BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27579_g1_i1 len=1341 path=[1:0-1340]

Length=1341
                                                                      Score     E

ref|XP_009592593.1|  PREDICTED: grpE protein homolog, mitochondri...    328   4e-105   
ref|XP_011070018.1|  PREDICTED: grpE protein homolog, mitochondrial     317   1e-100   
ref|XP_002530954.1|  Protein grpE, putative                             315   7e-100   Ricinus communis
ref|XP_004249350.1|  PREDICTED: grpE protein homolog, mitochondrial     312   8e-99    
ref|XP_010036281.1|  PREDICTED: grpE protein homolog, mitochondri...    308   9e-98    
ref|XP_003520909.1|  PREDICTED: grpE protein homolog, mitochondri...    306   1e-96    
gb|KHN42170.1|  Protein grpE                                            305   1e-96    
ref|XP_009762578.1|  PREDICTED: grpE protein homolog, mitochondrial     303   2e-96    
gb|KDO46641.1|  hypothetical protein CISIN_1g019043mg                   298   2e-95    
ref|XP_008240630.1|  PREDICTED: grpE protein homolog, mitochondrial     301   7e-95    
ref|XP_010942073.1|  PREDICTED: grpE protein homolog, mitochondrial     300   9e-95    
ref|XP_008810324.1|  PREDICTED: grpE protein homolog, mitochondri...    298   1e-94    
ref|XP_006339226.1|  PREDICTED: grpE protein homolog, mitochondri...    301   2e-94    
ref|XP_007029907.1|  Co-chaperone GrpE family protein                   299   6e-94    
ref|XP_006484785.1|  PREDICTED: grpE protein homolog, mitochondri...    299   7e-94    
gb|KDO46639.1|  hypothetical protein CISIN_1g019043mg                   299   8e-94    
gb|KDP39624.1|  hypothetical protein JCGZ_02644                         298   1e-93    
ref|XP_002267243.1|  PREDICTED: grpE protein homolog, mitochondri...    298   2e-93    Vitis vinifera
ref|XP_010245792.1|  PREDICTED: grpE protein homolog, mitochondri...    297   2e-93    
ref|XP_010245791.1|  PREDICTED: uncharacterized protein LOC104589...    298   2e-93    
ref|XP_003554067.1|  PREDICTED: grpE protein homolog, mitochondri...    297   3e-93    
ref|XP_007202333.1|  hypothetical protein PRUPE_ppa008162mg             297   3e-93    
ref|XP_011047049.1|  PREDICTED: grpE protein homolog, mitochondri...    296   5e-93    
ref|XP_011047048.1|  PREDICTED: grpE protein homolog, mitochondri...    296   5e-93    
ref|XP_006437270.1|  hypothetical protein CICLE_v10031794mg             296   2e-92    
ref|XP_009380787.1|  PREDICTED: grpE protein homolog, mitochondri...    293   1e-91    
gb|EYU35657.1|  hypothetical protein MIMGU_mgv1a009214mg                293   2e-91    
ref|XP_008351439.1|  PREDICTED: LOW QUALITY PROTEIN: grpE protein...    290   2e-91    
ref|XP_002319738.1|  co-chaperone grpE family protein                   291   4e-91    Populus trichocarpa [western balsam poplar]
ref|XP_004493254.1|  PREDICTED: protein GrpE-like isoform X1            290   2e-90    
ref|XP_004493255.1|  PREDICTED: protein GrpE-like isoform X2            290   2e-90    
ref|XP_007161911.1|  hypothetical protein PHAVU_001G108000g             288   6e-90    
ref|XP_010549722.1|  PREDICTED: grpE protein homolog, mitochondri...    287   2e-89    
ref|XP_008455767.1|  PREDICTED: grpE protein homolog, mitochondrial     286   3e-89    
ref|XP_004144308.1|  PREDICTED: protein GrpE-like                       286   5e-89    
ref|XP_004157987.1|  PREDICTED: protein GrpE-like                       286   5e-89    
ref|XP_006829866.1|  hypothetical protein AMTR_s00119p00133730          281   4e-88    
gb|KHG05284.1|  Protein grpE                                            282   2e-87    
ref|XP_004287210.1|  PREDICTED: protein GrpE-like                       281   2e-87    
ref|XP_010687147.1|  PREDICTED: grpE protein homolog, mitochondri...    281   3e-87    
ref|XP_009353046.1|  PREDICTED: grpE protein homolog, mitochondrial     279   2e-86    
gb|EPS68474.1|  hypothetical protein M569_06295                         277   1e-85    
gb|EEE57358.1|  hypothetical protein OsJ_07499                          276   4e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003575340.1|  PREDICTED: grpE protein homolog, mitochondri...    275   4e-85    
gb|EEC73579.1|  hypothetical protein OsI_08039                          276   5e-85    Oryza sativa Indica Group [Indian rice]
dbj|BAD19686.1|  putative co-chaperone CGE1 precursor isoform b         276   5e-85    Oryza sativa Japonica Group [Japonica rice]
gb|EMT25459.1|  hypothetical protein F775_52685                         274   1e-84    
ref|NP_850840.1|  embryo defective 1241                                 274   1e-84    Arabidopsis thaliana [mouse-ear cress]
ref|NP_568356.1|  embryo defective 1241                                 274   2e-84    Arabidopsis thaliana [mouse-ear cress]
emb|CDY02695.1|  BnaC02g07400D                                          273   2e-84    
ref|XP_003624768.1|  Protein grpE                                       274   3e-84    
gb|EMS64517.1|  Protein grpE                                            271   3e-84    
ref|XP_006288204.1|  hypothetical protein CARUB_v10001443mg             273   3e-84    
ref|XP_004953075.1|  PREDICTED: grpE protein homolog, mitochondri...    273   6e-84    
gb|AFW62939.1|  grpE protein-like protein                               272   1e-83    
ref|XP_002873846.1|  EMB1241                                            271   1e-83    
dbj|BAK06504.1|  predicted protein                                      271   1e-83    
dbj|BAJ98546.1|  predicted protein                                      271   1e-83    
ref|XP_006400314.1|  hypothetical protein EUTSA_v10014120mg             271   2e-83    
emb|CDY59313.1|  BnaAnng15980D                                          271   2e-83    
ref|XP_009126204.1|  PREDICTED: grpE protein homolog, mitochondrial     270   2e-83    
ref|XP_010492733.1|  PREDICTED: grpE protein homolog, mitochondri...    270   3e-83    
ref|XP_010420501.1|  PREDICTED: grpE protein homolog, mitochondri...    270   4e-83    
ref|XP_010088171.1|  Protein grpE                                       276   5e-83    
ref|NP_001151179.1|  protein grpE                                       270   8e-83    Zea mays [maize]
ref|XP_010453974.1|  PREDICTED: grpE protein homolog, mitochondri...    269   9e-83    
ref|XP_002452436.1|  hypothetical protein SORBIDRAFT_04g025770          269   1e-82    Sorghum bicolor [broomcorn]
gb|KFK25997.1|  hypothetical protein AALP_AA8G189400                    268   2e-82    
ref|XP_009409781.1|  PREDICTED: grpE protein homolog, mitochondri...    267   7e-82    
emb|CDY16895.1|  BnaC09g40220D                                          266   1e-81    
emb|CDY38454.1|  BnaA10g17040D                                          266   2e-81    
ref|XP_009121060.1|  PREDICTED: grpE protein homolog, mitochondri...    265   4e-81    
gb|ACG38006.1|  protein grpE                                            265   8e-81    Zea mays [maize]
ref|NP_001137005.1|  uncharacterized protein LOC100217168               264   1e-80    Zea mays [maize]
ref|XP_010558942.1|  PREDICTED: grpE protein homolog, mitochondri...    263   6e-80    
emb|CAN65730.1|  hypothetical protein VITISV_011922                     261   7e-79    Vitis vinifera
ref|XP_008794361.1|  PREDICTED: grpE protein homolog, mitochondri...    246   1e-74    
gb|ABK22476.1|  unknown                                                 235   3e-69    Picea sitchensis
ref|XP_001783635.1|  predicted protein                                  231   5e-69    
