093.1| Os12g0134000 [Oryza sativa Japonica Group]
 gb|ABG21875.1| Hydroxymethylglutaryl-CoA lyase, mitochondrial precursor, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29112.1| Os12g0134000 [Oryza sativa Japonica Group]
 dbj|BAG90190.1| unnamed protein product [Oryza sativa Japonica Group]
Length=377

 Score =   442 bits (1138),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 233/340 (69%), Positives = 283/340 (83%), Gaps = 10/340 (3%)
 Frame = -3

Query  1455  SYGW---KRQFRDRPYNGVSNRRS------FSGGWRNVLFNGVPKYVKIVEVGPRDGLQN  1303
             + GW      F  R +   SNRR+       +   ++VL++ +P++VKIVEVGPRDGLQN
Sbjct  38    AMGWIWSSELFHGRFHQTTSNRRNELTCSIMTVAMQHVLWD-LPRFVKIVEVGPRDGLQN  96

Query  1302  EKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVL  1123
             EKN VPTSVK+ELI KLV+ GL VVE T FVSPKWVPQL+DAKDV++ +K++   R PVL
Sbjct  97    EKNTVPTSVKIELIHKLVASGLSVVEATSFVSPKWVPQLADAKDVVEGIKHVPDVRFPVL  156

Query  1122  TPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRG  943
             TPNL+GFEAA+A+GAKEVAVFASASESFSK+N+NC+I+ESLVRY  V ++AKK  I +RG
Sbjct  157   TPNLRGFEAAVAAGAKEVAVFASASESFSKSNLNCTIKESLVRYHDVVTSAKKHGIRIRG  216

Query  942   YISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVP  763
             Y+SCVVGCPVEG I PSKVAY+AKEL++MGC EISLGDTIGV TPG+V+ MLEAVM+ VP
Sbjct  217   YVSCVVGCPVEGTIHPSKVAYVAKELYDMGCSEISLGDTIGVGTPGSVLAMLEAVMSFVP  276

Query  762   VEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLH  583
             V+K+AVHFHDTYGQ+L NILVSLQ+G+  VDSSVSGLGGCPYAKGATGNVATEDVVYMLH
Sbjct  277   VDKIAVHFHDTYGQALANILVSLQLGINIVDSSVSGLGGCPYAKGATGNVATEDVVYMLH  336

Query  582   GLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVS  463
             GLG++TNVDL KL+ AG++ISKHLGR+S SK   AL +++
Sbjct  337   GLGIETNVDLNKLMDAGDYISKHLGRQSGSKTTTALRKLT  376



>gb|KHF99280.1| Hydroxymethylglutaryl-CoA lyase, mitochondrial -like protein 
[Gossypium arboreum]
Length=378

 Score =   441 bits (1135),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 242/385 (63%), Positives = 291/385 (76%), Gaps = 14/385 (4%)
 Frame = -3

Query  1608  RLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCDEDFDEYGRGSYGWKRQFR  1429
             RL  I R+ G  ++ +      +     WI+  N       ++D D     +Y +     
Sbjct  6     RLDKISRLMGSRATPSAFLKAFNKESLLWIESLNPKVRLLGNDDGDAVRFSTYHYSSNCN  65

Query  1428  DRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLV  1249
               P N V          RN+     P +VKIVEVGPRDGLQNEK  VPTS KV+LI+ LV
Sbjct  66    HSPTNKV---------LRNL-----PAHVKIVEVGPRDGLQNEKEIVPTSTKVQLIKMLV  111

Query  1248  SCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakev  1069
             S GL VVE T FVSPKWVPQL+DAKDVM A++N++GAR PVL PNLKGFEAA+++GAKEV
Sbjct  112   SSGLTVVEATSFVSPKWVPQLADAKDVMDAIQNIQGARFPVLIPNLKGFEAAVSAGAKEV  171

Query  1068  avfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSK  889
             A+FASASESFSK+NINCSIE+SL R+R V SAA+++S+PVRGY+SCVVGCPVEG + PSK
Sbjct  172   AIFASASESFSKSNINCSIEDSLARFRDVVSAAREISLPVRGYVSCVVGCPVEGIVPPSK  231

Query  888   VAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPN  709
             VAY+AK+L +MGC EISLGDTIGV TPGT+IPMLE VM VVP++ LAVHFHDTYGQ+L N
Sbjct  232   VAYVAKQLFDMGCSEISLGDTIGVGTPGTIIPMLENVMNVVPIDNLAVHFHDTYGQALSN  291

Query  708   ILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGE  529
             IL SLQMG+ TVDSSVSGLGGCPYAKGA+GNVATEDVVYML+GLG++TNVDL KLL AG+
Sbjct  292   ILTSLQMGISTVDSSVSGLGGCPYAKGASGNVATEDVVYMLNGLGIETNVDLEKLLLAGD  351

Query  528   FISKHLGRESSSKAAIALTRVSADA  454
             FI KHL R  SSK A+AL+   A++
Sbjct  352   FICKHLRRPPSSKTAVALSSKKANS  376



>ref|XP_008798375.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X3 [Phoenix dactylifera]
Length=437

 Score =   443 bits (1140),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 251/422 (59%), Positives = 305/422 (72%), Gaps = 53/422 (13%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDG-MGERWIDGRNCSSSNSCDEDF----  1474
             EEPL +D LP  S   +   RF+S+ACRP  DD  M    I+GR+  SS  C+E++    
Sbjct  45    EEPLGIDNLPNWSA--QKLQRFTSSACRPKQDDSEMSNCTIEGRHHISSYICNEEYTGER  102

Query  1473  ---DEYGRGSYGWKRQF---RDRPYNGVSNRRSFSG-------------GWRNVLFNGVP  1351
                ++    S+  +  +     R Y+G+   R   G             G  + L   +P
Sbjct  103   QPWEKIRPKSFTLRTSYFGRYQRVYDGLYGSRDLQGCYFSSSRSDREITGPTSKLLRDLP  162

Query  1350  KYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKD  1171
              +V +VEVGPRDGLQNEKN VPT VK+ELIR+LVS GLPVVE T FVSPKWVPQ      
Sbjct  163   SFVNVVEVGPRDGLQNEKNIVPTPVKIELIRRLVSSGLPVVEATSFVSPKWVPQ------  216

Query  1170  VMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVRY  991
                                  GFEAA+A+GAKEVAVFASASESFSK+NINCSI++SL RY
Sbjct  217   ---------------------GFEAAVAAGAKEVAVFASASESFSKSNINCSIKDSLARY  255

Query  990   RAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVAT  811
             R VT AAK+ ++PVRGY+SCVVGCP+EG + PSKVAY++K+L++MGC EISLGDTIGV T
Sbjct  256   RDVTVAAKRFAMPVRGYVSCVVGCPIEGEVPPSKVAYVSKQLYDMGCSEISLGDTIGVGT  315

Query  810   PGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAK  631
             PGTV+PMLEAVM+VVPV+KLAVHFHDTYGQSLPNILVSLQMG+  VDSS++GLGGCPYAK
Sbjct  316   PGTVLPMLEAVMSVVPVQKLAVHFHDTYGQSLPNILVSLQMGISIVDSSIAGLGGCPYAK  375

Query  630   GATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSADAS  451
             GA+GNVATEDVVYMLHGLG++TNVDLGKL+ AG+FI KHL R+S SK AIALTR++A+AS
Sbjct  376   GASGNVATEDVVYMLHGLGIETNVDLGKLMAAGDFICKHLQRQSGSKTAIALTRITANAS  435

Query  450   KI  445
             K+
Sbjct  436   KM  437



>dbj|BAD81168.1| putative hydroxymethylglutaryl-CoA lyase [Oryza sativa Japonica 
Group]
Length=419

 Score =   442 bits (1137),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 232/312 (74%), Positives = 272/312 (87%), Gaps = 2/312 (1%)
 Frame = -3

Query  1374  NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
             N + + +P+ VKIVEVGPRDGLQNEKN VPT VK+ELI++L + GL VVE T FVSPKWV
Sbjct  108   NKIIHDLPRSVKIVEVGPRDGLQNEKNIVPTHVKIELIQRLATSGLSVVEATSFVSPKWV  167

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDVM  V+N+EG  LPVLTPNLKGFEAA+A+GAKEVAVFASASE+FSK+NINC+
Sbjct  168   PQLADAKDVMDVVRNIEGVSLPVLTPNLKGFEAAVAAGAKEVAVFASASEAFSKSNINCT  227

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             I+ESL RY+ V  AAK+L IP+RGY+SCVVGCPVEG + PS VA++AKEL++MGC+E+SL
Sbjct  228   IKESLARYKDVALAAKELKIPMRGYVSCVVGCPVEGYVPPSNVAHVAKELYDMGCYEVSL  287

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGV TPGTV+PMLEAVM  VP EKLAVHFHDTYGQSL NIL+SLQMGV  VDSSV+G
Sbjct  288   GDTIGVGTPGTVVPMLEAVMFFVPKEKLAVHFHDTYGQSLSNILISLQMGVSVVDSSVAG  347

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYML+GLG+ TNVDLGK++ AGEFI  HLGR+S SKAAIAL
Sbjct  348   LGGCPYAKGASGNVATEDVVYMLNGLGISTNVDLGKVMAAGEFICNHLGRQSGSKAAIAL  407

Query  474   TR--VSADASKI  445
                  +A+ASK+
Sbjct  408   GSKVATANASKL  419



>ref|XP_008677303.1| PREDICTED: LOC100283677 isoform X1 [Zea mays]
 gb|AFW64748.1| hypothetical protein ZEAMMB73_841440 [Zea mays]
Length=399

 Score =   440 bits (1132),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 253/404 (63%), Positives = 302/404 (75%), Gaps = 20/404 (5%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSS-NACRPVGDDGMGERWIDGRNCSSS---NSCDEDFD  1471
             EEPL L  LP+LS I+R+ GRF S  A RP  DD   +    G+  SSS    S    F 
Sbjct  5     EEPLGLGDLPKLS-INRL-GRFVSLGARRPPADD---DDHSTGKYSSSSCNNGSHQMAFH  59

Query  1470  EYGRGSYGWKRQFRDR--PYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEK  1297
                  SY W  Q R    P       R      R V++  +P++VKIVEVGPRDGLQNEK
Sbjct  60    HGSNSSYPWHPQCRQAADPSRDAVELRDLP---RKVMWE-LPRFVKIVEVGPRDGLQNEK  115

Query  1296  NNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTP  1117
              NVP SVK++LI KLV  GL VVE T FVSPKWVPQL+DA++V++ +K   G R PVLTP
Sbjct  116   GNVPASVKIQLIHKLVGAGLSVVEATSFVSPKWVPQLADAEEVLKGIKQEPGVRYPVLTP  175

Query  1116  NLKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYI  937
             NL+GFEAAIA+GAKE+AVFASASESFS++NINC+IEESL RYR VT+AAKK  + +RGY+
Sbjct  176   NLRGFEAAIAAGAKEIAVFASASESFSRSNINCTIEESLARYRGVTAAAKKHGLSIRGYV  235

Query  936   SCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVE  757
             SCV+ CPV GA  P+KVAY+AKEL+ MGC EISLGDT GV TPG+V+ ML+AVM+ VPV+
Sbjct  236   SCVIACPVGGATDPAKVAYVAKELYTMGCSEISLGDTTGVGTPGSVVAMLQAVMSFVPVD  295

Query  756   KLAVHFHDTYGQSLPNILVSLQ-----MGVCTVDSSVSGLGGCPYAKGATGNVATEDVVY  592
             K+AVHFHDTYGQ+L NILVSLQ     MG+  VDSSVSGLGGCPYAKGATGNVATEDVVY
Sbjct  296   KIAVHFHDTYGQALANILVSLQVSKATMGINIVDSSVSGLGGCPYAKGATGNVATEDVVY  355

Query  591   MLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSA  460
             MLHGLG++TNVDL KL++AG++ISKHLGR   SK A AL +++A
Sbjct  356   MLHGLGIETNVDLNKLMEAGDYISKHLGRPLGSKTATALRKLTA  399



>ref|NP_001042696.1| Os01g0269000 [Oryza sativa Japonica Group]
 dbj|BAF04610.1| Os01g0269000 [Oryza sativa Japonica Group]
 gb|EEE54300.1| hypothetical protein OsJ_01235 [Oryza sativa Japonica Group]
Length=459

 Score =   442 bits (1138),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 232/312 (74%), Positives = 272/312 (87%), Gaps = 2/312 (1%)
 Frame = -3

Query  1374  NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
             N + + +P+ VKIVEVGPRDGLQNEKN VPT VK+ELI++L + GL VVE T FVSPKWV
Sbjct  148   NKIIHDLPRSVKIVEVGPRDGLQNEKNIVPTHVKIELIQRLATSGLSVVEATSFVSPKWV  207

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDVM  V+N+EG  LPVLTPNLKGFEAA+A+GAKEVAVFASASE+FSK+NINC+
Sbjct  208   PQLADAKDVMDVVRNIEGVSLPVLTPNLKGFEAAVAAGAKEVAVFASASEAFSKSNINCT  267

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             I+ESL RY+ V  AAK+L IP+RGY+SCVVGCPVEG + PS VA++AKEL++MGC+E+SL
Sbjct  268   IKESLARYKDVALAAKELKIPMRGYVSCVVGCPVEGYVPPSNVAHVAKELYDMGCYEVSL  327

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGV TPGTV+PMLEAVM  VP EKLAVHFHDTYGQSL NIL+SLQMGV  VDSSV+G
Sbjct  328   GDTIGVGTPGTVVPMLEAVMFFVPKEKLAVHFHDTYGQSLSNILISLQMGVSVVDSSVAG  387

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYML+GLG+ TNVDLGK++ AGEFI  HLGR+S SKAAIAL
Sbjct  388   LGGCPYAKGASGNVATEDVVYMLNGLGISTNVDLGKVMAAGEFICNHLGRQSGSKAAIAL  447

Query  474   TR--VSADASKI  445
                  +A+ASK+
Sbjct  448   GSKVATANASKL  459



>gb|KEH23586.1| hydroxymethylglutaryl-CoA lyase [Medicago truncatula]
Length=312

 Score =   437 bits (1123),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 232/309 (75%), Positives = 268/309 (87%), Gaps = 1/309 (0%)
 Frame = -3

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
             L   +P +VKIVEVG RDGLQNEK  VPT VK+ELI+ LVS GL VVE T FVSPKWVPQ
Sbjct  4     LRKNIPDFVKIVEVGARDGLQNEKAIVPTDVKIELIKLLVSSGLSVVEATSFVSPKWVPQ  63

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+DAKDV+ AV+++EGA  PVLTPNLKGFEAA+A+GAKEVAVF +ASESFSKAN+NC IE
Sbjct  64    LADAKDVLAAVRDVEGASFPVLTPNLKGFEAAVAAGAKEVAVFPAASESFSKANLNCGIE  123

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ++L R R + SA++ L+IPVRGYISCVVGCP+EG I P KVAY+AK L+EMG  EISLGD
Sbjct  124   DNLARCRDIASASRSLTIPVRGYISCVVGCPLEGRIAPVKVAYVAKSLYEMGISEISLGD  183

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTVIPMLEAV+ VVP++KLAVHFHDTYGQ+L NIL+SLQMG+ TVDSSVSGLG
Sbjct  184   TIGVGTPGTVIPMLEAVLDVVPIDKLAVHFHDTYGQALSNILISLQMGISTVDSSVSGLG  243

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGATGNVATEDVVYML+GLGVKTNVDLGKL+ AG+FI KHLGR + SKAA AL +
Sbjct  244   GCPYAKGATGNVATEDVVYMLNGLGVKTNVDLGKLMHAGDFICKHLGRPTGSKAATALNK  303

Query  468   VSA-DASKI  445
             V+  +ASK+
Sbjct  304   VTTCNASKL  312



>emb|CBX25247.1| hypothetical_protein [Oryza brachyantha]
Length=406

 Score =   440 bits (1132),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 253/413 (61%), Positives = 309/413 (75%), Gaps = 33/413 (8%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCDEDFDEYGR  1459
             EEPL L  LP+LS I+R++ RFS +ACR   DD    +  +G N  +          +  
Sbjct  5     EEPLGLGDLPKLS-INRLE-RFSPSACRASADDTFSYKQRNGGNNQTI---------FHS  53

Query  1458  GSYGWKRQ--FRDRPYNGVSNR-RSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNV  1288
              ++ W  Q  + D   NGV    R+       VL++ +P++VKIVEVGPRDGLQNEKN V
Sbjct  54    SAHSWHMQGRYTDSSCNGVDMEFRALPRKVVQVLWD-LPRFVKIVEVGPRDGLQNEKNTV  112

Query  1287  PTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ--LSDAKDVMQAVKNLEGARLPVLTPN  1114
             PTSVK+ELI KLV+ GL VVE T FVSPKWVPQ  L+DAKDV++ ++++   R PVLTPN
Sbjct  113   PTSVKIELIHKLVASGLSVVEATSFVSPKWVPQVQLADAKDVVEGIRHVPDVRFPVLTPN  172

Query  1113  LKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYIS  934
             L+GFEAA+A+GAKEVAVFASASESFSK+N+NC+I+ESLVRYR V ++AKK  I +RGY+S
Sbjct  173   LRGFEAAVAAGAKEVAVFASASESFSKSNLNCTIKESLVRYRDVITSAKKHGIRLRGYVS  232

Query  933   CVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGT--------------VI  796
             CVVGCPVEGAI PSKVAY+AKEL++MGC EISLGDTIGV TPG+              V+
Sbjct  233   CVVGCPVEGAIHPSKVAYVAKELYDMGCSEISLGDTIGVGTPGSGPVVFAFSMSFLGSVL  292

Query  795   PMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQ--MGVCTVDSSVSGLGGCPYAKGAT  622
              MLEAVM+ V V+KLAVHFHDTYGQ+L NI+VSLQ  MG+  VDSSVSGLGGCPYA GAT
Sbjct  293   AMLEAVMSFVSVDKLAVHFHDTYGQALANIMVSLQVQMGINIVDSSVSGLGGCPYANGAT  352

Query  621   GNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVS  463
             GNVATEDVVYMLHGLG++TNVDL KL+ AG++ISKHLGR S SK   AL +++
Sbjct  353   GNVATEDVVYMLHGLGIETNVDLNKLMDAGDYISKHLGRPSGSKTTTALRKLT  405



>gb|EEC70380.1| hypothetical protein OsI_01328 [Oryza sativa Indica Group]
Length=459

 Score =   442 bits (1136),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 232/312 (74%), Positives = 272/312 (87%), Gaps = 2/312 (1%)
 Frame = -3

Query  1374  NVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWV  1195
             N + + +P+ VKIVEVGPRDGLQNEKN VPT VK+ELI++L + GL VVE T FVSPKWV
Sbjct  148   NKIIHDLPRSVKIVEVGPRDGLQNEKNIVPTHVKIELIQRLATSGLSVVEATSFVSPKWV  207

Query  1194  PQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCS  1015
             PQL+DAKDVM  V+N+EG  LPVLTPNLKGFEAA+A+GAKEVAVFASASE+FSK+NINC+
Sbjct  208   PQLADAKDVMDVVRNIEGVSLPVLTPNLKGFEAAVAAGAKEVAVFASASEAFSKSNINCT  267

Query  1014  IEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISL  835
             I+ESL RY+ V  AAK+L IP+RGY+SCVVGCPVEG + PS VA++AKEL++MGC+E+SL
Sbjct  268   IKESLARYKDVALAAKELKIPMRGYVSCVVGCPVEGYVPPSNVAHVAKELYDMGCYEVSL  327

Query  834   GDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSG  655
             GDTIGV TPGTV+PMLEAVM  VP EKLAVHFHDTYGQSL NIL+SLQMGV  VDSSV+G
Sbjct  328   GDTIGVGTPGTVVPMLEAVMFFVPKEKLAVHFHDTYGQSLSNILISLQMGVSVVDSSVAG  387

Query  654   LGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             LGGCPYAKGA+GNVATEDVVYML+GLG+ TNVDLGK++ AGEFI  HLGR+S SKAAIAL
Sbjct  388   LGGCPYAKGASGNVATEDVVYMLNGLGISTNVDLGKVMAAGEFICNHLGRQSGSKAAIAL  447

Query  474   TR--VSADASKI  445
                  +A+ASK+
Sbjct  448   GSKVATANASKL  459



>ref|XP_003624949.1| Hydroxymethylglutaryl-CoA lyase [Medicago truncatula]
Length=369

 Score =   437 bits (1125),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 232/309 (75%), Positives = 268/309 (87%), Gaps = 1/309 (0%)
 Frame = -3

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
             L   +P +VKIVEVG RDGLQNEK  VPT VK+ELI+ LVS GL VVE T FVSPKWVPQ
Sbjct  61    LRKNIPDFVKIVEVGARDGLQNEKAIVPTDVKIELIKLLVSSGLSVVEATSFVSPKWVPQ  120

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+DAKDV+ AV+++EGA  PVLTPNLKGFEAA+A+GAKEVAVF +ASESFSKAN+NC IE
Sbjct  121   LADAKDVLAAVRDVEGASFPVLTPNLKGFEAAVAAGAKEVAVFPAASESFSKANLNCGIE  180

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ++L R R + SA++ L+IPVRGYISCVVGCP+EG I P KVAY+AK L+EMG  EISLGD
Sbjct  181   DNLARCRDIASASRSLTIPVRGYISCVVGCPLEGRIAPVKVAYVAKSLYEMGISEISLGD  240

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTVIPMLEAV+ VVP++KLAVHFHDTYGQ+L NIL+SLQMG+ TVDSSVSGLG
Sbjct  241   TIGVGTPGTVIPMLEAVLDVVPIDKLAVHFHDTYGQALSNILISLQMGISTVDSSVSGLG  300

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGATGNVATEDVVYML+GLGVKTNVDLGKL+ AG+FI KHLGR + SKAA AL +
Sbjct  301   GCPYAKGATGNVATEDVVYMLNGLGVKTNVDLGKLMHAGDFICKHLGRPTGSKAATALNK  360

Query  468   VSA-DASKI  445
             V+  +ASK+
Sbjct  361   VTTCNASKL  369



>emb|CBX25345.1| hypothetical_protein [Oryza brachyantha]
Length=382

 Score =   437 bits (1123),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 246/398 (62%), Positives = 302/398 (76%), Gaps = 27/398 (7%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCDEDFDEYGR  1459
             E+PL L  LP+LS I+R++ RFS +ACR                 +S+        E  R
Sbjct  5     EQPLGLGDLPKLS-INRLE-RFSPSACR-----------------ASAEVTSIAMVEMTR  45

Query  1458  GSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLFNG-----VPKYVKIVEVGPRDGLQNEKN  1294
              S+        +    + +   +   W + LF+G     +P++VKIVEVGPRDGLQNEKN
Sbjct  46    RSFTVVLHGICKDTTPIHHAMEWI--WSSELFHGQVLWDLPRFVKIVEVGPRDGLQNEKN  103

Query  1293  NVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPN  1114
              VPTSVK+ELI KLV+ GL V+E T FVSPKWVPQL+DAKDV++ ++++   R PVLTPN
Sbjct  104   TVPTSVKIELIHKLVASGLSVIEATSFVSPKWVPQLADAKDVVEGIRHVPDVRFPVLTPN  163

Query  1113  LKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYIS  934
             LKGFEAA+A+GAKEVAVFASASESFSK+N+NC+I+ESLVRYR V ++AKK  I +R Y+S
Sbjct  164   LKGFEAAVAAGAKEVAVFASASESFSKSNLNCTIKESLVRYRDVITSAKKHGIGLRRYVS  223

Query  933   CVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPG-TVIPMLEAVMAVVPVE  757
             CVVGCPVEG I PSKVAY+AKEL++MGC EISLGDTIGV TPG +V+ MLEAVM+ VPV+
Sbjct  224   CVVGCPVEGTIHPSKVAYVAKELYDMGCSEISLGDTIGVGTPGGSVLAMLEAVMSFVPVD  283

Query  756   KLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGL  577
             KLAVHFHDTYGQ+L NI+VSLQMG+  VDSSVSGLGGCPYA GATGNVATEDVVYMLHGL
Sbjct  284   KLAVHFHDTYGQALANIMVSLQMGINIVDSSVSGLGGCPYANGATGNVATEDVVYMLHGL  343

Query  576   GVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVS  463
             G++TNVDL KL+ AG++ISKHLGR S SK   AL +++
Sbjct  344   GIETNVDLNKLMDAGDYISKHLGRPSGSKTTTALRKLT  381



>ref|XP_004980143.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Setaria italica]
Length=361

