BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27625_g1_i1 len=691 path=[669:0-690]

Length=691
                                                                      Score     E

ref|XP_009618837.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    121   1e-31   
ref|XP_004238414.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    117   3e-30   
ref|XP_002306968.1|  hypothetical protein POPTR_0005s26990g             117   3e-30   Populus trichocarpa [western balsam poplar]
ref|XP_003607260.1|  hypothetical protein MTR_4g075160                  118   4e-30   
ref|XP_007227520.1|  hypothetical protein PRUPE_ppa014487mg             117   5e-30   
ref|XP_006342110.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    117   8e-30   
ref|XP_009334299.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    116   1e-29   
ref|XP_003540566.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    116   2e-29   
ref|XP_008221156.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    115   2e-29   
ref|XP_008377089.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    115   3e-29   
ref|XP_002301930.2|  hypothetical protein POPTR_0002s01410g             115   4e-29   Populus trichocarpa [western balsam poplar]
gb|AFK47540.1|  unknown                                                 115   4e-29   
ref|XP_004291308.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    114   9e-29   
gb|KHF99974.1|  hypothetical protein F383_17879                         114   1e-28   
ref|XP_007017978.1|  Uncharacterized protein TCM_034349                 113   2e-28   
ref|XP_004505703.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    112   4e-28   
gb|AFK49070.1|  unknown                                                 110   1e-27   
ref|XP_011074732.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    110   2e-27   
ref|XP_004145533.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    109   4e-27   
ref|XP_009383474.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    109   5e-27   
ref|XP_009394043.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    109   6e-27   
ref|XP_002510641.1|  conserved hypothetical protein                     108   2e-26   Ricinus communis
ref|XP_007131610.1|  hypothetical protein PHAVU_011G027800g             107   2e-26   
ref|XP_006453389.1|  hypothetical protein CICLE_v10010113mg             107   3e-26   
gb|ABK96425.1|  unknown                                                 107   3e-26   Populus trichocarpa x Populus deltoides
gb|EPS68707.1|  hypothetical protein M569_06059                         107   3e-26   
ref|XP_010935227.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    107   5e-26   
ref|XP_010242841.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    107   7e-26   
ref|XP_008812046.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    105   2e-25   
ref|XP_010688753.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    104   5e-25   
ref|XP_009128160.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    103   1e-24   
ref|XP_010061147.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    101   7e-24   
ref|XP_006590794.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    101   7e-24   
ref|XP_008781254.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    101   8e-24   
gb|KCW68052.1|  hypothetical protein EUGRSUZ_F01733                     101   8e-24   
gb|KDO46516.1|  hypothetical protein CISIN_1g035245mg                   100   2e-23   
ref|XP_006828981.1|  hypothetical protein AMTR_s00001p00240340          100   2e-23   
ref|XP_010266114.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...  99.8    4e-23   
ref|XP_008452937.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...  99.0    6e-23   
ref|XP_010941393.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...  97.1    3e-22   
ref|XP_009418302.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...  96.3    7e-22   
ref|XP_006390222.1|  hypothetical protein EUTSA_v10019410mg           95.5    1e-21   
ref|NP_565128.1|  uncharacterized protein                             95.5    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002285922.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...  95.1    2e-21   Vitis vinifera
emb|CDP07313.1|  unnamed protein product                              94.7    3e-21   
gb|KCW68051.1|  hypothetical protein EUGRSUZ_F01733                   94.7    3e-21   
emb|CDX85939.1|  BnaC06g21950D                                        92.0    2e-20   
ref|XP_009106275.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...  91.7    3e-20   
ref|XP_009104686.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...  90.1    1e-19   
emb|CDX68107.1|  BnaA07g21470D                                        88.6    4e-19   
ref|XP_006390223.1|  hypothetical protein EUTSA_v10019410mg           88.6    4e-19   
emb|CDY50906.1|  BnaCnng19980D                                        85.1    6e-18   
emb|CBI18878.3|  unnamed protein product                              83.2    3e-17   
gb|ABK21431.1|  unknown                                               83.6    4e-17   Picea sitchensis
ref|XP_010935226.1|  PREDICTED: uncharacterized protein LOC105055...  84.3    4e-17   
gb|ABK25534.1|  unknown                                               83.2    6e-17   Picea sitchensis
emb|CAN74075.1|  hypothetical protein VITISV_000976                   84.3    7e-17   Vitis vinifera
ref|XP_001774617.1|  predicted protein                                82.4    8e-17   
ref|XP_008656572.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...  82.4    1e-16   
ref|XP_008656573.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...  82.0    1e-16   
ref|XP_004966497.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...  80.9    3e-16   
ref|NP_001054508.1|  Os05g0122900                                     80.9    4e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EEC78428.1|  hypothetical protein OsI_18259                        80.9    4e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_008649929.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...  80.9    8e-16   
gb|ACF86275.1|  unknown                                               79.7    9e-16   Zea mays [maize]
ref|XP_003563269.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...  79.3    1e-15   
gb|ACU13507.1|  unknown                                               77.4    6e-15   Glycine max [soybeans]
gb|ACU13825.1|  unknown                                               77.4    7e-15   Glycine max [soybeans]
ref|XP_001755322.1|  predicted protein                                77.0    4e-14   
gb|EAZ02409.1|  hypothetical protein OsI_24511                        73.6    1e-13   Oryza sativa Indica Group [Indian rice]
ref|NP_001175007.1|  Os06g0725400                                     73.2    2e-13   
ref|XP_006644170.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...  71.2    1e-12   
gb|EYU36823.1|  hypothetical protein MIMGU_mgv1a0190192mg             66.2    3e-11   
gb|KDQ21924.1|  hypothetical protein BOTBODRAFT_26329                 65.9    7e-11   
ref|XP_005645302.1|  hypothetical protein COCSUDRAFT_33883            64.7    5e-10   
ref|XP_007882169.1|  hypothetical protein PFL1_06437                  62.8    8e-10   
gb|ACG29497.1|  hypothetical protein                                  59.7    1e-08   Zea mays [maize]
ref|XP_003844619.1|  hypothetical protein LEMA_P022700.1              59.3    2e-08   
gb|AES89457.2|  hypothetical protein MTR_4g075160                     58.9    2e-08   
emb|CCM06208.1|  predicted protein                                    58.9    2e-08   
gb|KDQ57777.1|  hypothetical protein JAAARDRAFT_35469                 58.5    2e-08   
emb|CDS10330.1|  hypothetical protein LRAMOSA03006                    57.4    8e-08   
ref|XP_008034398.1|  hypothetical protein TRAVEDRAFT_113347           57.0    1e-07   
ref|XP_008022899.1|  hypothetical protein SETTUDRAFT_26733            56.6    1e-07   
gb|KFH64152.1|  hypothetical protein MVEG_09977                       56.6    2e-07   
gb|ELR10419.1|  hypothetical protein GMDG_00831                       56.2    2e-07   
gb|EGO00018.1|  hypothetical protein SERLA73DRAFT_88834               56.2    2e-07   
ref|XP_007675394.1|  hypothetical protein BAUCODRAFT_67924            55.8    2e-07   
emb|CEG02135.1|  unnamed product                                      56.6    2e-07   
ref|XP_003189082.1|  hypothetical protein AOR_1_1202184               55.8    2e-07   
ref|XP_011128120.1|  hypothetical protein AOL_s00215g616              55.5    3e-07   
ref|XP_007005299.1|  hypothetical protein TREMEDRAFT_31825            55.5    3e-07   
ref|XP_006958803.1|  hypothetical protein WALSEDRAFT_69279            55.5    4e-07   
ref|XP_001911311.1|  hypothetical protein                             55.5    4e-07   Podospora anserina S mat+
ref|XP_007711818.1|  hypothetical protein COCCADRAFT_94810            55.5    4e-07   
ref|XP_007689374.1|  hypothetical protein COCMIDRAFT_99075            55.5    4e-07   
ref|XP_003661629.1|  hypothetical protein MYCTH_48250                 55.1    4e-07   
gb|KDN43007.1|  hypothetical protein K437DRAFT_257678                 55.5    5e-07   
ref|XP_001266076.1|  hypothetical protein NFIA_037530                 54.7    6e-07   Aspergillus fischeri NRRL 181
ref|XP_008727429.1|  hypothetical protein G647_04870                  54.7    8e-07   
ref|XP_001799701.1|  hypothetical protein SNOG_09407                  54.7    9e-07   Parastagonospora nodorum SN15
gb|EHK15138.1|  hypothetical protein TRIVIDRAFT_90892                 54.3    9e-07   
gb|EYU36824.1|  hypothetical protein MIMGU_mgv1a0190191mg             53.9    1e-06   
ref|XP_011114343.1|  hypothetical protein H072_8648                   53.9    1e-06   
gb|KEQ94612.1|  hypothetical protein AUEXF2481DRAFT_40545             53.9    1e-06   
ref|XP_003083060.1|  Permease of the major facilitator superfamil...  58.2    1e-06   
dbj|GAC74095.1|  hypothetical protein PANT_10c00007                   55.8    1e-06   
dbj|GAK66164.1|  NADH dehydrogenase [ubiquinone] 1 beta subcomple...  54.3    1e-06   
ref|XP_001273888.1|  hypothetical protein ACLA_008820                 53.9    2e-06   Aspergillus clavatus NRRL 1
ref|XP_007266804.1|  hypothetical protein FOMMEDRAFT_86278            53.9    2e-06   
gb|KEQ80262.1|  hypothetical protein M438DRAFT_254343                 53.5    2e-06   
ref|XP_001930973.1|  conserved hypothetical protein                   53.5    2e-06   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_003709666.1|  hypothetical protein MGG_06927                   53.5    2e-06   
ref|XP_009658328.1|  hypothetical protein VDAG_08308                  53.1    2e-06   
ref|XP_004991758.1|  hypothetical protein PTSG_07955                  53.9    2e-06   
ref|XP_008611529.1|  hypothetical protein SDRG_07473                  54.3    2e-06   
ref|XP_007727471.1|  hypothetical protein A1O1_08419                  53.1    2e-06   
emb|CDI54575.1|  conserved hypothetical protein                       53.5    2e-06   
ref|XP_003008339.1|  predicted protein                                53.1    3e-06   
gb|EMS22795.1|  hypothetical protein RHTO_08148                       53.1    3e-06   
gb|EXV05103.1|  hypothetical protein X797_002790                      53.9    3e-06   
ref|XP_008717062.1|  hypothetical protein HMPREF1541_04495            53.1    3e-06   
ref|XP_001542937.1|  predicted protein                                53.1    3e-06   Histoplasma capsulatum NAm1
ref|XP_006967747.1|  predicted protein                                52.8    3e-06   
ref|XP_007755718.1|  hypothetical protein A1O7_03509                  53.1    3e-06   
gb|KEQ76219.1|  hypothetical protein M436DRAFT_79472                  53.1    3e-06   
ref|XP_002849002.1|  conserved hypothetical protein                   52.8    3e-06   Microsporum canis CBS 113480
ref|XP_009222246.1|  hypothetical protein GGTG_06168                  52.8    3e-06   
gb|KEQ61786.1|  hypothetical protein M437DRAFT_35703                  52.8    4e-06   
ref|XP_008600541.1|  hypothetical protein BBA_07222                   52.4    4e-06   
ref|XP_004364435.1|  hypothetical protein CAOG_01567                  52.8    4e-06   
gb|AFR95150.2|  hypothetical protein CNAG_00997                       53.1    5e-06   
gb|EPB81264.1|  hypothetical protein HMPREF1544_12030                 52.8    5e-06   
ref|XP_002482415.1|  conserved hypothetical protein                   52.4    5e-06   Talaromyces stipitatus ATCC 10500
ref|XP_007403965.1|  hypothetical protein MELLADRAFT_32222            52.8    5e-06   
ref|XP_007874927.1|  hypothetical protein PNEG_02890                  52.4    6e-06   
gb|ESA42635.1|  questionable protein                                  52.4    7e-06   
gb|ETS64079.1|  hypothetical protein PaG_01313                        55.5    7e-06   
ref|XP_002148160.1|  conserved hypothetical protein                   51.6    8e-06   Talaromyces marneffei ATCC 18224
ref|XP_008079189.1|  hypothetical protein GLAREA_07050                52.0    8e-06   
ref|XP_002621819.1|  conserved hypothetical protein                   51.6    8e-06   Blastomyces gilchristii SLH14081
gb|EPT02618.1|  hypothetical protein FOMPIDRAFT_1047682               52.0    9e-06   
ref|XP_001555384.1|  hypothetical protein BC1G_06089                  51.6    9e-06   Botrytis cinerea B05.10
ref|XP_009157993.1|  hypothetical protein HMPREF1120_05564            51.6    1e-05   
emb|CCF50617.1|  uncharacterized protein UHOR_05859                   52.0    1e-05   
emb|CBQ68468.1|  conserved hypothetical protein                       52.0    1e-05   
gb|EKV05188.1|  hypothetical protein PDIG_84540                       51.2    1e-05   
gb|ERT02343.1|  hypothetical protein HMPREF1624_00641                 51.2    1e-05   
gb|KGB74739.1|  hypothetical protein CNBG_0577                        51.6    1e-05   
gb|EST08082.1|  hypothetical protein PSEUBRA_SCAF19g03301             51.6    1e-05   
gb|ACZ81440.1|  CND01250                                              51.2    1e-05   Kwoniella heveanensis
ref|XP_005847834.1|  hypothetical protein CHLNCDRAFT_57885            52.0    1e-05   
gb|EPS27379.1|  hypothetical protein PDE_02322                        50.8    2e-05   
ref|XP_007784922.1|  hypothetical protein W97_08865                   50.8    2e-05   
gb|EFQ28156.1|  hypothetical protein GLRG_03300                       50.8    2e-05   
emb|CCF46611.1|  hypothetical protein CH063_03912                     50.4    2e-05   
gb|KGO37679.1|  hypothetical protein PEX1_056590                      51.2    2e-05   
ref|XP_002837262.1|  hypothetical protein                             50.4    2e-05   Tuber melanosporum Mel28
gb|KGO73144.1|  hypothetical protein PITC_003330                      51.6    2e-05   
gb|EJK59962.1|  hypothetical protein THAOC_19761                      51.6    2e-05   
gb|EQB54437.1|  hypothetical protein CGLO_05742                       50.4    3e-05   
gb|EXX70959.1|  hypothetical protein RirG_082750                      50.4    3e-05   
gb|EIE91326.1|  hypothetical protein RO3G_16037                       50.4    3e-05   
ref|XP_002293074.1|  predicted protein                                51.6    4e-05   Thalassiosira pseudonana CCMP1335
gb|EIE91067.1|  hypothetical protein RO3G_15778                       50.1    4e-05   
ref|XP_002544526.1|  predicted protein                                49.7    4e-05   Uncinocarpus reesii 1704
ref|XP_006669146.1|  hypothetical protein CCM_03935                   50.4    5e-05   
ref|XP_007738930.1|  hypothetical protein A1O5_00120                  48.9    8e-05   
ref|XP_007296128.1|  hypothetical protein MBM_08239                   48.9    9e-05   
ref|XP_009265890.1|  NADH dehydrogenase 1 beta subcomplex subunit 2   48.9    1e-04   
ref|XP_007766705.1|  hypothetical protein CONPUDRAFT_151779           48.9    1e-04   
ref|XP_002178561.1|  predicted protein                                49.7    1e-04   Phaeodactylum tricornutum CCAP 1055/1
tpe|CBF77847.1|  TPA: hypothetical protein ANIA_11137                 48.5    1e-04   
gb|EMF11904.1|  hypothetical protein SEPMUDRAFT_46938                 48.5    1e-04   
gb|EUC58730.1|  transmembrane protein, putative                       48.5    2e-04   
gb|KFH46308.1|  NADH dehydrogenase [ubiquinone] 1 beta subcomplex...  47.8    2e-04   
ref|XP_003343844.1|  hypothetical protein SMAC_04503                  48.9    2e-04   
ref|XP_570291.1|  hypothetical protein CND01250                       47.8    2e-04   Cryptococcus neoformans var. neoformans JEC21
gb|KEY66545.1|  hypothetical protein S7711_08048                      47.4    3e-04   
ref|XP_007863933.1|  hypothetical protein GLOTRDRAFT_38235            47.8    3e-04   
gb|EYE99534.1|  hypothetical protein EURHEDRAFT_407505                47.4    4e-04   
ref|XP_001830335.1|  hypothetical protein CC1G_01971                  47.4    4e-04   Coprinopsis cinerea okayama7#130
ref|XP_007361749.1|  hypothetical protein DICSQDRAFT_51219            47.4    5e-04   
ref|XP_005712436.1|  unnamed protein product                          47.4    5e-04   
gb|EME43647.1|  hypothetical protein DOTSEDRAFT_72868                 47.0    5e-04   
ref|XP_002789380.1|  conserved hypothetical protein                   46.6    6e-04   Paracoccidioides lutzii Pb01
ref|XP_007374348.1|  hypothetical protein SPAPADRAFT_137450           47.0    6e-04   
ref|XP_387641.1|  hypothetical protein FG07465.1                      46.6    6e-04   Fusarium graminearum PH-1
ref|XP_007328586.1|  hypothetical protein AGABI1DRAFT_99159           46.6    7e-04   
gb|KEF61754.1|  hypothetical protein A1O9_03324                       46.6    7e-04   
ref|XP_002501940.1|  predicted protein                                47.4    7e-04   Micromonas commoda
gb|EFW22819.1|  conserved hypothetical protein                        47.0    8e-04   
ref|XP_008893231.1|  hypothetical protein PPTG_01614                  47.8    8e-04   
ref|XP_001422738.1|  predicted protein                                47.0    8e-04   Ostreococcus lucimarinus CCE9901
emb|CEJ94547.1|  hypothetical protein VHEMI10070                      46.2    9e-04   