ref|XP_001780175.1|  predicted protein                                  228   5e-68    
gb|ADB23408.1|  chloroplast CGE2                                        229   2e-67    Physcomitrella patens
gb|ADB23407.1|  chloroplast CGE1                                        229   2e-67    Physcomitrella patens
ref|XP_009592594.1|  PREDICTED: grpE protein homolog, mitochondri...    218   2e-63    
ref|XP_002285824.1|  PREDICTED: grpE protein homolog, mitochondrial     218   4e-63    Vitis vinifera
ref|XP_006647500.1|  PREDICTED: grpE protein homolog, mitochondri...    208   1e-61    
ref|XP_010036282.1|  PREDICTED: grpE protein homolog, mitochondri...    213   3e-61    
ref|XP_010245060.1|  PREDICTED: grpE protein homolog, mitochondri...    213   4e-61    
ref|XP_009795641.1|  PREDICTED: grpE protein homolog, mitochondrial     212   7e-61    
ref|XP_009627883.1|  PREDICTED: grpE protein homolog, mitochondrial     211   2e-60    
gb|EYU23933.1|  hypothetical protein MIMGU_mgv1a009924mg                211   3e-60    
gb|KDP32732.1|  hypothetical protein JCGZ_12024                         209   6e-60    
ref|XP_011074901.1|  PREDICTED: grpE protein homolog, mitochondrial     209   7e-60    
ref|XP_006847037.1|  hypothetical protein AMTR_s00017p00181540          208   8e-60    
ref|XP_006366929.1|  PREDICTED: grpE protein homolog, mitochondri...    207   4e-59    
gb|KHG12283.1|  Protein grpE                                            205   2e-58    
ref|XP_004307232.1|  PREDICTED: protein GrpE-like                       204   3e-58    
emb|CBI31184.3|  unnamed protein product                                204   4e-58    
ref|XP_002513845.1|  Protein grpE, putative                             204   5e-58    Ricinus communis
ref|XP_010653155.1|  PREDICTED: uncharacterized protein LOC100251...    204   6e-58    
emb|CDP08484.1|  unnamed protein product                                200   3e-56    
ref|XP_009367021.1|  PREDICTED: grpE protein homolog, mitochondri...    200   4e-56    
ref|XP_009344252.1|  PREDICTED: grpE protein homolog, mitochondri...    199   6e-56    
ref|XP_006604279.1|  PREDICTED: grpE protein homolog, mitochondri...    197   2e-55    
ref|XP_009367332.1|  PREDICTED: grpE protein homolog, mitochondri...    198   2e-55    
ref|XP_011027640.1|  PREDICTED: grpE protein homolog, mitochondrial     197   2e-55    
ref|XP_002301021.2|  hypothetical protein POPTR_0002s09060g             197   3e-55    Populus trichocarpa [western balsam poplar]
ref|XP_010672791.1|  PREDICTED: grpE protein homolog, mitochondrial     197   4e-55    
ref|XP_007018915.1|  GrpE protein, putative                             196   6e-55    
ref|XP_002983121.1|  hypothetical protein SELMODRAFT_117407             194   6e-55    
ref|XP_008347771.1|  PREDICTED: grpE protein homolog, mitochondri...    196   8e-55    
ref|XP_002965873.1|  hypothetical protein SELMODRAFT_83859              194   8e-55    
ref|XP_010687148.1|  PREDICTED: uncharacterized protein LOC104901...    195   9e-55    
ref|XP_010064014.1|  PREDICTED: grpE protein homolog, mitochondrial     196   1e-54    
ref|XP_006484786.1|  PREDICTED: grpE protein homolog, mitochondri...    195   2e-54    
gb|KDO46640.1|  hypothetical protein CISIN_1g019043mg                   195   2e-54    
ref|XP_009596390.1|  PREDICTED: uncharacterized protein LOC104092484    192   3e-53    
ref|XP_006437269.1|  hypothetical protein CICLE_v10031794mg             193   3e-53    
ref|XP_008352692.1|  PREDICTED: LOW QUALITY PROTEIN: grpE protein...    191   4e-53    
ref|XP_004493256.1|  PREDICTED: protein GrpE-like isoform X3            191   5e-53    
ref|XP_008233940.1|  PREDICTED: grpE protein homolog, mitochondrial     190   1e-52    
ref|XP_006434089.1|  hypothetical protein CICLE_v10001980mg             189   3e-52    
ref|XP_006472690.1|  PREDICTED: grpE protein homolog, mitochondri...    189   4e-52    
ref|XP_006472689.1|  PREDICTED: grpE protein homolog, mitochondri...    188   4e-52    
ref|XP_006472691.1|  PREDICTED: grpE protein homolog, mitochondri...    188   6e-52    
ref|XP_007225704.1|  hypothetical protein PRUPE_ppa008776mg             188   1e-51    
ref|XP_006400315.1|  hypothetical protein EUTSA_v10014120mg             184   4e-51    
gb|KEH23550.1|  co-chaperone GrpE family protein                        185   4e-51    
gb|AFK33471.1|  unknown                                                 185   1e-50    
ref|XP_010431202.1|  PREDICTED: grpE protein homolog, mitochondri...    183   2e-50    
gb|KHN09159.1|  Protein grpE                                            183   4e-50    
ref|XP_003526604.2|  PREDICTED: grpE protein homolog, mitochondri...    183   8e-50    
ref|XP_004150939.1|  PREDICTED: protein GrpE-like                       182   2e-49    
ref|XP_002307407.2|  hypothetical protein POPTR_0005s16330g             179   2e-49    Populus trichocarpa [western balsam poplar]
ref|XP_004168166.1|  PREDICTED: LOW QUALITY PROTEIN: protein GrpE...    181   5e-49    
ref|XP_010930882.1|  PREDICTED: grpE protein homolog, mitochondrial     181   6e-49    
ref|XP_008445362.1|  PREDICTED: grpE protein homolog, mitochondrial     179   1e-48    
ref|XP_010095505.1|  Protein grpE                                       179   3e-48    
ref|XP_007136196.1|  hypothetical protein PHAVU_009G026300g             177   7e-48    
ref|XP_002893916.1|  co-chaperone grpE family protein                   176   7e-48    
ref|XP_008781554.1|  PREDICTED: grpE protein homolog, mitochondrial     176   4e-47    
gb|KFK22893.1|  hypothetical protein AALP_AAs71746U000500               173   3e-46    
ref|XP_010544336.1|  PREDICTED: LOW QUALITY PROTEIN: grpE protein...    173   4e-46    
ref|XP_009413410.1|  PREDICTED: grpE protein homolog, mitochondrial     172   4e-46    
ref|XP_006383482.1|  hypothetical protein POPTR_0005s16330g             169   4e-46    
ref|XP_008794362.1|  PREDICTED: uncharacterized protein LOC103710...    170   7e-46    
ref|NP_564475.1|  Co-chaperone GrpE family protein                      171   1e-45    Arabidopsis thaliana [mouse-ear cress]
gb|AAM65596.1|  putative heat shock protein                             171   1e-45    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003601139.1|  Protein grpE                                       171   3e-45    
ref|XP_010500077.1|  PREDICTED: grpE protein homolog, mitochondri...    169   7e-45    
ref|XP_010461358.1|  PREDICTED: grpE protein homolog, mitochondrial     169   9e-45    
emb|CDY52462.1|  BnaC08g47050D                                          168   2e-44    
ref|XP_010511131.1|  PREDICTED: grpE protein homolog, mitochondri...    168   2e-44    
ref|XP_009107901.1|  PREDICTED: grpE protein homolog, mitochondrial     167   3e-44    
ref|XP_006305497.1|  hypothetical protein CARUB_v10009969mg             166   9e-44    
dbj|BAJ95108.1|  predicted protein                                      165   2e-43    
ref|XP_001692412.1|  GrpE nucleotide release factor                     164   3e-43    Chlamydomonas reinhardtii
ref|XP_001692413.1|  GrpE nucleotide release factor                     164   3e-43    Chlamydomonas reinhardtii
ref|XP_006414526.1|  hypothetical protein EUTSA_v10025813mg             164   7e-43    
ref|XP_002951735.1|  hypothetical protein VOLCADRAFT_109146             162   1e-42    
ref|XP_004515658.1|  PREDICTED: protein GrpE-like                       162   4e-42    
ref|XP_006652297.1|  PREDICTED: grpE protein homolog, mitochondri...    161   4e-42    