 Score =   435 bits (1118),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 224/296 (76%), Positives = 263/296 (89%), Gaps = 0/296 (0%)
 Frame = -3

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             +P +VKIVEVGPRDGLQNEK NVPTSVK++LI KLV+ GL VVE T FVSPKWVPQL+DA
Sbjct  62    LPSFVKIVEVGPRDGLQNEKGNVPTSVKIQLIHKLVAAGLSVVEATSFVSPKWVPQLADA  121

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
             K+V++ ++ + G R PVLTPNL+GFEAA+A+GAKE+AVFASASESFSK+NINC+IEESLV
Sbjct  122   KEVLKGIQQVPGVRYPVLTPNLRGFEAAVAAGAKEIAVFASASESFSKSNINCTIEESLV  181

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             RYR VT+AAKK  + +RGY+SCV+GCPVEGAI PSKVAY+AKEL+ MGC EISLGDTIGV
Sbjct  182   RYRDVTAAAKKHGLLIRGYVSCVIGCPVEGAIDPSKVAYVAKELYNMGCSEISLGDTIGV  241

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
              TPG+V  MLEAVM+ VPV+K+AVHFHDTYGQ+L NILVSLQMG+  VDSSVSGLGGCPY
Sbjct  242   GTPGSVAAMLEAVMSFVPVDKIAVHFHDTYGQALANILVSLQMGISIVDSSVSGLGGCPY  301

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             AKGATGNVATEDVVYMLHGLG++TNVDL KL++AG++IS+HLGR   SK A AL +
Sbjct  302   AKGATGNVATEDVVYMLHGLGIETNVDLNKLMEAGDYISRHLGRPVGSKTAAALRK  357



>emb|CBX25437.1| hypothetical_protein [Oryza glaberrima]
Length=381

 Score =   434 bits (1117),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 247/403 (61%), Positives = 300/403 (74%), Gaps = 38/403 (9%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDDGMGERWIDGRNCSSSNSCDEDFDEYGR  1459
             EEPL L  LP+LS I+R++ RFS NACR   DD      +                    
Sbjct  5     EEPLGLGDLPKLS-INRLE-RFSPNACRASADDLTSITMVAT------------------  44

Query  1458  GSYGWKRQFRDRPYNGVSNRR-----SFSGGWRNVLFNG-----VPKYVKIVEVGPRDGL  1309
                  +R F     +G+         +    W + LF+G     +P++VKIVEVGPRDGL
Sbjct  45    ----IRRSFTAVLIHGICKANILIPPAMEWIWSSELFHGRVLWELPRFVKIVEVGPRDGL  100

Query  1308  QNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLP  1129
             QNEK+ VP SVK+ELI KLV+ GL VVE T FVSPKWV   +DAKDV+Q ++++   R P
Sbjct  101   QNEKSTVPASVKIELIHKLVASGLSVVEATSFVSPKWV---ADAKDVLQGIRHVPDVRFP  157

Query  1128  VLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPV  949
             VLTPNL+GFEAA+A+GAKEVAVFASASESFSK+N+NC+I+ESLVRYR V ++AKK  I +
Sbjct  158   VLTPNLRGFEAALAAGAKEVAVFASASESFSKSNLNCTIKESLVRYRDVVTSAKKHGIRI  217

Query  948   RG-YISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMA  772
             RG Y+SCVVGCPVEG I PSKVAY+AKEL++MGC EISLGDTIGV TPG+V+ MLEAVM+
Sbjct  218   RGRYVSCVVGCPVEGTIHPSKVAYVAKELYDMGCSEISLGDTIGVGTPGSVLAMLEAVMS  277

Query  771   VVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVY  592
              VPV+KLAVHFHDTYGQ+L NILVSLQ+G+  VDSSVSGLGGCPYAKGATGNVATEDVVY
Sbjct  278   FVPVDKLAVHFHDTYGQALANILVSLQLGINIVDSSVSGLGGCPYAKGATGNVATEDVVY  337

Query  591   MLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVS  463
             MLHGLG++TNVDL KL+ AG++ISKHLGR+S SK   AL +++
Sbjct  338   MLHGLGIETNVDLNKLMDAGDYISKHLGRQSGSKTTTALRKLT  380



>ref|XP_002990507.1| hypothetical protein SELMODRAFT_131779 [Selaginella moellendorffii]
 gb|EFJ08384.1| hypothetical protein SELMODRAFT_131779 [Selaginella moellendorffii]
Length=305

 Score =   419 bits (1076),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 221/305 (72%), Positives = 262/305 (86%), Gaps = 1/305 (0%)
 Frame = -3

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             +P++VKIVEVGPRDGLQNEK  VPT +KVELIRKL + GL VVE T FVSPKWVPQLSDA
Sbjct  1     MPEFVKIVEVGPRDGLQNEKKIVPTHIKVELIRKLCASGLQVVEATSFVSPKWVPQLSDA  60

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
             K+V+ A+K+L+G++ PVLTPN+KGF+AA+ +GA++VAVFA+ASESFSKANINC+I ESL 
Sbjct  61    KEVLHAIKSLQGSKFPVLTPNVKGFQAALDAGARDVAVFAAASESFSKANINCTISESLE  120

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             RY+ V   AK+  I VRGYISCVVGCP+EG + P KV Y+A EL+ MGC EISLGDTIGV
Sbjct  121   RYKQVCDLAKQHGISVRGYISCVVGCPIEGPVPPHKVGYVAGELYRMGCNEISLGDTIGV  180

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
              TPGT++PMLEAVM+VVPVE LAVH HDTYGQ+L NILV+LQMGV TVDSSVSGLGGCPY
Sbjct  181   GTPGTLVPMLEAVMSVVPVENLAVHMHDTYGQALSNILVALQMGVSTVDSSVSGLGGCPY  240

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVS-A  460
             AKGA+GNVATEDV+Y+L+GLGV TNVDL  +L AGEFIS+HLGR+S SK A+AL + S  
Sbjct  241   AKGASGNVATEDVIYLLNGLGVSTNVDLSLVLAAGEFISQHLGRQSGSKTAVALGKSSRC  300

Query  459   DASKI  445
             + SKI
Sbjct  301   EHSKI  305



>ref|XP_002983750.1| hypothetical protein SELMODRAFT_118899 [Selaginella moellendorffii]
 gb|EFJ15246.1| hypothetical protein SELMODRAFT_118899 [Selaginella moellendorffii]
Length=305

 Score =   418 bits (1075),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 221/305 (72%), Positives = 261/305 (86%), Gaps = 1/305 (0%)
 Frame = -3

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             +P++VKIVEVGPRDGLQNEK  VPT +KVELIRKL + GL VVE T FVSPKWVPQLSDA
Sbjct  1     MPEFVKIVEVGPRDGLQNEKKIVPTHIKVELIRKLCASGLQVVEATSFVSPKWVPQLSDA  60

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
             K+V+ A+K L+G++ PVLTPN+KGF+AA+ +GA++VAVFA+ASESFSKANINC+I ESL 
Sbjct  61    KEVLHAIKALQGSKFPVLTPNVKGFQAALDAGARDVAVFAAASESFSKANINCTISESLE  120

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             RY+ V   AK+  I VRGYISCVVGCP+EG + P KV Y+A EL+ MGC EISLGDTIGV
Sbjct  121   RYKQVCDLAKQHGISVRGYISCVVGCPIEGPVPPHKVGYVAGELYRMGCSEISLGDTIGV  180

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
              TPGT++PMLEAVM+VVPVE LAVH HDTYGQ+L NILV+LQMGV TVDSSVSGLGGCPY
Sbjct  181   GTPGTLVPMLEAVMSVVPVENLAVHMHDTYGQALSNILVALQMGVSTVDSSVSGLGGCPY  240

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVS-A  460
             AKGA+GNVATEDV+Y+L+GLGV TNVDL  +L AGEFIS+HLGR+S SK A+AL + S  
Sbjct  241   AKGASGNVATEDVIYLLNGLGVSTNVDLSLVLAAGEFISQHLGRQSGSKTAVALGKSSRC  300

Query  459   DASKI  445
             + SKI
Sbjct  301   EHSKI  305



>ref|XP_001771511.1| predicted protein [Physcomitrella patens]
 gb|EDQ63711.1| predicted protein [Physcomitrella patens]
Length=320

 Score =   417 bits (1072),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 217/298 (73%), Positives = 249/298 (84%), Gaps = 1/298 (0%)
 Frame = -3

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
             L  G+P YVKIVEVGPRDGLQNEK  VPT VKV LIR+L + GLPVVE T FVSPKWVPQ
Sbjct  11    LLRGLPSYVKIVEVGPRDGLQNEKTTVPTHVKVMLIRRLAAAGLPVVEATSFVSPKWVPQ  70

Query  1188  LSDAKDVMQAVKNLEG-ARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSI  1012
             L+DAKDVM  V++     R PVLTPNL+GFEAAI +GAKEVA F +ASESF KANINCS+
Sbjct  71    LADAKDVMADVRHCTSRCRFPVLTPNLRGFEAAIEAGAKEVAFFTAASESFVKANINCSL  130

Query  1011  EESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLG  832
             EESLVRYR V  AAK+ +IPVRGY+SC V CP+EG +  +KVAY+AKEL++MGC+EISLG
Sbjct  131   EESLVRYRQVCKAAKERNIPVRGYVSCAVACPIEGPMSAAKVAYVAKELYDMGCYEISLG  190

Query  831   DTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGL  652
             DTIGV TPGTV+PMLEAVMAVVPVE LAVHFHDTYGQ+L NILV+LQMG+  VDSSV+GL
Sbjct  191   DTIGVGTPGTVVPMLEAVMAVVPVESLAVHFHDTYGQALVNILVALQMGISVVDSSVAGL  250

Query  651   GGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GGCPYAKGATGNVATEDV+Y+L+GLG++ NV L K++  GEFI   LGR S SK A A
Sbjct  251   GGCPYAKGATGNVATEDVIYLLNGLGIQHNVSLDKVIAVGEFICDQLGRTSCSKTATA  308



>ref|XP_004510818.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=363

 Score =   419 bits (1076),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 227/346 (66%), Positives = 270/346 (78%), Gaps = 30/346 (9%)
 Frame = -3

Query  1638  EEPLSLDRLPRLSNIDRMDGRFSSNACRPVGDD-GMGERWIDGRNCSSSNSCDEDFDEYG  1462
             EEPL LD+LP ++ +DR+  RFS+  CRP  D+ GMG  WI+GR+CS+SN C+ED +EY 
Sbjct  5     EEPLGLDKLPSMNTMDRVR-RFSTGCCRPQVDNLGMGNYWIEGRSCSTSNCCNEDNEEYT  63

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLFN--------------------------  1360
               ++ WKRQ  D+      ++++ + G  ++ F+                          
Sbjct  64    AETFPWKRQTTDKSQCDSFSQKTMTIGRNSMKFDNSFYSSDYQYSRKRNNNDIQDMAYKF  123

Query  1359  --GVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQL  1186
               G+P++VKIVEVGPRDGLQNEKN VPT+VK+ELI +L S GL V+E T FVSPKWVPQL
Sbjct  124   MKGMPEFVKIVEVGPRDGLQNEKNIVPTAVKIELIHRLASTGLSVIEATSFVSPKWVPQL  183

Query  1185  SDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEE  1006
             +DAKDVMQAV NL G RLPVLTPNLKG+EAAIA+GA+EVA+FASASESFSK+NINCSIEE
Sbjct  184   ADAKDVMQAVHNLGGIRLPVLTPNLKGYEAAIAAGAREVAIFASASESFSKSNINCSIEE  243

Query  1005  SLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDT  826
             SL RYRAVT AAK+LSIPVRGY+SCVVGCPVEG I PSKVAY+AKEL++MGCFEISLGDT
Sbjct  244   SLARYRAVTRAAKELSIPVRGYVSCVVGCPVEGPISPSKVAYVAKELNDMGCFEISLGDT  303

Query  825   IGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQM  688
             IGV TPGTV+PML AVMAVVPVEKLAVHFHDTYGQSL NILVSLQ+
Sbjct  304   IGVGTPGTVVPMLLAVMAVVPVEKLAVHFHDTYGQSLANILVSLQL  349



>emb|CDP06202.1| unnamed protein product [Coffea canephora]
Length=442

 Score =   419 bits (1076),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 227/308 (74%), Positives = 269/308 (87%), Gaps = 0/308 (0%)
 Frame = -3

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
                 +PK+VKIVEVGPRDGLQNEK  VPT+VKV+LI+ LVS GL V+E T FVSPKWVPQ
Sbjct  135   FLGSIPKFVKIVEVGPRDGLQNEKAIVPTAVKVDLIKMLVSSGLSVIEATSFVSPKWVPQ  194

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+DAKDV++A++ ++GA+ PVLTPNLKGF AA+A+GAKEVA+FA+ASESFS++NINCSI+
Sbjct  195   LADAKDVLEAIQCVQGAKFPVLTPNLKGFAAAVAAGAKEVAIFAAASESFSRSNINCSIK  254

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             +SL RYR V  AA+  SIPVRGYISCVVGCPVEGA+ PS+V Y+AK L +MGC EISLGD
Sbjct  255   DSLYRYREVAHAARNSSIPVRGYISCVVGCPVEGAVSPSQVVYVAKALLDMGCTEISLGD  314

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTV+PMLEAV+ VVPVEKLAVHFHDTYGQ+L NIL+SLQMG+ TVDS+VSGLG
Sbjct  315   TIGVGTPGTVVPMLEAVLEVVPVEKLAVHFHDTYGQALSNILISLQMGIRTVDSAVSGLG  374

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGA+GNVATEDVVYML+GLGVKTNVDL K++ AG+FI KHLGR   SK A AL+R
Sbjct  375   GCPYAKGASGNVATEDVVYMLNGLGVKTNVDLEKVILAGDFICKHLGRSPGSKVAKALSR  434

Query  468   VSADASKI  445
             +  +ASK+
Sbjct  435   IPENASKL  442



>ref|XP_002308880.2| hypothetical protein POPTR_0006s03520g [Populus trichocarpa]
 gb|EEE92403.2| hypothetical protein POPTR_0006s03520g [Populus trichocarpa]
Length=271

 Score =   408 bits (1049),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 214/270 (79%), Positives = 242/270 (90%), Gaps = 0/270 (0%)
 Frame = -3

Query  1254  LVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGak  1075
             L S GLPVVE T FVSPKWVPQL+DAKDVM+A+++ +GAR PVLTPNLKGFEAAIA+GAK
Sbjct  2     LASSGLPVVEATSFVSPKWVPQLADAKDVMEAIRDFKGARFPVLTPNLKGFEAAIAAGAK  61

Query  1074  evavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILP  895
             EVAVFASASE FSK+NINCSIE+SLVRY  V  +A KLSIPVRGYISCVVGCPVEG + P
Sbjct  62    EVAVFASASEGFSKSNINCSIEDSLVRYHEVALSASKLSIPVRGYISCVVGCPVEGMVSP  121

Query  894   SKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSL  715
             SKVAY+AK+L +MGC+EISLGDTIGV TPGTVIPMLEAV+ VVP+EKLAVHFHDTYGQ+L
Sbjct  122   SKVAYVAKKLCDMGCYEISLGDTIGVGTPGTVIPMLEAVIDVVPIEKLAVHFHDTYGQAL  181

Query  714   PNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQA  535
              NIL SLQMG+ TVDSSVSGLGGCPYAKGA+GNVATEDVVYML+GLGVKTNVDL K++ A
Sbjct  182   SNILASLQMGISTVDSSVSGLGGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLQKIMLA  241

Query  534   GEFISKHLGRESSSKAAIALTRVSADASKI  445
             G FISKHLG  S SK AIAL++++A ASK+
Sbjct  242   GNFISKHLGHSSGSKTAIALSKITAHASKL  271



>ref|XP_007202441.1| hypothetical protein PRUPE_ppa009949mg [Prunus persica]
 gb|EMJ03640.1| hypothetical protein PRUPE_ppa009949mg [Prunus persica]
Length=271

 Score =   405 bits (1040),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 209/270 (77%), Positives = 243/270 (90%), Gaps = 0/270 (0%)
 Frame = -3

Query  1254  LVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGak  1075
             LV+ GL VVE T FVSPKWVPQL+DAKDVM+A++N+EG R PVLTPNLKGFEAA+A+GAK
Sbjct  2     LVASGLDVVEATSFVSPKWVPQLADAKDVMKAIRNVEGVRFPVLTPNLKGFEAAVAAGAK  61

Query  1074  evavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILP  895
             EVA+FASASESFSK+NINCSIE+SL+RY  V +AA KLSIPVRGYISCVVGCPVEG +LP
Sbjct  62    EVAIFASASESFSKSNINCSIEDSLIRYHDVATAATKLSIPVRGYISCVVGCPVEGTVLP  121

Query  894   SKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSL  715
             S+VAY+AK+L+ MGC +ISLGDTIGV TPGT+IPMLEAV  VVP +KLAVH+HDTYGQ+L
Sbjct  122   SQVAYVAKKLYNMGCSDISLGDTIGVGTPGTIIPMLEAVTDVVPTDKLAVHYHDTYGQAL  181

Query  714   PNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQA  535
              NIL SLQMG+ TVDSSVSGLGGCPYAKGA+GNVATEDVVYML+GLGVKTNVDL KL+ A
Sbjct  182   SNILASLQMGISTVDSSVSGLGGCPYAKGASGNVATEDVVYMLNGLGVKTNVDLKKLMLA  241

Query  534   GEFISKHLGRESSSKAAIALTRVSADASKI  445
             G+FI KHLGR S SK A+A+++V+A ASK+
Sbjct  242   GDFICKHLGRSSGSKTAVAMSKVTAHASKL  271



>ref|XP_001770817.1| predicted protein [Physcomitrella patens]
 gb|EDQ64341.1| predicted protein [Physcomitrella patens]
Length=311

 Score =   398 bits (1023),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 207/310 (67%), Positives = 250/310 (81%), Gaps = 2/310 (1%)
 Frame = -3

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
             L  G+P YVKIVEVGPRDGLQNEK  +PTSVKVELIR+L   GLPVVE T FVSPKWVPQ
Sbjct  2     LLKGLPSYVKIVEVGPRDGLQNEKTTIPTSVKVELIRRLAGAGLPVVEATSFVSPKWVPQ  61

Query  1188  LSDAKDVMQAVKNLEG-ARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSI  1012
             L+DAKDVM  V+N +   + PVLTPNLKG EAAI +GAKEVA F +ASESF + NINCS+
Sbjct  62    LADAKDVMADVRNCKSRCQFPVLTPNLKGLEAAIEAGAKEVAFFTAASESFVRTNINCSL  121

Query  1011  EESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLG  832
             EESLVR R +  AA+  +IPVRGY+SC + CP+EG +  +KVAY+A+EL++MGC EISLG
Sbjct  122   EESLVRGRQICKAAQGRNIPVRGYVSCAIACPIEGPVPAAKVAYVARELYDMGCHEISLG  181

Query  831   DTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGL  652
             DTIGV TPGTV PMLEAVMA VP E LAVHFHDTYGQ+L NIL++LQMG+  VDSSV+GL
Sbjct  182   DTIGVGTPGTVAPMLEAVMAAVPTECLAVHFHDTYGQALVNILIALQMGINVVDSSVAGL  241

Query  651   GGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA-L  475
             GGCPYAKGATGNVATEDVVY+L+GL ++ +VDL K++  GEFI   LGR  S K  +A +
Sbjct  242   GGCPYAKGATGNVATEDVVYLLNGLRIQHDVDLDKVIAIGEFICDQLGRTPSCKTTVATI  301

Query  474   TRVSADASKI  445
              ++ ++ +K+
Sbjct  302   AKLQSEKAKL  311



>ref|XP_001767580.1| predicted protein [Physcomitrella patens]
 gb|EDQ67539.1| predicted protein [Physcomitrella patens]
Length=392

 Score =   394 bits (1012),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 202/304 (66%), Positives = 252/304 (83%), Gaps = 0/304 (0%)
 Frame = -3

Query  1380  WRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPK  1201
             + N   + +PKYVKIVEVGPRDGLQNEK  + TSVK++LI++LV+ GLPVVE T FVSPK
Sbjct  82    FSNAKVSSLPKYVKIVEVGPRDGLQNEKGIILTSVKIQLIQRLVAAGLPVVEATSFVSPK  141

Query  1200  WVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANIN  1021
             WVPQL+DAKDVM  V+NLE  RLPVL PNLKGF+AAI +GA+EVA+FA+ASESF+KAN N
Sbjct  142   WVPQLADAKDVMAGVRNLEQTRLPVLVPNLKGFKAAIEAGAREVAIFAAASESFAKANTN  201

Query  1020  CSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEI  841
             C++EES+ R+R V  AAKK +I VRGY+SCVVGCP+EG I P KVA++AKEL ++GC+EI
Sbjct  202   CTVEESINRFREVCDAAKKQNISVRGYVSCVVGCPIEGPISPDKVAHVAKELLQLGCYEI  261

Query  840   SLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSV  661
             SLGDTIG+  PGTV  ML+AVM  VP  KL VHFH+TYGQ+L NI+V+LQMG+  VDSSV
Sbjct  262   SLGDTIGIGNPGTVRRMLQAVMQEVPASKLGVHFHNTYGQALVNIVVALQMGINVVDSSV  321

Query  660   SGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAI  481
             +GLGGCPYAKGATGNVATE+V+Y+L GLG+KT VDL ++ + G+FI +H+GR S  K   
Sbjct  322   AGLGGCPYAKGATGNVATEEVLYLLEGLGIKTGVDLAQVEETGKFICEHIGRASGVKVGR  381

Query  480   ALTR  469
             +++R
Sbjct  382   SMSR  385



>ref|XP_007430573.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Python bivittatus]
Length=322

 Score =   380 bits (976),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 197/296 (67%), Positives = 240/296 (81%), Gaps = 0/296 (0%)
 Frame = -3

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             PK+VKIVEVGPRDGLQNEKN VPT VK++LI  L   GL V+E T FVSPKWVPQ++D  
Sbjct  27    PKHVKIVEVGPRDGLQNEKNIVPTHVKIDLINMLSDTGLSVIEATSFVSPKWVPQMADHT  86

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             +VMQ ++ + G   PVLTPNLKGFEAA+A+GAKEV++F +ASE F+K NINCSIEESL R
Sbjct  87    EVMQGIRKISGISYPVLTPNLKGFEAAVAAGAKEVSIFGAASELFTKKNINCSIEESLQR  146

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
             +  V SA+K+ +IPVRGY+SCV+GCP EG I P+KVA ++K+++ MGC+EISLGDTIGV 
Sbjct  147   FSDVLSASKEANIPVRGYVSCVLGCPYEGKIAPAKVAEVSKKMYAMGCYEISLGDTIGVG  206

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYA  634
             TPG +  ML AVM  VPV  LAVH HDTYGQ+L N LV+LQMGV  VDSSV+GLGGCPYA
Sbjct  207   TPGNMREMLSAVMKEVPVGALAVHCHDTYGQALANTLVALQMGVNVVDSSVAGLGGCPYA  266

Query  633   KGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             +GA+GNVATED+VYMLHGLG+ T VDL KLL+AG FI K L R+++SK A A  ++
Sbjct  267   QGASGNVATEDMVYMLHGLGIHTGVDLSKLLEAGAFICKMLNRKTNSKVAQATCKL  322



>ref|XP_002601472.1| hypothetical protein BRAFLDRAFT_270381 [Branchiostoma floridae]
 gb|EEN57484.1| hypothetical protein BRAFLDRAFT_270381 [Branchiostoma floridae]
Length=313

 Score =   379 bits (973),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 200/297 (67%), Positives = 237/297 (80%), Gaps = 0/297 (0%)
 Frame = -3

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             +P+YVKIVEVGPRDGLQNEK  VPTSVKV+LI +L   GLPV+E T FVSPKWVPQ+ D 
Sbjct  17    LPEYVKIVEVGPRDGLQNEKEIVPTSVKVDLINRLSETGLPVIEATSFVSPKWVPQMGDH  76

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
              DVM+ ++   G   PVLTPNLKGF++AIA GAKEVA+F +ASESFSK NINCSIEESL 
Sbjct  77    TDVMRDIRRHPGVNYPVLTPNLKGFQSAIAVGAKEVAIFGAASESFSKKNINCSIEESLK  136

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             R+  V  AA++ +IPVR Y+SCV+GCP EG I P+ VA +A +++ MGC+EISLGDTIGV
Sbjct  137   RFDEVMKAAREANIPVRAYVSCVLGCPYEGKIAPAAVAEVASKMYAMGCYEISLGDTIGV  196