>ref|XP_009618837.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Nicotiana tomentosiformis]
 ref|XP_009777630.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Nicotiana sylvestris]
Length=65

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 64/66 (97%), Gaps = 1/66 (2%)
 Frame = +3

Query  108  MGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHG  287
            MG GHGHGVTYKGITIHQPKRWH+VTGKGLCAVMWFW+LYRAKQDGPVVLGWRHPW+GHG
Sbjct  1    MGGGHGHGVTYKGITIHQPKRWHSVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPWDGHG  60

Query  288  DHGNDH  305
             HG+DH
Sbjct  61   -HGHDH  65



>ref|XP_004238414.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Solanum lycopersicum]
Length=65

 Score =   117 bits (294),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 1/66 (2%)
 Frame = +3

Query  108  MGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHG  287
            MG G GHGVT+KGIT+HQPKRWH+VTGKGLCAVMWFWILYRAK+DGPVVLGWRHPWEGHG
Sbjct  1    MGGGDGHGVTFKGITVHQPKRWHSVTGKGLCAVMWFWILYRAKKDGPVVLGWRHPWEGHG  60

Query  288  DHGNDH  305
             HG+DH
Sbjct  61   -HGHDH  65



>ref|XP_002306968.1| hypothetical protein POPTR_0005s26990g [Populus trichocarpa]
 ref|XP_006383762.1| hypothetical protein POPTR_0005s26990g [Populus trichocarpa]
 gb|EEE93964.1| hypothetical protein POPTR_0005s26990g [Populus trichocarpa]
 gb|ERP61559.1| hypothetical protein POPTR_0005s26990g [Populus trichocarpa]
Length=68

 Score =   117 bits (294),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  MGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHG  287
            M  GHG G+ YKG+T+H+PKRWH VTGKGLCAVMWFW+LYRAKQDGPVVLGWRHPWEGHG
Sbjct  1    MAGGHGEGINYKGLTMHKPKRWHVVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPWEGHG  60

Query  288  DHGND  302
            DHG++
Sbjct  61   DHGHE  65



>ref|XP_003607260.1| hypothetical protein MTR_4g075160 [Medicago truncatula]
Length=84

 Score =   118 bits (295),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGNDH*M  311
             TYKG+TIHQPKRWHTVTGKGLCAVMWFW++YRAKQD PVVLGWRHPWEGHGDHG++  +
Sbjct  12   TTYKGVTIHQPKRWHTVTGKGLCAVMWFWVMYRAKQDAPVVLGWRHPWEGHGDHGDELQL  71

Query  312  SGSKHEGNMNNLTE  353
               +H+ N+ +L  
Sbjct  72   QNLEHQ-NLKDLCS  84



>ref|XP_007227520.1| hypothetical protein PRUPE_ppa014487mg [Prunus persica]
 ref|XP_007227521.1| hypothetical protein PRUPE_ppa014487mg [Prunus persica]
 gb|EMJ28719.1| hypothetical protein PRUPE_ppa014487mg [Prunus persica]
 gb|EMJ28720.1| hypothetical protein PRUPE_ppa014487mg [Prunus persica]
Length=67

 Score =   117 bits (293),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +3

Query  108  MGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHG  287
            MG GHG G TYKG T+HQPKRWHT+TGKG+CA+MWFW+LYRAKQDGPVVLGWRHPWEGHG
Sbjct  1    MGGGHGEGTTYKGFTVHQPKRWHTLTGKGMCAMMWFWVLYRAKQDGPVVLGWRHPWEGHG  60

Query  288  DH  293
            DH
Sbjct  61   DH  62



>ref|XP_006342110.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2-like [Solanum tuberosum]
Length=65

 Score =   117 bits (292),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 1/66 (2%)
 Frame = +3

Query  108  MGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHG  287
            MG G GHG+T+KGIT+HQPKRWH+VTGKGLCAVMWFWILYRAK+DGPVVLGWRHPWEGHG
Sbjct  1    MGGGDGHGMTFKGITVHQPKRWHSVTGKGLCAVMWFWILYRAKKDGPVVLGWRHPWEGHG  60

Query  288  DHGNDH  305
             HG+DH
Sbjct  61   -HGHDH  65



>ref|XP_009334299.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Pyrus x bretschneideri]
Length=63

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  108  MGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHG  287
            MG GHG G+TYKGIT+HQPKRWHT+TGKG+CAVMWFW+LYRAK+DGPVVLGWRHPWEGH 
Sbjct  1    MGGGHGEGITYKGITVHQPKRWHTLTGKGMCAVMWFWVLYRAKKDGPVVLGWRHPWEGHE  60

Query  288  DH  293
            DH
Sbjct  61   DH  62



>ref|XP_003540566.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Glycine max]
 gb|KHN05461.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Glycine 
soja]
Length=67

 Score =   116 bits (290),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = +3

Query  108  MGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEG-H  284
            MG G GHG TYKG+TIHQPKRWHT+TGKGLCAVMWFW+ YRAKQDGPVVLGWRHPWEG H
Sbjct  1    MGGGQGHGTTYKGVTIHQPKRWHTITGKGLCAVMWFWVFYRAKQDGPVVLGWRHPWEGHH  60

Query  285  GDHGNDH  305
             DHG  H
Sbjct  61   DDHGKGH  67



>ref|XP_008221156.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Prunus mume]
 ref|XP_008221157.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Prunus mume]
Length=67

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  108  MGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHG  287
            MG GHG G TYKG T+HQPKRWH +TGKG+CA+MWFW+LYRAKQDGPVVLGWRHPWEGHG
Sbjct  1    MGGGHGEGTTYKGFTVHQPKRWHALTGKGMCAMMWFWVLYRAKQDGPVVLGWRHPWEGHG  60

Query  288  DH  293
            DH
Sbjct  61   DH  62



>ref|XP_008377089.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Malus domestica]
 ref|XP_008377090.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Malus domestica]
Length=63

 Score =   115 bits (288),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  108  MGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHG  287
            MG GHG G+TYKGIT+HQPKRWHT+TGKG+CAVMWFW+LYRAK+DGPVVLGWRHPW+GH 
Sbjct  1    MGGGHGEGITYKGITVHQPKRWHTLTGKGMCAVMWFWVLYRAKKDGPVVLGWRHPWDGHD  60

Query  288  DH  293
            DH
Sbjct  61   DH  62



>ref|XP_002301930.2| hypothetical protein POPTR_0002s01410g, partial [Populus trichocarpa]
 gb|EEE81203.2| hypothetical protein POPTR_0002s01410g, partial [Populus trichocarpa]
Length=99

 Score =   115 bits (289),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = +3

Query  48   ITVKHGVICGCGEERDRR-SEMGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWIL  224
            +  +    C    ER RR  EM  GHG G  YKG+T+H+PKRWHTVTGKGLCAVMWFW+L
Sbjct  11   VIPRQNRTCDRSIERQRRVKEMAGGHGEGFAYKGLTMHKPKRWHTVTGKGLCAVMWFWVL  70

Query  225  YRAKQDGPVVLGWRHPWE  278
            YRAKQDGPVVLGWRHPWE
Sbjct  71   YRAKQDGPVVLGWRHPWE  88



>gb|AFK47540.1| unknown [Medicago truncatula]
Length=69

 Score =   115 bits (287),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGNDH  305
             TYKG+TIHQPKRWHTVTGKGLCAVMWFW++YRAKQD PVVLGWRHPWEGHGDHG++H
Sbjct  12   TTYKGVTIHQPKRWHTVTGKGLCAVMWFWVMYRAKQDAPVVLGWRHPWEGHGDHGDEH  69



>ref|XP_004291308.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2-like [Fragaria vesca subsp. vesca]
Length=70

 Score =   114 bits (285),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  108  MGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            MG GHGHG+TYKG+T+HQPKRWHTVTGKGLCAVMWFW+LYRAKQDGPVVLGWRHPWE
Sbjct  1    MGGGHGHGITYKGVTVHQPKRWHTVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPWE  57



>gb|KHF99974.1| hypothetical protein F383_17879 [Gossypium arboreum]
Length=92

 Score =   114 bits (285),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  108  MGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHG  287
            MG GHG   TYKG+T+H PKRWH VTGKGLCAVMWFW+LYRAKQDGPVVLGWRHPWEGH 
Sbjct  1    MGGGHGESTTYKGLTLHHPKRWHVVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPWEGHD  60

Query  288  DHGN  299
            DH +
Sbjct  61   DHSH  64



>ref|XP_007017978.1| Uncharacterized protein TCM_034349 [Theobroma cacao]
 gb|EOY15203.1| Uncharacterized protein TCM_034349 [Theobroma cacao]
Length=70

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 60/73 (82%), Gaps = 3/73 (4%)
 Frame = +3

Query  108  MGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHG  287
            MG GH    TYKG+T+H PKRWHTVTGKGLCA+MWFW+LYRAKQDGPVVLGWRHPWEGH 
Sbjct  1    MGGGHEGSTTYKGVTLHHPKRWHTVTGKGLCAIMWFWVLYRAKQDGPVVLGWRHPWEGHD  60

Query  288  DHGNDH*MSGSKH  326
            DH + H   G KH
Sbjct  61   DHSHGH---GDKH  70



>ref|XP_004505703.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2-like [Cicer arietinum]
Length=69

 Score =   112 bits (280),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGNDH  305
             TYKG+TIHQPKRWHTVTGKGLCAVMWFW++YRAKQDGPVVLGWRHPWEGH DHG+ H
Sbjct  12   TTYKGVTIHQPKRWHTVTGKGLCAVMWFWVMYRAKQDGPVVLGWRHPWEGHDDHGSGH  69



>gb|AFK49070.1| unknown [Lotus japonicus]
Length=66

 Score =   110 bits (276),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGNDH  305
             TYKG+T+H PKRWH VTGKGLCAVMWFW+LYRAKQDGPVVLGWRHPWEGHGDHG+ H
Sbjct  9    TTYKGVTVHTPKRWHAVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPWEGHGDHGDGH  66



>ref|XP_011074732.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Sesamum indicum]
Length=65

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/54 (94%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDH  293
            VTYKG+T+HQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGH DH
Sbjct  11   VTYKGVTLHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHDDH  64



>ref|XP_004145533.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2-like isoform 1 [Cucumis sativus]
 ref|XP_004145534.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2-like isoform 2 [Cucumis sativus]
 ref|XP_004157078.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2-like isoform 1 [Cucumis sativus]
 ref|XP_004157079.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2-like isoform 2 [Cucumis sativus]
 gb|KGN55485.1| hypothetical protein Csa_4G653460 [Cucumis sativus]
Length=69