gb|EAY94163.1|  hypothetical protein OsI_15938                          160   8e-42    Oryza sativa Indica Group [Indian rice]
ref|NP_001052822.1|  Os04g0431100                                       160   9e-42    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003579761.1|  PREDICTED: grpE protein homolog, mitochondrial     160   9e-42    
ref|XP_001419369.1|  chloroplast GrpE-like protein                      160   1e-41    Ostreococcus lucimarinus CCE9901
ref|WP_023171568.1|  co-chaperone GrpE                                  157   1e-41    
ref|WP_017298327.1|  co-chaperone GrpE                                  158   2e-41    
ref|XP_004975635.1|  PREDICTED: grpE protein homolog, mitochondri...    159   4e-41    
ref|WP_035990298.1|  co-chaperone GrpE                                  157   4e-41    
ref|XP_002447849.1|  hypothetical protein SORBIDRAFT_06g016920          157   1e-40    Sorghum bicolor [broomcorn]
ref|XP_008671294.1|  PREDICTED: grpE protein homolog, mitochondrial     154   2e-40    
ref|XP_005846367.1|  hypothetical protein CHLNCDRAFT_36141              152   4e-40    
ref|XP_008338873.1|  PREDICTED: grpE protein homolog, mitochondri...    151   5e-40    
ref|WP_017661959.1|  co-chaperone GrpE                                  154   6e-40    
tpg|DAA37763.1|  TPA: hypothetical protein ZEAMMB73_896904              155   7e-40    
ref|XP_003058911.1|  mitochondrial protein translocase family           155   1e-39    
ref|WP_009556482.1|  co-chaperone GrpE                                  152   4e-39    
ref|WP_024124393.1|  co-chaperone GrpE                                  151   6e-39    
gb|EMS49120.1|  Protein grpE                                            152   1e-38    
ref|WP_036009021.1|  co-chaperone GrpE                                  150   2e-38    
ref|WP_022608172.1|  co-chaperone GrpE                                  150   3e-38    
ref|WP_011057154.1|  co-chaperone GrpE                                  150   3e-38    
gb|AGT16068.1|  hypothetical protein SHCRBa_185_O22_R_90                150   4e-38    
gb|EMT30761.1|  Protein grpE                                            150   6e-38    
ref|WP_019487096.1|  co-chaperone GrpE                                  149   9e-38    
ref|WP_012161085.1|  co-chaperone GrpE                                  148   1e-37    
ref|WP_010473392.1|  co-chaperone GrpE                                  148   1e-37    
ref|WP_014274815.1|  co-chaperone GrpE                                  147   2e-37    
ref|WP_008049500.1|  co-chaperone GrpE                                  147   3e-37    
ref|WP_006620080.1|  co-chaperone GrpE                                  147   3e-37    
ref|WP_015170455.1|  co-chaperone GrpE                                  145   8e-37    
ref|WP_012630041.1|  co-chaperone GrpE                                  145   1e-36    
gb|EPS60511.1|  hypothetical protein M569_14294                         147   1e-36    
ref|WP_007101115.1|  co-chaperone GrpE                                  145   1e-36    
ref|WP_015227089.1|  co-chaperone GrpE                                  144   2e-36    
ref|WP_037223932.1|  heat shock protein GrpE                            144   3e-36    
ref|WP_017288853.1|  co-chaperone GrpE                                  143   4e-36    
ref|WP_015146536.1|  co-chaperone GrpE                                  144   4e-36    
ref|XP_005644635.1|  GrpE nucleotide exchange factor                    141   6e-36    
ref|WP_009783906.1|  co-chaperone GrpE                                  143   7e-36    
ref|WP_015109887.1|  co-chaperone GrpE                                  143   8e-36    
ref|WP_012194572.1|  co-chaperone GrpE                                  143   8e-36    
ref|WP_023068665.1|  co-chaperone GrpE                                  143   1e-35    
ref|WP_006620592.1|  MULTISPECIES: co-chaperone GrpE                    143   1e-35    
ref|WP_035139980.1|  co-chaperone GrpE                                  143   1e-35    
gb|AIE73784.1|  Heat shock protein GrpE                                 142   1e-35    
ref|WP_038024536.1|  co-chaperone GrpE                                  142   1e-35    
ref|WP_006457178.1|  co-chaperone GrpE                                  142   1e-35    
gb|EAU75353.1|  molecular chaperone GrpE, heat shock protein            142   2e-35    Synechococcus sp. RS9916
ref|WP_026722301.1|  co-chaperone GrpE                                  142   2e-35    
ref|WP_010313990.1|  co-chaperone GrpE                                  140   3e-35    
ref|WP_016865116.1|  co-chaperone GrpE                                  141   4e-35    
ref|XP_003080808.1|  co-chaperone CGE1 precursor isoform b (ISS)        141   6e-35    
ref|WP_009456789.1|  co-chaperone GrpE                                  140   6e-35    
ref|WP_016872218.1|  co-chaperone GrpE                                  140   6e-35    
ref|WP_016859578.1|  co-chaperone GrpE                                  140   6e-35    
ref|WP_039727327.1|  hypothetical protein                               140   6e-35    
ref|WP_006102976.1|  co-chaperone GrpE                                  140   6e-35    
ref|WP_038551933.1|  co-chaperone GrpE                                  140   7e-35    
ref|WP_036901875.1|  co-chaperone GrpE                                  140   7e-35    
ref|WP_015162376.1|  co-chaperone GrpE                                  140   7e-35    
ref|WP_035830812.1|  co-chaperone GrpE                                  140   7e-35    
ref|WP_017312974.1|  co-chaperone GrpE                                  140   7e-35    
ref|WP_015228005.1|  co-chaperone GrpE                                  140   8e-35    
ref|WP_011131654.1|  co-chaperone GrpE                                  140   1e-34    
ref|WP_015123320.1|  co-chaperone GrpE                                  140   1e-34    
ref|WP_013191068.1|  co-chaperone GrpE                                  139   1e-34    
ref|WP_009149230.1|  co-chaperone GrpE                                  140   1e-34    
ref|WP_011144178.1|  co-chaperone GrpE                                  138   1e-34    
ref|WP_015140726.1|  co-chaperone GrpE                                  140   1e-34    
ref|WP_015180928.1|  co-chaperone GrpE                                  140   1e-34    
ref|WP_015216330.1|  co-chaperone GrpE                                  140   1e-34    
gb|AII46582.1|  molecular chaperone GrpE                                139   1e-34    
gb|KEF42392.1|  molecular chaperone GrpE                                139   2e-34    
ref|WP_016922736.1|  co-chaperone GrpE                                  139   2e-34    
ref|XP_005829336.1|  GrpE nucleotide exchange factor, chloroplastic     141   2e-34    
ref|WP_038107479.1|  co-chaperone GrpE                                  139   2e-34    
ref|WP_011611384.1|  co-chaperone GrpE                                  139   2e-34    
ref|WP_010873518.1|  co-chaperone GrpE                                  139   3e-34    
ref|WP_015197478.1|  co-chaperone GrpE                                  138   3e-34    
ref|WP_017742971.1|  co-chaperone GrpE                                  139   3e-34    
gb|EHA59121.1|  Protein grpE                                            139   3e-34    
gb|AIQ94045.1|  Heat shock protein GrpE                                 138   4e-34    
ref|WP_028082414.1|  co-chaperone GrpE                                  137   4e-34    