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
              TPG +  ML AV   VPV+ LAVH HDTYGQ+L NIL +LQMGV  VDSSV+GLGGCPY
Sbjct  197   GTPGGMQDMLRAVTKEVPVDALAVHCHDTYGQALANILTALQMGVSVVDSSVAGLGGCPY  256

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             AKGA+GNVATEDVVYMLHGLG+KT VDL KL   G FIS  LGR +SSK A A++++
Sbjct  257   AKGASGNVATEDVVYMLHGLGIKTGVDLDKLTSVGSFISAALGRRTSSKVAQAMSKL  313



>ref|WP_028878535.1| hydroxymethylglutaryl-CoA lyase [Terasakiella pusilla]
Length=300

 Score =   378 bits (970),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 237/295 (80%), Gaps = 0/295 (0%)
 Frame = -3

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             +PK VKIV+VGPRDGLQNEK  VPT  K+ELI +L   GLPVVE   FVSPKWVPQ++D+
Sbjct  3     IPKKVKIVDVGPRDGLQNEKEIVPTEAKIELIHRLAEAGLPVVEAGSFVSPKWVPQMADS  62

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
              ++M+ +   +G   PVLTPNLKGFE A+A GAKEVA+F +ASESFS+ NINC+IEESL 
Sbjct  63    AEIMEKITRKDGVSYPVLTPNLKGFEGAMAVGAKEVAIFGAASESFSQKNINCTIEESLE  122

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             R+R V  AAK+L + VRGY+SCVVGCP EG I P KVA ++ +L+EMGC+EISLGDT+GV
Sbjct  123   RFRPVVEAAKELGVLVRGYVSCVVGCPYEGEIAPEKVADVSAKLYEMGCYEISLGDTVGV  182

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
              TPG V  ML AV A VP+EKLAVHFHDTYGQ+L NI  +L+MGV TVDSSV+GLGGCPY
Sbjct  183   GTPGKVKDMLAAVSAKVPMEKLAVHFHDTYGQALANIYAALEMGVATVDSSVAGLGGCPY  242

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALT  472
             AKGA+GNVATEDVVYML+GLG+ T VDL KL +AG FIS  LGR  +SK ++A+ 
Sbjct  243   AKGASGNVATEDVVYMLNGLGIDTGVDLDKLCEAGRFISNVLGRAPASKVSLAMA  297



>ref|XP_008119004.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X2 [Anolis carolinensis]
Length=317

 Score =   378 bits (971),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 196/308 (64%), Positives = 240/308 (78%), Gaps = 0/308 (0%)
 Frame = -3

Query  1401  RRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEV  1222
             R S  G         +PK+VKIVEVGPRDGLQNEKN VPT VK++ I +L   GL V+E 
Sbjct  6     RGSLIGQLSTAAATSLPKHVKIVEVGPRDGLQNEKNIVPTQVKIDFINRLSETGLSVIEA  65

Query  1221  TGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasases  1042
             T FVSPKWVPQ++D  +VMQ ++ + G   PVLTPNLKGF+AA+A+GAKEV++F +ASE 
Sbjct  66    TSFVSPKWVPQMADHAEVMQGIQKVPGISYPVLTPNLKGFQAAVAAGAKEVSIFGAASEL  125

Query  1041  fskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELH  862
             F+K NINCSI+ESL R+  V  AAK+ +IPVRGY+SCV+GCP EG I P+KVA ++K+++
Sbjct  126   FTKKNINCSIDESLERFSDVLRAAKEANIPVRGYVSCVLGCPYEGKIAPAKVAEVSKKMY  185

Query  861   EMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGV  682
              MGC+EISLGDTIGV TPG +  ML AVM  VP+  LAVH HDTYGQ+L N LV+LQMGV
Sbjct  186   AMGCYEISLGDTIGVGTPGNMREMLSAVMKEVPIGALAVHCHDTYGQALANTLVALQMGV  245

Query  681   CTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRE  502
               VDSSV+GLGGCPYA+GA+GNVATED+VYMLHGLG+ T VDL KLL+AG FI K L R 
Sbjct  246   SVVDSSVAGLGGCPYAQGASGNVATEDMVYMLHGLGIHTGVDLSKLLEAGAFICKALNRR  305

Query  501   SSSKAAIA  478
             ++SK A A
Sbjct  306   TNSKVAQA  313



>ref|XP_007574236.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Poecilia formosa]
 ref|XP_007574280.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Poecilia formosa]
Length=337

 Score =   379 bits (973),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 192/299 (64%), Positives = 235/299 (79%), Gaps = 0/299 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             + +P+ VKIVEVGPRDGLQNEK  VPT  K+ LI  L   GLPV+E T FVSPKWVPQ++
Sbjct  39    HALPQTVKIVEVGPRDGLQNEKTVVPTEAKINLINMLSESGLPVIEATSFVSPKWVPQMA  98

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D  +VM+ +    G   PVLTPNLKGF+AA+ +GA EVA+F +ASE FSK NINCS+EES
Sbjct  99    DQVEVMKGISKKPGVSYPVLTPNLKGFQAALKAGASEVAIFGAASELFSKKNINCSVEES  158

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             L R+  V  AAK+ ++PVRGY+SCVVGCP EG + P KVA++AK L+ MGC+EISLGDTI
Sbjct  159   LQRFEEVMKAAKEAAVPVRGYVSCVVGCPYEGQVAPEKVAHVAKRLYSMGCYEISLGDTI  218

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAV   VPV  LAVH HDTYGQ+L NIL++LQMG+  VDSSV+GLGGC
Sbjct  219   GVGTPGSMTKMLEAVTKEVPVSALAVHCHDTYGQALANILIALQMGISVVDSSVAGLGGC  278

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             PYA+GA+GNVATEDVVYMLHGLG+KT VDL KL+ AG FI + + R++SSK A A  ++
Sbjct  279   PYAQGASGNVATEDVVYMLHGLGIKTGVDLSKLMDAGAFICRTINRKTSSKVAQATCKL  337



>ref|XP_008397801.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Poecilia 
reticulata]
Length=337

 Score =   378 bits (971),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 191/299 (64%), Positives = 236/299 (79%), Gaps = 0/299 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             + +P+ VKIVEVGPRDGLQNEK  VPT  K+ LI  L   GLPV+E T FVSPKWVPQ++
Sbjct  39    HALPQTVKIVEVGPRDGLQNEKTIVPTEAKINLINMLSESGLPVIEATSFVSPKWVPQMA  98

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D  +VM+ ++   G   PVLTPNLKGF+AA+ +GA EVA+F +ASE FSK NINCS+EES
Sbjct  99    DQVEVMKGIRKKPGVSYPVLTPNLKGFQAALKAGASEVAIFGAASELFSKKNINCSVEES  158

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             L R+  V  AAK+ ++PVRGY+SCVVGCP EG + P KVA++AK L+ MGC+EISLGDTI
Sbjct  159   LQRFEEVMKAAKEAAVPVRGYVSCVVGCPYEGQVAPEKVAHVAKRLYSMGCYEISLGDTI  218

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAV   VPV  LAVH HDTYGQ+L NIL++LQMG+  VDSSV+GLGGC
Sbjct  219   GVGTPGSMTKMLEAVTKEVPVSALAVHCHDTYGQALANILIALQMGISVVDSSVAGLGGC  278

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             PYA+GA+GNVATEDVVYMLHGLG++T VDL KL+ AG FI + + R++SSK A A  ++
Sbjct  279   PYAQGASGNVATEDVVYMLHGLGIETGVDLSKLMDAGAFICRTINRKTSSKVAQATCKL  337



>ref|XP_005799199.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Xiphophorus maculatus]
Length=333

 Score =   377 bits (967),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 191/299 (64%), Positives = 236/299 (79%), Gaps = 0/299 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             + +P+ VKIVEVGPRDGLQNEK  VPT  K+ LI  L   GLPV+E T FVSPKWVPQ++
Sbjct  35    HALPQTVKIVEVGPRDGLQNEKTVVPTEAKINLINMLSESGLPVIEATSFVSPKWVPQMA  94

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D  +VM+ +    G   PVLTPNLKGF+AA+ +GA EVA+F +ASE FSK NINCS+EES
Sbjct  95    DQVEVMKGIIKKPGVSYPVLTPNLKGFQAALKAGASEVAIFGAASELFSKKNINCSVEES  154

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             L R+  V  AAK+ ++PVRGY+SCVVGCP EG + P KVA++AK L+ MGC+EISLGDTI
Sbjct  155   LQRFEEVMKAAKEAAVPVRGYVSCVVGCPYEGQVAPEKVAHVAKRLYSMGCYEISLGDTI  214

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAV   VPV  LAVH HDTYGQ+L NIL++LQMG+  VDSSV+GLGGC
Sbjct  215   GVGTPGSMTKMLEAVTKEVPVSALAVHCHDTYGQALANILIALQMGISVVDSSVAGLGGC  274

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             PYA+GA+GNVATEDVVYMLHGLG++T VDL KL++AG FI + + R++SSK A A  ++
Sbjct  275   PYAQGASGNVATEDVVYMLHGLGIQTGVDLSKLMEAGAFICRIINRKTSSKVAQATCKL  333



>ref|XP_003227616.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Anolis carolinensis]
Length=342

 Score =   377 bits (967),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 193/293 (66%), Positives = 237/293 (81%), Gaps = 0/293 (0%)
 Frame = -3

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             +PK+VKIVEVGPRDGLQNEKN VPT VK++ I +L   GL V+E T FVSPKWVPQ++D 
Sbjct  46    LPKHVKIVEVGPRDGLQNEKNIVPTQVKIDFINRLSETGLSVIEATSFVSPKWVPQMADH  105

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
              +VMQ ++ + G   PVLTPNLKGF+AA+A+GAKEV++F +ASE F+K NINCSI+ESL 
Sbjct  106   AEVMQGIQKVPGISYPVLTPNLKGFQAAVAAGAKEVSIFGAASELFTKKNINCSIDESLE  165

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             R+  V  AAK+ +IPVRGY+SCV+GCP EG I P+KVA ++K+++ MGC+EISLGDTIGV
Sbjct  166   RFSDVLRAAKEANIPVRGYVSCVLGCPYEGKIAPAKVAEVSKKMYAMGCYEISLGDTIGV  225

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
              TPG +  ML AVM  VP+  LAVH HDTYGQ+L N LV+LQMGV  VDSSV+GLGGCPY
Sbjct  226   GTPGNMREMLSAVMKEVPIGALAVHCHDTYGQALANTLVALQMGVSVVDSSVAGLGGCPY  285

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             A+GA+GNVATED+VYMLHGLG+ T VDL KLL+AG FI K L R ++SK A A
Sbjct  286   AQGASGNVATEDMVYMLHGLGIHTGVDLSKLLEAGAFICKALNRRTNSKVAQA  338



>ref|XP_007068091.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Chelonia mydas]
Length=334

 Score =   375 bits (964),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 232/289 (80%), Gaps = 0/289 (0%)
 Frame = -3

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             +PK VKIVEVGPRDGLQNEKN VPT VK+ LI  L   GLPV+E T FVSPKWVPQ++D 
Sbjct  38    LPKQVKIVEVGPRDGLQNEKNIVPTQVKISLINMLSETGLPVIEATSFVSPKWVPQMADH  97

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
              +V+Q ++   G   PVLTPNLKGF+AA+A+GAKEV++F +ASE F+K NINCSIEESL 
Sbjct  98    TEVLQGIQKFPGVSYPVLTPNLKGFQAAVAAGAKEVSIFGAASELFTKKNINCSIEESLQ  157

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             R+  V  AA   S+PVRGY+SCV+GCP EG I P+KVA ++K+++ MGC+EISLGDTIGV
Sbjct  158   RFSEVMHAAGAASVPVRGYVSCVLGCPYEGKIAPAKVAEVSKKMYSMGCYEISLGDTIGV  217

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
              TPG++  ML AVM  VPV  LAVH HDTYGQ+L N LV+LQMGV  VDSSV+GLGGCPY
Sbjct  218   GTPGSMKEMLSAVMKEVPVGALAVHCHDTYGQALANTLVALQMGVSVVDSSVAGLGGCPY  277

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSK  490
             A+GA+GNVATED+VYMLHGLG+ T VDL KL++AG FI K L R +SSK
Sbjct  278   AQGASGNVATEDLVYMLHGLGIHTGVDLQKLMEAGVFICKALNRRTSSK  326



>ref|XP_010770898.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X2 [Notothenia coriiceps]
Length=334

 Score =   374 bits (961),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 191/295 (65%), Positives = 233/295 (79%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
               +P+ VKIVEVGPRDGLQNEK  VPT  K+ LI  L + GLPV+E T FVSPKWVPQ++
Sbjct  36    QALPEKVKIVEVGPRDGLQNEKTIVPTETKIHLIDMLSATGLPVIEATSFVSPKWVPQMA  95

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D  +VM+ +    G   PVLTPNLKGF+AA+ +GA EVA+F +ASE FSK NINCS+EES
Sbjct  96    DQVEVMKGIGRKPGVSYPVLTPNLKGFQAALKAGASEVAIFGAASELFSKKNINCSVEES  155

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             L R+  +  AAK+  +PVRGY+SCV+GCP EG + P KVA++AK L+ MGC+EISLGDTI
Sbjct  156   LQRFEVIMKAAKEAGVPVRGYVSCVLGCPYEGKVAPEKVAHVAKRLYSMGCYEISLGDTI  215

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++I MLEAV   VPV  LAVH HDTYGQ+L NILV+LQMG+  VDSSV+GLGGC
Sbjct  216   GVGTPGSMIEMLEAVSKEVPVNALAVHCHDTYGQALANILVALQMGISVVDSSVAGLGGC  275

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYA+GA+GNVATEDVVYMLHGLG++T VDL KL+ AG +I + L R++SSK A A
Sbjct  276   PYAQGASGNVATEDVVYMLHGLGIQTGVDLSKLMDAGAYICRTLNRKTSSKVAQA  330



>ref|XP_010770897.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Notothenia coriiceps]
Length=337

 Score =   374 bits (961),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 191/295 (65%), Positives = 233/295 (79%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
               +P+ VKIVEVGPRDGLQNEK  VPT  K+ LI  L + GLPV+E T FVSPKWVPQ++
Sbjct  39    QALPEKVKIVEVGPRDGLQNEKTIVPTETKIHLIDMLSATGLPVIEATSFVSPKWVPQMA  98

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D  +VM+ +    G   PVLTPNLKGF+AA+ +GA EVA+F +ASE FSK NINCS+EES
Sbjct  99    DQVEVMKGIGRKPGVSYPVLTPNLKGFQAALKAGASEVAIFGAASELFSKKNINCSVEES  158

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             L R+  +  AAK+  +PVRGY+SCV+GCP EG + P KVA++AK L+ MGC+EISLGDTI
Sbjct  159   LQRFEVIMKAAKEAGVPVRGYVSCVLGCPYEGKVAPEKVAHVAKRLYSMGCYEISLGDTI  218

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++I MLEAV   VPV  LAVH HDTYGQ+L NILV+LQMG+  VDSSV+GLGGC
Sbjct  219   GVGTPGSMIEMLEAVSKEVPVNALAVHCHDTYGQALANILVALQMGISVVDSSVAGLGGC  278

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYA+GA+GNVATEDVVYMLHGLG++T VDL KL+ AG +I + L R++SSK A A
Sbjct  279   PYAQGASGNVATEDVVYMLHGLGIQTGVDLSKLMDAGAYICRTLNRKTSSKVAQA  333



>ref|XP_008169232.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Chrysemys 
picta bellii]
Length=322

 Score =   374 bits (959),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 194/297 (65%), Positives = 234/297 (79%), Gaps = 0/297 (0%)
 Frame = -3

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             +PK VKIVEVGPRDGLQNEKN VPT VK+ LI  L   GLPV+E T FVSPKWVPQ++D 
Sbjct  26    LPKQVKIVEVGPRDGLQNEKNIVPTQVKISLINMLSETGLPVIEATSFVSPKWVPQMADH  85

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
              +V+Q ++   G   PVLTPNLKGF+AA+A+GAKEV++F +ASE F+K NINCSIEESL 
Sbjct  86    TEVLQGIQKFPGVSYPVLTPNLKGFQAAVAAGAKEVSIFGAASELFTKKNINCSIEESLQ  145

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             R+  V  AA    I VRGY+SCV+GCP EG I P+KVA ++K+++ MGC+EISLGDTIGV
Sbjct  146   RFSEVMHAAGAAGIAVRGYVSCVLGCPYEGKIAPAKVAEVSKKMYSMGCYEISLGDTIGV  205

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
              TPG++  ML AVM  VPV  LAVH HDTYGQ+L N LV+LQMGV  VDSSV+GLGGCPY
Sbjct  206   GTPGSMKEMLSAVMKEVPVGALAVHCHDTYGQALANTLVALQMGVSVVDSSVAGLGGCPY  265

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             A+GA+GNVATED+VYMLHGLG+ T VDL KL++AG FI K L R +SSK   A +R+
Sbjct  266   AQGASGNVATEDLVYMLHGLGIHTGVDLQKLMEAGVFICKALNRRTSSKVVQASSRL  322



>ref|XP_006130547.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Pelodiscus sinensis]
Length=334

 Score =   374 bits (960),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 195/293 (67%), Positives = 234/293 (80%), Gaps = 0/293 (0%)
 Frame = -3

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             +PK VKIVEVGPRDGLQNEKN VPT VK+ LI  L   GLPV+E T FVSP+WVPQ++D 
Sbjct  38    LPKQVKIVEVGPRDGLQNEKNIVPTQVKISLINMLSETGLPVIETTSFVSPRWVPQMADH  97

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
              +V+Q ++   G   PVLTPNLKGF+ A+A+GAKEV+VF +ASE F+K NINCSIEESL 
Sbjct  98    TEVLQGIQRFPGVGYPVLTPNLKGFQTAVAAGAKEVSVFGAASELFTKKNINCSIEESLQ  157

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             R+  V  AA   SIPVRGY+SCV+GCP EG I P+KVA ++K+++ MGC+EISLGDTIGV
Sbjct  158   RFGEVVHAAGAASIPVRGYVSCVLGCPYEGKIAPAKVAEVSKKMYSMGCYEISLGDTIGV  217

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
              TPG++  ML AV+  +P+  LAVH HDTYGQ+L NILV+LQMGV  VDSSV+GLGGCPY
Sbjct  218   GTPGSMKEMLSAVVKEIPIGALAVHCHDTYGQALANILVALQMGVSVVDSSVAGLGGCPY  277

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             A+GA+GNVATEDVVYMLHGLGV T VDL KL++AG FI K L R +SSK A A
Sbjct  278   AQGASGNVATEDVVYMLHGLGVHTGVDLQKLMEAGMFICKALNRRTSSKVAQA  330



>gb|KFO81235.1| 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic, partial 
[Cuculus canorus]
Length=307

 Score =   373 bits (957),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 240/295 (81%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNEK  VPT +K+ELI +L   GLP +EVT FVS KWVPQ++
Sbjct  6     SGLPEYIKIVEVGPRDGLQNEKVIVPTDIKIELINRLSKTGLPAIEVTSFVSSKWVPQMA  65

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM+ ++   G R PVLTPNL+GF +AIA+GA EV+VF +ASE+FSK NINCSIEES
Sbjct  66    DQKEVMRGIERHPGVRYPVLTPNLRGFHSAIAAGATEVSVFGAASETFSKMNINCSIEES  125

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             + ++  V +AA+ ++IPVRGY+SC +GCP EG I+P+KVA ++K L+ MGC+EISLGDTI
Sbjct  126   IKKFEEVATAARNMNIPVRGYVSCALGCPYEGNIVPAKVAEVSKRLYSMGCYEISLGDTI  185

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  186   GVGTPGSMKRMLEAVMKEIPLSALAVHCHDTYGQALANILTAIQMGVAVVDSSVAGLGGC  245

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYAKGATGNVATEDV+YML+GLG+ T VDL  +++AG FI   L ++++SK A A
Sbjct  246   PYAKGATGNVATEDVIYMLNGLGINTGVDLYAVMEAGNFICTALNKKTNSKVAQA  300



>ref|XP_008613404.1| hydroxymethylglutaryl-CoA lyase, mitochondrial [Saprolegnia diclina 
VS20]
 gb|EQC33281.1| hydroxymethylglutaryl-CoA lyase, mitochondrial [Saprolegnia diclina 
VS20]
Length=318

 Score =   372 bits (955),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 200/305 (66%), Positives = 235/305 (77%), Gaps = 0/305 (0%)
 Frame = -3

Query  1383  GWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSP  1204
             G R +     P YVKIVEVGPRDGLQNEK  V T+ KV LI  L   GLPVVE T FVSP
Sbjct  8     GSRALSTRSYPSYVKIVEVGPRDGLQNEKTVVSTADKVTLINMLSDAGLPVVEATSFVSP  67

Query  1203  KWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANI  1024
             KWVPQ+ D  DVMQ +K  EG   PVLTPNL GF+AA+   A+EVA+F +ASESFS+ NI
Sbjct  68    KWVPQMGDNSDVMQQIKRKEGVFYPVLTPNLMGFDAAVKVHAQEVAIFGAASESFSRKNI  127

Query  1023  NCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFE  844
             NCSIEESL R++ V   AK L I VRGY+SCV+GCP EG I P+ VA +AK L +MGC+E
Sbjct  128   NCSIEESLERFQPVCEKAKSLGIRVRGYVSCVLGCPYEGPIDPAVVAKVAKTLLDMGCYE  187

Query  843   ISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSS  664
             ISLGDTIG+ TPG+ + ML A   VVPV++LAVHFHDTYGQ+L NILV+LQ GV  VDS+
Sbjct  188   ISLGDTIGIGTPGSTLEMLRATKEVVPVDQLAVHFHDTYGQALANILVALQEGVSVVDSA  247

Query  663   VSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAA  484
             V+GLGGCPYAKGA+GNVATEDVVYMLHGLG++T VDL K+++AG FIS  L R +SSKAA
Sbjct  248   VAGLGGCPYAKGASGNVATEDVVYMLHGLGIETGVDLAKVMEAGSFISTVLDRPTSSKAA  307

Query  483   IALTR  469
              AL +
Sbjct  308   RALQK  312



>ref|XP_004082429.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Oryzias latipes]
Length=337

 Score =   373 bits (957),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 191/299 (64%), Positives = 236/299 (79%), Gaps = 0/299 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             + +P+ VKIVEVGPRDGLQNEK+ VPT  K+ LI  L   GL V+E T FVSPKWVPQ++
Sbjct  39    HALPEKVKIVEVGPRDGLQNEKSIVPTEAKIHLIDMLSESGLQVIEATSFVSPKWVPQMA  98

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D  +VM+ ++   G   PVLTPNLKGF+AA+ +GA EVA+F +ASE FSK NINCS++ES
Sbjct  99    DQVEVMKGIQRKPGVTYPVLTPNLKGFQAAVKAGASEVAIFGAASELFSKKNINCSVDES  158

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             L R+  V  AAK+ ++PVRGY+SCV GCP EG + P KVA++AK L+ MGC+EISLGDTI
Sbjct  159   LQRFDEVMRAAKEAAVPVRGYVSCVAGCPYEGKVAPEKVAHVAKRLYAMGCYEISLGDTI  218

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG+++ MLEAV   VPV  LAVH HDTYGQ+L NILV+LQMG+  VDSSV+GLGGC
Sbjct  219   GVGTPGSMVDMLEAVTREVPVSALAVHCHDTYGQALANILVALQMGISVVDSSVAGLGGC  278

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             PYA+GA+GNVATEDVVYMLHGLG++T VDL KL+ AG FI + L R+SSSK A A  ++
Sbjct  279   PYAQGASGNVATEDVVYMLHGLGIQTGVDLTKLMDAGAFICRTLSRKSSSKVAQATCKL  337



>gb|KDO31235.1| hydroxymethylglutaryl-CoA lyase [Saprolegnia parasitica CBS 223.65]
Length=320

 Score =   371 bits (952),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 232/295 (79%), Gaps = 0/295 (0%)
 Frame = -3

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             P YVKIVEVGPRDGLQNEK  V T+ KV LI  L   GLPVVE T FVSPKWVPQ+ D  
Sbjct  20    PSYVKIVEVGPRDGLQNEKTVVSTADKVTLINMLSDAGLPVVEATSFVSPKWVPQMGDNS  79

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             DVMQ +K  EG   PVLTPNL GF+AA+   A+EVA+F +ASESFS+ NINCSIEESL R
Sbjct  80    DVMQQIKRKEGVFYPVLTPNLMGFDAAVKVHAQEVAIFGAASESFSRKNINCSIEESLER  139