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 56/60 (93%), Gaps = 2/60 (3%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE--GHGDHGNDH  305
             T+KG+TIH PKRWHTVTGKGLCAVMWFW+LYRAKQDGPVVLGWRHPWE  GHGDHGN+H
Sbjct  10   TTFKGVTIHPPKRWHTVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPWEGHGHGDHGNEH  69



>ref|XP_009383474.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2-like [Musa acuminata subsp. malaccensis]
Length=72

 Score =   109 bits (273),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +3

Query  129  GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGNDH  305
              TYKG TIH PKRWH VTGKGLCA+MWFW+LYRAKQDGPVVLGW HPWEGHGDH +DH
Sbjct  10   STTYKGFTIHHPKRWHVVTGKGLCAIMWFWVLYRAKQDGPVVLGWHHPWEGHGDHSHDH  68



>ref|XP_009394043.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2-like [Musa acuminata subsp. malaccensis]
Length=76

 Score =   109 bits (273),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +3

Query  129  GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGNDH  305
              TYKG TIH PKRWH VTGK LCA+MWFW+LYRAKQDGPVVLGWRHPWEGHGDH ++H
Sbjct  11   STTYKGFTIHHPKRWHVVTGKSLCAIMWFWVLYRAKQDGPVVLGWRHPWEGHGDHSHEH  69



>ref|XP_002510641.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52828.1| conserved hypothetical protein [Ricinus communis]
Length=69

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  108  MGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            MG GHG G TYKG+TIHQPKRWH++TGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE
Sbjct  1    MGGGHGEGYTYKGVTIHQPKRWHSITGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  57



>ref|XP_007131610.1| hypothetical protein PHAVU_011G027800g [Phaseolus vulgaris]
 gb|ESW03604.1| hypothetical protein PHAVU_011G027800g [Phaseolus vulgaris]
Length=66

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = +3

Query  117  GHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEG-HGDH  293
            GHG   TYKG+TIH PKRWHT+TGKGLCAVMWFW++YRAKQD PVVLGWRHPWEG H DH
Sbjct  3    GHGDSTTYKGVTIHHPKRWHTITGKGLCAVMWFWVMYRAKQDAPVVLGWRHPWEGHHDDH  62

Query  294  GNDH  305
            G  H
Sbjct  63   GKGH  66



>ref|XP_006453389.1| hypothetical protein CICLE_v10010113mg [Citrus clementina]
 ref|XP_006453390.1| hypothetical protein CICLE_v10010113mg [Citrus clementina]
 ref|XP_006474171.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2-like [Citrus sinensis]
 gb|ESR66629.1| hypothetical protein CICLE_v10010113mg [Citrus clementina]
 gb|ESR66630.1| hypothetical protein CICLE_v10010113mg [Citrus clementina]
Length=69

 Score =   107 bits (268),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 57/67 (85%), Gaps = 2/67 (3%)
 Frame = +3

Query  111  GDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGD  290
            G  HG  V Y G+ +H+PKRWHTVTGKGLCAVMWFW+LYRAKQDGPVVLGWRHPWEGH D
Sbjct  3    GGDHGESVKYNGMALHRPKRWHTVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPWEGHDD  62

Query  291  --HGNDH  305
              HG+DH
Sbjct  63   RGHGHDH  69



>gb|ABK96425.1| unknown [Populus trichocarpa x Populus deltoides]
Length=68

 Score =   107 bits (268),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  108  MGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            M  GHG G+ YKG+T+H+PKRWHTVTGKGLCAVMWFW+LYRAKQDGPVVLGWRHPWE
Sbjct  1    MAGGHGEGIAYKGLTMHKPKRWHTVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPWE  57



>gb|EPS68707.1| hypothetical protein M569_06059 [Genlisea aurea]
Length=65

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 1/63 (2%)
 Frame = +3

Query  108  MGDGHG-HGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGH  284
            M  GHG  GVTYKGIT+H+PKRWHTVTGKGLCAVMWFWILYRAKQDG V+LG+RHPWEGH
Sbjct  1    MAGGHGGDGVTYKGITLHKPKRWHTVTGKGLCAVMWFWILYRAKQDGAVLLGYRHPWEGH  60

Query  285  GDH  293
             DH
Sbjct  61   DDH  63



>ref|XP_010935227.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2-like isoform X2 [Elaeis guineensis]
Length=76

 Score =   107 bits (266),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  129  GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGNDH  305
              TY G TIH PKRWHT+TGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGH DH   H
Sbjct  10   STTYNGYTIHHPKRWHTLTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHEDHSQGH  68



>ref|XP_010242841.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2-like [Nelumbo nucifera]
Length=77

 Score =   107 bits (266),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGNDH  305
             TYKG T+H PKRWH +TGKG+CA+MWFW+LYRAKQDGPVVLGWRHPWEGHGDH + H
Sbjct  12   TTYKGFTVHHPKRWHVLTGKGMCAIMWFWVLYRAKQDGPVVLGWRHPWEGHGDHSHGH  69



>ref|XP_008812046.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2-like [Phoenix dactylifera]
Length=72

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGNDH  305
             TY+G  IH+PKRWH +TGKGLCA+MWFW+LYRAKQDGPVVLGWRHPWEGHGDH + H
Sbjct  11   TTYRGYAIHRPKRWHVLTGKGLCAIMWFWVLYRAKQDGPVVLGWRHPWEGHGDHSHGH  68



>ref|XP_010688753.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Beta vulgaris subsp. vulgaris]
Length=65

 Score =   104 bits (259),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGN  299
             TYKG+T+H PKRWH+VTGKG+CA+MWFW+LYRAKQDGPVVLGWRHPW+GH DHG+
Sbjct  10   TTYKGMTLHTPKRWHSVTGKGMCALMWFWVLYRAKQDGPVVLGWRHPWDGHDDHGH  65



>ref|XP_009128160.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Brassica rapa]
 emb|CDY46007.1| BnaA02g17890D [Brassica napus]
Length=60

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +3

Query  123  GHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDH  293
            G G+TYKG+T+  PK WHTV GKGLC VMWFWILYRAKQDGPVV+GWRHPW+GHGDH
Sbjct  3    GGGITYKGVTVQTPKTWHTVAGKGLCGVMWFWILYRAKQDGPVVMGWRHPWDGHGDH  59



>ref|XP_010061147.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Eucalyptus grandis]
 gb|KCW68050.1| hypothetical protein EUGRSUZ_F01733 [Eucalyptus grandis]
Length=76

 Score =   101 bits (252),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +3

Query  129  GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGH  284
              TYKG+++H PKRWH VTGKGLCAVMWFW+LYRAKQDGPVVLGWRHPWEGH
Sbjct  10   STTYKGMSLHHPKRWHAVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPWEGH  61



>ref|XP_006590794.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Glycine max]
 gb|KHN32297.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Glycine 
soja]
Length=67

 Score =   101 bits (251),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  138  YKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEG-HGDHGNDH  305
            YKG+T+H PKRWHT+TGKGLCAVMWFW+ YRAKQDGPVVLGWRHPWEG H DHG  H
Sbjct  11   YKGVTVHHPKRWHTITGKGLCAVMWFWVFYRAKQDGPVVLGWRHPWEGHHDDHGKGH  67



>ref|XP_008781254.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Phoenix dactylifera]
Length=76

 Score =   101 bits (251),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGH  284
             TYKG TIH+PKRWH +TGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGH
Sbjct  11   TTYKGYTIHRPKRWHALTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGH  61



>gb|KCW68052.1| hypothetical protein EUGRSUZ_F01733 [Eucalyptus grandis]
Length=82

 Score =   101 bits (252),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +3

Query  129  GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGH  284
              TYKG+++H PKRWH VTGKGLCAVMWFW+LYRAKQDGPVVLGWRHPWEGH
Sbjct  10   STTYKGMSLHHPKRWHAVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPWEGH  61



>gb|KDO46516.1| hypothetical protein CISIN_1g035245mg [Citrus sinensis]
Length=69

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  111  GDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            G  HG  V Y G+ +H+PKRWHTVTGKGLCAVMWFW+LYRAKQDGPVVLGWRHPWE
Sbjct  3    GGDHGESVKYNGMALHRPKRWHTVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPWE  58



>ref|XP_006828981.1| hypothetical protein AMTR_s00001p00240340 [Amborella trichopoda]
 gb|ERM96397.1| hypothetical protein AMTR_s00001p00240340 [Amborella trichopoda]
Length=70

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  111  GDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGD  290
            G G GH  TYKG T+H PKRWH VTGKG+CA+MWFWI+YRAKQDG  +LG RHPWEGH D
Sbjct  3    GGGDGHSTTYKGFTVHHPKRWHVVTGKGMCAMMWFWIMYRAKQDGAALLGLRHPWEGHED  62

Query  291  H  293
            H
Sbjct  63   H  63



>ref|XP_010266114.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2-like [Nelumbo nucifera]
Length=74

 Score = 99.8 bits (247),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  117  GHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            G GH  TYKG T+H PKRWH +TGKG+CA+MWFW+LYRAKQDGPVVLGWRHPWE
Sbjct  6    GDGHSTTYKGFTMHYPKRWHVITGKGMCAIMWFWVLYRAKQDGPVVLGWRHPWE  59



>ref|XP_008452937.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Cucumis melo]
 ref|XP_008452938.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Cucumis melo]
Length=72

 Score = 99.0 bits (245),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  135  TYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            TYKG+TIH PKRWHTVTGKGLCA+MWFW+LYRAKQDGPVVLGWRHPWE
Sbjct  11   TYKGVTIHPPKRWHTVTGKGLCAIMWFWVLYRAKQDGPVVLGWRHPWE  58



>ref|XP_010941393.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2-like [Elaeis guineensis]
Length=76

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGH  284
             TY+G TIH PKRWH +TGKGLCA+MWFWILYRAKQDGPVVLGWRHPW GH
Sbjct  11   TTYRGYTIHHPKRWHVLTGKGLCAIMWFWILYRAKQDGPVVLGWRHPWAGH  61



>ref|XP_009418302.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2-like [Musa acuminata subsp. malaccensis]
Length=76

 Score = 96.3 bits (238),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  129  GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
              TYKG TIH PKRWH VTGKGLCA+MWFWILYRAKQDGPVVLGWRHPWE
Sbjct  10   STTYKGFTIHHPKRWHVVTGKGLCAIMWFWILYRAKQDGPVVLGWRHPWE  59



>ref|XP_006390222.1| hypothetical protein EUTSA_v10019410mg [Eutrema salsugineum]
 gb|ESQ27508.1| hypothetical protein EUTSA_v10019410mg [Eutrema salsugineum]
Length=68

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            +TYKG+T+H PK WHTVTGKGLCAVMWFWILYRAKQDGPVV+GWRHPW+
Sbjct  9    ITYKGVTVHTPKTWHTVTGKGLCAVMWFWILYRAKQDGPVVMGWRHPWD  57



>ref|NP_565128.1| uncharacterized protein [Arabidopsis thaliana]
 ref|XP_002887630.1| hypothetical protein ARALYDRAFT_476772 [Arabidopsis lyrata subsp. 
lyrata]
 sp|Q8LDK3.1|NDUB2_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Arabidopsis thaliana]
 gb|AAM63174.1| unknown [Arabidopsis thaliana]
 gb|ABF82600.1| At1g76200 [Arabidopsis thaliana]
 dbj|BAE98502.1| hypothetical protein [Arabidopsis thaliana]
 gb|EFH63889.1| hypothetical protein ARALYDRAFT_476772 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE35810.1| uncharacterized protein AT1G76200 [Arabidopsis thaliana]
Length=69

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            +TYKG+T+H PK WHTVTGKGLCAVMWFWILYRAKQDGPVV+GWRHPW+
Sbjct  10   ITYKGVTVHTPKTWHTVTGKGLCAVMWFWILYRAKQDGPVVMGWRHPWD  58



>ref|XP_002285922.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Vitis vinifera]
Length=69

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  129  GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
              TYKG+T+H PKRWHT+TGKGLCA+MWFW++YRAKQDGPVVLGWRHPW
Sbjct  9    STTYKGVTMHHPKRWHTITGKGLCAIMWFWVMYRAKQDGPVVLGWRHPW  57



>emb|CDP07313.1| unnamed protein product [Coffea canephora]
Length=71

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +3

Query  138  YKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            +KGIT+H PKRWH+VTGKG+CA+MWFWILYRAKQDGPVVLGWRHPWE
Sbjct  12   FKGITVHHPKRWHSVTGKGMCALMWFWILYRAKQDGPVVLGWRHPWE  58



>gb|KCW68051.1| hypothetical protein EUGRSUZ_F01733 [Eucalyptus grandis]
Length=75

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 1/52 (2%)
 Frame = +3

Query  129  GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGH  284
              TYKG+++H PKRWH VTGKGLCAVM FW+LYRAKQDGPVVLGWRHPWEGH
Sbjct  10   STTYKGMSLHHPKRWHAVTGKGLCAVM-FWVLYRAKQDGPVVLGWRHPWEGH  60



>emb|CDX85939.1| BnaC06g21950D [Brassica napus]
Length=65

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  117  GHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            G G G+TYKG+++  PK WHTV GKGLC VMWFWILYRAKQDGPVV+GWRHPW+
Sbjct  3    GVGGGMTYKGVSVQTPKTWHTVAGKGLCGVMWFWILYRAKQDGPVVMGWRHPWD  56



>ref|XP_009106275.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Brassica rapa]
 emb|CDX87629.1| BnaA07g32440D [Brassica napus]
 emb|CDX73242.1| BnaC06g36900D [Brassica napus]
Length=67

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            +TYKG+T+H PK WHTV GKGLC VMWFWILYRAKQDGPVV+GWRHPW+
Sbjct  7    ITYKGVTVHTPKTWHTVAGKGLCGVMWFWILYRAKQDGPVVMGWRHPWD  55



>ref|XP_009104686.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2-like [Brassica rapa]
Length=65