ref|WP_038014957.1|  co-chaperone GrpE                                  138   4e-34    
ref|WP_011429854.1|  co-chaperone GrpE                                  138   4e-34    
ref|XP_008803238.1|  PREDICTED: grpE protein homolog, mitochondri...    136   5e-34    
ref|WP_015186828.1|  co-chaperone GrpE                                  137   5e-34    
ref|WP_032519874.1|  co-chaperone GrpE                                  137   5e-34    
ref|WP_011363064.1|  co-chaperone GrpE                                  137   6e-34    
ref|WP_006911529.1|  co-chaperone GrpE                                  137   7e-34    
gb|AHF62448.1|  putative heat shock protein GrpE                        137   7e-34    
ref|XP_005703222.1|  molecular chaperone GrpE (plastid)                 139   7e-34    
ref|WP_038027462.1|  co-chaperone GrpE                                  137   7e-34    
ref|WP_016874199.1|  co-chaperone GrpE                                  137   7e-34    
ref|WP_010312637.1|  co-chaperone GrpE                                  137   7e-34    
ref|WP_015204748.1|  co-chaperone GrpE                                  137   8e-34    
ref|WP_036020781.1|  co-chaperone GrpE                                  136   1e-33    
ref|XP_010245062.1|  PREDICTED: grpE protein homolog, mitochondri...    137   1e-33    
ref|WP_006276281.1|  co-chaperone GrpE                                  134   1e-33    
ref|WP_026103971.1|  co-chaperone GrpE                                  137   1e-33    
ref|WP_015128122.1|  co-chaperone GrpE                                  137   1e-33    
ref|WP_025923769.1|  co-chaperone GrpE                                  137   1e-33    
ref|WP_028953253.1|  co-chaperone GrpE                                  136   1e-33    
gb|EKV01995.1|  molecular chaperone GrpE (heat shock protein)           136   1e-33    
pir||PC2235  GrpE protein - Synechococcus sp. (strain PCC 7942)  ...    135   1e-33 
ref|WP_038020997.1|  co-chaperone GrpE                                  137   1e-33    
ref|WP_008276105.1|  co-chaperone GrpE                                  137   1e-33    
ref|WP_006042667.1|  co-chaperone GrpE                                  136   1e-33    
ref|WP_011378302.1|  co-chaperone GrpE                                  135   1e-33    
gb|KFB83884.1|  heat shock protein GrpE                                 137   1e-33    
ref|WP_011817493.1|  co-chaperone GrpE                                  136   2e-33    
ref|WP_035153817.1|  co-chaperone GrpE                                  137   2e-33    
ref|WP_011126901.1|  co-chaperone GrpE                                  135   2e-33    
ref|WP_011244331.1|  co-chaperone GrpE                                  135   2e-33    
gb|AHJ27111.1|  Heat shock protein GrpE                                 136   2e-33    
ref|WP_008196487.1|  co-chaperone GrpE                                  136   2e-33    
ref|WP_036531630.1|  co-chaperone GrpE                                  136   2e-33    
ref|WP_038650428.1|  co-chaperone GrpE                                  137   2e-33    
ref|WP_011822817.1|  co-chaperone GrpE                                  137   2e-33    
ref|WP_035372640.1|  co-chaperone GrpE                                  135   2e-33    
ref|WP_011293976.1|  co-chaperone GrpE                                  136   2e-33    
ref|WP_036906080.1|  co-chaperone GrpE                                  136   2e-33    
ref|WP_012406950.1|  co-chaperone GrpE                                  135   3e-33    
ref|WP_002805356.1|  co-chaperone GrpE                                  135   3e-33    
ref|XP_010245061.1|  PREDICTED: grpE protein homolog, mitochondri...    137   3e-33    
ref|WP_025895295.1|  MULTISPECIES: co-chaperone GrpE                    135   3e-33    
ref|WP_006635245.1|  co-chaperone GrpE                                  136   3e-33    
ref|WP_032523807.1|  co-chaperone GrpE                                  135   3e-33    
ref|WP_036899273.1|  co-chaperone GrpE                                  135   3e-33    
ref|WP_019480590.1|  co-chaperone GrpE                                  135   3e-33    
ref|WP_011618013.1|  co-chaperone GrpE                                  136   3e-33    
ref|WP_025973077.1|  co-chaperone GrpE                                  135   4e-33    
ref|WP_011317261.1|  co-chaperone GrpE                                  135   4e-33    
ref|WP_010996601.1|  co-chaperone GrpE                                  135   4e-33    
ref|WP_025957482.1|  co-chaperone GrpE                                  135   4e-33    
ref|WP_025934651.1|  co-chaperone GrpE                                  135   4e-33    
ref|WP_025935562.1|  co-chaperone GrpE                                  135   4e-33    
ref|WP_025968914.1|  co-chaperone GrpE                                  135   4e-33    
ref|WP_036922796.1|  co-chaperone GrpE                                  135   4e-33    
ref|WP_025931106.1|  co-chaperone GrpE                                  135   4e-33    
ref|WP_019502288.1|  co-chaperone GrpE                                  135   4e-33    
ref|WP_025924001.1|  co-chaperone GrpE                                  135   4e-33    
ref|WP_017654521.1|  co-chaperone GrpE                                  135   5e-33    
ref|WP_031292801.1|  co-chaperone GrpE                                  135   5e-33    
gb|ESA36132.1|  molecular chaperone                                     135   5e-33    
ref|WP_011931957.1|  co-chaperone GrpE                                  135   5e-33    
ref|WP_012006820.1|  co-chaperone GrpE                                  135   5e-33    
ref|WP_019474879.1|  co-chaperone GrpE                                  135   6e-33    
ref|WP_039743185.1|  heat shock protein GrpE                            134   7e-33    
ref|WP_009625411.1|  co-chaperone GrpE                                  135   7e-33    
ref|XP_002501372.1|  mitochondrial protein translocase family           136   8e-33    
ref|WP_012593860.1|  MULTISPECIES: co-chaperone GrpE                    135   8e-33    
ref|WP_006172739.1|  co-chaperone GrpE                                  134   9e-33    
ref|WP_007306868.1|  co-chaperone GrpE                                  133   9e-33    
ref|WP_011375581.1|  co-chaperone GrpE                                  134   9e-33    
ref|WP_019477906.1|  co-chaperone GrpE                                  134   9e-33    
ref|WP_008234709.1|  co-chaperone GrpE                                  131   9e-33    
ref|WP_026796140.1|  MULTISPECIES: co-chaperone GrpE                    134   1e-32    
ref|WP_019494382.1|  co-chaperone GrpE                                  134   1e-32    
ref|XP_007515304.1|  GrpE protein                                       135   1e-32    
ref|WP_026785695.1|  co-chaperone GrpE                                  134   1e-32    
gb|AGX01022.1|  heat shock protein                                      134   1e-32    
ref|WP_025937815.1|  co-chaperone GrpE                                  134   1e-32    
ref|WP_017321996.1|  co-chaperone GrpE                                  134   1e-32    
ref|WP_032523062.1|  co-chaperone GrpE                                  134   1e-32    
ref|WP_025959565.1|  MULTISPECIES: co-chaperone GrpE                    134   1e-32    
ref|WP_009788535.1|  co-chaperone GrpE                                  134   1e-32    
ref|WP_025965111.1|  co-chaperone GrpE                                  134   1e-32    
ref|WP_026796229.1|  co-chaperone GrpE                                  134   1e-32    