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
             ++ V   AK L I VRGY+SCV+GCP EG I P+ VA +AK L +MGC+EISLGDTIG+ 
Sbjct  140   FQPVCEKAKSLGIRVRGYVSCVLGCPYEGPIDPAVVAKVAKTLLDMGCYEISLGDTIGIG  199

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYA  634
             TPG+ + ML A   VVPV++LAVHFHDTYGQ+L NILV+LQ GV  VDS+V+GLGGCPYA
Sbjct  200   TPGSTLEMLRATKEVVPVDQLAVHFHDTYGQALANILVALQEGVSVVDSAVAGLGGCPYA  259

Query  633   KGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             KGA+GNVATEDVVYMLHGLG++T VDL K+++AG FIS  L R +SSKAA AL +
Sbjct  260   KGASGNVATEDVVYMLHGLGIETGVDLAKVMEAGSFISTVLDRPTSSKAARALQK  314



>gb|KFQ74252.1| 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic, partial 
[Phaethon lepturus]
Length=307

 Score =   370 bits (949),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 239/295 (81%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNEK  VPT +K+ELI +L   GLP +EVT FVS KWVPQ++
Sbjct  6     SGLPEYIKIVEVGPRDGLQNEKVIVPTDIKIELINRLSRTGLPAIEVTSFVSSKWVPQMA  65

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM+ ++   G + PVLTPNL+GF +AI +GA EV+VF +ASESFSK NINCSIEES
Sbjct  66    DHKEVMRGIERHPGVQYPVLTPNLQGFHSAIVAGATEVSVFGAASESFSKMNINCSIEES  125

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             + ++  V  +A+ ++IPVRGY+SC +GCP EG I+P+KVA ++K L+ MGC+EISLGDTI
Sbjct  126   IEKFEEVAKSARNMNIPVRGYVSCALGCPYEGNIIPAKVAEVSKRLYSMGCYEISLGDTI  185

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  186   GVGTPGSMKRMLEAVMKEIPLSALAVHCHDTYGQALANILTAIQMGVAVVDSSVAGLGGC  245

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYAKGATGNVATEDV+YMLHGLG+ T V+L K+++AG FI   L ++++SK A A
Sbjct  246   PYAKGATGNVATEDVIYMLHGLGINTGVNLYKVMEAGNFICTALNKKTNSKVAQA  300



>ref|XP_008282420.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Stegastes 
partitus]
Length=337

 Score =   371 bits (952),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 190/299 (64%), Positives = 232/299 (78%), Gaps = 0/299 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
               +P+ VKIVEVGPRDGLQNEK  VPT  K+ LI  L   GL V+E T FVSPKWVPQ++
Sbjct  39    QALPEKVKIVEVGPRDGLQNEKTVVPTEAKINLINMLSESGLSVIEATSFVSPKWVPQMA  98

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D  +VM+ +    G   PVLTPNLKGF+AA+ +GA EVA+F +ASE FSK NINCS++ES
Sbjct  99    DQMEVMKGITRKPGVSYPVLTPNLKGFQAAVKAGAAEVAIFGAASELFSKKNINCSVDES  158

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             L R+  V  AAK+  +PVRGY+SCVVGCP EG + P KVA++AK L+ MGC+EISLGDTI
Sbjct  159   LQRFDEVMKAAKEAGVPVRGYVSCVVGCPYEGKVAPEKVAHVAKRLYSMGCYEISLGDTI  218

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAV   VPV  LAVH HDTYGQ+L NILV+LQMG+  VDSSV+GLGGC
Sbjct  219   GVGTPGSMSAMLEAVSKEVPVSALAVHCHDTYGQALANILVALQMGISVVDSSVAGLGGC  278

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             PYA+GA+GNVATEDVVYMLHGLG++T VDL KL+ AG FI + + R++SSK A A  ++
Sbjct  279   PYAQGASGNVATEDVVYMLHGLGIQTGVDLTKLMDAGAFICRTINRKTSSKVAQATCKL  337



>gb|KFP02262.1| 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic, partial 
[Calypte anna]
Length=307

 Score =   369 bits (948),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 239/295 (81%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNEK  VPT +K+ELI +L   GLPV+E T FVS KWVPQ++
Sbjct  6     SGLPEYIKIVEVGPRDGLQNEKVIVPTDIKIELINRLSRTGLPVIEATSFVSSKWVPQMA  65

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM+ ++   G + PVLTPNL+GF +AIA+GA EV+VF +ASESFSK NINCSIEES
Sbjct  66    DHKEVMKGIERHPGVQYPVLTPNLQGFHSAIAAGATEVSVFGAASESFSKININCSIEES  125

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             L ++  VT +A+ + IPVRGY+SC +GCP EG I+P+KVA ++K L+ MGC+EISLGDTI
Sbjct  126   LEKFEEVTKSARNMDIPVRGYVSCALGCPYEGNIMPAKVAEVSKRLYSMGCYEISLGDTI  185

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  186   GVGTPGSMKRMLEAVMKEIPLSALAVHCHDTYGQALANILTAIQMGVAVVDSSVAGLGGC  245

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYAKGATGNVATEDV+YML+GLG+ T V+L  +++AG FI   L ++++SK A A
Sbjct  246   PYAKGATGNVATEDVIYMLNGLGINTGVNLYAVMEAGNFICTALNKKTNSKVAQA  300



>ref|XP_010729592.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Larimichthys 
crocea]
Length=337

 Score =   370 bits (950),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 190/299 (64%), Positives = 232/299 (78%), Gaps = 0/299 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
               +P+ VKIVEVGPRDGLQNEK  VP   K+ LI  L   GL V+E T FVSPKWVPQ++
Sbjct  39    QALPEKVKIVEVGPRDGLQNEKTIVPAETKIHLIDMLSQSGLTVIEATSFVSPKWVPQMA  98

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D  +VM+ +    G   PVLTPNLKGF+AA+ +GA EVA+F +ASE FSK NINCS+EES
Sbjct  99    DQVEVMKGISRKPGVSYPVLTPNLKGFQAAVKAGASEVAIFGAASELFSKKNINCSVEES  158

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             L R+  V  AAK+  +PVRGY+SCV+GCP EG + P KVA++AK L+ MGC+EISLGDTI
Sbjct  159   LQRFDEVMKAAKEAGVPVRGYVSCVLGCPYEGKVAPEKVAHVAKRLYSMGCYEISLGDTI  218

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAV   VPV+ LAVH HDTYGQ+L NILV+LQMG+  VDSSV+GLGGC
Sbjct  219   GVGTPGSMTEMLEAVSREVPVKALAVHCHDTYGQALANILVALQMGISVVDSSVAGLGGC  278

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             PYA+GA+GNVATEDVVYMLHGLG++T VDL KL+ AG FI + L R++SSK A A  ++
Sbjct  279   PYAQGASGNVATEDVVYMLHGLGIQTGVDLSKLMDAGAFICRTLNRKTSSKVAQATCKL  337



>ref|XP_006980887.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Peromyscus 
maniculatus bairdii]
Length=325

 Score =   369 bits (948),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 194/325 (60%), Positives = 244/325 (75%), Gaps = 4/325 (1%)
 Frame = -3

Query  1440  RQFRDRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELI  1261
             RQ   R   G+++ R+ S           PK VKIVEVGPRDGLQNEKN VPT+VK++L+
Sbjct  5     RQAFPRRLLGLASLRAISTSS----MGAFPKQVKIVEVGPRDGLQNEKNIVPTAVKIKLV  60

Query  1260  RKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASG  1081
               L   GLPV+E T FVSPKWVPQ++D  +V++ ++   G   PVLTPN+KGFE A+A+G
Sbjct  61    DMLSEAGLPVIEATSFVSPKWVPQMADHSEVLKGIQKFPGINYPVLTPNMKGFEEAVAAG  120

Query  1080  akevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAI  901
             AKEV +F +ASE F++ N+NCSI+ES  R+  V  AA+  SIPVRGY+SC +GCP EG I
Sbjct  121   AKEVCIFGAASELFTRKNVNCSIDESFQRFDGVMQAAQAASIPVRGYVSCALGCPYEGKI  180

Query  900   LPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQ  721
              P+KVA +AK+L+ MGC+EISLGDTIGV TPG +  ML AVM  VPV  LAVH HDTYGQ
Sbjct  181   SPAKVAEVAKKLYSMGCYEISLGDTIGVGTPGLMKDMLTAVMREVPVAALAVHCHDTYGQ  240

Query  720   SLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLL  541
             +L N LV+LQMGV  VDSSV+GLGGCPYA+GA+GN+ATED+VYML GLG+ T V+L KLL
Sbjct  241   ALANTLVALQMGVSVVDSSVAGLGGCPYAQGASGNLATEDLVYMLTGLGIHTGVELQKLL  300

Query  540   QAGEFISKHLGRESSSKAAIALTRV  466
             +AG+FI + L R++SSK A A  R+
Sbjct  301   EAGDFICQALNRKTSSKVAQATCRL  325



>ref|XP_008493876.1| PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic 
[Calypte anna]
Length=322

 Score =   369 bits (947),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 239/295 (81%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNEK  VPT +K+ELI +L   GLPV+E T FVS KWVPQ++
Sbjct  20    SGLPEYIKIVEVGPRDGLQNEKVIVPTDIKIELINRLSRTGLPVIEATSFVSSKWVPQMA  79

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM+ ++   G + PVLTPNL+GF +AIA+GA EV+VF +ASESFSK NINCSIEES
Sbjct  80    DHKEVMKGIERHPGVQYPVLTPNLQGFHSAIAAGATEVSVFGAASESFSKININCSIEES  139

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             L ++  VT +A+ + IPVRGY+SC +GCP EG I+P+KVA ++K L+ MGC+EISLGDTI
Sbjct  140   LEKFEEVTKSARNMDIPVRGYVSCALGCPYEGNIMPAKVAEVSKRLYSMGCYEISLGDTI  199

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  200   GVGTPGSMKRMLEAVMKEIPLSALAVHCHDTYGQALANILTAIQMGVAVVDSSVAGLGGC  259

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYAKGATGNVATEDV+YML+GLG+ T V+L  +++AG FI   L ++++SK A A
Sbjct  260   PYAKGATGNVATEDVIYMLNGLGINTGVNLYAVMEAGNFICTALNKKTNSKVAQA  314



>gb|KFO62189.1| 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic, partial 
[Corvus brachyrhynchos]
Length=307

 Score =   369 bits (946),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/294 (63%), Positives = 239/294 (81%), Gaps = 0/294 (0%)
 Frame = -3

Query  1359  GVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSD  1180
             G+P+Y+KIVEVGPRDGLQNEK  VPT +K+ELI +L   GLP VEVT FVS KWVPQ++D
Sbjct  7     GLPEYIKIVEVGPRDGLQNEKVIVPTDIKIELINQLSKTGLPAVEVTSFVSSKWVPQMAD  66

Query  1179  AKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESL  1000
              K+VM+ ++   G + PVLTPNL+GF +AIA+GA EV+VF +ASESFSK NINCSIEES+
Sbjct  67    HKEVMRGIERHPGVQYPVLTPNLQGFHSAIAAGATEVSVFGAASESFSKMNINCSIEESI  126

Query  999   VRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIG  820
              ++ AVT +A+ ++IPVRGY+SC +GCP EG ++P KVA ++K L+ MGC+EISLGDTIG
Sbjct  127   EKFEAVTKSARNMNIPVRGYVSCALGCPYEGNVIPEKVAEVSKRLYSMGCYEISLGDTIG  186

Query  819   VATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCP  640
             V TPG++  +LEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGCP
Sbjct  187   VGTPGSMKKLLEAVMKEIPLSALAVHCHDTYGQALANILTAIQMGVAVVDSSVAGLGGCP  246

Query  639   YAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             YAKGATGNVATEDV+YML+GLG+ T V+L  +++AG FI   L ++++SK A A
Sbjct  247   YAKGATGNVATEDVIYMLNGLGINTGVNLHAVMEAGNFICTALNKKTNSKVAQA  300



>ref|XP_004592315.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Ochotona 
princeps]
Length=325

 Score =   369 bits (947),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 195/325 (60%), Positives = 246/325 (76%), Gaps = 4/325 (1%)
 Frame = -3

Query  1440  RQFRDRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELI  1261
             R+   R   G++  R+ S      L    PK VKIVEVGPRDGLQNEKN VPT+VK++LI
Sbjct  5     RKVLPRRLVGLATLRAVSTSSVGTL----PKQVKIVEVGPRDGLQNEKNVVPTAVKIKLI  60

Query  1260  RKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASG  1081
               L   GLPV+E T FVSPKWVPQ++D  +V++ ++   G   PVLTPNLKGFE+A+A+G
Sbjct  61    DMLSEAGLPVIEATSFVSPKWVPQMADHTEVLRGIQKFPGRSYPVLTPNLKGFESAVAAG  120

Query  1080  akevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAI  901
             AKEV++F +ASE F+K NINCSIEES  R+ A+  AA+  SIPVRGY+SCV+GCP EG +
Sbjct  121   AKEVSIFGAASELFTKKNINCSIEESFQRFDAILQAARAASIPVRGYVSCVLGCPYEGKV  180

Query  900   LPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQ  721
              P+KVA +AK+L+ MGC+EISLGDTIGV TPG +  ML AV   VP+  LAVH HDTYGQ
Sbjct  181   SPAKVAEVAKKLYSMGCYEISLGDTIGVGTPGAMKDMLSAVTHEVPLSALAVHCHDTYGQ  240

Query  720   SLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLL  541
             +L N LV+LQMGV  VD+SV+GLGGCPYA+GA+GN+ATED+VYML GLG+ T V+L KLL
Sbjct  241   ALANTLVALQMGVSVVDASVAGLGGCPYAQGASGNLATEDLVYMLAGLGIHTGVNLQKLL  300

Query  540   QAGEFISKHLGRESSSKAAIALTRV  466
              AG+FI + L R++SSK A A  ++
Sbjct  301   AAGDFICQALNRKTSSKVAQATCKL  325



>ref|XP_008862524.1| hypothetical protein H310_01244 [Aphanomyces invadans]
 gb|ETW08719.1| hypothetical protein H310_01244 [Aphanomyces invadans]
Length=316

 Score =   369 bits (946),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 197/297 (66%), Positives = 232/297 (78%), Gaps = 0/297 (0%)
 Frame = -3

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             P YVKIVEVGPRDGLQNEK  V T  KV+LI  L   GLPVVE T FVSPKWVPQ+ D  
Sbjct  18    PSYVKIVEVGPRDGLQNEKTVVSTEDKVKLINLLSEAGLPVVEATSFVSPKWVPQMGDNA  77

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             +VM+ +   EG   PVLTPNL GFEAAI   A EVA+F +ASESFS+ NINCSI+ESL R
Sbjct  78    EVMKQINRKEGVYYPVLTPNLTGFEAAIKVNAHEVAIFGAASESFSRKNINCSIQESLDR  137

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
             ++ V   A+ L + VRGY+SCV+GCP EG I PS VA +AK L +MGC+EISLGDTIG+ 
Sbjct  138   FQPVCVRAQSLGVRVRGYVSCVLGCPYEGPIKPSTVAKVAKTLLDMGCYEISLGDTIGIG  197

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYA  634
             TPG+ + ML+A   VVPVE+LAVHFHDTYGQ+L NILV+LQ GV  VDS+V+GLGGCPYA
Sbjct  198   TPGSTLKMLQATKEVVPVEQLAVHFHDTYGQALANILVALQEGVSVVDSAVAGLGGCPYA  257

Query  633   KGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVS  463
             KGA+GNVATEDVVYMLHGLG+KT VDL KLL AG+FIS  LGR ++S+ A A+ + S
Sbjct  258   KGASGNVATEDVVYMLHGLGIKTGVDLDKLLSAGDFISSVLGRPTNSRVARAMQKPS  314



>ref|XP_005988802.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Latimeria chalumnae]
Length=339

 Score =   369 bits (948),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 195/301 (65%), Positives = 235/301 (78%), Gaps = 0/301 (0%)
 Frame = -3

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
             + N +P+ V +VEVGPRDGLQNEK  VPT VK++LI  L   GLPVVE T FVSPKWVPQ
Sbjct  39    MVNSLPQQVTLVEVGPRDGLQNEKAVVPTEVKIQLINMLSEAGLPVVEATSFVSPKWVPQ  98

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             +SD  +VMQ ++     R PVL PNLKGF+AA+A+GA+EVA+F +ASE FSK NINCSIE
Sbjct  99    MSDHVEVMQGIQKYPHVRYPVLAPNLKGFQAAVAAGAREVAIFGAASELFSKKNINCSIE  158

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ESL R+  V  AA + +IPVRGY+SCV+GCP EG + P KVA +AK+L+ MGC+EISLGD
Sbjct  159   ESLQRFSEVMKAAGEANIPVRGYVSCVLGCPYEGKVAPLKVADVAKKLYAMGCYEISLGD  218

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPG +  ML AV+  VPV  LAVH HDTYGQ+L NILV+LQMGV  VDSSV+GLG
Sbjct  219   TIGVGTPGNMREMLSAVVREVPVSALAVHCHDTYGQALANILVALQMGVSVVDSSVAGLG  278

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYA+GA+GNVATEDVVYMLHGLG+ T VDL KL+ AG FI + L R+S SK + A  +
Sbjct  279   GCPYAQGASGNVATEDVVYMLHGLGIHTGVDLPKLMDAGAFICRALNRKSGSKVSQAACK  338

Query  468   V  466
             +
Sbjct  339   L  339



>ref|XP_005238238.1| PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic 
[Falco peregrinus]
 ref|XP_005441939.1| PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic 
[Falco cherrug]
Length=323

 Score =   369 bits (946),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 240/295 (81%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNEK  VPT +K+ELI +L   GLP +EVT FVS KWVPQ++
Sbjct  21    SGLPEYIKIVEVGPRDGLQNEKVIVPTDIKIELINRLSKTGLPAIEVTSFVSSKWVPQMA  80

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM+ ++   G + PVLTPNL+GF +AIA+GA EV+VF +ASESFSK NINCSIEES
Sbjct  81    DHKEVMRGIERQPGVQYPVLTPNLQGFHSAIAAGATEVSVFGAASESFSKMNINCSIEES  140

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             + ++  V  +A+ ++IPVRGY+SC +GCP EG I+P+KVA ++K L+ MGC+EISLGDTI
Sbjct  141   IDKFEEVAKSARNMNIPVRGYVSCALGCPYEGNIVPAKVAEVSKRLYSMGCYEISLGDTI  200

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  201   GVGTPGSMRRMLEAVMKEIPLSALAVHCHDTYGQALANILTAIQMGVTVVDSSVAGLGGC  260

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYAKGATGNVATEDV+YML+GLGV T V+L  +++AG+FI   L ++++SK A A
Sbjct  261   PYAKGATGNVATEDVIYMLNGLGVNTGVNLYTVMEAGDFICTALNKKTNSKVAQA  315



>ref|XP_009909953.1| PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic 
[Picoides pubescens]
Length=310

 Score =   368 bits (945),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/300 (61%), Positives = 239/300 (80%), Gaps = 0/300 (0%)
 Frame = -3

Query  1377  RNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
             R V  +G+P+Y+KIVEVGPRDGLQNE+  VPT +K+ELI +L   GLP +E T FVS KW
Sbjct  3     RQVTTSGLPEYIKIVEVGPRDGLQNERVIVPTDIKIELINRLSKTGLPAIEATSFVSSKW  62

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQ++D K+VM+ ++   G   PVLTPNL+GF AA+A+GA EV+VF +ASE+FSK NINC
Sbjct  63    VPQMADHKEVMRGIERHPGVEYPVLTPNLQGFHAAVAAGATEVSVFGAASETFSKMNINC  122

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             SIEES+ R+  V  +A+ ++IPVRGY+SC +GCP EG ++P+KVA ++K L+ MGC+EIS
Sbjct  123   SIEESIERFEEVAKSARNMNIPVRGYVSCALGCPYEGNVIPAKVAEVSKRLYSMGCYEIS  182

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIGV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+
Sbjct  183   LGDTIGVGTPGSMKRMLEAVMKEIPMSALAVHCHDTYGQALANILTAIQMGVAVVDSSVA  242

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYAKGA+GNVATEDV+YML+GLG+ T V+L K+++ G FI   L + ++SK A+A
Sbjct  243   GLGGCPYAKGASGNVATEDVIYMLNGLGINTGVNLCKVMETGNFICTALNKTTNSKVALA  302



>gb|KFQ56742.1| 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic, partial 
[Nestor notabilis]
Length=307

 Score =   368 bits (944),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 239/295 (81%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNEK  VPT +K+ELI +L   GLP +EVT FVS KWVPQ++
Sbjct  6     SGLPEYIKIVEVGPRDGLQNEKVIVPTDIKIELINRLSKTGLPAIEVTSFVSSKWVPQMA  65

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM+ ++   G + PVLTPNL+GF AAIA+GA EV+VF +ASESFSK NINCSIEES
Sbjct  66    DHKEVMRGIERHPGVQYPVLTPNLQGFHAAIAAGATEVSVFGAASESFSKMNINCSIEES  125

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             + ++  V  +A+ ++IPVRGY+SC +GCP EG I+P+KVA ++K L+ MGC+EISLGDTI
Sbjct  126   IEKFEDVAKSARNMNIPVRGYVSCALGCPYEGNIIPAKVAEVSKRLYSMGCYEISLGDTI  185

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  186   GVGTPGSMKRMLEAVMKEIPLHALAVHCHDTYGQALANILTAIQMGVAVVDSSVAGLGGC  245

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYAKGATGNVATEDV+YML+GLG+ T V+L  +++AG FI   L ++++SK A A
Sbjct  246   PYAKGATGNVATEDVIYMLNGLGINTGVNLYTVMEAGNFICTALNKKTNSKVAQA  300



>gb|KDO53630.1| hypothetical protein CISIN_1g0158831mg, partial [Citrus sinensis]
 gb|KDO53631.1| hypothetical protein CISIN_1g0158831mg, partial [Citrus sinensis]
 gb|KDO53632.1| hypothetical protein CISIN_1g0158831mg, partial [Citrus sinensis]
Length=249

 Score =   365 bits (937),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 193/249 (78%), Positives = 227/249 (91%), Gaps = 1/249 (0%)
 Frame = -3

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             L+DAKDVM A++N+EGAR PVLTPNLKGFEAA+A+GAKEVA+FASASESFSK+NINC+IE
Sbjct  1     LADAKDVMAAIQNVEGARFPVLTPNLKGFEAAVAAGAKEVAIFASASESFSKSNINCTIE  60

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             +SL+RYR V  AA++LSIPVRGY+SCVVGCPVEG + PSKVAY++K+L++MGC EISLGD
Sbjct  61    DSLIRYRDVALAARELSIPVRGYLSCVVGCPVEGMVPPSKVAYVSKQLYDMGCSEISLGD  120

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIGV TPGTVIPMLEAV+  VPV+KLAVHFHDTYGQ+L NIL SLQMG+ TVDSSVSGLG
Sbjct  121   TIGVGTPGTVIPMLEAVLDAVPVDKLAVHFHDTYGQALSNILASLQMGISTVDSSVSGLG  180

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTR  469
             GCPYAKGA+GNVATEDVVYML+GLGV+TNVD+ KL+ AG+FI KHLGR S SK AIAL++
Sbjct  181   GCPYAKGASGNVATEDVVYMLNGLGVRTNVDIRKLMIAGDFICKHLGRTSGSKTAIALSK  240

Query  468   VS-ADASKI  445
              S A+ASK+
Sbjct  241   TSTANASKL  249



>ref|XP_004637657.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Octodon degus]
Length=325

 Score =   368 bits (944),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 194/297 (65%), Positives = 236/297 (79%), Gaps = 0/297 (0%)
 Frame = -3

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             +PK VKIVEVGPRDGLQNEKN VPTSVK++LI  L   GLPV+E T FVSPKWVPQ++D 
Sbjct  29    LPKQVKIVEVGPRDGLQNEKNVVPTSVKIKLIDMLSEAGLPVIEATSFVSPKWVPQMADH  88

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
              +V++ ++   G   PVLTPNLKGFEAA+A+GAKEV+VF +ASE FSK NINCSIEES  
Sbjct  89    TEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVSVFGAASELFSKKNINCSIEESFQ  148

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             R   V  AA+   IPVRGY+SCV+GCP EG I P+KVA ++K+L+ MGC+EISLGDTIGV
Sbjct  149   RMGGVLEAARAAGIPVRGYVSCVLGCPYEGKISPAKVAEVSKKLYSMGCYEISLGDTIGV  208