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            +TYKG+T+  PK WHTV GKGLC VMWFWILYRAKQDGPVV+GWRHPW+
Sbjct  8    ITYKGVTVQTPKTWHTVAGKGLCGVMWFWILYRAKQDGPVVMGWRHPWD  56



>emb|CDX68107.1| BnaA07g21470D [Brassica napus]
Length=67

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            +TYKG+T+  PK WH V GKGLC VMWFWILYRAKQDGPVV+GWRHPW+
Sbjct  8    ITYKGVTVQTPKTWHAVAGKGLCGVMWFWILYRAKQDGPVVMGWRHPWD  56



>ref|XP_006390223.1| hypothetical protein EUTSA_v10019410mg [Eutrema salsugineum]
 gb|ESQ27509.1| hypothetical protein EUTSA_v10019410mg [Eutrema salsugineum]
Length=67

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 1/49 (2%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            +TYKG+T+H PK WHTVTGKGLCAVM FWILYRAKQDGPVV+GWRHPW+
Sbjct  9    ITYKGVTVHTPKTWHTVTGKGLCAVM-FWILYRAKQDGPVVMGWRHPWD  56



>emb|CDY50906.1| BnaCnng19980D [Brassica napus]
Length=57

 Score = 85.1 bits (209),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 2/56 (4%)
 Frame = +3

Query  123  GHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGD  290
            G G+ YKG+T+  PK WHTV GKGLC VM FWILYRAKQDGPVV+GWRHPW+ HG+
Sbjct  3    GGGIAYKGVTVQTPKTWHTVAGKGLCGVM-FWILYRAKQDGPVVMGWRHPWD-HGE  56



>emb|CBI18878.3| unnamed protein product [Vitis vinifera]
Length=53

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +3

Query  153  IHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            +H PKRWHT+TGKGLCA+MWFW++YRAKQDGPVVLGWRHPW
Sbjct  1    MHHPKRWHTITGKGLCAIMWFWVMYRAKQDGPVVLGWRHPW  41



>gb|ABK21431.1| unknown [Picea sitchensis]
Length=80

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEG  281
            +TY G T+H P +WH  TGK +CAVMWFWILYRAK+DGPV+LG RHPWE 
Sbjct  16   ITYNGFTMHPPNKWHARTGKFMCAVMWFWILYRAKEDGPVLLGMRHPWES  65



>ref|XP_010935226.1| PREDICTED: uncharacterized protein LOC105055176 isoform X1 [Elaeis 
guineensis]
Length=111

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +3

Query  129  GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVL  257
              TY G TIH PKRWHT+TGKGLCAVMWFWILYRAKQDGPVVL
Sbjct  10   STTYNGYTIHHPKRWHTLTGKGLCAVMWFWILYRAKQDGPVVL  52



>gb|ABK25534.1| unknown [Picea sitchensis]
 gb|ACN40028.1| unknown [Picea sitchensis]
Length=80

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEG  281
            +TY G T+H P +WH  TGK +CAVMWFWILYRAK+DGPV+LG RHPWE 
Sbjct  16   LTYNGFTMHPPNKWHARTGKFMCAVMWFWILYRAKEDGPVLLGMRHPWES  65



>emb|CAN74075.1| hypothetical protein VITISV_000976 [Vitis vinifera]
Length=132

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 68/122 (56%), Gaps = 19/122 (16%)
 Frame = -3

Query  431  IPFLVNY*TEINRT-------LTRHF---HSQNKPKFSKVIHIAFML*TRHLMIIPMISM  282
            +P +  Y TEIN+        LT+HF   H  +      ++ +  M          M+ M
Sbjct  16   LPLMSIYSTEINKDVPVFQNPLTQHFMLFHFSSSSSRCLILMVVTM---------AMLVM  66

Query  281  TFPRMPPSQYYRSILFGSVQNPKPHDGTQALAGDGVPALGLMDRNAFVSYAVAMSVSHLR  102
            T PRM P+QYYR++L   V +PKPHDG QAL+GD +P+LG+M   AFV  AV+M+ S   
Sbjct  67   TLPRMSPTQYYRTVLLSPVHDPKPHDGAQALSGDSMPSLGMMHCYAFVCSAVSMASSSHL  126

Query  101  SP  96
            SP
Sbjct  127  SP  128



>ref|XP_001774617.1| predicted protein [Physcomitrella patens]
 gb|EDQ60551.1| predicted protein [Physcomitrella patens]
Length=69

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +3

Query  111  GDGHG-HGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            G GHG H +T+ G+++H  K WH+  G+G+CAVMWFW+LYRAKQDG V++GWRHPWE
Sbjct  3    GGGHGAHNITHGGLSLHATKGWHSRVGQGMCAVMWFWVLYRAKQDGAVLMGWRHPWE  59



>ref|XP_008656572.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 isoform X1 [Zea mays]
 gb|ACN36526.1| unknown [Zea mays]
 gb|AFW82973.1| hypothetical protein ZEAMMB73_490100 [Zea mays]
Length=90

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +3

Query  111  GDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            G  HG G TYKG TI   KRWHTV GKGLCAVMWFW+ YRAKQDG  +LG RHPW
Sbjct  4    GGAHG-GTTYKGYTIPHNKRWHTVAGKGLCAVMWFWVFYRAKQDGATLLGLRHPW  57



>ref|XP_008656573.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 isoform X2 [Zea mays]
 gb|ACF81009.1| unknown [Zea mays]
 gb|ACG26048.1| hypothetical protein [Zea mays]
 gb|AFW82972.1| hypothetical protein ZEAMMB73_490100 [Zea mays]
Length=74

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +3

Query  111  GDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            G  HG G TYKG TI   KRWHTV GKGLCAVMWFW+ YRAKQDG  +LG RHPW
Sbjct  4    GGAHG-GTTYKGYTIPHNKRWHTVAGKGLCAVMWFWVFYRAKQDGATLLGLRHPW  57



>ref|XP_004966497.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2-like [Setaria italica]
Length=81

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  135  TYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            TYKG TI   KRWHTV GKGLCAVMWFW+ YRAKQDG V+LG RHPW
Sbjct  11   TYKGYTIPHNKRWHTVAGKGLCAVMWFWVFYRAKQDGAVLLGLRHPW  57



>ref|NP_001054508.1| Os05g0122900 [Oryza sativa Japonica Group]
 dbj|BAB88326.1| BLE1 protein [Oryza sativa]
 gb|AAS72370.2| BLE1 protein [Oryza sativa Japonica Group]
 dbj|BAF16422.1| Os05g0122900 [Oryza sativa Japonica Group]
 dbj|BAG92417.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94093.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97051.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62157.1| hypothetical protein OsJ_16944 [Oryza sativa Japonica Group]
Length=81

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  135  TYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            TYKG TI   KRWHTV GKGLCAVMWFW+ YRAKQDG V+LG RHPW
Sbjct  11   TYKGYTIPHNKRWHTVAGKGLCAVMWFWVFYRAKQDGAVLLGMRHPW  57



>gb|EEC78428.1| hypothetical protein OsI_18259 [Oryza sativa Indica Group]
Length=81

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  135  TYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            TYKG TI   KRWHTV GKGLCAVMWFW+ YRAKQDG V+LG RHPW
Sbjct  11   TYKGYTIPHNKRWHTVAGKGLCAVMWFWVFYRAKQDGAVLLGMRHPW  57



>ref|XP_008649929.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Zea mays]
Length=114

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
             TYKG TI   KRWHTV GKGLCAVMWFW+ YRAKQDG  +LG RHPW
Sbjct  44   TTYKGYTIPHNKRWHTVAGKGLCAVMWFWVFYRAKQDGATLLGLRHPW  91



>gb|ACF86275.1| unknown [Zea mays]
 gb|ACL53737.1| unknown [Zea mays]
 gb|AFW78893.1| hypothetical protein ZEAMMB73_757916 [Zea mays]
Length=80

 Score = 79.7 bits (195),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  132  VTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
             TYKG TI   KRWHTV GKGLCAVMWFW+ YRAKQDG  +LG RHPW
Sbjct  10   TTYKGYTIPHNKRWHTVAGKGLCAVMWFWVFYRAKQDGATLLGLRHPW  57



>ref|XP_003563269.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2 [Brachypodium distachyon]
Length=83

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  138  YKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            YKG TI   KRWHTV GKGLCAVMWFWI YRAKQDG V+LG RHPW
Sbjct  12   YKGYTIPHNKRWHTVAGKGLCAVMWFWIFYRAKQDGAVLLGMRHPW  57



>gb|ACU13507.1| unknown [Glycine max]
Length=81

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 48/73 (66%), Gaps = 1/73 (1%)
 Frame = -3

Query  308  LMIIPMISM-TFPRMPPSQYYRSILFGSVQNPKPHDGTQALAGDGVPALGLMDRNAFVSY  132
            LM + MI M T PRM P+QY R+IL   V+ PKPHD  Q LAGD VPAL LM+ N FV  
Sbjct  2    LMALAMIIMVTLPRMSPAQYNRTILLCPVEYPKPHDRAQTLAGDSVPALWLMNGNTFVGC  61

Query  131  AVAMSVSHLRSPI  93
            AV +S  H  SP+
Sbjct  62   AVTLSSLHHNSPL  74



>gb|ACU13825.1| unknown [Glycine max]
Length=83

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  293  MISMTFPRMPPSQYYRSILFGSVQNPKPHDGTQALAGDGVPALGLMDRNAFVSYAVAMSV  114
            +I MT PRMPP+QY R++L   V+ PKPHD  Q LAGD VPAL +M+ N+FV  AV +S 
Sbjct  12   IIVMTLPRMPPAQYNRTVLLCPVEYPKPHDRAQTLAGDSVPALWVMNGNSFVGGAVTVSS  71

Query  113  SH  108
            SH
Sbjct  72   SH  73



>ref|XP_001755322.1| predicted protein [Physcomitrella patens]
 gb|EDQ79802.1| predicted protein [Physcomitrella patens]
Length=162

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +3

Query  126  HGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            H +T+ G+++H  K WH+  G+G+CAVMW W+LYRAKQDG V++GWRHPW
Sbjct  69   HNITHGGLSLHATKGWHSRVGQGMCAVMWLWVLYRAKQDGAVLMGWRHPW  118



>gb|EAZ02409.1| hypothetical protein OsI_24511 [Oryza sativa Indica Group]
Length=73

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
             TI   KRWHTV GKGLCAVMWFW+ YRAKQDG V+LG RHPW
Sbjct  10   FTIPHNKRWHTVAGKGLCAVMWFWVFYRAKQDGAVLLGLRHPW  52



>ref|NP_001175007.1| Os06g0725400 [Oryza sativa Japonica Group]
 dbj|BAD61701.1| putative BLE1 protein [Oryza sativa Japonica Group]
 gb|EAZ38331.1| hypothetical protein OsJ_22706 [Oryza sativa Japonica Group]
 dbj|BAH00968.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH93735.1| Os06g0725400 [Oryza sativa Japonica Group]
Length=73

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
             TI   KRWHTV GKGLCAVMWFW+ YRAKQDG V+LG RHPW
Sbjct  10   FTIPHNKRWHTVAGKGLCAVMWFWVFYRAKQDGAVLLGLRHPW  52



>ref|XP_006644170.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 2-like [Oryza brachyantha]
Length=77

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +3

Query  165  KRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            KRWHTV GKGLCAVMWFW+ YRAKQDG V+LG RHPW
Sbjct  18   KRWHTVAGKGLCAVMWFWVFYRAKQDGAVLLGLRHPW  54



>gb|EYU36823.1| hypothetical protein MIMGU_mgv1a0190192mg, partial [Erythranthe 
guttata]
Length=34

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  108  MGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVM  209
            M  GHGHGVTYKG+T+HQPKRWHTVTGKGLCAVM
Sbjct  1    MAGGHGHGVTYKGVTLHQPKRWHTVTGKGLCAVM  34



>gb|KDQ21924.1| hypothetical protein BOTBODRAFT_26329 [Botryobasidium botryosum 
FD-172 SS1]
Length=63

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = +3

Query  144  GITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE--GHGDHGNDH  305
            G   H P   H    K L A MWF+I YRA+QDGP +LG RHPWE  GHGDHG  H
Sbjct  7    GFHPHPPTFQHRFLAKALGATMWFFIFYRARQDGPKLLGLRHPWEGHGHGDHGEAH  62



>ref|XP_005645302.1| hypothetical protein COCSUDRAFT_33883 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20758.1| hypothetical protein COCSUDRAFT_33883 [Coccomyxa subellipsoidea 
C-169]
Length=121

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 43/76 (57%), Gaps = 6/76 (8%)
 Frame = +3

Query  108  MGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHG  287
            M   HG  VTY G+T+++P RWH + G+G+ ++MWFWI YRA  DG  +L       GH 
Sbjct  47   MASDHGPPVTYAGLTLYKPARWHVLWGEGMASLMWFWIFYRAYHDGSTLLF------GHA  100

Query  288  DHGNDH*MSGSKHEGN  335
             H       G  HEG+
Sbjct  101  QHFEHDEGHGESHEGD  116



>ref|XP_007882169.1| hypothetical protein PFL1_06437 [Pseudozyma flocculosa PF-1]
 gb|EPQ25982.1| hypothetical protein PFL1_06437 [Pseudozyma flocculosa PF-1]
Length=70

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  156  HQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGND  302
            HQP   H    K L A MWFWI YRAKQDGPV+LG RHPW+GH  H ++
Sbjct  15   HQPAFKHRWGAKLLGATMWFWIFYRAKQDGPVLLGLRHPWDGHHGHHDE  63



>gb|ACG29497.1| hypothetical protein [Zea mays]
Length=64

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  183  TGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            T KGLCAVMWFW+ YRAKQDG  +LG RHPWE
Sbjct  11   TYKGLCAVMWFWVFYRAKQDGATLLGLRHPWE  42



>ref|XP_003844619.1| hypothetical protein LEMA_P022700.1 [Leptosphaeria maculans JN3]
 emb|CBY01140.1| hypothetical protein LEMA_P022700.1 [Leptosphaeria maculans JN3]
Length=65