ref|WP_032518055.1|  co-chaperone GrpE                                  134   1e-32    
ref|WP_011358864.1|  co-chaperone GrpE                                  133   1e-32    
ref|WP_017718581.1|  co-chaperone GrpE                                  134   2e-32    
ref|WP_032525722.1|  co-chaperone GrpE                                  134   2e-32    
ref|WP_015176187.1|  co-chaperone GrpE                                  134   2e-32    
ref|WP_025973635.1|  co-chaperone GrpE                                  133   2e-32    
ref|WP_029633162.1|  co-chaperone GrpE [                                133   2e-32    
ref|WP_015116316.1|  co-chaperone GrpE                                  132   2e-32    
ref|WP_025915325.1|  co-chaperone GrpE                                  133   2e-32    
ref|WP_007313333.1|  co-chaperone GrpE                                  133   2e-32    
ref|WP_008230511.1|  co-chaperone GrpE                                  132   3e-32    
dbj|GAL93832.1|  heat shock protein GrpE                                133   3e-32    
ref|WP_002788084.1|  co-chaperone GrpE                                  133   3e-32    
ref|WP_002797768.1|  co-chaperone GrpE                                  133   3e-32    
ref|WP_006527413.1|  co-chaperone GrpE                                  132   3e-32    
ref|WP_002771392.1|  co-chaperone GrpE                                  132   4e-32    
gb|KGG27948.1|  Heat shock protein GrpE                                 132   4e-32    
ref|WP_019477445.1|  co-chaperone GrpE                                  132   4e-32    
ref|WP_036913095.1|  MULTISPECIES: co-chaperone GrpE                    132   4e-32    
gb|KGG31329.1|  Heat shock protein GrpE                                 132   4e-32    
ref|WP_038542444.1|  co-chaperone GrpE                                  132   4e-32    
ref|WP_015081024.1|  co-chaperone GrpE                                  132   5e-32    
ref|WP_011824710.1|  co-chaperone GrpE                                  132   5e-32    
ref|WP_002763110.1|  co-chaperone GrpE                                  132   5e-32    
ref|WP_002752086.1|  co-chaperone GrpE                                  132   6e-32    
ref|WP_017315724.1|  co-chaperone GrpE                                  132   6e-32    
ref|WP_039202898.1|  heat shock protein GrpE                            131   6e-32    
ref|WP_002742600.1|  co-chaperone GrpE                                  132   7e-32    
ref|WP_027401138.1|  co-chaperone GrpE                                  131   7e-32    
ref|WP_002738986.1|  co-chaperone GrpE                                  132   7e-32    
ref|WP_024970085.1|  co-chaperone GrpE                                  132   8e-32    
ref|WP_011434468.1|  co-chaperone GrpE                                  132   8e-32    
ref|WP_035789519.1|  co-chaperone GrpE                                  131   8e-32    
ref|WP_033374008.1|  co-chaperone GrpE                                  132   9e-32    
ref|WP_027843111.1|  co-chaperone GrpE                                  132   1e-31    
ref|WP_015223799.1|  co-chaperone GrpE                                  132   1e-31    
gb|KFM25435.1|  Protein GrpE                                            131   1e-31    
ref|WP_015211080.1|  co-chaperone GrpE                                  132   1e-31    
ref|WP_015163743.1|  co-chaperone GrpE                                  132   1e-31    
ref|WP_036916621.1|  MULTISPECIES: co-chaperone GrpE                    131   1e-31    
dbj|BAP17280.1|  heat shock protein                                     132   1e-31    
ref|WP_036801173.1|  co-chaperone GrpE                                  131   1e-31    
ref|WP_015112101.1|  co-chaperone GrpE                                  131   1e-31    
ref|WP_032514073.1|  co-chaperone GrpE                                  131   1e-31    
ref|WP_015191447.1|  co-chaperone GrpE                                  131   1e-31    
ref|WP_039715856.1|  protein GrpE                                       131   2e-31    
ref|WP_015153788.1|  co-chaperone GrpE                                  131   2e-31    
gb|KGG16933.1|  Heat shock protein GrpE                                 131   2e-31    
ref|WP_012264074.1|  co-chaperone GrpE                                  130   2e-31    
ref|WP_011819341.1|  co-chaperone GrpE                                  130   2e-31    
ref|XP_008663202.1|  PREDICTED: grpE protein homolog, mitochondri...    130   3e-31    
ref|WP_011129400.1|  co-chaperone GrpE                                  130   3e-31    
gb|AFW58267.1|  hypothetical protein ZEAMMB73_815827                    130   3e-31    
ref|WP_006511260.1|  co-chaperone GrpE                                  131   3e-31    
ref|WP_009543904.1|  MULTISPECIES: co-chaperone GrpE                    130   4e-31    
ref|WP_011124171.1|  MULTISPECIES: co-chaperone GrpE                    129   5e-31    
ref|WP_022775473.1|  co-chaperone GrpE                                  128   5e-31    
ref|WP_011934439.1|  co-chaperone GrpE                                  129   7e-31    
ref|WP_038331174.1|  co-chaperone GrpE                                  129   1e-30    
ref|WP_035774387.1|  co-chaperone GrpE                                  127   1e-30    
ref|WP_015143931.1|  co-chaperone GrpE                                  129   1e-30    
gb|KFF41322.1|  molecular chaperone GrpE (heat shock protein)           128   2e-30    
ref|XP_005719374.1|  Heat Shock Protein GrpE                            130   2e-30    
ref|WP_022766486.1|  co-chaperone GrpE                                  127   2e-30    
ref|YP_002049062.1|  Heat shock protein GrpE                            127   2e-30    
ref|WP_008313435.1|  co-chaperone GrpE                                  128   2e-30    
ref|WP_026517458.1|  co-chaperone GrpE                                  127   2e-30    
ref|WP_015219609.1|  co-chaperone GrpE                                  128   3e-30    
ref|WP_035632107.1|  co-chaperone GrpE                                  125   3e-30    
ref|WP_034475099.1|  co-chaperone GrpE                                  127   3e-30    
ref|WP_013282012.1|  co-chaperone GrpE                                  127   4e-30    
ref|WP_026520046.1|  MULTISPECIES: co-chaperone GrpE                    126   4e-30    
ref|WP_022768033.1|  co-chaperone GrpE                                  126   5e-30    
ref|WP_027415802.1|  co-chaperone GrpE                                  125   5e-30    
ref|WP_019536088.1|  co-chaperone GrpE                                  125   9e-30    
ref|WP_026668792.1|  co-chaperone GrpE                                  125   1e-29    
ref|WP_015255256.1|  co-chaperone GrpE                                  125   1e-29    
ref|WP_026263898.1|  co-chaperone GrpE                                  124   1e-29    
ref|WP_026514402.1|  co-chaperone GrpE                                  124   1e-29    
ref|WP_011194637.1|  co-chaperone GrpE                                  124   1e-29    
ref|WP_025931184.1|  MULTISPECIES: co-chaperone GrpE                    125   1e-29    
ref|WP_013321898.1|  co-chaperone GrpE                                  126   2e-29    
gb|AIQ13997.1|  molecular chaperone GrpE                                124   2e-29    
ref|WP_028561681.1|  co-chaperone GrpE                                  124   2e-29    
ref|WP_015956136.1|  co-chaperone GrpE                                  126   2e-29    