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
              TPG +  ML AVM  VPV  LAVH HDTYGQ+L N L++LQMGV  VD+SV+GLGGCPY
Sbjct  209   GTPGLMKDMLSAVMHEVPVAALAVHCHDTYGQALANTLMALQMGVSVVDASVAGLGGCPY  268

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             A+GA+GN+ATED+VYML GLG+ T V+L KLL+AG+FI + L R++SSK A A  R+
Sbjct  269   AQGASGNLATEDLVYMLSGLGIHTGVNLQKLLEAGDFICQVLNRKTSSKVAQASCRL  325



>ref|XP_003641072.1| PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic 
isoformX1 [Gallus gallus]
Length=344

 Score =   368 bits (945),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 189/323 (59%), Positives = 245/323 (76%), Gaps = 0/323 (0%)
 Frame = -3

Query  1446  WKRQFRDRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVE  1267
             ++   +++ + G          W     +G+P+YVKIVEVGPRDGLQNEK  VPT  K+E
Sbjct  14    YQHLLKEQLWIGEPTAGGLGPAWEESQASGLPEYVKIVEVGPRDGLQNEKVIVPTDTKIE  73

Query  1266  LIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIA  1087
             LI +L   GLP +EVT FVS KWVPQ++D K+VM+ ++   G + PVLTPNLKGF +AIA
Sbjct  74    LINRLSKTGLPAIEVTSFVSSKWVPQMADHKEVMRGIERHPGVQYPVLTPNLKGFHSAIA  133

Query  1086  SGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEG  907
             +GA EV+VF +ASESFSK NINCSIEES+ ++  V  +A+ ++IPVRGY+SC +GCP EG
Sbjct  134   AGATEVSVFGAASESFSKMNINCSIEESIEKFEEVAKSARNMNIPVRGYVSCALGCPYEG  193

Query  906   AILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTY  727
              I P+KVA ++K L+ MGC+EISLGDTIGV TPG++  MLEAVM  +P+  LAVH HDTY
Sbjct  194   DITPAKVAEVSKRLYSMGCYEISLGDTIGVGTPGSMKRMLEAVMKEIPLSALAVHCHDTY  253

Query  726   GQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGK  547
             GQ+L NIL ++QMGV  VDSSV+GLGGCPYAKGATGNVATEDV+YML+GLG+ T V+L  
Sbjct  254   GQALANILTAIQMGVAVVDSSVAGLGGCPYAKGATGNVATEDVIYMLNGLGINTGVNLYT  313

Query  546   LLQAGEFISKHLGRESSSKAAIA  478
             +++AG FI   L ++++SK A A
Sbjct  314   VMEAGNFICTALNKKTNSKVAQA  336



>gb|KFR07972.1| 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic, partial 
[Nipponia nippon]
Length=305

 Score =   367 bits (941),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 185/295 (63%), Positives = 239/295 (81%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNEK  VPT +K+ELI +L   GLP +EVT FVS KWVPQ++
Sbjct  6     SGLPEYIKIVEVGPRDGLQNEKVIVPTDIKIELINRLSRTGLPAIEVTSFVSSKWVPQMA  65

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM+ ++   G + PVLTPNL+GF +AIA+GA EV+VF +ASESFSK NINCSIEES
Sbjct  66    DHKEVMRGIERHPGVQYPVLTPNLQGFHSAIAAGATEVSVFGAASESFSKMNINCSIEES  125

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             + ++  V  +A+ ++IPVRGY+SC +GCP EG I+P+KVA ++K L+ MGC+EISLGDTI
Sbjct  126   IEKFEEVAKSARNMNIPVRGYVSCALGCPYEGNIIPAKVAEVSKRLYSMGCYEISLGDTI  185

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  186   GVGTPGSMKRMLEAVMKEIPLSALAVHCHDTYGQALANILTAIQMGVAVVDSSVAGLGGC  245

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYAKGATGNVATEDV+YML+GLG+ T V+L  +++AG FI   L ++++SK A A
Sbjct  246   PYAKGATGNVATEDVIYMLNGLGINTGVNLYTVMEAGNFICTALNKKTNSKVAQA  300



>ref|XP_005433102.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Falco cherrug]
Length=318

 Score =   367 bits (942),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 192/309 (62%), Positives = 238/309 (77%), Gaps = 0/309 (0%)
 Frame = -3

Query  1392  FSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGF  1213
             ++G  R V     P+ VK+VEVGPRDGLQNEKN VPT VK+ LI  L   GL V+E T F
Sbjct  10    WAGSLRPVTAGAFPRRVKVVEVGPRDGLQNEKNIVPTPVKINLINMLAETGLQVIEATSF  69

Query  1212  VSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfsk  1033
             VSPKWVPQ++D  +VMQ +  L G   PVLTPNLKGF+AA+A+GAKEV++F +ASE F+K
Sbjct  70    VSPKWVPQMADHTEVMQGINKLPGISYPVLTPNLKGFQAAVAAGAKEVSIFGAASELFTK  129

Query  1032  ANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMG  853
              NINCSIEESL R+  V +AAK  SIPVRGY+SCV+GCP EG I  +KVA ++K+++ MG
Sbjct  130   KNINCSIEESLERFDEVMTAAKAASIPVRGYVSCVLGCPYEGKISAAKVAEVSKKMYSMG  189

Query  852   CFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTV  673
             C+EISLGDTIG+ TPG++  ML AVM  VPV  LAVH HDTYGQ+L NILV+LQMGV  V
Sbjct  190   CYEISLGDTIGIGTPGSMKEMLTAVMKEVPVGALAVHCHDTYGQALANILVALQMGVSVV  249

Query  672   DSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSS  493
             D+SV+GLGGCPYA+GA+GNVATED+VYML+GLG+ T VDL KL+  G +I   L R ++S
Sbjct  250   DASVAGLGGCPYAQGASGNVATEDLVYMLNGLGIHTGVDLQKLMDTGTYICNALNRRTNS  309

Query  492   KAAIALTRV  466
             K + A  R+
Sbjct  310   KVSQASCRL  318



>ref|XP_009821593.1| hypothetical protein H257_00555 [Aphanomyces astaci]
 gb|ETV89193.1| hypothetical protein H257_00555 [Aphanomyces astaci]
Length=316

 Score =   367 bits (942),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 232/297 (78%), Gaps = 0/297 (0%)
 Frame = -3

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             P YVKIVEVGPRDGLQNEK  V T+ KV LI  L   GLPVVE T FVSPKWVPQ+ D  
Sbjct  18    PSYVKIVEVGPRDGLQNEKTLVSTADKVALINLLSEAGLPVVEATSFVSPKWVPQMGDNA  77

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             DVM+ +K  EG   PVLTPNL GF+AAI   A EVA+F +ASESFS+ NINCSI+ESL R
Sbjct  78    DVMKQIKRKEGVFYPVLTPNLTGFDAAIKVNAHEVAIFGAASESFSRKNINCSIQESLER  137

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
             +  V   A  L + VRGY+SCV+GCP EGAI P+ VA +AK L +MGC+EISLGDTIG+ 
Sbjct  138   FHPVCEKAHSLGVRVRGYVSCVLGCPYEGAIDPAVVANVAKTLLDMGCYEISLGDTIGIG  197

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYA  634
             TPG+ + ML+A   VVPVEKLAVHFHDTYGQ+L NILV+LQ GV  VDS+V+GLGGCPYA
Sbjct  198   TPGSTLKMLQATKDVVPVEKLAVHFHDTYGQALANILVALQEGVSVVDSAVAGLGGCPYA  257

Query  633   KGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVS  463
             KGA+GNVATEDVVYMLHGLG++T VDL K++ AG+FIS  LG+ ++S+ A AL + S
Sbjct  258   KGASGNVATEDVVYMLHGLGIRTGVDLTKVVAAGDFISSVLGKATNSRVARALQKPS  314



>gb|EMC90228.1| putative 3-hydroxymethyl-3-methylglutaryl-CoA lyase 2, partial 
[Columba livia]
Length=308

 Score =   367 bits (941),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 185/295 (63%), Positives = 239/295 (81%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNEK  VPT +K+ELI +L   GLP +EVT FVS KWVPQ++
Sbjct  6     SGLPEYIKIVEVGPRDGLQNEKVIVPTDIKIELINRLSKTGLPAIEVTSFVSSKWVPQMA  65

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM+ ++   G + PVLTPNL+GF +AIA+GA EV+VF +ASESFSK NINCSIEES
Sbjct  66    DHKEVMRGIERHPGVQYPVLTPNLRGFHSAIAAGATEVSVFGAASESFSKMNINCSIEES  125

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             + ++  V  +A+ ++IPVRGY+SC +GCP EG I+P+KVA ++K L+ MGC+EISLGDTI
Sbjct  126   IEKFEEVAKSARNMNIPVRGYVSCALGCPYEGNIIPAKVAEVSKRLYSMGCYEISLGDTI  185

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  186   GVGTPGSMKRMLEAVMKDIPLSALAVHCHDTYGQALANILTAIQMGVTVVDSSVAGLGGC  245

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYAKGATGNVATEDV+YML+GLG+ T V+L  +++AG FI   L ++++SK A A
Sbjct  246   PYAKGATGNVATEDVIYMLNGLGINTGVNLYAVMEAGNFICTALNKKTNSKVAQA  300



>gb|KFO11432.1| 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic, partial 
[Balearica regulorum gibbericeps]
Length=307

 Score =   367 bits (941),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 184/293 (63%), Positives = 238/293 (81%), Gaps = 0/293 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNEK  VPT  K+ELI +L   GLP +EVT FVS KWVPQ++
Sbjct  6     SGLPEYIKIVEVGPRDGLQNEKVIVPTDTKIELINRLSKTGLPAIEVTSFVSSKWVPQMA  65

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM+ ++   G + PVLTPNL+GF +AIA+GA EV+VF +ASESFSK NINCSIEES
Sbjct  66    DHKEVMRGIERHPGVQYPVLTPNLQGFHSAIAAGATEVSVFGAASESFSKMNINCSIEES  125

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             + ++  V  +A+ +++PVRGY+SC +GCP EG I+P+KVA ++K L+ MGC+EISLGDTI
Sbjct  126   IEKFEEVAKSARNMNVPVRGYVSCALGCPYEGNIIPAKVAEVSKRLYSMGCYEISLGDTI  185

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  186   GVGTPGSMKRMLEAVMKEIPLSALAVHCHDTYGQALANILTAIQMGVAVVDSSVAGLGGC  245

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAA  484
             PYAKGATGNVATEDV+YML+GLG+ T V+L K+++AG FI   L ++++SK A
Sbjct  246   PYAKGATGNVATEDVIYMLNGLGINTGVNLYKVMEAGNFICTALNKKTNSKVA  298



>ref|XP_005915581.1| PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic-like 
[Haplochromis burtoni]
Length=341

 Score =   368 bits (944),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 186/309 (60%), Positives = 243/309 (79%), Gaps = 0/309 (0%)
 Frame = -3

Query  1377  RNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
             + +  +  P++VKIVEVGPRDGLQNEK  VPT VK++LI  L   GL V+E T FVS KW
Sbjct  32    KTITGHAYPEFVKIVEVGPRDGLQNEKEIVPTGVKIQLIDMLSGTGLSVIEATSFVSSKW  91

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQ++D  DV++ ++     + PVLTPNL+GF+ A+A+GA EVAVF SASE+FSK NINC
Sbjct  92    VPQMADHTDVLRGIQRASNVQYPVLTPNLQGFQDAVAAGATEVAVFGSASETFSKKNINC  151

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             S++ES++R+  V +AAKK  IPVRGY+SC +GCP EG I PSKVA +AK L+EMGC+EIS
Sbjct  152   SVDESMLRFEEVINAAKKRQIPVRGYVSCALGCPHEGHIEPSKVAEVAKRLYEMGCYEIS  211

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIG+ TPG+++ ML+ VM  VP+  LAVH HDTYGQ+LPNIL +LQMGV  VDS+V+
Sbjct  212   LGDTIGIGTPGSMLKMLQRVMKDVPINALAVHCHDTYGQALPNILTALQMGVSVVDSAVA  271

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYA+G++GNV+TEDV+YMLHG+G++T V++ K+++AG FI   L RE++SK A A
Sbjct  272   GLGGCPYAQGSSGNVSTEDVLYMLHGMGIETGVNIAKVIEAGSFICSALSRETNSKVAQA  331

Query  477   LTRVSADAS  451
              +    DAS
Sbjct  332   RSTACCDAS  340



>gb|KFP15961.1| 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic, partial 
[Egretta garzetta]
Length=307

 Score =   367 bits (941),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 185/295 (63%), Positives = 239/295 (81%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNEK  VPT +K+ELI +L   GLP +EVT FVS KWVPQ++
Sbjct  6     SGLPEYIKIVEVGPRDGLQNEKVIVPTDIKIELINRLSRTGLPAIEVTSFVSSKWVPQMA  65

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM+ ++   G + PVLTPNL+GF +AIA+GA EV+VF +ASESFSK NINCSIEES
Sbjct  66    DHKEVMRGIERHPGVQYPVLTPNLQGFHSAIAAGATEVSVFGAASESFSKMNINCSIEES  125

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             + ++  V  +A+ ++IPVRGY+SC +GCP EG I+P+KVA ++K L+ MGC+EISLGDTI
Sbjct  126   IEKFEEVAKSARNMNIPVRGYVSCALGCPYEGNIIPAKVAEVSKRLYSMGCYEISLGDTI  185

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  186   GVGTPGSMKRMLEAVMKEIPLSALAVHCHDTYGQALANILTAIQMGVAVVDSSVAGLGGC  245

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYAKGATGNVATEDV+YML+GLG+ T V+L  +++AG FI   L ++++SK A A
Sbjct  246   PYAKGATGNVATEDVIYMLNGLGINTGVNLYTVMEAGNFICTALNKKTNSKVAQA  300



>gb|KFW73605.1| 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic, partial 
[Pygoscelis adeliae]
Length=307

 Score =   367 bits (941),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 239/295 (81%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNEK  VPT +K+ELI +L   GLP +EVT FVS KWVPQ++
Sbjct  6     SGLPEYIKIVEVGPRDGLQNEKVIVPTDIKIELINQLSRTGLPAIEVTSFVSSKWVPQMA  65

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM+ ++   G + PVLTPNL+GF +AIA+GA EV+VF +ASESFSK NINCSIEES
Sbjct  66    DHKEVMRGIERHPGVQYPVLTPNLQGFHSAIAAGATEVSVFGAASESFSKMNINCSIEES  125

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             + ++  V  +A+ +SIPVRGY+SC +GCP EG I+P+KVA ++K L+ MGC+EISLGDTI
Sbjct  126   IEKFEEVAKSARNMSIPVRGYVSCALGCPYEGNIIPAKVAEVSKRLYSMGCYEISLGDTI  185

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  186   GVGTPGSMKRMLEAVMKEIPLSALAVHCHDTYGQALANILTAIQMGVAVVDSSVAGLGGC  245

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYAKG+TGNVATEDV+YML+GLGV T V+L  +++AG FI   L ++++SK A A
Sbjct  246   PYAKGSTGNVATEDVIYMLNGLGVNTGVNLYTVMEAGNFICTALNKKTNSKVAQA  300



>ref|XP_010877513.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Esox 
lucius]
Length=340

 Score =   368 bits (944),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 192/304 (63%), Positives = 232/304 (76%), Gaps = 5/304 (2%)
 Frame = -3

Query  1389  SGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFV  1210
             S  W+      +P+ VKIVEVGPRDGLQNEK  VPT VK+ LI  L   GLPV+E T FV
Sbjct  38    SSAWK-----ALPERVKIVEVGPRDGLQNEKTVVPTEVKIHLIDMLSEAGLPVIEATSFV  92

Query  1209  SPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskA  1030
             SPKWVPQ++D  +VM+ ++   G   PVLTPNLKGF+ A+ +GA EVA+F +ASE FSK 
Sbjct  93    SPKWVPQMADQVEVMKGIRRRPGVAYPVLTPNLKGFQEAVKAGAAEVAIFGAASELFSKK  152

Query  1029  NINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGC  850
             NINCS+EESL R+  VT AAK+  +PVRGY+SCV+GCP EG + P KVA +AK L+ MGC
Sbjct  153   NINCSVEESLQRFEEVTKAAKEAGVPVRGYVSCVLGCPYEGKVSPDKVAQVAKRLYSMGC  212

Query  849   FEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVD  670
             +EISLGDT GV TPG +  MLE V   VPV  LAVH HDTYGQ+L NIL++LQMGV  VD
Sbjct  213   YEISLGDTTGVGTPGGMTEMLEVVSREVPVTALAVHCHDTYGQALANILIALQMGVSVVD  272

Query  669   SSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSK  490
             SSV+GLGGCPYA+GA+GNVATEDVVYMLHGLG++T VDL K++ AG FI + L R++SSK
Sbjct  273   SSVAGLGGCPYAQGASGNVATEDVVYMLHGLGIQTGVDLTKVMDAGAFICRSLNRKTSSK  332

Query  489   AAIA  478
              A A
Sbjct  333   VAQA  336



>ref|XP_005427979.1| PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic 
[Geospiza fortis]
Length=356

 Score =   368 bits (945),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 190/318 (60%), Positives = 247/318 (78%), Gaps = 4/318 (1%)
 Frame = -3

Query  1431  RDRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKL  1252
             R  P +G+ +R     G      +G+P+Y+KIVEVGPRDGLQNEK  VPT +K+ELI +L
Sbjct  35    RANPSSGLQHRN----GELEPQASGLPEYIKIVEVGPRDGLQNEKVIVPTDIKIELINQL  90

Query  1251  VSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGake  1072
                GLP +EVT FVS KWVPQ++D K+VM+ ++   G + PVLTPNL+GF +AIA+GA E
Sbjct  91    SKTGLPAIEVTSFVSSKWVPQMADHKEVMRGIERHPGVQYPVLTPNLQGFHSAIAAGATE  150

Query  1071  vavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPS  892
             ++VF +ASESFSK NINCSIEES+ R+  VT +A+ ++IPVRGY+SC +GCP EG ++P 
Sbjct  151   ISVFGAASESFSKMNINCSIEESIERFEEVTKSARSMNIPVRGYVSCALGCPYEGNVVPD  210

Query  891   KVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLP  712
             KVA ++K L+ MGC+EISLGDTIGV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L 
Sbjct  211   KVAEVSKRLYSMGCYEISLGDTIGVGTPGSMKKMLEAVMKEIPLSALAVHCHDTYGQALA  270

Query  711   NILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAG  532
             NIL ++QMGV  VDSSV+GLGGCPYAKGATGNVATEDV+YML+GLG+ T V+L  +++AG
Sbjct  271   NILTAMQMGVSVVDSSVAGLGGCPYAKGATGNVATEDVIYMLNGLGINTGVNLCAVMEAG  330

Query  531   EFISKHLGRESSSKAAIA  478
              FI   L ++++SK A A
Sbjct  331   NFICTALNKKTNSKVAQA  348



>gb|KFV99018.1| 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic, partial 
[Eurypyga helias]
Length=307

 Score =   366 bits (940),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 239/295 (81%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNEK  VPT +K+ELI +L   GLP +EVT FVS KWVPQ++
Sbjct  6     SGLPEYIKIVEVGPRDGLQNEKVIVPTDIKIELINRLSKTGLPAIEVTSFVSSKWVPQMA  65

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM+ ++   G + PVLTPNL+GF +AIA+GA EV+VF +ASESFSK NINCSIEES
Sbjct  66    DHKEVMRGIERHPGVQYPVLTPNLQGFHSAIAAGATEVSVFGAASESFSKMNINCSIEES  125

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             + ++  V  +A+ ++IPVRGY+SC +GCP EG I+P+KVA ++K L+ MGC+EISLGDTI
Sbjct  126   IEKFEEVAKSARNMNIPVRGYVSCALGCPYEGNIIPAKVAEVSKRLYSMGCYEISLGDTI  185

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  186   GVGTPGSMKRMLEAVMKEIPLSALAVHCHDTYGQALANILTAIQMGVAVVDSSVAGLGGC  245

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYAKGATGNVATEDV+YML+GLG+ T  +L ++++AG FI   L ++++SK A A
Sbjct  246   PYAKGATGNVATEDVIYMLNGLGINTGANLYRVMEAGNFICTALNKKTNSKVAQA  300



>gb|KFZ58637.1| 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic, partial 
[Caprimulgus carolinensis]
Length=307

 Score =   366 bits (940),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 185/295 (63%), Positives = 238/295 (81%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNEK  VPT  K+ELI +L   GLP +EVT FVS KWVPQ++
Sbjct  6     SGLPEYIKIVEVGPRDGLQNEKVIVPTDTKIELINRLSRTGLPAIEVTSFVSSKWVPQMA  65

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM+ ++   G + PVLTPNL+GF +AIASGA EV+VF +ASESFSK NINCSIEES
Sbjct  66    DHKEVMRGIERHPGVQYPVLTPNLQGFHSAIASGATEVSVFGAASESFSKMNINCSIEES  125

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             + ++  +  +A+ ++IPVRGY+SC +GCP EG I+P+KVA ++K L+ MGC+EISLGDTI
Sbjct  126   IEKFEEIAKSARNMNIPVRGYVSCALGCPYEGNIIPAKVAEVSKRLYSMGCYEISLGDTI  185

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  186   GVGTPGSMKRMLEAVMKEIPLSALAVHCHDTYGQALANILTAIQMGVAVVDSSVAGLGGC  245

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYAKGATGNVATEDV+YML+GLG+ T V+L  +++AG FI   L ++++SK A A
Sbjct  246   PYAKGATGNVATEDVIYMLNGLGINTGVNLYTVMEAGNFICTALNKKTNSKVAQA  300



>gb|KFQ68614.1| hypothetical protein N335_11361, partial [Phaethon lepturus]
Length=297

 Score =   366 bits (939),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 191/296 (65%), Positives = 233/296 (79%), Gaps = 0/296 (0%)
 Frame = -3

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             PK VK+VEVGPRDGLQNEKN VPT VK+ LI  L   GL V+E T FVSPKWVPQ++D  
Sbjct  2     PKRVKVVEVGPRDGLQNEKNVVPTPVKINLINMLSETGLQVIEATSFVSPKWVPQMADHT  61

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             +VMQ +  L G   PVLTPNLKGF+AA+A+GAKEV++F +ASE F+K NINCSIEESL R
Sbjct  62    EVMQGINKLPGISYPVLTPNLKGFQAAVAAGAKEVSIFGAASELFTKKNINCSIEESLER  121

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
             +  V SAA+  SIPVRGY+SCV+GCP EG I  +KVA ++K+++ MGC+EISLGDTIG+ 
Sbjct  122   FDEVMSAARAASIPVRGYVSCVLGCPYEGKISAAKVAEVSKKMYSMGCYEISLGDTIGIG  181

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYA  634
             TPG++  ML AVM  VPV  LAVH HDTYGQ+L NILV+LQMGV  VD+SV+GLGGCPYA
Sbjct  182   TPGSMKEMLTAVMKEVPVGALAVHCHDTYGQALANILVALQMGVSVVDASVAGLGGCPYA  241

Query  633   KGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             +GA+GNVATED+VYML+GLG+ T VDL KL+  G FI   L R ++SK + A  R+
Sbjct  242   QGASGNVATEDLVYMLNGLGIHTGVDLQKLMDTGTFICNALNRRTNSKVSQASCRL  297



>gb|KGL82586.1| 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic, partial 
[Tinamus guttatus]
Length=307

 Score =   366 bits (940),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/294 (64%), Positives = 236/294 (80%), Gaps = 0/294 (0%)
 Frame = -3

Query  1359  GVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSD  1180
             G+P+YVKIVEVGPRDGLQNEK  VPT +K+ELI +L   GLP +EVT FVS KWVPQ++D
Sbjct  7     GLPEYVKIVEVGPRDGLQNEKVIVPTDIKIELINRLSKTGLPAIEVTSFVSSKWVPQMAD  66

Query  1179  AKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESL  1000
              K+VM+ ++   G + PVLTPNL+GF +AIASGA EV+VF +ASESFSK NINCSIEES+
Sbjct  67    HKEVMRGIERYPGVQYPVLTPNLQGFHSAIASGATEVSVFGAASESFSKMNINCSIEESI  126

Query  999   VRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIG  820
              ++  V  AA+ ++IPVRGY+SC +GCP EG I P+KVA ++K L+ MGC+EISLGDTIG
Sbjct  127   DKFEEVVKAARNMNIPVRGYVSCALGCPYEGNITPTKVAEVSKRLYSMGCYEISLGDTIG  186