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +3

Query  99   RSEMGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            R+ MG           I IH  +  +     GL A MWF+++YRAK+DGPV+LGWRHPWE
Sbjct  5    RARMGPPKYAPHPNHPIHIHPARPLYRFVATGLGASMWFFLMYRAKKDGPVLLGWRHPWE  64



>gb|AES89457.2| hypothetical protein MTR_4g075160 [Medicago truncatula]
Length=74

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/26 (96%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = +3

Query  135  TYKGITIHQPKRWHTVTGKGLCAVMW  212
            TYKG+TIHQPKRWHTVTGKGLCAVMW
Sbjct  13   TYKGVTIHQPKRWHTVTGKGLCAVMW  38



>emb|CCM06208.1| predicted protein [Fibroporia radiculosa]
Length=70

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = +3

Query  129  GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGND  302
            G    G   H P   H      L A MWFWI YRA++DG  +LG RHPWEGHG HG+D
Sbjct  3    GPYAPGFHPHLPGYKHKFLATALGATMWFWIFYRARKDGAKLLGLRHPWEGHG-HGHD  59



>gb|KDQ57777.1| hypothetical protein JAAARDRAFT_35469 [Jaapia argillacea MUCL 
33604]
Length=66

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +3

Query  123  GHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHG  287
            GHG T  G   H P   +    K L A MWF+I YRA++DGP +L  RHPWEGHG
Sbjct  3    GHGPT-SGFNPHLPGFRYQFLAKTLGATMWFFIFYRAREDGPKLLMLRHPWEGHG  56



>emb|CDS10330.1| hypothetical protein LRAMOSA03006 [Absidia idahoensis var. thermophila]
Length=62

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  129  GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            G    G   H    WH   GK L A MWFW++YRAKQDGPV+LG +HPW
Sbjct  3    GAAGLGFHPHFAGFWHRFAGKTLGATMWFWMMYRAKQDGPVLLGLQHPW  51



>ref|XP_008034398.1| hypothetical protein TRAVEDRAFT_113347, partial [Trametes versicolor 
FP-101664 SS1]
 gb|EIW63047.1| hypothetical protein TRAVEDRAFT_113347, partial [Trametes versicolor 
FP-101664 SS1]
Length=62

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +3

Query  141  KGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDH  293
             G   H P   H      L A MWF+I YRA+ DG  +LGW+HPW+GH DH
Sbjct  1    SGFNPHLPGFKHKFLATTLGATMWFFIFYRARCDGAKLLGWKHPWDGHDDH  51



>ref|XP_008022899.1| hypothetical protein SETTUDRAFT_26733 [Setosphaeria turcica Et28A]
 gb|EOA89509.1| hypothetical protein SETTUDRAFT_26733 [Setosphaeria turcica Et28A]
Length=65

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I IH  + ++     GL A MWF+++YRAKQDGP +LGW+HPW+
Sbjct  21   IHIHPARPFYRFMATGLGASMWFFLMYRAKQDGPALLGWKHPWD  64



>gb|KFH64152.1| hypothetical protein MVEG_09977 [Mortierella verticillata NRRL 
6337]
Length=64

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  144  GITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            G   H P   ++V  K L A MWFW++Y+AK++GPVVLG RHPW+
Sbjct  3    GFHPHMPAARYSVAAKILGASMWFWVMYKAKEEGPVVLGLRHPWD  47



>gb|ELR10419.1| hypothetical protein GMDG_00831 [Pseudogymnoascus destructans 
20631-21]
Length=53

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I IH  +  +     GL A MWF+++YRAKQDGP +LGW+HPW+
Sbjct  9    IHIHPARPLYRFAATGLGASMWFFLMYRAKQDGPALLGWKHPWD  52



>gb|EGO00018.1| hypothetical protein SERLA73DRAFT_88834 [Serpula lacrymans var. 
lacrymans S7.3]
Length=68

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 32/53 (60%), Gaps = 1/53 (2%)
 Frame = +3

Query  117  GHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            GHG G    G   H P   +    K L A MWF+I YRA+QDGP +LGWRHPW
Sbjct  3    GHGAGHP-SGFNPHLPGFRYQFLAKALGATMWFFIFYRARQDGPKLLGWRHPW  54



>ref|XP_007675394.1| hypothetical protein BAUCODRAFT_67924 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC97711.1| hypothetical protein BAUCODRAFT_67924 [Baudoinia compniacensis 
UAMH 10762]
Length=58

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            + +H  +  +     GL A MWF+++YRA+ DGPV+LGWRHPWE
Sbjct  14   VHVHPARPLYRFAATGLGAAMWFFLMYRARYDGPVLLGWRHPWE  57



>emb|CEG02135.1| unnamed product [Ostreococcus tauri]
Length=97

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   ICGCGEERDRRSEMGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGP  248
            +   G   +R      G+GHGVT++G+T+H+    H   G G  A+MWFW+ YR   DG 
Sbjct  17   LANAGAGFNRARGYASGNGHGVTHEGVTLHEASTAHKALGTGFGALMWFWVFYRFYHDGD  76

Query  249  VVL  257
             ++
Sbjct  77   TLI  79



>ref|XP_003189082.1| hypothetical protein AOR_1_1202184 [Aspergillus oryzae RIB40]
Length=51

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I IH  +  +  T   L A MWF+++YRAK+DGP +LGW+HPWE
Sbjct  7    IHIHPARPLYRFTATALGASMWFFLMYRAKKDGPALLGWKHPWE  50



>ref|XP_011128120.1| hypothetical protein AOL_s00215g616 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX43160.1| hypothetical protein AOL_s00215g616 [Arthrobotrys oligospora 
ATCC 24927]
Length=59

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = +3

Query  123  GHGVTYKG---ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            GHG    G   I IH  +  + +   GL A MWF+++YRAK+DGPV+LGWRHP++
Sbjct  4    GHGARPHGGHPIHIHPARPVYRLFATGLGASMWFFLMYRAKKDGPVLLGWRHPFD  58



>ref|XP_007005299.1| hypothetical protein TREMEDRAFT_31825 [Tremella mesenterica DSM 
1558]
 gb|EIW68735.1| hypothetical protein TREMEDRAFT_31825 [Tremella mesenterica DSM 
1558]
Length=58

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +3

Query  144  GITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHG  287
            G   H P   H    K L A MWF+I YRA+QDG  ++G RHPW+GHG
Sbjct  7    GFHPHPPPLLHRGLAKALGAGMWFFIFYRARQDGAALIGLRHPWDGHG  54



>ref|XP_006958803.1| hypothetical protein WALSEDRAFT_69279 [Wallemia sebi CBS 633.66]
 gb|EIM21126.1| hypothetical protein WALSEDRAFT_69279 [Wallemia sebi CBS 633.66]
Length=57

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 31/51 (61%), Gaps = 1/51 (2%)
 Frame = +3

Query  153  IHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGNDH  305
             H P R+H      L A MWFWI Y+A+QD P +LGW  P+E HGDH   H
Sbjct  8    FHAPPRFHRFASTALGASMWFWIFYKARQDLPHMLGWHLPFE-HGDHDEHH  57



>ref|XP_001911311.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP73136.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP25538.1| Putative protein of unknown function [Podospora anserina S mat+]
Length=58

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  174  HTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            +  T  GL A MWFWI Y+AK+DGPV+LGW+HPW+
Sbjct  23   YRYTATGLGASMWFWIFYKAKEDGPVLLGWKHPWD  57



>ref|XP_007711818.1| hypothetical protein COCCADRAFT_94810 [Bipolaris zeicola 26-R-13]
 gb|EUC33908.1| hypothetical protein COCCADRAFT_94810 [Bipolaris zeicola 26-R-13]
 gb|EUN24505.1| hypothetical protein COCVIDRAFT_39981 [Bipolaris victoriae FI3]
Length=65

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +3

Query  99   RSEMGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            RS MG           I IH  +  +     GL A MWF+++YRAK+DGP +LGW+HPW+
Sbjct  5    RSRMGPPKYPPHPNHPIHIHPVRPLYRFMATGLGASMWFFLMYRAKKDGPALLGWKHPWD  64



>ref|XP_007689374.1| hypothetical protein COCMIDRAFT_99075 [Bipolaris oryzae ATCC 
44560]
 gb|EMD92086.1| hypothetical protein COCHEDRAFT_1173643 [Bipolaris maydis C5]
 gb|ENI02431.1| hypothetical protein COCC4DRAFT_201345 [Bipolaris maydis ATCC 
48331]
 gb|EUC44102.1| hypothetical protein COCMIDRAFT_99075 [Bipolaris oryzae ATCC 
44560]
Length=65

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +3

Query  99   RSEMGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            RS MG           I IH  +  +     GL A MWF+++YRAK+DGP +LGW+HPW+
Sbjct  5    RSRMGPPKYAPHPNHPIHIHPVRPLYRFMATGLGASMWFFLMYRAKKDGPALLGWKHPWD  64



>ref|XP_003661629.1| hypothetical protein MYCTH_48250, partial [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO56384.1| hypothetical protein MYCTH_48250, partial [Myceliophthora thermophila 
ATCC 42464]
Length=50

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  192  GLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            GL A MWFWI YRAK+DGPV+LGW+HPWE
Sbjct  21   GLGASMWFWIFYRAKKDGPVLLGWKHPWE  49



>gb|KDN43007.1| hypothetical protein K437DRAFT_257678 [Tilletiaria anomala UBC 
951]
Length=80

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +3

Query  144  GITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            G   HQP   H      L A MWFWI YRA+QDGPV+LG RHPW
Sbjct  20   GFHPHQPSLKHRAGATILGATMWFWIFYRARQDGPVLLGLRHPW  63



>ref|XP_001266076.1| hypothetical protein NFIA_037530 [Neosartorya fischeri NRRL 181]
 ref|XP_003188966.1| hypothetical protein ANI_1_344154 [Aspergillus niger CBS 513.88]
 gb|EAW24179.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181]
 gb|EHA22476.1| hypothetical protein ASPNIDRAFT_204582 [Aspergillus niger ATCC 
1015]
Length=51

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I IH  +  +  T   L A MWF+++YRAK+DGP +LGW+HPW+
Sbjct  7    IHIHPARPLYRFTATALGASMWFFLMYRAKKDGPALLGWKHPWD  50



>ref|XP_008727429.1| hypothetical protein G647_04870 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI23074.1| hypothetical protein G647_04870 [Cladophialophora carrionii CBS 
160.54]
Length=62

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  153  IHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I+   R + V   GL A MWF++ YR KQDGP +LGW+HPW+
Sbjct  20   INAAPRLYRVAATGLGAAMWFFLFYRMKQDGPALLGWKHPWD  61



>ref|XP_001799701.1| hypothetical protein SNOG_09407 [Phaeosphaeria nodorum SN15]
 gb|EAT83599.1| hypothetical protein SNOG_09407 [Phaeosphaeria nodorum SN15]
Length=65

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I IH  +  +     GL A MWF+++YRAK+DGPV+LGW+HPW+
Sbjct  21   IHIHPVRPLYRFMATGLGASMWFFLMYRAKKDGPVLLGWKHPWD  64



>gb|EHK15138.1| hypothetical protein TRIVIDRAFT_90892 [Trichoderma virens Gv29-8]
Length=50

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  174  HTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            + VT   L A MWFW++YRAK+DGPV+LGW+HPW+
Sbjct  15   YRVTATALGAGMWFWLMYRAKKDGPVLLGWKHPWD  49



>gb|EYU36824.1| hypothetical protein MIMGU_mgv1a0190191mg, partial [Erythranthe 
guttata]
Length=29

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 1/28 (4%)
 Frame = +3

Query  213  FWILYRAKQDGPVVLGWRHPWEGH-GDH  293
            FW+LYRAKQDGPVVLGWRHPW+GH GDH
Sbjct  1    FWVLYRAKQDGPVVLGWRHPWDGHDGDH  28



>ref|XP_011114343.1| hypothetical protein H072_8648 [Dactylellina haptotyla CBS 200.50]
 gb|EPS37654.1| hypothetical protein H072_8648 [Dactylellina haptotyla CBS 200.50]
Length=54

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I IH  +  + +   GL A MWF+++YRAK+DG V+LGWRHP+E
Sbjct  10   IHIHPVRPLYRIAATGLGASMWFFLMYRAKKDGAVLLGWRHPFE  53



>gb|KEQ94612.1| hypothetical protein AUEXF2481DRAFT_40545, partial [Aureobasidium 
subglaciale EXF-2481]
Length=62

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I IH  +  +     GL A MWF+++YRAK+DGP +LGW+HPW+
Sbjct  18   IHIHPVRPLYRFAATGLGASMWFFLMYRAKKDGPALLGWKHPWD  61



>ref|XP_003083060.1| Permease of the major facilitator superfamily (ISS) [Ostreococcus 
tauri]
Length=669

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = +3

Query  78   CGEERDRRSEMGD--GHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPV  251
            C +E  RRS+  D  G+GHGVT++G+T+H+    H   G G  A+MWFW+ YR   DG  
Sbjct  590  CVDECARRSDPSDPSGNGHGVTHEGVTLHEASTAHKALGTGFGALMWFWVFYRFYHDGDT  649

Query  252  VL  257
            ++
Sbjct  650  LI  651



>dbj|GAC74095.1| hypothetical protein PANT_10c00007 [Pseudozyma antarctica T-34]
Length=166

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +3

Query  144  GITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            G   H P   H    K L A MWFWI YRAKQDGPV+LG +HPW
Sbjct  108  GFAPHPPAFKHRWGAKLLGATMWFWIFYRAKQDGPVLLGLKHPW  151



>dbj|GAK66164.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2-like 
isoform 2 [Pseudozyma antarctica]
Length=76

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +3

Query  144  GITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            G   H P   H    K L A MWFWI YRAKQDGPV+LG +HPW
Sbjct  18   GFAPHPPAFKHRWGAKLLGATMWFWIFYRAKQDGPVLLGLKHPW  61



>ref|XP_001273888.1| hypothetical protein ACLA_008820 [Aspergillus clavatus NRRL 1]
 gb|EAW12462.1| hypothetical protein ACLA_008820 [Aspergillus clavatus NRRL 1]
Length=69

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I IH  +  +  T   L A MWF+++YRAK+DGP +LGW+HPW+
Sbjct  25   IHIHPARPLYRFTATALGASMWFFLMYRAKKDGPALLGWKHPWD  68