ref|WP_006036261.1|  co-chaperone GrpE                                  123   3e-29    
ref|WP_026650791.1|  co-chaperone GrpE                                  124   3e-29    
ref|WP_009675371.1|  MULTISPECIES: co-chaperone GrpE                    123   3e-29    
ref|WP_025972730.1|  co-chaperone GrpE                                  124   4e-29    
ref|WP_022249289.1|  co-chaperone GrpE                                  122   5e-29    
ref|WP_034630688.1|  hypothetical protein                               123   5e-29    
ref|WP_026656565.1|  MULTISPECIES: co-chaperone GrpE                    123   5e-29    
ref|WP_036482308.1|  co-chaperone GrpE                                  124   6e-29    
ref|WP_026668297.1|  co-chaperone GrpE                                  123   6e-29    
ref|WP_025701648.1|  co-chaperone GrpE                                  122   7e-29    
ref|WP_025694883.1|  co-chaperone GrpE                                  122   8e-29    
ref|WP_012726667.1|  co-chaperone GrpE                                  121   1e-28    
ref|WP_031423218.1|  co-chaperone GrpE                                  121   1e-28    
ref|WP_036629397.1|  co-chaperone GrpE                                  121   1e-28    
ref|WP_025921291.1|  co-chaperone GrpE                                  122   1e-28    
ref|WP_025967728.1|  co-chaperone GrpE                                  122   1e-28    
ref|WP_025955000.1|  co-chaperone GrpE                                  122   1e-28    
ref|WP_035186685.1|  co-chaperone GrpE                                  120   1e-28    
ref|WP_011862043.1|  co-chaperone GrpE                                  122   1e-28    
ref|WP_025690937.1|  co-chaperone GrpE                                  121   1e-28    
ref|WP_013173293.1|  co-chaperone GrpE [                                121   1e-28    
ref|WP_025932852.1|  co-chaperone GrpE                                  122   2e-28    
ref|WP_032515159.1|  co-chaperone GrpE                                  122   2e-28    
ref|WP_036589867.1|  co-chaperone GrpE                                  121   2e-28    
ref|WP_034778140.1|  co-chaperone GrpE                                  120   2e-28    
ref|WP_034447183.1|  co-chaperone GrpE                                  121   2e-28    
ref|WP_035767297.1|  co-chaperone GrpE                                  121   2e-28    
ref|WP_012954522.1|  co-chaperone GrpE                                  122   2e-28    
ref|WP_034809509.1|  co-chaperone GrpE                                  120   2e-28    
ref|WP_017292586.1|  co-chaperone GrpE                                  122   2e-28    
ref|WP_016508028.1|  co-chaperone GrpE                                  120   2e-28    
ref|WP_024371426.1|  MULTISPECIES: co-chaperone GrpE                    120   3e-28    
ref|WP_025963440.1|  co-chaperone GrpE                                  121   3e-28    
ref|WP_025924934.1|  MULTISPECIES: co-chaperone GrpE                    121   3e-28    
ref|WP_018975738.1|  co-chaperone GrpE                                  120   3e-28    
ref|WP_025980830.1|  co-chaperone GrpE                                  121   3e-28    
ref|WP_012306324.1|  MULTISPECIES: co-chaperone GrpE                    121   4e-28    
ref|WP_025335946.1|  co-chaperone GrpE                                  120   4e-28    
ref|WP_025929037.1|  co-chaperone GrpE                                  121   4e-28    
ref|WP_025952184.1|  MULTISPECIES: co-chaperone GrpE                    121   4e-28    
ref|WP_025941102.1|  co-chaperone GrpE                                  121   4e-28    
ref|WP_025927235.1|  MULTISPECIES: co-chaperone GrpE                    121   4e-28    
ref|WP_029595210.1|  co-chaperone GrpE                                  120   4e-28    
ref|WP_035802082.1|  co-chaperone GrpE                                  120   4e-28    
ref|WP_025879993.1|  co-chaperone GrpE                                  121   4e-28    
gb|AIQ54272.1|  molecular chaperone GrpE                                120   4e-28    
ref|WP_025970040.1|  co-chaperone GrpE                                  121   4e-28    
ref|WP_025964483.1|  co-chaperone GrpE                                  121   4e-28    
ref|WP_014828864.1|  co-chaperone GrpE                                  120   4e-28    
ref|WP_025887300.1|  MULTISPECIES: co-chaperone GrpE                    121   4e-28    
ref|WP_025956392.1|  MULTISPECIES: co-chaperone GrpE                    121   5e-28    
ref|WP_025932233.1|  co-chaperone GrpE                                  121   5e-28    
ref|WP_025851307.1|  co-chaperone GrpE                                  120   5e-28    
ref|WP_038595485.1|  co-chaperone GrpE                                  119   6e-28    
ref|WP_021065669.1|  co-chaperone GrpE                                  119   6e-28    
ref|WP_021256826.1|  MULTISPECIES: co-chaperone GrpE                    119   6e-28    
ref|WP_039832754.1|  molecular chaperone GrpE                           119   6e-28    
ref|WP_026509599.1|  co-chaperone GrpE                                  120   7e-28    
ref|WP_006312534.1|  co-chaperone GrpE                                  119   7e-28    
ref|WP_020428123.1|  co-chaperone GrpE                                  119   7e-28    
ref|WP_019909189.1|  co-chaperone GrpE                                  119   8e-28    
ref|WP_025940343.1|  co-chaperone GrpE                                  119   9e-28    
ref|WP_006286516.1|  co-chaperone GrpE                                  119   9e-28    
ref|WP_006676261.1|  co-chaperone GrpE                                  119   1e-27    
ref|WP_006980979.1|  co-chaperone GrpE                                  118   1e-27    
ref|WP_029323321.1|  co-chaperone GrpE                                  119   1e-27    
ref|WP_013488187.1|  co-chaperone GrpE                                  118   1e-27    
ref|XP_001692653.1|  GrpE nucleotide release factor                     116   1e-27    
ref|XP_010312800.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    120   1e-27    
ref|WP_034814883.1|  co-chaperone GrpE                                  118   1e-27    
ref|WP_009248597.1|  co-chaperone GrpE                                  119   1e-27    
ref|WP_025943132.1|  co-chaperone GrpE                                  119   1e-27    
ref|WP_025643172.1|  co-chaperone GrpE [                                119   1e-27    
gb|AFK46907.1|  unknown                                                 119   1e-27    
ref|WP_035643303.1|  co-chaperone GrpE                                  119   2e-27    
ref|WP_034625407.1|  protein GrpE                                       117   2e-27    
ref|WP_004605140.1|  co-chaperone GrpE [                                119   2e-27    
ref|WP_025951735.1|  co-chaperone GrpE                                  119   2e-27    
ref|WP_025905699.1|  MULTISPECIES: co-chaperone GrpE                    119   2e-27    
ref|WP_031217920.1|  co-chaperone GrpE                                  117   2e-27    
sp|Q9KWS8.1|GRPE_GEOTM  RecName: Full=Protein GrpE; AltName: Full...    119   2e-27    
ref|WP_025945542.1|  co-chaperone GrpE                                  119   2e-27    
ref|WP_036677097.1|  co-chaperone GrpE                                  118   2e-27    
ref|WP_036704736.1|  co-chaperone GrpE                                  117   2e-27    
ref|WP_017435622.1|  co-chaperone GrpE                                  118   3e-27    