Query  819   VATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCP  640
             V TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGCP
Sbjct  187   VGTPGSMKRMLEAVMKEIPLNALAVHCHDTYGQALANILTAIQMGVAVVDSSVAGLGGCP  246

Query  639   YAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             YAKGATGNVATEDV+YML+GLG+ T V+L  +++ G FI   L ++++SK A A
Sbjct  247   YAKGATGNVATEDVIYMLNGLGISTGVNLYAVMETGNFICTALNKKTNSKVAQA  300



>ref|XP_004940522.1| PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic 
isoform X4 [Gallus gallus]
Length=371

 Score =   369 bits (946),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 191/317 (60%), Positives = 243/317 (77%), Gaps = 10/317 (3%)
 Frame = -3

Query  1398  RSFSGGWRNVLFN----------GVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLV  1249
             RS +   R V+ +          G+P+YVKIVEVGPRDGLQNEK  VPT  K+ELI +L 
Sbjct  47    RSLASKIREVIIHLYSALESQASGLPEYVKIVEVGPRDGLQNEKVIVPTDTKIELINRLS  106

Query  1248  SCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakev  1069
               GLP +EVT FVS KWVPQ++D K+VM+ ++   G + PVLTPNLKGF +AIA+GA EV
Sbjct  107   KTGLPAIEVTSFVSSKWVPQMADHKEVMRGIERHPGVQYPVLTPNLKGFHSAIAAGATEV  166

Query  1068  avfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSK  889
             +VF +ASESFSK NINCSIEES+ ++  V  +A+ ++IPVRGY+SC +GCP EG I P+K
Sbjct  167   SVFGAASESFSKMNINCSIEESIEKFEEVAKSARNMNIPVRGYVSCALGCPYEGDITPAK  226

Query  888   VAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPN  709
             VA ++K L+ MGC+EISLGDTIGV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L N
Sbjct  227   VAEVSKRLYSMGCYEISLGDTIGVGTPGSMKRMLEAVMKEIPLSALAVHCHDTYGQALAN  286

Query  708   ILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGE  529
             IL ++QMGV  VDSSV+GLGGCPYAKGATGNVATEDV+YML+GLG+ T V+L  +++AG 
Sbjct  287   ILTAIQMGVAVVDSSVAGLGGCPYAKGATGNVATEDVIYMLNGLGINTGVNLYTVMEAGN  346

Query  528   FISKHLGRESSSKAAIA  478
             FI   L ++++SK A A
Sbjct  347   FICTALNKKTNSKVAQA  363



>emb|CDQ74683.1| unnamed protein product [Oncorhynchus mykiss]
Length=340

 Score =   367 bits (942),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 189/299 (63%), Positives = 233/299 (78%), Gaps = 0/299 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
               +P+ VKIVEVGPRDGLQNEK  VPT VK+ LI  L   GLPV+E T FVSP+WVPQ++
Sbjct  42    KALPQRVKIVEVGPRDGLQNEKTLVPTEVKIHLIDMLSEAGLPVIEATSFVSPEWVPQMA  101

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D  +VM+ +    G   PVLTPNLKGF+AA+ +GA EVA+F +ASE FSK NINCS++ES
Sbjct  102   DQVEVMKGINRRPGVSYPVLTPNLKGFQAAVKAGAAEVAIFGAASELFSKKNINCSVDES  161

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             L R+  VT AAK+  + VRGY+SCV+GCP EG + P KVA +AK L+ MGC+EISLGDTI
Sbjct  162   LQRFEEVTKAAKEAGVRVRGYVSCVLGCPYEGQVSPDKVAQVAKRLYSMGCYEISLGDTI  221

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG +  +LEAV   VPV+ LAVH HDTYGQ+L NIL++LQMG+  VDSSV+GLGGC
Sbjct  222   GVGTPGGMAELLEAVSREVPVDALAVHCHDTYGQALANILIALQMGISVVDSSVAGLGGC  281

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             PYA+GA+GNVATEDVVYMLHGLG++T VDL KL+ AG FI + L R++SSK A A  ++
Sbjct  282   PYAQGASGNVATEDVVYMLHGLGIQTGVDLPKLMDAGAFICRSLNRKTSSKVAQATCKL  340



>gb|KFQ75914.1| 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic, partial 
[Phoenicopterus ruber ruber]
Length=307

 Score =   365 bits (938),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 238/295 (81%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNEK  VPT +K+E I +L   GLP +EVT FVS KWVPQ++
Sbjct  6     SGLPEYIKIVEVGPRDGLQNEKVIVPTDIKIEFINRLSKTGLPAIEVTSFVSSKWVPQMA  65

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM+ ++   G + PVLTPNL+GF +AIA+GA EV+VF +ASESFSK NINCSIEES
Sbjct  66    DHKEVMRGIERHPGVQYPVLTPNLQGFHSAIAAGATEVSVFGAASESFSKMNINCSIEES  125

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             + ++  V  +A+ ++IPVRGY+SC +GCP EG I+P+KVA ++K L+ MGC+EISLGDTI
Sbjct  126   IEKFEEVAKSARNMNIPVRGYVSCALGCPYEGNIIPAKVAEVSKRLYSMGCYEISLGDTI  185

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  186   GVGTPGSMKRMLEAVMKEIPLSALAVHCHDTYGQALANILTAIQMGVAVVDSSVAGLGGC  245

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYAKGATGNVATEDV+YML+GLG+ T V+L  +++AG FI   L ++++SK A A
Sbjct  246   PYAKGATGNVATEDVIYMLNGLGINTGVNLYTVMEAGNFICTALNKKTNSKVAQA  300



>ref|XP_005486082.1| PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic 
[Zonotrichia albicollis]
Length=356

 Score =   367 bits (943),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 190/318 (60%), Positives = 247/318 (78%), Gaps = 4/318 (1%)
 Frame = -3

Query  1431  RDRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKL  1252
             R  P +G+ +      G   +  +G+P+Y+KIVEVGPRDGLQNEK  VPT +K+ELI +L
Sbjct  35    RANPSSGLQH----GNGELELQASGLPEYIKIVEVGPRDGLQNEKVIVPTDIKIELINQL  90

Query  1251  VSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGake  1072
                GLP +EVT FVS KWVPQ++D K+VM+ ++   G + PVLTPNL+GF +AIA+GA E
Sbjct  91    SKTGLPAIEVTSFVSSKWVPQMADHKEVMRGIERHPGVQYPVLTPNLQGFHSAIAAGATE  150

Query  1071  vavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPS  892
             V+VF +ASESFSK NINCSIEES+ R+  VT +A+ ++IPVRGY+SC +GCP EG ++P 
Sbjct  151   VSVFGAASESFSKMNINCSIEESIERFEEVTKSARSMNIPVRGYVSCALGCPYEGNVVPD  210

Query  891   KVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLP  712
             KVA ++K L+ MGC+EISLGDTIGV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L 
Sbjct  211   KVAEVSKRLYSMGCYEISLGDTIGVGTPGSMKKMLEAVMKEIPLSALAVHCHDTYGQALA  270

Query  711   NILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAG  532
             NIL ++QMGV  VDSSV+GLGGCPYAKGATGNVATEDV+YML+GLG+ T V+L  +++AG
Sbjct  271   NILTAMQMGVSVVDSSVAGLGGCPYAKGATGNVATEDVIYMLNGLGINTGVNLCAVMEAG  330

Query  531   EFISKHLGRESSSKAAIA  478
              FI   L ++++SK A A
Sbjct  331   NFICTALNKKTNSKVAQA  348



>ref|XP_009080289.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial, partial 
[Acanthisitta chloris]
Length=302

 Score =   365 bits (938),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 190/296 (64%), Positives = 234/296 (79%), Gaps = 0/296 (0%)
 Frame = -3

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             PK VK+VEVGPRDGLQNEKN VPT VK+ LI  L   GL V+E T FVSPKWVPQ++D  
Sbjct  7     PKKVKVVEVGPRDGLQNEKNVVPTPVKINLINMLSETGLQVIEATSFVSPKWVPQMADHT  66

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             +VMQ +  L G   PVLTPNLKGF+AA+A+GAKEV++F +ASE F+K NINCSIEESL R
Sbjct  67    EVMQGINKLPGISYPVLTPNLKGFQAAVAAGAKEVSIFGAASELFTKKNINCSIEESLER  126

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
             +  V +AAK  +IPVRGY+SCV+GCP EG I P+KVA ++K+++ MGC+EISLGDTIG+ 
Sbjct  127   FDEVMTAAKGANIPVRGYVSCVLGCPYEGKISPAKVAEVSKKMYSMGCYEISLGDTIGIG  186

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYA  634
             TPG++  ML AVM  VPV  LAVH HDTYGQ+L NILV+LQMGV  VD+SV+GLGGCPYA
Sbjct  187   TPGSMKEMLTAVMKEVPVGALAVHCHDTYGQALANILVALQMGVSVVDASVAGLGGCPYA  246

Query  633   KGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             +GA+GNVATED+VYML+GLG+ + VDL KL+  G FI   L R ++SK + A  R+
Sbjct  247   QGASGNVATEDLVYMLNGLGIHSGVDLQKLMDTGTFICNALNRRTNSKVSQASCRL  302



>ref|XP_004556012.1| PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic-like 
[Maylandia zebra]
 ref|XP_006800804.1| PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic-like 
[Neolamprologus brichardi]
Length=341

 Score =   367 bits (942),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 185/309 (60%), Positives = 243/309 (79%), Gaps = 0/309 (0%)
 Frame = -3

Query  1377  RNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
             + +  +  P++VKIVEVGPRDGLQNEK  VPT VK++LI  L   GL V+E T FVS KW
Sbjct  32    KTITGHAYPEFVKIVEVGPRDGLQNEKEIVPTGVKIQLIDMLSGTGLSVIEATSFVSSKW  91

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQ++D  DV++ ++     + PVLTPNL+GF+ A+A+GA EVAVF SASE+FSK NINC
Sbjct  92    VPQMADHTDVLRGIQKASNVQYPVLTPNLQGFQDAVAAGATEVAVFGSASETFSKKNINC  151

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             S++ES++R+  V +AAKK  IPVRGY+SC +GCP EG I PSKVA +AK L+EMGC+EIS
Sbjct  152   SVDESMLRFEEVINAAKKRQIPVRGYVSCALGCPHEGHIEPSKVAEVAKRLYEMGCYEIS  211

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIG+ TPG+++ ML+ VM  VP+  LAVH HDTYGQ+LPNIL +LQMGV  VDS+V+
Sbjct  212   LGDTIGIGTPGSMLKMLQRVMKDVPINALAVHCHDTYGQALPNILTALQMGVSVVDSAVA  271

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYA+G++GNV+TEDV+YMLHG+G++T V++ K+++AG FI   L R+++SK A A
Sbjct  272   GLGGCPYAQGSSGNVSTEDVLYMLHGMGIETGVNIAKVIEAGSFICSALSRKTNSKVAQA  331

Query  477   LTRVSADAS  451
              +    DAS
Sbjct  332   RSTACCDAS  340



>gb|KFP71293.1| hypothetical protein N310_02806, partial [Acanthisitta chloris]
Length=298

 Score =   365 bits (937),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 190/296 (64%), Positives = 234/296 (79%), Gaps = 0/296 (0%)
 Frame = -3

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             PK VK+VEVGPRDGLQNEKN VPT VK+ LI  L   GL V+E T FVSPKWVPQ++D  
Sbjct  3     PKKVKVVEVGPRDGLQNEKNVVPTPVKINLINMLSETGLQVIEATSFVSPKWVPQMADHT  62

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             +VMQ +  L G   PVLTPNLKGF+AA+A+GAKEV++F +ASE F+K NINCSIEESL R
Sbjct  63    EVMQGINKLPGISYPVLTPNLKGFQAAVAAGAKEVSIFGAASELFTKKNINCSIEESLER  122

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
             +  V +AAK  +IPVRGY+SCV+GCP EG I P+KVA ++K+++ MGC+EISLGDTIG+ 
Sbjct  123   FDEVMTAAKGANIPVRGYVSCVLGCPYEGKISPAKVAEVSKKMYSMGCYEISLGDTIGIG  182

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYA  634
             TPG++  ML AVM  VPV  LAVH HDTYGQ+L NILV+LQMGV  VD+SV+GLGGCPYA
Sbjct  183   TPGSMKEMLTAVMKEVPVGALAVHCHDTYGQALANILVALQMGVSVVDASVAGLGGCPYA  242

Query  633   KGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             +GA+GNVATED+VYML+GLG+ + VDL KL+  G FI   L R ++SK + A  R+
Sbjct  243   QGASGNVATEDLVYMLNGLGIHSGVDLQKLMDTGTFICNALNRRTNSKVSQASCRL  298



>gb|KFQ63128.1| 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic, partial 
[Pelecanus crispus]
Length=307

 Score =   365 bits (938),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 185/295 (63%), Positives = 239/295 (81%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNEK  VPT +K+ELI +L   GLP +EVT FVS KWVPQ++
Sbjct  6     SGLPEYIKIVEVGPRDGLQNEKVIVPTDIKIELINRLSRTGLPAIEVTSFVSSKWVPQMA  65

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM+ ++   G + PVLTPNL+GF +AIA+GA EV+VF +ASESFSK NINCSIEES
Sbjct  66    DHKEVMRGIERHPGVQYPVLTPNLQGFHSAIAAGATEVSVFGAASESFSKMNINCSIEES  125

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             + ++  V  +A+ ++IPVRGY+SC +GCP EG I+P+KVA ++K L+ MGC+EISLGDTI
Sbjct  126   IEKFEEVAKSARNMNIPVRGYVSCALGCPYEGNIIPAKVAEVSKRLYSMGCYEISLGDTI  185

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  186   GVGTPGSMKRMLEAVMKEIPLGALAVHCHDTYGQALANILTAIQMGVAVVDSSVAGLGGC  245

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYAKGATGNVATEDV+YML+GLG+ T V+L  +++AG FI   L ++++SK A A
Sbjct  246   PYAKGATGNVATEDVIYMLNGLGINTGVNLYTVMEAGNFICTALNKKTNSKVAQA  300



>ref|XP_008316736.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Cynoglossus 
semilaevis]
Length=337

 Score =   367 bits (941),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 193/328 (59%), Positives = 245/328 (75%), Gaps = 4/328 (1%)
 Frame = -3

Query  1461  RGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPT  1282
             R S+      +   ++  +N R+ + G    L    P+ VKIVEVGPRDGLQNEK  VPT
Sbjct  10    RSSFTSAMGHQYLAFSAAANVRASAVGAGQTL----PERVKIVEVGPRDGLQNEKTLVPT  65

Query  1281  SVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGF  1102
               K++LI  L   GLPV+E T FVSPKWVPQ++D  +VM+ +    G   PVLTPNLKGF
Sbjct  66    ETKIQLIDLLSESGLPVIEATSFVSPKWVPQMADQVEVMKGICRKPGVTYPVLTPNLKGF  125

Query  1101  EAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVG  922
             +AA+ +GAKEVA+F +ASE FSK NINCS++ESL+R+  V  AA++  +PVRGY+SCV+G
Sbjct  126   QAALTAGAKEVAIFGAASELFSKKNINCSVDESLLRFEEVMEAAREACVPVRGYVSCVLG  185

Query  921   CPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVH  742
             CP EG + P KVA++AK L+ MGC+EISLGDTIGV TPG++  ML AV   VP+  LAVH
Sbjct  186   CPYEGKVAPEKVAHVAKRLYSMGCYEISLGDTIGVGTPGSMSQMLAAVTREVPLNALAVH  245

Query  741   FHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTN  562
              HDTYGQ+L NILV+LQMG+  VDSSV+GLGGCPYA+GA+GNVATEDVVYMLHGLG++T 
Sbjct  246   CHDTYGQALANILVALQMGISVVDSSVAGLGGCPYAQGASGNVATEDVVYMLHGLGIQTG  305

Query  561   VDLGKLLQAGEFISKHLGRESSSKAAIA  478
             VD+ KL+ AG FI + L R+++SK A A
Sbjct  306   VDMSKLMNAGAFICRILNRKTNSKVAQA  333



>ref|XP_005317654.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Ictidomys tridecemlineatus]
Length=325

 Score =   366 bits (940),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 192/292 (66%), Positives = 234/292 (80%), Gaps = 0/292 (0%)
 Frame = -3

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             PK VKIVEVGPRDGLQNEKN VPT VK++LI  L   GLPVVEVT FVSPKWVPQ++D  
Sbjct  30    PKRVKIVEVGPRDGLQNEKNIVPTPVKIKLIDMLSEAGLPVVEVTSFVSPKWVPQMADHT  89

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             +V++ ++   G   PVLTPNLKGFEAA+A+GAKEV+VF +ASE F++ NINCSI+ES  R
Sbjct  90    EVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVSVFGAASELFTRKNINCSIDESFQR  149

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
                +  AA+  +IPVRGY+SCV+GCP EG I P+KVA +AK+L+ MGC+EISLGDTIGV 
Sbjct  150   MDVILKAAQATNIPVRGYVSCVLGCPYEGKIPPAKVAEVAKKLYSMGCYEISLGDTIGVG  209

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYA  634
             TPG +  ML AVM  VPV  LAVH HDTYGQ+L N L++LQMGV  VDSSV+GLGGCPYA
Sbjct  210   TPGIMKDMLSAVMHEVPVAALAVHCHDTYGQALANTLMALQMGVSVVDSSVAGLGGCPYA  269

Query  633   KGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             +GA+GN+ATED+VYML GLG+ T V+L KLL+AG+FI + L R++SSK A A
Sbjct  270   QGASGNLATEDLVYMLTGLGIHTGVNLQKLLEAGDFICQVLNRKTSSKVAQA  321



>ref|XP_003415431.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Loxodonta africana]
Length=325

 Score =   366 bits (940),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 236/297 (79%), Gaps = 0/297 (0%)
 Frame = -3

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             +PK VKIVEVGPRDGLQNEK+ +PT VK++LI  L   GLPV+E T FVSPKWVPQL+DA
Sbjct  29    LPKRVKIVEVGPRDGLQNEKDIIPTPVKIKLIDMLSEAGLPVIEATSFVSPKWVPQLADA  88

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
              +V++ ++   G   PVLTPNLKGF+ A+A+GAKEVAV  +ASE F+K NINCS++ES  
Sbjct  89    AEVLKGIQRFPGINYPVLTPNLKGFQDAVAAGAKEVAVLGAASELFTKKNINCSLDESFQ  148

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             R   V  AA+  SIPVRGY+SCV+GCP +G I P+KVA +AK+L+ MGC+EISLGDTIGV
Sbjct  149   RSDEVLKAAQARSIPVRGYVSCVLGCPYQGKISPAKVAEVAKKLYSMGCYEISLGDTIGV  208

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
              TPG +  ML AVM  VPV  LAVH HDTYGQ+L N L++LQMGV  VDSSV+GLGGCPY
Sbjct  209   GTPGVMKDMLSAVMHEVPVTALAVHCHDTYGQALANTLMALQMGVSVVDSSVAGLGGCPY  268

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             A+GA+GN+ATED++YML GLG+ T V+L KLL+AG FISK L R++SSK A A +++
Sbjct  269   AQGASGNLATEDLLYMLAGLGIHTGVNLQKLLEAGTFISKALNRKTSSKVAQATSKL  325



>ref|XP_006631395.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Lepisosteus oculatus]
Length=338

 Score =   367 bits (941),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 201/336 (60%), Positives = 244/336 (73%), Gaps = 11/336 (3%)
 Frame = -3

Query  1464  GRGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLFNGV---PKYVKIVEVGPRDGLQNEKN  1294
             G  S G   +FRD         RSF    +    + V   P+ VKIVEVGPRDGLQNEK 
Sbjct  11    GTFSSGLGFRFRDL--------RSFVSAAKAAGVSPVKCLPERVKIVEVGPRDGLQNEKT  62

Query  1293  NVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPN  1114
              VP  VK+ LI  L   GLPV+E T FVSPKWVPQ++D  +VMQ ++   G   PVL PN
Sbjct  63    IVPAEVKIRLIDMLSEAGLPVIEATSFVSPKWVPQMADQMEVMQGIRKHPGVSYPVLAPN  122

Query  1113  LKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYIS  934
             LKGF+AA+ + A+EVA+F +ASE FSK NINCSIEESL R+  VT AA++  + VRGY+S
Sbjct  123   LKGFQAAVKADAREVAIFGAASELFSKKNINCSIEESLQRFEEVTRAAQEAGVLVRGYVS  182

Query  933   CVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEK  754
             CV+GCP EG + P KVA +AK ++ MGC+EISLGDTIGV TPG++  ML AV   VPV+ 
Sbjct  183   CVLGCPYEGKVSPEKVAQVAKRMYSMGCYEISLGDTIGVGTPGSMREMLCAVTKEVPVDA  242

Query  753   LAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLG  574
             LAVH HDTYGQ+L NILV+LQMGV  VDSSV+GLGGCPYA+GA+GNVATEDVVYMLHGLG
Sbjct  243   LAVHCHDTYGQALANILVALQMGVSVVDSSVAGLGGCPYAQGASGNVATEDVVYMLHGLG  302

Query  573   VKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             ++T VDL KL+ AG FI + L R +SSK A AL ++
Sbjct  303   IQTGVDLQKLMDAGAFICRSLNRRTSSKVAQALCKL  338



>ref|XP_004377180.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
1 [Trichechus manatus latirostris]
Length=325

 Score =   366 bits (939),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 191/297 (64%), Positives = 235/297 (79%), Gaps = 0/297 (0%)
 Frame = -3

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             +PK VKIVEVGPRDGLQNEKN VPT VK++LI  L   GLPV+E T FVSPKWVPQ++D 
Sbjct  29    LPKRVKIVEVGPRDGLQNEKNFVPTPVKIKLIDMLSEAGLPVIEATSFVSPKWVPQMADH  88

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
              +V++ ++   G   PVL PNLKGF+ A+A+GAKEV+VF +ASE F++ NINCSI+ESL 
Sbjct  89    AEVLKGIQTFPGINYPVLIPNLKGFQTAVAAGAKEVSVFGAASELFTRKNINCSIDESLQ  148

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             R+  V  AA+ LSIPVRGY+SCV+GCP EG I  +KVA +AK ++ MGC+EISLGDTIGV
Sbjct  149   RFDEVLKAAQALSIPVRGYVSCVLGCPYEGKISLAKVAEVAKRMYSMGCYEISLGDTIGV  208

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
              TPG +  ML AVM  VPV  LAVH HDTYGQ+L NIL++LQMGV  VDSSV+GLGGCPY
Sbjct  209   GTPGVMKDMLSAVMHEVPVAALAVHCHDTYGQALANILMALQMGVSVVDSSVAGLGGCPY  268

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             AKGA+GN+ATED+VYML GLG+ T V+L KLL+AG FI + L R++SSK A A  ++
Sbjct  269   AKGASGNLATEDLVYMLTGLGIHTGVNLQKLLEAGTFICQALNRKTSSKVAQATCKL  325



>ref|XP_006196828.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Vicugna pacos]
Length=325

 Score =   366 bits (939),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 195/325 (60%), Positives = 245/325 (75%), Gaps = 4/325 (1%)
 Frame = -3

Query  1440  RQFRDRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELI  1261
             R+   R   G+++ R+ S           PK VKIVEVGPRDGLQNEKN VPT+ K++LI
Sbjct  5     RRVLPRRLVGLASLRAVSTSSAGTF----PKRVKIVEVGPRDGLQNEKNIVPTATKIKLI  60

Query  1260  RKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASG  1081
               L   GLPVVE T FVSPKWVPQ++D  +V++ ++   G   PVLTPN KG++AA+A+G
Sbjct  61    DMLSEAGLPVVEATSFVSPKWVPQMADHAEVLKGIQKFPGINYPVLTPNFKGYQAAVAAG  120

Query  1080  akevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAI  901
             AKEVA+F +ASE F++ NINCSI+ESL R+  +  AA+  SIPVRGY+SCV+GCP EG I
Sbjct  121   AKEVAIFGAASELFTRKNINCSIDESLQRFDEILKAAQAASIPVRGYVSCVLGCPYEGKI  180

Query  900   LPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQ  721
              P+KVA +AK+L+ MGC+EISLGDTIGV TPG +  ML AVM  VPV  LAVH HDTYGQ
Sbjct  181   SPAKVAEVAKKLYSMGCYEISLGDTIGVGTPGIMRDMLSAVMHEVPVAALAVHCHDTYGQ  240