>ref|XP_007266804.1| hypothetical protein FOMMEDRAFT_86278, partial [Fomitiporia mediterranea 
MF3/22]
 gb|EJD03093.1| hypothetical protein FOMMEDRAFT_86278, partial [Fomitiporia mediterranea 
MF3/22]
Length=60

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +3

Query  144  GITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHG  287
            G   H P   + +  KGL A MWF+I YRA+QDG  +LG  HPWE HG
Sbjct  3    GFHPHLPGLGYQLLAKGLGASMWFFIFYRARQDGAKLLGLSHPWEHHG  50



>gb|KEQ80262.1| hypothetical protein M438DRAFT_254343, partial [Aureobasidium 
pullulans EXF-150]
Length=50

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I IH  +  +     GL A MWF+++YRAK+DGP +LGW+HPW+
Sbjct  6    IHIHPVRPLYRFAATGLGASMWFFLMYRAKKDGPALLGWKHPWD  49



>ref|XP_001930973.1| conserved hypothetical protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 ref|XP_003299811.1| hypothetical protein PTT_10883 [Pyrenophora teres f. teres 0-1]
 gb|EDU40078.1| conserved hypothetical protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EFQ92098.1| hypothetical protein PTT_10883 [Pyrenophora teres f. teres 0-1]
Length=65

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +3

Query  99   RSEMGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            R+ MG           I +H  +  +     GL A MWF+++YRAK+DGP +LGW+HPW+
Sbjct  5    RARMGPPKYAPHPNHPIHVHPVRPLYRFMATGLGASMWFFLMYRAKKDGPALLGWKHPWD  64



>ref|XP_003709666.1| hypothetical protein MGG_06927 [Magnaporthe oryzae 70-15]
 gb|EHA57054.1| hypothetical protein MGG_06927 [Magnaporthe oryzae 70-15]
 gb|ELQ43599.1| hypothetical protein OOU_Y34scaffold00140g7 [Magnaporthe oryzae 
Y34]
 gb|ELQ67207.1| hypothetical protein OOW_P131scaffold00328g7 [Magnaporthe oryzae 
P131]
Length=68

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  174  HTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            +   G  L A MWF+++YRAK+DGPV+LGW+HPW+
Sbjct  33   YRFAGTALSASMWFFLMYRAKKDGPVLLGWKHPWD  67



>ref|XP_009658328.1| hypothetical protein VDAG_08308 [Verticillium dahliae VdLs.17]
 gb|EGY17974.1| hypothetical protein VDAG_08308 [Verticillium dahliae VdLs.17]
Length=56

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  162  PKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            P R H   G  L A MWF+++YRAK+DG V+LGW+HPW+
Sbjct  17   PLRIHNFVGTALGAGMWFFLMYRAKKDGAVLLGWKHPWD  55



>ref|XP_004991758.1| hypothetical protein PTSG_07955 [Salpingoeca rosetta]
 gb|EGD75837.1| hypothetical protein PTSG_07955 [Salpingoeca rosetta]
Length=92

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  141  KGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGND  302
            + +T  +P   ++    G+ AVMWFWIL+RAK D P +LG+ HPW+   +HG++
Sbjct  36   ESVTPIEPSPMYSYAATGMGAVMWFWILWRAKHDLPHLLGFEHPWDHLHEHGDE  89



>ref|XP_008611529.1| hypothetical protein SDRG_07473 [Saprolegnia diclina VS20]
 gb|EQC35245.1| hypothetical protein SDRG_07473 [Saprolegnia diclina VS20]
 gb|KDO19175.1| hypothetical protein SPRG_14786 [Saprolegnia parasitica CBS 223.65]
Length=105

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 31/59 (53%), Gaps = 1/59 (2%)
 Frame = +3

Query  99   RSEMGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            RS    GHGHG    G+  H     H   G     + W WI YRAK+DG VVLGW HPW
Sbjct  16   RSMASHGHGHGSYPHGMHFHVDPV-HKALGTAFGTLTWLWIFYRAKEDGAVVLGWEHPW  73



>ref|XP_007727471.1| hypothetical protein A1O1_08419 [Capronia coronata CBS 617.96]
 gb|EXJ80277.1| hypothetical protein A1O1_08419 [Capronia coronata CBS 617.96]
Length=57

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  153  IHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I+QP+  +     GL A MWF+++YRAK+DGP ++G +HPW+
Sbjct  15   INQPRPLYRFAATGLGAAMWFFLMYRAKKDGPALIGLKHPWD  56



>emb|CDI54575.1| conserved hypothetical protein [Melanopsichium pennsylvanicum 
4]
Length=77

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +3

Query  144  GITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            G   HQP   H  + K L A MWFWI YRAKQDG V+LG +HPW
Sbjct  19   GFHPHQPAFKHRWSAKLLGATMWFWIFYRAKQDGAVLLGLKHPW  62



>ref|XP_003008339.1| predicted protein [Verticillium alfalfae VaMs.102]
 gb|EEY13913.1| predicted protein [Verticillium alfalfae VaMs.102]
Length=56

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  162  PKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            P R H   G  L A MWF+++YRAK+DG V+LGW+HPW+
Sbjct  17   PLRVHNFVGTALGAGMWFFLMYRAKKDGAVLLGWKHPWD  55



>gb|EMS22795.1| hypothetical protein RHTO_08148 [Rhodosporidium toruloides NP11]
 emb|CDR45063.1| RHTO0S10e04676g1_1 [Rhodosporidium toruloides]
Length=56

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 30/54 (56%), Gaps = 0/54 (0%)
 Frame = +3

Query  117  GHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
             HG      G     P   H +  K L A MWF+I YRA+QDG V+LG RHPWE
Sbjct  2    AHGRPTPAGGFYPSLPGLGHRMAAKLLGASMWFFIFYRARQDGAVLLGLRHPWE  55



>gb|EXV05103.1| hypothetical protein X797_002790 [Metarhizium robertsii]
Length=95

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  174  HTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            + +T   L A MWFW++YRAK+DGPV++GW+HPW+
Sbjct  60   YRLTATALGAGMWFWLMYRAKKDGPVLMGWKHPWD  94



>ref|XP_008717062.1| hypothetical protein HMPREF1541_04495 [Cyphellophora europaea 
CBS 101466]
 gb|ETN40219.1| hypothetical protein HMPREF1541_04495 [Cyphellophora europaea 
CBS 101466]
Length=62

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 35/61 (57%), Gaps = 4/61 (7%)
 Frame = +3

Query  108  MGDGHGHGVTYKGI----TIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            M    G   T+KG      I   + ++     GL A MWF++ YRAK+DGP +LGW+HPW
Sbjct  1    MAQSAGGKTTWKGNHPVGQIAAARPFYRFAATGLGAAMWFFLFYRAKKDGPALLGWKHPW  60

Query  276  E  278
            +
Sbjct  61   D  61



>ref|XP_001542937.1| predicted protein [Histoplasma capsulatum NAm1]
 gb|EDN06505.1| predicted protein [Histoplasma capsulatum NAm1]
 gb|EEH10536.1| conserved hypothetical protein [Histoplasma capsulatum G186AR]
 gb|EER40846.1| conserved hypothetical protein [Histoplasma capsulatum H143]
 gb|EGC45054.1| conserved hypothetical protein [Histoplasma capsulatum H88]
Length=51

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I +   +  +      L A MWF+++YRAK+DGPV+LGW+HPWE
Sbjct  7    IQVRATRPLYRFAATALGASMWFFLMYRAKKDGPVLLGWKHPWE  50



>ref|XP_006967747.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR46477.1| predicted protein [Trichoderma reesei QM6a]
 gb|EHK49743.1| hypothetical protein TRIATDRAFT_82911 [Trichoderma atroviride 
IMI 206040]
 gb|ETR99431.1| hypothetical protein M419DRAFT_86223 [Trichoderma reesei RUT 
C-30]
Length=50

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  174  HTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            + VT   L A MWFW++YRAK+DGP +LGW+HPW+
Sbjct  15   YRVTATALGAGMWFWLMYRAKKDGPALLGWKHPWD  49



>ref|XP_007755718.1| hypothetical protein A1O7_03509 [Cladophialophora yegresii CBS 
114405]
 gb|EXJ63064.1| hypothetical protein A1O7_03509 [Cladophialophora yegresii CBS 
114405]
Length=63

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  153  IHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I+   R + V   GL A MWF++ YR K+DGP +LGW+HPW+
Sbjct  21   INAAPRLYRVAATGLGAAMWFFLFYRMKKDGPALLGWKHPWD  62



>gb|KEQ76219.1| hypothetical protein M436DRAFT_79472 [Aureobasidium pullulans 
var. namibiae CBS 147.97]
Length=60

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I IH  +  +     GL A MWF+++YRA++DGP +LGW+HPW+
Sbjct  16   IHIHPVRPLYRFAATGLGASMWFFLMYRARKDGPALLGWKHPWD  59



>ref|XP_002849002.1| conserved hypothetical protein [Arthroderma otae CBS 113480]
 gb|EEQ29117.1| conserved hypothetical protein [Arthroderma otae CBS 113480]
 gb|KDB24879.1| hypothetical protein H109_03307 [Trichophyton interdigitale MR816]
Length=53

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  174  HTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            +      L A MWFW++YRAK+DGPV+LGW+HPW+
Sbjct  18   YRFAATALGASMWFWLMYRAKKDGPVLLGWKHPWD  52



>ref|XP_009222246.1| hypothetical protein GGTG_06168 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
 gb|EJT76246.1| hypothetical protein GGTG_06168 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
Length=54

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 1/46 (2%)
 Frame = +3

Query  141  KGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            KG     P  +  V G  L A MWF+++YRAK+DGPV+LGW+HPW+
Sbjct  9    KGALYRAPPVYRFV-GTALGASMWFFLMYRAKKDGPVLLGWKHPWD  53



>gb|KEQ61786.1| hypothetical protein M437DRAFT_35703, partial [Aureobasidium 
melanogenum CBS 110374]
Length=50

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I IH  +  +     GL A MWF+++YRA++DGP +LGW+HPW+
Sbjct  6    IHIHPVRPLYRFAATGLGASMWFFLMYRARKDGPALLGWKHPWD  49



>ref|XP_008600541.1| hypothetical protein BBA_07222 [Beauveria bassiana ARSEF 2860]
 gb|EJP63898.1| hypothetical protein BBA_07222 [Beauveria bassiana ARSEF 2860]
Length=50

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  174  HTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            + +T   L A MWFW++YRAK+DGPV++GW+HPW+
Sbjct  15   YRLTATALGAGMWFWLMYRAKKDGPVLMGWKHPWD  49



>ref|XP_004364435.1| hypothetical protein CAOG_01567 [Capsaspora owczarzaki ATCC 30864]
 gb|EFW43523.1| hypothetical protein CAOG_01567 [Capsaspora owczarzaki ATCC 30864]
Length=65

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  165  KRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGNDH  305
            K WH   GK + A MWFW+ +R ++DG V+LG+R  WE  G HG+ H
Sbjct  11   KTWHHYAGKLMGATMWFWVFHRLREDGDVLLGYRKAWEHKGHHGSHH  57



>gb|AFR95150.2| hypothetical protein CNAG_00997 [Cryptococcus neoformans var. 
grubii H99]
Length=87

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +3

Query  156  HQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            H P   H    K L A MWF+I YRA+QDGP ++G RHPW
Sbjct  37   HPPSLLHRGLAKALGASMWFFIFYRARQDGPALIGLRHPW  76



>gb|EPB81264.1| hypothetical protein HMPREF1544_12030 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=65

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  174  HTVTGKGLCAVMWFWILYRAKQDGPVVLGWR  266
            H   GK L A MWFW++YRAKQDGPV+LGWR
Sbjct  20   HRFVGKALGATMWFWMMYRAKQDGPVLLGWR  50



>ref|XP_002482415.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500]
 gb|EED18423.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500]
Length=51

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I +H  +  +      L A MWF+++YRAK+DGP +LGW+HPW+
Sbjct  7    IHVHPARPLYRFAATALGASMWFFLMYRAKKDGPALLGWKHPWD  50



>ref|XP_007403965.1| hypothetical protein MELLADRAFT_32222 [Melampsora larici-populina 
98AG31]
 gb|EGG13027.1| hypothetical protein MELLADRAFT_32222 [Melampsora larici-populina 
98AG31]
Length=72

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 31/56 (55%), Gaps = 4/56 (7%)
 Frame = +3

Query  135  TYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGND  302
            TY G   H P RW     K L A MWF++ YR ++DG  V   RHPW    DHG+D
Sbjct  15   TYGGFHPHPPTRWQRGAAKALGATMWFFMFYRIREDGQQVFLGRHPW----DHGHD  66



>ref|XP_007874927.1| hypothetical protein PNEG_02890 [Pneumocystis murina B123]
 gb|EMR08712.1| hypothetical protein PNEG_02890 [Pneumocystis murina B123]
Length=58

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  144  GITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGH  284
            GI  H P + + V  + L A MWF++LYR K+DGP++LG ++PWE H
Sbjct  6    GIHFHPPPKSYIVISQLLGASMWFFMLYRMKKDGPIILGLKNPWENH  52



>gb|ESA42635.1| questionable protein [Neurospora crassa OR74A]
 gb|ESA42636.1| questionable protein, variant [Neurospora crassa OR74A]
 gb|KHE79989.1| hypothetical protein GE21DRAFT_8068 [Neurospora crassa]
Length=83

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 40/81 (49%), Gaps = 14/81 (17%)
 Frame = +3

Query  78   CGEERDRRSEMGDGHGHGVTYKGITIHQ--------------PKRWHTVTGKGLCAVMWF  215
             G+    R    D + HG  ++  T+HQ               K  +     GL A MWF
Sbjct  2    AGDGEFERVPRPDNYPHGPEFQPRTLHQRLQGKWWYRVPPNHSKPIYQFLSIGLGASMWF  61