>ref|XP_009592593.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Nicotiana 
tomentosiformis]
Length=354

 Score =   328 bits (841),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 195/299 (65%), Positives = 236/299 (79%), Gaps = 1/299 (0%)
 Frame = -2

Query  1094  HHSSGPAIRLPVSRSSGKFSLFASDGDVAETAQTepqeqdqvqdsevednqdVAPGSDDI  915
             HHS+   ++LP  RS  KF +FAS+GD AE AQTE QE +Q      ++       ++D 
Sbjct  53    HHSANTIVQLP-HRSVEKFIVFASNGDAAEAAQTETQEPEQEVQESEQEENVDGAAAEDA  111

Query  914   SNeadtttseetaSIVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllt  735
             S+E D   ++ETAS +  +L+ YRDAL  ND+SK+AE+E  LKSIE+EK+ L+RK+  LT
Sbjct  112   SDEGDNAAADETASFIATSLQLYRDALANNDDSKVAEIEISLKSIEEEKIELQRKVASLT  171

Query  734   eelsneKDRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVE  555
             EELS+E+DRVLRISADFDNFRKRTERERLS   NAQGEVVEKLL +LDNF+RAK QIKV 
Sbjct  172   EELSSERDRVLRISADFDNFRKRTERERLSLVKNAQGEVVEKLLSILDNFERAKMQIKVA  231