Query  720   SLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLL  541
             +L N L++LQMGV  VDSSV+GLGGCPYA+GA+GN+ATED+VYML GLGV T V+L KLL
Sbjct  241   ALANTLMALQMGVSVVDSSVAGLGGCPYAQGASGNLATEDLVYMLTGLGVHTGVNLQKLL  300

Query  540   QAGEFISKHLGRESSSKAAIALTRV  466
             +AG FI + L R++SSK A A  ++
Sbjct  301   EAGAFICQALNRKTSSKVAQATCKL  325



>gb|KFM07856.1| 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic, partial 
[Aptenodytes forsteri]
Length=307

 Score =   365 bits (937),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 238/295 (81%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNEK  VPT +K+ELI +L   GLP +EVT FVS KWVPQ++
Sbjct  6     SGLPEYIKIVEVGPRDGLQNEKVIVPTDIKIELINQLSRTGLPAIEVTSFVSSKWVPQMA  65

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM+ ++   G + PVLTPNL+GF +AIA+GA EV+VF +ASESF K NINCSIEES
Sbjct  66    DHKEVMRGIERHPGVQYPVLTPNLQGFHSAIAAGATEVSVFGAASESFRKMNINCSIEES  125

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             + ++  V  +A+ ++IPVRGY+SC +GCP EG I+P+KVA ++K L+ MGC+EISLGDTI
Sbjct  126   IEKFEEVAKSARNMNIPVRGYVSCALGCPYEGNIIPAKVAEVSKRLYSMGCYEISLGDTI  185

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  186   GVGTPGSMKRMLEAVMKEIPLSALAVHCHDTYGQALANILTAIQMGVAVVDSSVAGLGGC  245

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYAKG+TGNVATEDV+YML+GLGV T V+L  +++AG FI   L ++++SK A A
Sbjct  246   PYAKGSTGNVATEDVIYMLNGLGVNTGVNLYTVMEAGNFICTALNKKTNSKVAQA  300



>ref|XP_005737201.1| PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic-like 
isoform X1 [Pundamilia nyererei]
Length=341

 Score =   366 bits (940),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 185/309 (60%), Positives = 243/309 (79%), Gaps = 0/309 (0%)
 Frame = -3

Query  1377  RNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
             + +  +  P++VKIVEVGPRDGLQNEK  VPT VK++LI  L   GL V+E T FVS KW
Sbjct  32    KTITGHAYPEFVKIVEVGPRDGLQNEKEIVPTGVKIQLIDMLSGTGLSVIEATSFVSSKW  91

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQ++D  DV++ ++     + PVLTPNL+GF+ A+A+GA EVAVF SASE+FSK NINC
Sbjct  92    VPQMADHTDVLRGIQRASNVQYPVLTPNLQGFQDAVAAGATEVAVFGSASETFSKKNINC  151

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             S++ES++R+  V +AAKK  IPVRGY+SC +GCP EG I PSKVA +AK L+EMGC+EIS
Sbjct  152   SVDESMLRFEEVINAAKKRQIPVRGYVSCALGCPHEGHIEPSKVAEVAKRLYEMGCYEIS  211

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIG+ TPG+++ ML+ VM  VP+  LAVH HDTYGQ+LPNIL +LQMGV  VDS+V+
Sbjct  212   LGDTIGIGTPGSMLKMLQRVMKDVPINALAVHCHDTYGQALPNILTALQMGVSVVDSAVA  271

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYA+G++GNV+TEDV+YMLHG+G++T V++ K+++AG FI   L R+++SK A A
Sbjct  272   GLGGCPYAQGSSGNVSTEDVLYMLHGMGIETGVNIAKVIEAGSFICSALSRKTNSKVAQA  331

Query  477   LTRVSADAS  451
              +    DAS
Sbjct  332   RSTACCDAS  340



>ref|XP_005737202.1| PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic-like 
isoform X2 [Pundamilia nyererei]
Length=351

 Score =   367 bits (941),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 194/354 (55%), Positives = 256/354 (72%), Gaps = 12/354 (3%)
 Frame = -3

Query  1512  RNCSSSNSCDEDFDEYGRGSYGWKRQFRDRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIV  1333
             ++C S     ED        Y W R++      G S ++           +  P++VKIV
Sbjct  9     KHCLSYEQLIED--------YPWLRRWLQEDKVGCSLKKI----EETSQVDAYPEFVKIV  56

Query  1332  EVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVK  1153
             EVGPRDGLQNEK  VPT VK++LI  L   GL V+E T FVS KWVPQ++D  DV++ ++
Sbjct  57    EVGPRDGLQNEKEIVPTGVKIQLIDMLSGTGLSVIEATSFVSSKWVPQMADHTDVLRGIQ  116

Query  1152  NLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVRYRAVTSA  973
                  + PVLTPNL+GF+ A+A+GA EVAVF SASE+FSK NINCS++ES++R+  V +A
Sbjct  117   RASNVQYPVLTPNLQGFQDAVAAGATEVAVFGSASETFSKKNINCSVDESMLRFEEVINA  176

Query  972   AKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIP  793
             AKK  IPVRGY+SC +GCP EG I PSKVA +AK L+EMGC+EISLGDTIG+ TPG+++ 
Sbjct  177   AKKRQIPVRGYVSCALGCPHEGHIEPSKVAEVAKRLYEMGCYEISLGDTIGIGTPGSMLK  236

Query  792   MLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNV  613
             ML+ VM  VP+  LAVH HDTYGQ+LPNIL +LQMGV  VDS+V+GLGGCPYA+G++GNV
Sbjct  237   MLQRVMKDVPINALAVHCHDTYGQALPNILTALQMGVSVVDSAVAGLGGCPYAQGSSGNV  296

Query  612   ATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRVSADAS  451
             +TEDV+YMLHG+G++T V++ K+++AG FI   L R+++SK A A +    DAS
Sbjct  297   STEDVLYMLHGMGIETGVNIAKVIEAGSFICSALSRKTNSKVAQARSTACCDAS  350



>ref|XP_003471376.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Cavia porcellus]
Length=325

 Score =   366 bits (939),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 193/292 (66%), Positives = 232/292 (79%), Gaps = 0/292 (0%)
 Frame = -3

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             PK VKIVEVGPRDGLQNEKN VPT VK++LI  L   GLPV+E T FVSPKWVPQ++D  
Sbjct  30    PKQVKIVEVGPRDGLQNEKNVVPTPVKIKLIDMLSEAGLPVIEATSFVSPKWVPQMADHT  89

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             +V++ ++   G   PVLTPNLKGFEAA+A+GAKEV+VF +ASE F++ NINCSIEES  R
Sbjct  90    EVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVSVFGAASELFTQKNINCSIEESFRR  149

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
                V  AA+   IPVRGY+SCV+GCP EG I P+KVA +AK+L+ MGC+EISLGDTIGV 
Sbjct  150   MGGVLEAARAAGIPVRGYVSCVLGCPYEGKISPAKVAEVAKKLYSMGCYEISLGDTIGVG  209

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYA  634
             TPG +  ML AVM  VPV  LAVH HDTYGQ+L N LV+LQMGV  VDSSV+GLGGCPYA
Sbjct  210   TPGLMKDMLSAVMRDVPVAALAVHCHDTYGQALANTLVALQMGVSVVDSSVAGLGGCPYA  269

Query  633   KGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             +GA+GN+ATED+VYML GLG+ T V+L KLL+AG+FI + L R++SSK A A
Sbjct  270   QGASGNLATEDLVYMLTGLGIHTGVNLQKLLEAGDFICQVLNRKTSSKVAQA  321



>gb|KFV63788.1| 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic, partial 
[Picoides pubescens]
Length=307

 Score =   365 bits (937),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 237/295 (80%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNE+  VPT +K+ELI +L   GLP +E T FVS KWVPQ++
Sbjct  6     SGLPEYIKIVEVGPRDGLQNERVIVPTDIKIELINRLSKTGLPAIEATSFVSSKWVPQMA  65

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM+ ++   G   PVLTPNL+GF AA+A+GA EV+VF +ASE+FSK NINCSIEES
Sbjct  66    DHKEVMRGIERHPGVEYPVLTPNLQGFHAAVAAGATEVSVFGAASETFSKMNINCSIEES  125

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             + R+  V  +A+ ++IPVRGY+SC +GCP EG ++P+KVA ++K L+ MGC+EISLGDTI
Sbjct  126   IERFEEVAKSARNMNIPVRGYVSCALGCPYEGNVIPAKVAEVSKRLYSMGCYEISLGDTI  185

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  186   GVGTPGSMKRMLEAVMKEIPMSALAVHCHDTYGQALANILTAIQMGVAVVDSSVAGLGGC  245

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYAKGA+GNVATEDV+YML+GLG+ T V+L K+++ G FI   L + ++SK A+A
Sbjct  246   PYAKGASGNVATEDVIYMLNGLGINTGVNLCKVMETGNFICTALNKTTNSKVALA  300



>ref|NP_001085152.1| 3-hydroxymethyl-3-methylglutaryl-CoA lyase [Xenopus laevis]
 gb|AAH72247.1| MGC82338 protein [Xenopus laevis]
Length=328

 Score =   366 bits (939),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 192/296 (65%), Positives = 234/296 (79%), Gaps = 0/296 (0%)
 Frame = -3

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             PK VKIVEVGPRDGLQNEK  VPT VK+ LI  L   GL  +E T FVSPKWVPQ++D K
Sbjct  33    PKEVKIVEVGPRDGLQNEKTVVPTDVKIHLINMLSEAGLQAIEATSFVSPKWVPQMADHK  92

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             +VMQ +K       PVLTPNL GF+AA+  GAKEVA+F +ASE FSK NINCSI+ESL R
Sbjct  93    NVMQGIKKYPNISYPVLTPNLTGFQAAVECGAKEVAIFGAASELFSKKNINCSIDESLQR  152

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
             ++AV + AK+ +IPVRGY+SCV+GCP EG + PSKVA +A ++  MGC+EISLGDTIGV 
Sbjct  153   FKAVITEAKEANIPVRGYVSCVLGCPYEGKVAPSKVAEVAYKMFSMGCYEISLGDTIGVG  212

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYA  634
             TPG +  ML AV+ VVP + LAVH HDTYGQ+L NILV+LQMGV  VD+SV+GLGGCPYA
Sbjct  213   TPGGMRDMLSAVLDVVPAKALAVHCHDTYGQALANILVALQMGVQVVDASVAGLGGCPYA  272

Query  633   KGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             +GA+GNVATEDVVYMLHGLG++T +DL KL +AG FI K LG++S SK + A+ ++
Sbjct  273   QGASGNVATEDVVYMLHGLGIQTGIDLKKLTEAGAFICKALGKKSHSKVSQAICKL  328



>ref|XP_003387466.1| PREDICTED: hydroxymethylglutaryl-CoA lyase-like [Amphimedon queenslandica]
Length=326

 Score =   366 bits (939),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 235/297 (79%), Gaps = 0/297 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             + +P  VKIVEVGPRDGLQNEK+ VPT VKV+LI +L   GL V+E T FVSPKWVPQ+ 
Sbjct  27    SSLPSKVKIVEVGPRDGLQNEKSVVPTEVKVQLIDRLSETGLKVIEATSFVSPKWVPQMG  86

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D  +VM A+K   G + PVL PN+KGFEAA+ +GA+EV++F +ASE+FSK NINC+IEES
Sbjct  87    DHAEVMAAIKRKAGVKYPVLVPNMKGFEAAMKAGAEEVSIFGAASETFSKKNINCTIEES  146

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             L R+R VT AA+   IPVRGY+SCVVGCP EG I P  VA +A ++ E+GC+EISLGDTI
Sbjct  147   LERFRLVTEAAQTKGIPVRGYVSCVVGCPYEGPISPQAVAKVAVKMKELGCYEISLGDTI  206

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPGT+I ML+ V A +P+  LA+H HDTYGQ+L NIL +LQMG+  VD+SVSGLGGC
Sbjct  207   GVGTPGTIIKMLKEVTAHLPLSCLAIHCHDTYGQALSNILTALQMGISVVDASVSGLGGC  266

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALT  472
             PYA GA+GNVATEDVVYM++GLG+ T V+L KL++A  FIS  LGR+SSSK   AL+
Sbjct  267   PYAPGASGNVATEDVVYMMNGLGIDTGVNLEKLIEASSFISDSLGRKSSSKVTQALS  323



>ref|XP_005474136.1| PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic-like 
isoform X2 [Oreochromis niloticus]
Length=341

 Score =   366 bits (940),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 185/309 (60%), Positives = 243/309 (79%), Gaps = 0/309 (0%)
 Frame = -3

Query  1377  RNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
             + +  +  P++VKIVEVGPRDGLQNEK  VPT VK++LI  L   GL V+EVT FVS KW
Sbjct  32    KTITGHAYPEFVKIVEVGPRDGLQNEKEIVPTGVKIQLIDMLSGTGLSVIEVTSFVSSKW  91

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQ++D  DV++ ++     + PVLTPNL+GF+ A+A+GA EVAVF SASE+FSK NINC
Sbjct  92    VPQMADHTDVLRGIQKASNVQYPVLTPNLQGFQDAVAAGATEVAVFGSASETFSKKNINC  151

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             S++ES++R+  V +AAKK  IPVRGY+SC +GCP EG I PSKVA +AK L+EMGC+EIS
Sbjct  152   SVDESMLRFEEVINAAKKRQIPVRGYVSCALGCPHEGHIEPSKVAEVAKRLYEMGCYEIS  211

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIG+ TPG+++ ML+ VM  VP+  LAVH HDTYGQ+LPNIL +LQMGV  VDS+V+
Sbjct  212   LGDTIGIGTPGSMLKMLQRVMKDVPINALAVHCHDTYGQALPNILTALQMGVSVVDSAVA  271

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYA+G++GNV+TEDV+YMLHG+G++T V++ K+++AG FI   L R+++SK A A
Sbjct  272   GLGGCPYAQGSSGNVSTEDVLYMLHGMGIETGVNIAKVIEAGSFICSALSRKTNSKVAQA  331

Query  477   LTRVSADAS  451
              +    D S
Sbjct  332   RSTACCDES  340



>gb|EMC78536.1| Hydroxymethylglutaryl-CoA lyase, partial [Columba livia]
Length=298

 Score =   364 bits (935),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 234/297 (79%), Gaps = 0/297 (0%)
 Frame = -3

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             +PK VK+VEVGPRDGLQNEKN VPT VK+ LI  L   GL V+E T FVSPKWVPQ++D 
Sbjct  2     LPKRVKVVEVGPRDGLQNEKNVVPTPVKINLINMLSETGLQVIEATSFVSPKWVPQMADH  61

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
              +VMQ +  L G   PVLTPNLKGF+AA+A+GAKEV++F +ASE F+K NINCSIEESL 
Sbjct  62    TEVMQGINKLPGVSYPVLTPNLKGFQAAVAAGAKEVSIFGAASELFTKKNINCSIEESLE  121

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             R+  V +AA+  SIPVRGY+SCV+GCP EG I  +KVA ++K+++ MGC+EISLGDTIG+
Sbjct  122   RFGEVMTAARAASIPVRGYVSCVLGCPYEGKISAAKVAEVSKKMYSMGCYEISLGDTIGI  181

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
              TPG++  ML AVM  VPV  LAVH HDTYGQ+L NILV+LQMGV  VD+SV+GLGGCPY
Sbjct  182   GTPGSMREMLTAVMKEVPVGALAVHCHDTYGQALANILVALQMGVSVVDASVAGLGGCPY  241

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             A+GA+GNVATED+VYML+GLG+ T VDL KL+  G FI   L R ++SK + A  R+
Sbjct  242   AQGASGNVATEDLVYMLNGLGIHTGVDLQKLMDTGTFICNALNRRTNSKVSQASCRL  298



>gb|KFW72832.1| hypothetical protein AS28_08604, partial [Pygoscelis adeliae]
Length=298

 Score =   364 bits (935),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 190/296 (64%), Positives = 233/296 (79%), Gaps = 0/296 (0%)
 Frame = -3

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             PK VK+VEVGPRDGLQNEKN VPT VK+ LI  L   GL V+E T FVSPKWVPQ++D  
Sbjct  3     PKRVKVVEVGPRDGLQNEKNVVPTPVKISLINMLSETGLQVIEATSFVSPKWVPQMADHT  62

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             +VMQ +  L G   PVLTPNLKGF+AA+A+GAKEV++F +ASE F+K NINCSIEESL R
Sbjct  63    EVMQGINKLPGISYPVLTPNLKGFQAAVAAGAKEVSIFGAASELFTKKNINCSIEESLER  122

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
             +  V +AA+  SIPVRGY+SCV+GCP EG I  +KVA ++K+++ MGC+EISLGDTIG+ 
Sbjct  123   FDEVMTAARAASIPVRGYVSCVLGCPYEGKISAAKVAEVSKKMYSMGCYEISLGDTIGIG  182

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYA  634
             TPG++  ML AVM  VPV  LAVH HDTYGQ+L NILV+LQMGV  VD+SV+GLGGCPYA
Sbjct  183   TPGSMREMLTAVMKEVPVGALAVHCHDTYGQALANILVALQMGVSVVDASVAGLGGCPYA  242

Query  633   KGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             +GA+GNVATED+VYML+GLG+ T VDL KL+  G FI   L R ++SK + A  R+
Sbjct  243   QGASGNVATEDLVYMLNGLGIHTGVDLQKLMDTGTFICNALNRRTNSKVSQASCRL  298



>ref|XP_003212675.2| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X2 [Meleagris gallopavo]
Length=319

 Score =   365 bits (937),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 190/304 (63%), Positives = 236/304 (78%), Gaps = 0/304 (0%)
 Frame = -3

Query  1377  RNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
             R V     P+ VK+VEVGPRDGLQNEK+ VPT VK+ LI  L   GLPV+E T FVSP+W
Sbjct  16    RQVSTAAFPQRVKVVEVGPRDGLQNEKSVVPTPVKIRLIDMLSETGLPVIEATSFVSPRW  75

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQ++D  +VMQ +  L G   PVLTPNLKGF+AA+A+GAKEV++F +ASE F+K NINC
Sbjct  76    VPQMADHAEVMQGINKLPGVSYPVLTPNLKGFQAAVAAGAKEVSIFGAASELFTKKNINC  135

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             SIEESL R+  V +AA+  SIPVRGY+SCV+GCP EG I  +KVA ++K+++ MGC+EIS
Sbjct  136   SIEESLERFSEVMNAARAASIPVRGYVSCVLGCPYEGKISAAKVAEVSKKMYSMGCYEIS  195

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIG+ TPG++  ML AVM  VPV  LAVH HDTYGQ+L NILV+LQMGV  VD+SV+
Sbjct  196   LGDTIGIGTPGSMKEMLAAVMKEVPVGALAVHCHDTYGQALANILVALQMGVSVVDASVA  255

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYA+GA+GNVATED+VYML+GLG+ T VDL KL+  G FI   L R ++SK + A
Sbjct  256   GLGGCPYAQGASGNVATEDLVYMLNGLGIHTGVDLQKLMDTGTFICNALNRRTNSKVSQA  315

Query  477   LTRV  466
               R+
Sbjct  316   SCRL  319



>ref|XP_004465461.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
1 [Dasypus novemcinctus]
Length=325

 Score =   365 bits (938),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 193/316 (61%), Positives = 244/316 (77%), Gaps = 4/316 (1%)
 Frame = -3

Query  1413  GVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLP  1234
             G+++ R+FS        + +PK VKIVEVGPRDGLQNEKN VPT VK++LI  L   GLP
Sbjct  14    GLASLRAFSISS----VDTIPKQVKIVEVGPRDGLQNEKNIVPTPVKIKLIDMLSEAGLP  69

Query  1233  VVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfas  1054
             V+E T FVSPKWVPQ++D  +V++ ++   G   PVLTPNLKGFEAA+A+GAKEV++F +
Sbjct  70    VIEATSFVSPKWVPQMADHAEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVSIFGA  129

Query  1053  asesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLA  874
             ASE F+K NINCSI+ESL R+  +  AA+   I VRGY+SCV+GCP EG I P+KVA +A
Sbjct  130   ASELFTKKNINCSIDESLQRFDEILKAARAAGISVRGYVSCVLGCPYEGKISPAKVAEVA  189

Query  873   KELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSL  694
             K+L+ MGC+EISLGDTIGV TPG +  ML AVM  VP+  LAVH HDTYGQ+L N L++L
Sbjct  190   KKLYSMGCYEISLGDTIGVGTPGVMKDMLSAVMYEVPLAALAVHCHDTYGQALANTLMAL  249

Query  693   QMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKH  514
             QMGV  VDSSV+GLGGCPYA+GA+GN+ATED+VYML GLG+ T V+L KLL+AG FI + 
Sbjct  250   QMGVSVVDSSVAGLGGCPYAQGASGNLATEDLVYMLTGLGILTGVNLQKLLEAGAFICQA  309

Query  513   LGRESSSKAAIALTRV  466
             L R++SSK A A  ++
Sbjct  310   LNRKTSSKVAQATCKL  325



>ref|XP_006800699.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Neolamprologus brichardi]
Length=337

 Score =   366 bits (939),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 189/296 (64%), Positives = 231/296 (78%), Gaps = 0/296 (0%)
 Frame = -3

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             P  VKIVEVGPRDGLQNEK  VPT  K++LI  L   GL V+E T FVSPKWVPQ++D  
Sbjct  42    PGKVKIVEVGPRDGLQNEKTLVPTEAKIKLINMLSESGLSVIEATSFVSPKWVPQMADQV  101

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             +VM+ +    G    VLTPNLKGF+AA+ +GA EVA+F +ASE FSK NINCS++ESL R
Sbjct  102   EVMKGISRKPGVTYQVLTPNLKGFQAAVKAGAPEVAIFGAASELFSKKNINCSVDESLQR  161

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
             +  V  AAK+  +PVRGY+SCVVGCP EG + P KVA++AK L+ MGC+EISLGDTIGV 
Sbjct  162   FDEVMKAAKEAGVPVRGYVSCVVGCPYEGKVAPEKVAHVAKRLYSMGCYEISLGDTIGVG  221

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYA  634
             TPG++  MLEAV+  VPV  LAVH HDTYGQ+L NILV+LQMG+  VDSSV+GLGGCPYA
Sbjct  222   TPGSMTKMLEAVIKEVPVSALAVHCHDTYGQALANILVALQMGISVVDSSVAGLGGCPYA  281

Query  633   KGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             +GA+GNV+TEDVVYMLHGLG++T VDL KL+ AG FI + L R++SSK A A  ++
Sbjct  282   QGASGNVSTEDVVYMLHGLGIQTGVDLSKLMDAGAFICRTLNRKTSSKVAQAACKL  337



>ref|WP_033067578.1| hydroxymethylglutaryl-CoA lyase [Thalassospira australica]
Length=309

 Score =   365 bits (936),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 190/298 (64%), Positives = 230/298 (77%), Gaps = 0/298 (0%)
 Frame = -3

Query  1368  LFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQ  1189
             L + +P+ VKIVEVGPRDGLQNEK  VPT+ KVELI +L   GL V+E T FVSPKWVPQ
Sbjct  3     LISDLPRRVKIVEVGPRDGLQNEKAMVPTNTKVELIHRLNDAGLSVIEATAFVSPKWVPQ  62

Query  1188  LSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIE  1009
             ++DA DVM  +    G   PVLTPN+KG EAAIASGA EVAVF +ASESFS+ NINCSI 
Sbjct  63    MADAPDVMAQIDRKPGVTYPVLTPNMKGLEAAIASGATEVAVFGAASESFSQKNINCSIA  122

Query  1008  ESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGD  829
             ESL R+R V  AA++  + VRGY+SCV+GCP EG I P KVA +AK L++MGC+EISLGD
Sbjct  123   ESLDRFRPVADAAREGGLAVRGYVSCVLGCPYEGDIAPEKVAEVAKALYDMGCYEISLGD  182

Query  828   TIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLG  649
             TIG  TP     M+ AV   VP+EK+A HFHDTYGQ+L N+L  LQMGV T+DSSV+GLG
Sbjct  183   TIGTGTPAKAQAMITAVAKHVPIEKIAAHFHDTYGQALANLLAVLQMGVATIDSSVAGLG  242

Query  648   GCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIAL  475
             GCPYAKGA+GNVATEDVVYML+GLG++T +DL KL + G +I   +G+ S+SK  +AL
Sbjct  243   GCPYAKGASGNVATEDVVYMLNGLGIETGIDLEKLTKTGSWICDQIGKSSASKVNLAL  300



>ref|XP_006777619.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Myotis davidii]
Length=325