Query  216  WILYRAKQDGPVVLGWRHPWE  278
            WI+YRAK+DG V+LG +HPW+
Sbjct  62   WIMYRAKKDGAVLLGLKHPWD  82



>gb|ETS64079.1| hypothetical protein PaG_01313 [Pseudozyma aphidis DSM 70725]
Length=276

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +3

Query  144  GITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            G   H P   H    K L A MWFWI YRAKQDGPV+LG +HPW
Sbjct  218  GFAPHPPAFKHRWGAKLLGATMWFWIFYRAKQDGPVLLGLKHPW  261



>ref|XP_002148160.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224]
 gb|EEA24649.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224]
Length=51

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I +H  +  +      L A MWF+++YRAK+DGP +LGW+HPW+
Sbjct  7    IHVHPARPIYRFAATALGASMWFFLMYRAKKDGPALLGWKHPWD  50



>ref|XP_008079189.1| hypothetical protein GLAREA_07050 [Glarea lozoyensis ATCC 20868]
 gb|EPE34037.1| hypothetical protein GLAREA_07050 [Glarea lozoyensis ATCC 20868]
Length=58

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  174  HTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            +     GL A MWF+++YRAK+DGPV+LGW+HPW+
Sbjct  23   YRFMATGLGASMWFFLMYRAKKDGPVLLGWKHPWD  57



>ref|XP_002621819.1| conserved hypothetical protein [Blastomyces dermatitidis SLH14081]
 gb|EEQ73444.1| conserved hypothetical protein [Blastomyces dermatitidis SLH14081]
 gb|EEQ90218.1| conserved hypothetical protein [Blastomyces dermatitidis ER-3]
 gb|EGE86349.1| hypothetical protein BDDG_09294 [Blastomyces dermatitidis ATCC 
18188]
Length=51

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I +   +  +      L A MWF+++YRAK+DGP +LGW+HPWE
Sbjct  7    IQVRPSRPLYRFAATALGASMWFFLMYRAKKDGPALLGWKHPWE  50



>gb|EPT02618.1| hypothetical protein FOMPIDRAFT_1047682 [Fomitopsis pinicola 
FP-58527 SS1]
Length=68

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 28/48 (58%), Gaps = 0/48 (0%)
 Frame = +3

Query  144  GITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHG  287
            G   H P   H      L A MWF+I YRA++DG  +LG  HPWEGHG
Sbjct  9    GFHPHLPAFKHRFLATTLGASMWFFIFYRARKDGAKLLGLSHPWEGHG  56



>ref|XP_001555384.1| hypothetical protein BC1G_06089 [Botrytis cinerea B05.10]
Length=53

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 6/52 (12%)
 Frame = +3

Query  123  GHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            G G  Y+   I++        G  L A MWF+++YRAK+DGP +LGW+HPW+
Sbjct  7    GPGGLYRAPPIYR------FAGTALGASMWFFLMYRAKKDGPALLGWKHPWD  52



>ref|XP_009157993.1| hypothetical protein HMPREF1120_05564 [Exophiala dermatitidis 
NIH/UT8656]
 gb|EHY57532.1| hypothetical protein HMPREF1120_05564 [Exophiala dermatitidis 
NIH/UT8656]
Length=57

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  153  IHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I+Q +  + V   GL A MWF+++YRAK+DGP ++G +HPW+
Sbjct  15   INQTRPLYRVAATGLGAAMWFFLMYRAKKDGPALIGLKHPWD  56



>emb|CCF50617.1| uncharacterized protein UHOR_05859 [Ustilago hordei]
Length=81

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +3

Query  144  GITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            G   HQP   H    K L A MWFWI YRAKQDG V+LG +HPW
Sbjct  20   GFHPHQPAFKHRWGAKLLGATMWFWIFYRAKQDGAVLLGLKHPW  63



>emb|CBQ68468.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
Length=84

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +3

Query  144  GITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            G   HQP   H    K L A MWFWI YRAKQDG V+LG +HPW
Sbjct  19   GFHPHQPAFKHRWGAKLLGATMWFWIFYRAKQDGAVLLGLKHPW  62



>gb|EKV05188.1| hypothetical protein PDIG_84540 [Penicillium digitatum PHI26]
 gb|EKV19734.1| hypothetical protein PDIP_22200 [Penicillium digitatum Pd1]
Length=53

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  129  GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            G +   I IH  +  +  T   L A MWF+++YRAK+DG  +LGW+HPW+
Sbjct  3    GNSSHPIHIHPVRPLYRFTATALGASMWFFLMYRAKKDGAALLGWKHPWD  52



>gb|ERT02343.1| hypothetical protein HMPREF1624_00641 [Sporothrix schenckii ATCC 
58251]
Length=51

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  174  HTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            +  T   L A MWF+++YRAK+DGP ++GW+HPWE
Sbjct  16   YRFTATALGASMWFFLMYRAKKDGPALMGWKHPWE  50



>gb|KGB74739.1| hypothetical protein CNBG_0577 [Cryptococcus gattii R265]
Length=61

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = +3

Query  141  KGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
             G   H P   H    K L A MWF+I YRA+QDGP ++G RHPW
Sbjct  4    PGFHPHPPSLLHRGLAKALGAGMWFFIFYRARQDGPALIGLRHPW  48



>gb|EST08082.1| hypothetical protein PSEUBRA_SCAF19g03301 [Pseudozyma brasiliensis 
GHG001]
Length=76

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = +3

Query  144  GITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            G   HQP   H    K L A MWFWI YRAK DG V+LG +HPW
Sbjct  19   GFAPHQPAFKHRWGAKLLGATMWFWIFYRAKNDGAVLLGLKHPW  62



>gb|ACZ81440.1| CND01250 [Kwoniella heveanensis]
Length=59

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  156  HQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            H P   H    K L A MWF+I YRA+QDGP ++G RHPW+
Sbjct  8    HPPSLLHRGLAKALGAGMWFFIFYRARQDGPALIGLRHPWD  48



>ref|XP_005847834.1| hypothetical protein CHLNCDRAFT_57885 [Chlorella variabilis]
 gb|EFN55732.1| hypothetical protein CHLNCDRAFT_57885 [Chlorella variabilis]
Length=115

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 2/53 (4%)
 Frame = +3

Query  90   RDRRSEMGDGHGH--GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQD  242
            +  R     GHGH   VT++G+TIH+   WH  TG+G   +MWFW+LYR   D
Sbjct  34   QQTRGFAAGGHGHHDSVTHEGLTIHKAASWHKYTGQGFAGLMWFWVLYRFYHD  86



>gb|EPS27379.1| hypothetical protein PDE_02322 [Penicillium oxalicum 114-2]
Length=53

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I IH  +  +  T   L A MWF+++YRAK+DG  +LGW+HPW+
Sbjct  9    IHIHPVRPLYRFTATALGASMWFFLMYRAKKDGAALLGWKHPWD  52



>ref|XP_007784922.1| hypothetical protein W97_08865 [Coniosporium apollinis CBS 100218]
 gb|EON69605.1| hypothetical protein W97_08865 [Coniosporium apollinis CBS 100218]
Length=60

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            + IH  +  +     GL A MWF+++YRA++DG  ++GWRHPWE
Sbjct  16   VHIHPARPLYRFFATGLGASMWFFLMYRARKDGAALMGWRHPWE  59



>gb|EFQ28156.1| hypothetical protein GLRG_03300 [Colletotrichum graminicola M1.001]
Length=51

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  174  HTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            +  T   L A MWF+++YRAK+DGPV+LGW+HPW+
Sbjct  16   YRFTATALGAGMWFFLMYRAKKDGPVLLGWKHPWD  50



>emb|CCF46611.1| hypothetical protein CH063_03912 [Colletotrichum higginsianum]
Length=51

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  174  HTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            +  T   L A MWF+++YRAK+DGPV+LGW+HPW+
Sbjct  16   YRFTATALGAGMWFFLMYRAKKDGPVLLGWKHPWD  50



>gb|KGO37679.1| hypothetical protein PEX1_056590 [Penicillium expansum]
 gb|KGO39908.1| hypothetical protein PEXP_032910 [Penicillium expansum]
 gb|KGO55049.1| hypothetical protein PEX2_086280 [Penicillium expansum]
Length=86

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  129  GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            G +   I IH  +  +  T   L A MWF+++YRAK+DG  +LGW+HPW+
Sbjct  36   GNSSHPIHIHPVRPLYRFTATALGASMWFFLMYRAKKDGAALLGWKHPWD  85



>ref|XP_002837262.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ81453.1| unnamed protein product [Tuber melanosporum]
Length=51

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I IH  +  + V+ K L A MWF+++YRAK+DG V LG +HPW+
Sbjct  7    IHIHPVRPLYAVSAKLLGASMWFFLMYRAKKDGAVFLGLKHPWD  50



>gb|KGO73144.1| hypothetical protein PITC_003330 [Penicillium italicum]
Length=115

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  129  GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            G +   I IH  +  +  T   L A MWF+++YRAK+DG  +LGW+HPW+
Sbjct  65   GNSSHPIHIHPVRPLYRFTATALGASMWFFLMYRAKKDGAALLGWKHPWD  114



>gb|EJK59962.1| hypothetical protein THAOC_19761 [Thalassiosira oceanica]
Length=124

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 3/48 (6%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGD  290
            + + QP   H   G+    + W WI YRAKQD PVVLGWRHPWE   D
Sbjct  37   LEVSQP---HHYLGEACGFLTWMWIFYRAKQDLPVVLGWRHPWEHAED  81



>gb|EQB54437.1| hypothetical protein CGLO_05742 [Colletotrichum gloeosporioides 
Cg-14]
Length=51

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  183  TGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            T   L A MWF+++YRAK+DGPV+LGW+HPW+
Sbjct  19   TATALGAGMWFFLMYRAKKDGPVLLGWKHPWD  50



>gb|EXX70959.1| hypothetical protein RirG_082750 [Rhizophagus irregularis DAOM 
197198w]
Length=68

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +3

Query  162  PKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGNDH  305
            P R H    K     M FW+LYR K++ PVVLG RHPWE HG H N H
Sbjct  13   PGRAHVFISKLFGGSMAFWMLYRGKKELPVVLGLRHPWEHHG-HENGH  59



>gb|EIE91326.1| hypothetical protein RO3G_16037 [Rhizopus delemar RA 99-880]
Length=61

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +3

Query  156  HQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWR  266
            H P   H   GK L A MWFW++YRAK+DGPV+LG R
Sbjct  11   HLPGFTHRFVGKALGATMWFWMMYRAKEDGPVLLGLR  47



>ref|XP_002293074.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED89535.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=149

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 39/77 (51%), Gaps = 8/77 (10%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGNDH*MSGSKH  326
            +++ QP   HT+ G+      W W+ YRAK D PVVLG RHPWE    HG D   + S H
Sbjct  51   MSVSQP---HTIAGEVCGFFTWLWVFYRAKHDLPVVLGMRHPWE----HGEDP-WAISDH  102

Query  327  EGNMNNLTELWLILGMK  377
              N+  L   W     K
Sbjct  103  VDNLEELQGDWEEFAEK  119



>gb|EIE91067.1| hypothetical protein RO3G_15778 [Rhizopus delemar RA 99-880]
Length=60

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +3

Query  156  HQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWR  266
            H P   H   GK L A MWFW++YRAK+DGPV+LG R
Sbjct  10   HLPGFTHRFVGKALGATMWFWMMYRAKEDGPVLLGLR  46



>ref|XP_002544526.1| predicted protein [Uncinocarpus reesii 1704]
 gb|EEP79197.1| predicted protein [Uncinocarpus reesii 1704]
Length=51

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I +   +  +      L A MWF++ YRAK+DGP +LGW+HPW+
Sbjct  7    IQVPPARPLYKFAATALGASMWFFLFYRAKKDGPALLGWKHPWD  50



>ref|XP_006669146.1| hypothetical protein CCM_03935 [Cordyceps militaris CM01]
 gb|EGX92562.1| hypothetical protein CCM_03935 [Cordyceps militaris CM01]
Length=99

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  174  HTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            + +T   L A MWFW++YRAK+DG V++GW+HPW+
Sbjct  64   YRLTATALGAGMWFWLMYRAKKDGAVLMGWKHPWD  98



>ref|XP_007738930.1| hypothetical protein A1O5_00120 [Cladophialophora psammophila 
CBS 110553]
 gb|EXJ75613.1| hypothetical protein A1O5_00120 [Cladophialophora psammophila 
CBS 110553]
Length=57

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +3

Query  153  IHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I+    ++     GL A MWF++ YRAKQDGP +LG +HPW+
Sbjct  15   INAAPPFYRYCATGLGAAMWFFLFYRAKQDGPALLGLKHPWD  56



>ref|XP_007296128.1| hypothetical protein MBM_08239 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD13521.1| hypothetical protein MBM_08239 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=55

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +3

Query  123  GHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            G G     + +   +  +      L A MWF+++YRAK+DGP +LGW+HPW+
Sbjct  3    GPGPATHPVQVPPVRPLYRFAATTLGASMWFFLMYRAKKDGPALLGWKHPWD  54



>ref|XP_009265890.1| NADH dehydrogenase 1 beta subcomplex subunit 2 [Wallemia ichthyophaga 
EXF-994]
 gb|EOR04867.1| NADH dehydrogenase 1 beta subcomplex subunit 2 [Wallemia ichthyophaga 
EXF-994]
Length=57

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 29/51 (57%), Gaps = 2/51 (4%)
 Frame = +3

Query  153  IHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGNDH  305
             H P  +H      L A MWFW+ Y+A+QD P +LGW  P+E   DH  +H
Sbjct  8    FHAPPAFHRFASTALGASMWFWVFYKARQDLPHMLGWHLPFE--HDHDEEH  56



>ref|XP_007766705.1| hypothetical protein CONPUDRAFT_151779 [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW82722.1| hypothetical protein CONPUDRAFT_151779 [Coniophora puteana RWD-64-598 
SS2]
Length=66

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +3

Query  144  GITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            G   H P R +    K L A MWF+I YRA++DGP +LG RHPW
Sbjct  9    GFHPHLPGRGYNFMAKALGATMWFFIFYRAREDGPKLLGLRHPW  52



>ref|XP_002178561.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC50226.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=123

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +3

Query  174  HTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHGDHGNDH  305
            HT+ G+    V W WI +RA+ D PVVLG+RHPWE   D  + H
Sbjct  41   HTMWGEAFGTVCWLWIFHRARHDLPVVLGFRHPWEHAEDPFSPH  84



>tpe|CBF77847.1| TPA: hypothetical protein ANIA_11137 [Aspergillus nidulans FGSC 
A4]
Length=51

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I IH  + ++      L A MWF+++YRAK+DGP +LGW+HPW+
Sbjct  7    IHIHPARPFYRFAATALGASMWFFLMYRAKKDGPALLGWKHPWD  50



>gb|EMF11904.1| hypothetical protein SEPMUDRAFT_46938, partial [Sphaerulina musiva 
SO2202]
Length=50

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I IH  +  +     GL A MWF++ YRA+ D PV+LG RHPW+
Sbjct  6    IHIHPARPLYRFAAVGLGASMWFFLFYRARYDLPVLLGMRHPWD  49



>gb|EUC58730.1| transmembrane protein, putative [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KEP53279.1| putative transmembrane protein [Rhizoctonia solani 123E]
Length=66

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 28/51 (55%), Gaps = 1/51 (2%)
 Frame = +3

Query  129  GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEG  281
            G    G   H P   H    K L A MWF+I YRAKQDGP +LG  HPWE 
Sbjct  3    GPAGPGFHPHPPGFGHRFLAKTLGATMWFFIFYRAKQDGPKLLG-AHPWEA  52



>gb|KFH46308.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit-like 
protein [Acremonium chrysogenum ATCC 11550]
Length=25

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +3

Query  207  MWFWILYRAKQDGPVVLGWRHPWE  278
            MWFW++YRAK+DGPV++GW+HPW+
Sbjct  1    MWFWLMYRAKKDGPVLMGWKHPWD  24



>ref|XP_003343844.1| hypothetical protein SMAC_04503 [Sordaria macrospora k-hell]
 emb|CCC10658.1| unnamed protein product [Sordaria macrospora k-hell]
Length=95

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  192  GLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            GL A MWFWI+YRAK+DG V+LG +HPW+
Sbjct  66   GLGASMWFWIMYRAKKDGAVLLGLKHPWD  94



>ref|XP_570291.1| hypothetical protein CND01250 [Cryptococcus neoformans var. neoformans 
JEC21]
 ref|XP_775776.1| hypothetical protein CNBD5050 [Cryptococcus neoformans var. neoformans 
B-3501A]
 ref|XP_003193515.1| hypothetical protein CGB_D3480C [Cryptococcus gattii WM276]
 gb|EAL21129.1| hypothetical protein CNBD5050 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW42984.1| hypothetical protein CND01250 [Cryptococcus neoformans var. neoformans 
JEC21]
 gb|ADV21728.1| hypothetical protein CND01250 [Cryptococcus gattii WM276]
Length=61

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = +3

Query  144  GITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            G   H P   H    K L A MWF+I YRA+QDGP ++G RHPW
Sbjct  5    GFHPHPPSLLHRGLAKALGASMWFFIFYRARQDGPALIGLRHPW  48



>gb|KEY66545.1| hypothetical protein S7711_08048 [Stachybotrys chartarum IBT 
7711]
 gb|KFA47102.1| hypothetical protein S40293_04580 [Stachybotrys chartarum IBT 
40293]
 gb|KFA62630.1| hypothetical protein S40285_05168 [Stachybotrys chlorohalonata 
IBT 40285]
 gb|KFA71366.1| hypothetical protein S40288_08229 [Stachybotrys chartarum IBT 
40288]
Length=50

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  174  HTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            + +T   L A MWF++ YRA++DGPV+LG +HPW+
Sbjct  15   YRITATALGAGMWFFLFYRARKDGPVLLGLKHPWD  49



>ref|XP_007863933.1| hypothetical protein GLOTRDRAFT_38235, partial [Gloeophyllum 
trabeum ATCC 11539]
 gb|EPQ57334.1| hypothetical protein GLOTRDRAFT_38235, partial [Gloeophyllum 
trabeum ATCC 11539]
Length=64

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 26/48 (54%), Gaps = 0/48 (0%)
 Frame = +3

Query  144  GITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGHG  287
            G   H P   H    K L A MWF+I YRA+ DG  +L   HPWE HG
Sbjct  1    GFHPHLPGFRHQFLAKALGATMWFFIFYRARCDGAKLLMLSHPWETHG  48



>gb|EYE99534.1| hypothetical protein EURHEDRAFT_407505, partial [Aspergillus 
ruber CBS 135680]
Length=51

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I IH  +  +  T   L A MWF+++YRAK+DGP +LG +HPW+
Sbjct  7    IHIHPARPLYRFTATALGASMWFFLMYRAKKDGPALLGLKHPWD  50



>ref|XP_001830335.1| hypothetical protein CC1G_01971 [Coprinopsis cinerea okayama7#130]
 gb|EAU91482.1| hypothetical protein CC1G_01971 [Coprinopsis cinerea okayama7#130]
Length=56

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +3

Query  129  GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            G    G   H P + +T  G  L A MWF+I YRA+QDG  +LG +HPW+
Sbjct  4    GPRAPGFHPHLPGKGYTFLGTALGATMWFFIFYRARQDGAKLLG-KHPWD  52



>ref|XP_007361749.1| hypothetical protein DICSQDRAFT_51219, partial [Dichomitus squalens 
LYAD-421 SS1]
 gb|EJF65113.1| hypothetical protein DICSQDRAFT_51219, partial [Dichomitus squalens 
LYAD-421 SS1]
Length=64

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 0/44 (0%)
 Frame = +3

Query  144  GITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            G   H P   H +    L A MWF+I YRA++DG  +LG +HPW
Sbjct  3    GFNPHLPGFKHRILATTLGATMWFFIFYRARKDGAKLLGLKHPW  46



>ref|XP_005712436.1| unnamed protein product [Chondrus crispus]
 emb|CDF32665.1| unnamed protein product [Chondrus crispus]
Length=77

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 26/49 (53%), Gaps = 0/49 (0%)
 Frame = +3

Query  129  GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            G  Y G     P  W +  G  +   MW WI YR K+D P +LGW+HPW
Sbjct  12   GKPYGGFKPVPPAAWQSRVGYVMGVSMWLWIFYRGKKDLPHLLGWKHPW  60



>gb|EME43647.1| hypothetical protein DOTSEDRAFT_72868 [Dothistroma septosporum 
NZE10]
Length=67

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +3

Query  147  ITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I +H  +  +     GL A MWF++ YRA+ D PV+LG++HPW+
Sbjct  23   IHVHPVRPLYRFAAVGLGASMWFFLFYRARTDLPVLLGFKHPWD  66



>ref|XP_002789380.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' 
Pb01]
Length=51

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  195  LCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            L A MWF+++YRAK+DGP +LGW+HPWE
Sbjct  23   LGASMWFFLMYRAKKDGPALLGWKHPWE  50



>ref|XP_007374348.1| hypothetical protein SPAPADRAFT_137450 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW32833.1| hypothetical protein SPAPADRAFT_137450 [Spathaspora passalidarum 
NRRL Y-27907]
Length=60

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +3

Query  183  TGKGLCAVMWFWILYRAKQDGPVVLGWRHPWEGH  284
            T K   A MWFWILYR K+DGPV+ GW+ P E H
Sbjct  27   TAKLSGAAMWFWILYRVKEDGPVMFGWKLPHEHH  60



>ref|XP_387641.1| hypothetical protein FG07465.1 [Fusarium graminearum PH-1]
 ref|XP_009260820.1| hypothetical protein FPSE_09428 [Fusarium pseudograminearum CS3096]
 gb|EGU87252.1| hypothetical protein FOXB_02234 [Fusarium oxysporum Fo5176]
 gb|EKJ70434.1| hypothetical protein FPSE_09428 [Fusarium pseudograminearum CS3096]
 gb|EMT64951.1| hypothetical protein FOC4_g10010925 [Fusarium oxysporum f. sp. 
cubense race 4]
 emb|CCT65508.1| uncharacterized protein FFUJ_02456 [Fusarium fujikuroi IMI 58289]
 gb|ESU13731.1| hypothetical protein FGSG_07465 [Fusarium graminearum PH-1]
 gb|EWG47751.1| hypothetical protein FVEG_07793 [Fusarium verticillioides 7600]
 gb|EWY99612.1| hypothetical protein FOYG_03607 [Fusarium oxysporum FOSC 3-a]
 gb|EWY99613.1| hypothetical protein FOYG_03607 [Fusarium oxysporum FOSC 3-a]
 gb|EWZ45640.1| hypothetical protein FOZG_05898 [Fusarium oxysporum Fo47]
 gb|EWZ45641.1| hypothetical protein FOZG_05898 [Fusarium oxysporum Fo47]
 gb|EWZ97542.1| hypothetical protein FOWG_01985 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EWZ97543.1| hypothetical protein FOWG_01985 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA50911.1| hypothetical protein FOVG_03433 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXA50912.1| hypothetical protein FOVG_03433 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXK43050.1| hypothetical protein FOMG_05745 [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK43051.1| hypothetical protein FOMG_05745 [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK99701.1| hypothetical protein FOQG_00138 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXK99702.1| hypothetical protein FOQG_00138 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL62990.1| hypothetical protein FOCG_01403 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL62991.1| hypothetical protein FOCG_01403 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL79671.1| hypothetical protein FOPG_06458 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXL79672.1| hypothetical protein FOPG_06458 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXM07704.1| hypothetical protein FOIG_02664 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM07705.1| hypothetical protein FOIG_02664 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM35704.1| hypothetical protein FOTG_00126 [Fusarium oxysporum f. sp. vasinfectum 
25433]
 gb|EXM35705.1| hypothetical protein FOTG_00126 [Fusarium oxysporum f. sp. vasinfectum 
25433]
 gb|EYB27504.1| hypothetical protein FG05_07465 [Fusarium graminearum]
 emb|CEF82865.1| unnamed protein product [Fusarium graminearum]
Length=59

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 34/57 (60%), Gaps = 4/57 (7%)
 Frame = +3

Query  117  GHGH---GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            GHGH       K    H P R +  T   L A MWF+++YRAK+DG V+LG +HPW+
Sbjct  3    GHGHHSFNGPPKPPVAHVP-RIYRFTATALGAGMWFFLMYRAKKDGAVLLGLKHPWD  58



>ref|XP_007328586.1| hypothetical protein AGABI1DRAFT_99159 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM81072.1| hypothetical protein AGABI1DRAFT_99159 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=60

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 34/57 (60%), Gaps = 3/57 (5%)
 Frame = +3

Query  129  GVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW--EGHGDH  293
            G +  G   H P   +T   KGL A+MWF+I YRA+QDG  ++G RHP   + HG H
Sbjct  4    GGSSPGFHPHLPGFRYTFLSKGLGAMMWFFIFYRARQDGAKLIG-RHPVADDSHGSH  59



>gb|KEF61754.1| hypothetical protein A1O9_03324 [Exophiala aquamarina CBS 119918]
Length=62

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +3

Query  153  IHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            I+  +  +     GL A MWF++ YRAKQDG  +LG +HPW+
Sbjct  20   INPQRPLYRFAATGLGAAMWFFLFYRAKQDGAALLGLKHPWD  61



>ref|XP_002501940.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63198.1| predicted protein [Micromonas sp. RCC299]
Length=102

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  96   RRSEMGDGHGHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVL  257
            R++    G G+GVT++G+T+H+P  +H     GL  + WFW+ YR  +DG  ++
Sbjct  33   RQTRAMGGGGNGVTHEGLTLHEPGAFHKFWAYGLGGLTWFWVFYRFYKDGDTLI  86



>gb|EFW22819.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira]
Length=80

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +3

Query  165  KRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            +  +      L A MWF++ YRAK+DGP +LG +HPW+
Sbjct  42   RPLYKFAATALGASMWFFLFYRAKKDGPALLGLKHPWD  79



>ref|XP_008893231.1| hypothetical protein PPTG_01614 [Phytophthora parasitica INRA-310]
 gb|ETI45161.1| hypothetical protein F443_10146 [Phytophthora parasitica P1569]
 gb|ETK85130.1| hypothetical protein L915_09927 [Phytophthora parasitica]
 gb|ETL38549.1| hypothetical protein L916_09840 [Phytophthora parasitica]
 gb|ETL91675.1| hypothetical protein L917_09757 [Phytophthora parasitica]
 gb|ETM44981.1| hypothetical protein L914_09812 [Phytophthora parasitica]
 gb|ETN21437.1| hypothetical protein PPTG_01614 [Phytophthora parasitica INRA-310]
 gb|ETO73817.1| hypothetical protein F444_10243 [Phytophthora parasitica P1976]
 gb|ETP14970.1| hypothetical protein F441_10087 [Phytophthora parasitica CJ01A1]
 gb|ETP43055.1| hypothetical protein F442_10051 [Phytophthora parasitica P10297]
Length=141

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 35/70 (50%), Gaps = 6/70 (9%)
 Frame = +3

Query  99   RSEMGDGHGHGVTYK-GITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW  275
            R  M   HGHG  Y  G+  H     H         ++W W+ +RAKQDG  VLG+ HPW
Sbjct  17   RRAMSSAHGHGHNYPHGMHFHVSP-VHKNLALAYGTMLWLWVFWRAKQDGLAVLGFEHPW  75

Query  276  EGHGDHGNDH  305
                DHG+ H
Sbjct  76   ----DHGHSH  81



>ref|XP_001422738.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP01055.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=94

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = +3

Query  123  GHGVTYKGITIHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVL  257
            G GVT++G+T+H     H   G G  AVMWFW+ YR   DG  ++
Sbjct  35   GGGVTHEGVTLHDASFAHKALGTGFGAVMWFWVFYRFYHDGDTLI  79



>emb|CEJ94547.1| hypothetical protein VHEMI10070 [Torrubiella hemipterigena]
Length=50

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  174  HTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE  278
            + +T   L A MWFW++YRAK+DG V++G +HPW+
Sbjct  15   YRITATALGAGMWFWLMYRAKKDGAVLIGRKHPWD  49



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1067213240424