 Score =   365 bits (937),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 187/296 (63%), Positives = 233/296 (79%), Gaps = 0/296 (0%)
 Frame = -3

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             PK VKIVEVGPRDGLQNEKN VPTSVK+ +I  L   GLPV+E T FVSPKWVPQ++D  
Sbjct  30    PKRVKIVEVGPRDGLQNEKNIVPTSVKIRMIDMLSEAGLPVIEATSFVSPKWVPQMADHV  89

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             +V++ ++   G   PVLTPN KGF+AA+A+GAKEV++F +ASE F++ NINCSIEESL R
Sbjct  90    EVLKGIQKFPGINYPVLTPNFKGFQAAVAAGAKEVSIFGAASELFTRKNINCSIEESLQR  149

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
             +  V  AA+   IPVRGY+SCV+GCP EG I P+KVA ++K+++ MGC+EISLGDTIGV 
Sbjct  150   FDQVLKAAQAAGIPVRGYVSCVLGCPYEGKISPAKVAEVSKKMYSMGCYEISLGDTIGVG  209

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYA  634
             TPG +  ML AVM  VPV  LAVH HDTYGQ+L N L++LQMGV  VDSSV+GLGGCPYA
Sbjct  210   TPGIMKDMLSAVMHEVPVAALAVHCHDTYGQALANTLMALQMGVSVVDSSVAGLGGCPYA  269

Query  633   KGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             +GA+GN+ATED+VYML GLG+ T V+  KLL+AG FI + L R++SSK A A  ++
Sbjct  270   QGASGNLATEDLVYMLEGLGIHTGVNFQKLLEAGTFICQALNRKTSSKVAQATCKL  325



>ref|NP_001185644.1| hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 1 [Gallus 
gallus]
Length=319

 Score =   365 bits (937),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 190/304 (63%), Positives = 236/304 (78%), Gaps = 0/304 (0%)
 Frame = -3

Query  1377  RNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKW  1198
             R V     P+ VK+VEVGPRDGLQNEK+ VPT VK+ LI  L   GLPV+E T FVSP+W
Sbjct  16    RQVSTAAFPQRVKVVEVGPRDGLQNEKSVVPTPVKIRLIDMLSETGLPVIEATSFVSPRW  75

Query  1197  VPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINC  1018
             VPQ++D  +VMQ +  L G   PVLTPNLKGF+AA+A+GAKEV++F +ASE F+K NINC
Sbjct  76    VPQMADHAEVMQGINKLPGVSYPVLTPNLKGFQAAVAAGAKEVSIFGAASELFTKKNINC  135

Query  1017  SIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEIS  838
             SIEESL R+  V +AA+  SIPVRGY+SCV+GCP EG I  +KVA ++K+++ MGC+EIS
Sbjct  136   SIEESLERFSEVMNAARAASIPVRGYVSCVLGCPYEGNISAAKVAEVSKKMYSMGCYEIS  195

Query  837   LGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVS  658
             LGDTIG+ TPG++  ML AVM  VPV  LAVH HDTYGQ+L NILV+LQMGV  VD+SV+
Sbjct  196   LGDTIGIGTPGSMKEMLAAVMKEVPVGALAVHCHDTYGQALANILVALQMGVSVVDASVA  255

Query  657   GLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             GLGGCPYA+GA+GNVATED+VYML+GLG+ T VDL KL+  G FI   L R ++SK + A
Sbjct  256   GLGGCPYAQGASGNVATEDLVYMLNGLGIHTGVDLQKLMDTGTFICNALNRRTNSKVSQA  315

Query  477   LTRV  466
               R+
Sbjct  316   ACRL  319



>ref|XP_005518165.1| PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic 
isoform X1 [Pseudopodoces humilis]
Length=342

 Score =   365 bits (938),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 236/295 (80%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNEK  VPT  K+E I +L   GLP +EVT FVS KWVPQ++
Sbjct  40    SGLPEYIKIVEVGPRDGLQNEKMIVPTDTKIEFINQLSKTGLPAIEVTSFVSSKWVPQMA  99

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM  ++   G + PVLTPNL+GF +AIA+GA EV+VF +ASESF+K NINCSIEES
Sbjct  100   DHKEVMSGIERHPGVQYPVLTPNLQGFHSAIAAGATEVSVFGAASESFNKMNINCSIEES  159

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             + R+  VT +A+ ++IPVRGY+SC +GCP EG ++P KVA ++K L+ MGC+EISLGDTI
Sbjct  160   MERFEEVTKSARNMNIPVRGYVSCALGCPYEGNVVPDKVAEVSKRLYSMGCYEISLGDTI  219

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  220   GVGTPGSMKKMLEAVMKEIPLSALAVHCHDTYGQALANILTAIQMGVAVVDSSVAGLGGC  279

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYAKGATGNVATEDV+YML+GLG+ T V+L  +++AG FI   L ++++SK A A
Sbjct  280   PYAKGATGNVATEDVIYMLNGLGINTGVNLCAVMEAGNFICTALSKKTNSKVAQA  334



>ref|XP_005518166.1| PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic 
isoform X2 [Pseudopodoces humilis]
Length=344

 Score =   366 bits (939),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 236/295 (80%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNEK  VPT  K+E I +L   GLP +EVT FVS KWVPQ++
Sbjct  42    SGLPEYIKIVEVGPRDGLQNEKMIVPTDTKIEFINQLSKTGLPAIEVTSFVSSKWVPQMA  101

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM  ++   G + PVLTPNL+GF +AIA+GA EV+VF +ASESF+K NINCSIEES
Sbjct  102   DHKEVMSGIERHPGVQYPVLTPNLQGFHSAIAAGATEVSVFGAASESFNKMNINCSIEES  161

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             + R+  VT +A+ ++IPVRGY+SC +GCP EG ++P KVA ++K L+ MGC+EISLGDTI
Sbjct  162   MERFEEVTKSARNMNIPVRGYVSCALGCPYEGNVVPDKVAEVSKRLYSMGCYEISLGDTI  221

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  222   GVGTPGSMKKMLEAVMKEIPLSALAVHCHDTYGQALANILTAIQMGVAVVDSSVAGLGGC  281

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYAKGATGNVATEDV+YML+GLG+ T V+L  +++AG FI   L ++++SK A A
Sbjct  282   PYAKGATGNVATEDVIYMLNGLGINTGVNLCAVMEAGNFICTALSKKTNSKVAQA  336



>ref|XP_005506939.1| PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic 
[Columba livia]
Length=397

 Score =   367 bits (943),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 185/295 (63%), Positives = 239/295 (81%), Gaps = 0/295 (0%)
 Frame = -3

Query  1362  NGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLS  1183
             +G+P+Y+KIVEVGPRDGLQNEK  VPT +K+ELI +L   GLP +EVT FVS KWVPQ++
Sbjct  95    SGLPEYIKIVEVGPRDGLQNEKVIVPTDIKIELINRLSKTGLPAIEVTSFVSSKWVPQMA  154

Query  1182  DAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEES  1003
             D K+VM+ ++   G + PVLTPNL+GF +AIA+GA EV+VF +ASESFSK NINCSIEES
Sbjct  155   DHKEVMRGIERHPGVQYPVLTPNLRGFHSAIAAGATEVSVFGAASESFSKMNINCSIEES  214

Query  1002  LVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTI  823
             + ++  V  +A+ ++IPVRGY+SC +GCP EG I+P+KVA ++K L+ MGC+EISLGDTI
Sbjct  215   IEKFEEVAKSARNMNIPVRGYVSCALGCPYEGNIIPAKVAEVSKRLYSMGCYEISLGDTI  274

Query  822   GVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGC  643
             GV TPG++  MLEAVM  +P+  LAVH HDTYGQ+L NIL ++QMGV  VDSSV+GLGGC
Sbjct  275   GVGTPGSMKRMLEAVMKDIPLSALAVHCHDTYGQALANILTAIQMGVTVVDSSVAGLGGC  334

Query  642   PYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             PYAKGATGNVATEDV+YML+GLG+ T V+L  +++AG FI   L ++++SK A A
Sbjct  335   PYAKGATGNVATEDVIYMLNGLGINTGVNLYAVMEAGNFICTALNKKTNSKVAQA  389



>ref|XP_002934605.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X1 [Xenopus (Silurana) tropicalis]
 ref|XP_004916040.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X3 [Xenopus (Silurana) tropicalis]
 ref|XP_004916041.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
isoform X4 [Xenopus (Silurana) tropicalis]
Length=331

 Score =   365 bits (937),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 195/329 (59%), Positives = 245/329 (74%), Gaps = 13/329 (4%)
 Frame = -3

Query  1413  GVSNRRSFSGGW-------------RNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVK  1273
              VS RR+ + GW              ++     PK VK+VEVGPRDGLQNEK  VP+ VK
Sbjct  3     AVSVRRAVALGWGAGWTPLAILRQLSSLPIQSFPKEVKVVEVGPRDGLQNEKTVVPSEVK  62

Query  1272  VELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAA  1093
             + LI  L   GL  +E T FVSPKWVPQ++D K+V+Q +K       PVLTPNL GF+AA
Sbjct  63    IHLINLLSEAGLQAIEATSFVSPKWVPQMADHKNVIQGIKKYPNVTYPVLTPNLTGFQAA  122

Query  1092  IASGakevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPV  913
             +  GAKEVA+F +ASE FSK NINCSI+ESL R++ V +AAK+ +IPVRGY+SCV+GCP 
Sbjct  123   VECGAKEVAIFGAASELFSKKNINCSIDESLQRFKDVIAAAKEANIPVRGYVSCVLGCPY  182

Query  912   EGAILPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHD  733
             EG + PSKVA +A ++  MGC+EISLGDTIGV TPG +  ML AV+ VVP + LAVH HD
Sbjct  183   EGKVAPSKVAEVAYKMFSMGCYEISLGDTIGVGTPGGMRDMLRAVLDVVPAKALAVHCHD  242

Query  732   TYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDL  553
             TYGQ+L NILV+LQMGV  VD+SV+GLGGCPYA+GA+GNVATEDVVYMLHGLG++T +D+
Sbjct  243   TYGQALANILVALQMGVQVVDASVAGLGGCPYAQGASGNVATEDVVYMLHGLGIQTGIDI  302

Query  552   GKLLQAGEFISKHLGRESSSKAAIALTRV  466
              KL +AG FI K LG++S+SK A A+ ++
Sbjct  303   KKLTEAGAFICKALGKKSNSKVAQAMCKL  331



>ref|XP_005513518.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X2 [Columba livia]
Length=323

 Score =   365 bits (936),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 234/297 (79%), Gaps = 0/297 (0%)
 Frame = -3

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             +PK VK+VEVGPRDGLQNEKN VPT VK+ LI  L   GL V+E T FVSPKWVPQ++D 
Sbjct  27    LPKRVKVVEVGPRDGLQNEKNVVPTPVKINLINMLSETGLQVIEATSFVSPKWVPQMADH  86

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
              +VMQ +  L G   PVLTPNLKGF+AA+A+GAKEV++F +ASE F+K NINCSIEESL 
Sbjct  87    TEVMQGINKLPGVSYPVLTPNLKGFQAAVAAGAKEVSIFGAASELFTKKNINCSIEESLE  146

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             R+  V +AA+  SIPVRGY+SCV+GCP EG I  +KVA ++K+++ MGC+EISLGDTIG+
Sbjct  147   RFGEVMTAARAASIPVRGYVSCVLGCPYEGKISAAKVAEVSKKMYSMGCYEISLGDTIGI  206

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
              TPG++  ML AVM  VPV  LAVH HDTYGQ+L NILV+LQMGV  VD+SV+GLGGCPY
Sbjct  207   GTPGSMREMLTAVMKEVPVGALAVHCHDTYGQALANILVALQMGVSVVDASVAGLGGCPY  266

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             A+GA+GNVATED+VYML+GLG+ T VDL KL+  G FI   L R ++SK + A  R+
Sbjct  267   AQGASGNVATEDLVYMLNGLGIHTGVDLQKLMDTGTFICNALNRRTNSKVSQASCRL  323



>ref|XP_005739025.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like 
[Pundamilia nyererei]
Length=337

 Score =   365 bits (937),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 188/296 (64%), Positives = 231/296 (78%), Gaps = 0/296 (0%)
 Frame = -3

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             P  VKIVEVGPRDGLQNEK  VPT  K++LI  L   GL V+E T FVSPKWVPQ++D  
Sbjct  42    PGKVKIVEVGPRDGLQNEKTLVPTEAKIKLINMLSESGLSVIEATSFVSPKWVPQMADQV  101

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             +VM+ +    G    VLTPNL+GF+AA+ +GA EVA+F +ASE FSK NINCS++ESL R
Sbjct  102   EVMKGISRKPGVTYQVLTPNLQGFQAAVKAGAPEVAIFGAASELFSKKNINCSVDESLQR  161

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
             +  V  AAK+  +PVRGY+SCVVGCP EG + P KVA++AK L+ MGC+EISLGDTIGV 
Sbjct  162   FDEVMKAAKEAGVPVRGYVSCVVGCPYEGKVAPEKVAHVAKRLYSMGCYEISLGDTIGVG  221

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYA  634
             TPG++  MLEAV+  VPV  LAVH HDTYGQ+L NILV+LQMG+  VDSSV+GLGGCPYA
Sbjct  222   TPGSMTKMLEAVIKEVPVSALAVHCHDTYGQALANILVALQMGISVVDSSVAGLGGCPYA  281

Query  633   KGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             +GA+GNV+TEDVVYMLHGLG++T VDL KL+ AG FI + L R++SSK A A  ++
Sbjct  282   QGASGNVSTEDVVYMLHGLGIQTGVDLSKLMDAGSFICRTLNRKTSSKVAQAACKL  337



>ref|XP_005513517.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X1 [Columba livia]
Length=323

 Score =   365 bits (936),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 234/297 (79%), Gaps = 0/297 (0%)
 Frame = -3

Query  1356  VPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDA  1177
             +PK VK+VEVGPRDGLQNEKN VPT VK+ LI  L   GL V+E T FVSPKWVPQ++D 
Sbjct  27    LPKRVKVVEVGPRDGLQNEKNVVPTPVKINLINMLSETGLQVIEATSFVSPKWVPQMADH  86

Query  1176  KDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLV  997
              +VMQ +  L G   PVLTPNLKGF+AA+A+GAKEV++F +ASE F+K NINCSIEESL 
Sbjct  87    TEVMQGINKLPGVSYPVLTPNLKGFQAAVAAGAKEVSIFGAASELFTKKNINCSIEESLE  146

Query  996   RYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGV  817
             R+  V +AA+  SIPVRGY+SCV+GCP EG I  +KVA ++K+++ MGC+EISLGDTIG+
Sbjct  147   RFGEVMTAARAASIPVRGYVSCVLGCPYEGKISAAKVAEVSKKMYSMGCYEISLGDTIGI  206

Query  816   ATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPY  637
              TPG++  ML AVM  VPV  LAVH HDTYGQ+L NILV+LQMGV  VD+SV+GLGGCPY
Sbjct  207   GTPGSMREMLTAVMKEVPVGALAVHCHDTYGQALANILVALQMGVSVVDASVAGLGGCPY  266

Query  636   AKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             A+GA+GNVATED+VYML+GLG+ T VDL KL+  G FI   L R ++SK + A  R+
Sbjct  267   AQGASGNVATEDLVYMLNGLGIHTGVDLQKLMDTGTFICNALNRRTNSKVSQASCRL  323



>ref|XP_005300259.1| PREDICTED: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic 
isoform X1 [Chrysemys picta bellii]
Length=341

 Score =   365 bits (937),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/296 (63%), Positives = 238/296 (80%), Gaps = 0/296 (0%)
 Frame = -3

Query  1365  FNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQL  1186
              +G P YVKIVEVGPRDGLQNEK  VPT +K+ELI +L   GL V+E T FVS KWVPQ+
Sbjct  42    ISGFPDYVKIVEVGPRDGLQNEKVTVPTDIKIELINRLSKAGLSVIEATSFVSSKWVPQM  101

Query  1185  SDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEE  1006
             +D  +VM+ ++   G + PVLTPNL+GF +AIA+GA EV+VF +ASESF+K NINCSIEE
Sbjct  102   ADHTEVMRRIERHPGVQYPVLTPNLQGFHSAIAAGATEVSVFGAASESFNKMNINCSIEE  161

Query  1005  SLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDT  826
             S+ ++  VT +A+ ++IPVRGY+SC +GCP EG I+P+KVA ++K+L+ MGC+EISLGDT
Sbjct  162   SIEKFEEVTKSAQNMNIPVRGYVSCALGCPYEGNIIPAKVAEVSKQLYSMGCYEISLGDT  221

Query  825   IGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGG  646
             IGV TPG++  MLEAVM  +PV  LAVH HDTYGQ+L NIL +LQMGV  VDS+V+GLGG
Sbjct  222   IGVGTPGSMKRMLEAVMKEIPVSALAVHCHDTYGQALANILTALQMGVGVVDSAVAGLGG  281

Query  645   CPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIA  478
             CPYAKGATGNVATEDV+YML+GLG+ T V+L K+++AG FI   L ++++SK A A
Sbjct  282   CPYAKGATGNVATEDVLYMLNGLGINTGVNLYKVMEAGNFICTALNKKTNSKVAQA  337



>ref|XP_010574389.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Haliaeetus 
leucocephalus]
Length=323

 Score =   364 bits (935),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 190/296 (64%), Positives = 234/296 (79%), Gaps = 0/296 (0%)
 Frame = -3

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             PK VK+VEVGPRDGLQNEKN VPT VK+ LI  L   GLPV+E T FVSPKWVPQ++D  
Sbjct  28    PKRVKVVEVGPRDGLQNEKNVVPTPVKINLINMLSETGLPVIEATSFVSPKWVPQMADHA  87

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             +VM+ +  L G   PVLTPNLKGF+AA+A+GAKEVA+F +ASE F+K NINCSI+ESL R
Sbjct  88    EVMRGINKLPGISYPVLTPNLKGFQAAVAAGAKEVAIFGAASELFTKKNINCSIDESLER  147

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
             +  V +AA+  SIPVRGY+SCV+GCP EG I  +KVA ++K+++ MGC+EISLGDTIG+ 
Sbjct  148   FSEVMTAARAASIPVRGYVSCVLGCPYEGKISTAKVAEVSKKMYSMGCYEISLGDTIGIG  207

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYA  634
             TPG++  ML AVM  VPV  LAVH HDTYGQ+L NILV+LQMGV  VD+SV+GLGGCPYA
Sbjct  208   TPGSMKEMLTAVMKEVPVGALAVHCHDTYGQALANILVALQMGVSVVDASVAGLGGCPYA  267

Query  633   KGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             +GA+GNVATED+VYML+GLG+ T VDL KL+  G FI   L R ++SK + A  R+
Sbjct  268   QGASGNVATEDLVYMLNGLGIHTGVDLQKLMDTGTFICNALNRRTNSKVSQASCRL  323



>ref|NP_032280.2| hydroxymethylglutaryl-CoA lyase, mitochondrial precursor [Mus 
musculus]
 sp|P38060.2|HMGCL_MOUSE RecName: Full=Hydroxymethylglutaryl-CoA lyase, mitochondrial; 
Short=HL; Short=HMG-CoA lyase; AltName: Full=3-hydroxy-3-methylglutarate-CoA 
lyase; Flags: Precursor [Mus musculus]
 gb|AAH25440.1| Hmgcl protein [Mus musculus]
 dbj|BAE32329.1| unnamed protein product [Mus musculus]
 dbj|BAE20956.1| unnamed protein product [Mus musculus]
 dbj|BAE26328.1| unnamed protein product [Mus musculus]
 gb|EDL29963.1| 3-hydroxy-3-methylglutaryl-Coenzyme A lyase [Mus musculus]
Length=325

 Score =   365 bits (936),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 194/325 (60%), Positives = 242/325 (74%), Gaps = 4/325 (1%)
 Frame = -3

Query  1440  RQFRDRPYNGVSNRRSFSGGWRNVLFNGVPKYVKIVEVGPRDGLQNEKNNVPTSVKVELI  1261
             R+   R   G+++ R+ S      L    PK VKIVEVGPRDGLQNEK+ VPT VK+ LI
Sbjct  5     RKAFPRRLVGLTSLRAVSTSSMGTL----PKQVKIVEVGPRDGLQNEKSIVPTPVKIRLI  60

Query  1260  RKLVSCGLPVVEVTGFVSPKWVPQLSDAKDVMQAVKNLEGARLPVLTPNLKGFEAAIASG  1081
               L   GLPV+E T FVSPKWVPQ++D  DV++ ++   G   PVLTPN+KGFE A+A+G
Sbjct  61    DMLSEAGLPVIEATSFVSPKWVPQMADHSDVLKGIQKFPGINYPVLTPNMKGFEEAVAAG  120

Query  1080  akevavfasasesfskANINCSIEESLVRYRAVTSAAKKLSIPVRGYISCVVGCPVEGAI  901
             AKEV+VF + SE F++ N NCSIEES  R+  V  AA+  SI VRGY+SC +GCP EG +
Sbjct  121   AKEVSVFGAVSELFTRKNANCSIEESFQRFAGVMQAAQAASISVRGYVSCALGCPYEGKV  180

Query  900   LPSKVAYLAKELHEMGCFEISLGDTIGVATPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQ  721
              P+KVA +AK+L+ MGC+EISLGDTIGV TPG +  ML AVM  VPV  LAVH HDTYGQ
Sbjct  181   SPAKVAEVAKKLYSMGCYEISLGDTIGVGTPGLMKDMLTAVMHEVPVTALAVHCHDTYGQ  240

Query  720   SLPNILVSLQMGVCTVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGVKTNVDLGKLL  541
             +L N LV+LQMGV  VDSSV+GLGGCPYAKGA+GN+ATED+VYML+GLG+ T V+L KLL
Sbjct  241   ALANTLVALQMGVSVVDSSVAGLGGCPYAKGASGNLATEDLVYMLNGLGIHTGVNLQKLL  300

Query  540   QAGEFISKHLGRESSSKAAIALTRV  466
             +AG+FI + L R++SSK A A  ++
Sbjct  301   EAGDFICQALNRKTSSKVAQATCKL  325



>ref|XP_005607413.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X3 [Equus caballus]
 ref|XP_008518986.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial isoform 
X2 [Equus przewalskii]
Length=306

 Score =   364 bits (934),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 189/296 (64%), Positives = 234/296 (79%), Gaps = 0/296 (0%)
 Frame = -3

Query  1353  PKYVKIVEVGPRDGLQNEKNNVPTSVKVELIRKLVSCGLPVVEVTGFVSPKWVPQLSDAK  1174
             PK VKIVEVGPRDGLQNEKN VPT++K++LI  L   GLPV+E T FVSPKWVPQ++D  
Sbjct  11    PKRVKIVEVGPRDGLQNEKNIVPTAMKIKLIDMLSEAGLPVIEATSFVSPKWVPQMADHT  70

Query  1173  DVMQAVKNLEGARLPVLTPNLKGFEAAIASGakevavfasasesfskANINCSIEESLVR  994
             +V++ ++   G   PVLTPN KGF+AA+A+GAKEVAVF +ASE F+K NINCSIEES+ R
Sbjct  71    EVLKGIQKFPGINYPVLTPNFKGFQAAVAAGAKEVAVFGAASELFTKKNINCSIEESIQR  130

Query  993   YRAVTSAAKKLSIPVRGYISCVVGCPVEGAILPSKVAYLAKELHEMGCFEISLGDTIGVA  814
             +  V  AA+  SIPVRGY+SC +GCP EG I P+KVA + K+++ MGC+EISLGDTIGV 
Sbjct  131   FGEVLKAARAASIPVRGYVSCALGCPYEGKISPAKVAEVTKKMYSMGCYEISLGDTIGVG  190

Query  813   TPGTVIPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILVSLQMGVCTVDSSVSGLGGCPYA  634
             TPG +  ML AVM  VPV  LAVH HDTYGQ+L N L++LQMGV  VDSSV+GLGGCPYA
Sbjct  191   TPGGMKDMLSAVMQEVPVAALAVHCHDTYGQALANTLMALQMGVSVVDSSVAGLGGCPYA  250

Query  633   KGATGNVATEDVVYMLHGLGVKTNVDLGKLLQAGEFISKHLGRESSSKAAIALTRV  466
             +GA+GN+ATED+VYML GLG+ T V+L KLL+AG FI + L R++SSK A A  ++
Sbjct  251   QGASGNLATEDLVYMLAGLGIHTGVNLQKLLEAGTFICQALNRKTSSKVAQATCKL  306



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5239027156630