Query  554   SEGEEKINNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQ  375
             +EGEEKINNSYQSISK+F EILGSLGV  VETVGKPFDPLLHEAIMREDS EF+EGV+++
Sbjct  232   TEGEEKINNSYQSISKKFGEILGSLGVETVETVGKPFDPLLHEAIMREDSEEFEEGVVLE  291

Query  374   EFRKGFQLGERLLRPSMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPEGANETG  198
             E+RKGF+LG+RLLRPSMVKVSAGPGPAKPET++P EEQ    E +EEG ++  G   TG
Sbjct  292   EYRKGFKLGDRLLRPSMVKVSAGPGPAKPETAEPKEEQNEVEEKSEEGTAETAGDEGTG  350



>ref|XP_011070018.1| PREDICTED: grpE protein homolog, mitochondrial [Sesamum indicum]
Length=352

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 199/327 (61%), Positives = 241/327 (74%), Gaps = 14/327 (4%)
 Frame = -2

Query  1172  HNFSCVVSFprrrrassrlparcRVHHHS-SGPAIRLPVSRSSGKFSLFASDGDVAETAQ  996
             HN +CV SF   R   +R      +HH S    + +LP SRS+ KF  FA+DG+ AE   
Sbjct  32    HNLACV-SFIPSRLPVARCR----IHHTSYKRSSAKLP-SRSAHKFLTFAADGETAEAQT  85

Query  995   TepqeqdqvqdsevednqdVAPGS--DDISNeadtttseetaSIVMMALKSYRDALDTND  822
                ++          + +    G+  DD S+E+D   + E +S+V+ +L  Y++AL  ND
Sbjct  86    ETQEKDAVQGSESEPEIEGNTDGALDDDTSSESDNAVAGEPSSVVVASLNLYKEALANND  145

Query  821   ESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDNFRKRTERERLSS  642
             ESK+AE+E+FLKSIEDEK+ LERK+  L+EELS+E+DRVLRISADFDNFRKRTERERLS 
Sbjct  146   ESKVAEVESFLKSIEDEKIGLERKVATLSEELSSERDRVLRISADFDNFRKRTERERLSL  205

Query  641   FTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFVEILGSLGVTPVE  462
              TNAQGEVVE LL VLDNF+RAK QIKVE+EGEEKINNSYQSI KQF EILGSLGV PVE
Sbjct  206   VTNAQGEVVESLLSVLDNFERAKAQIKVETEGEEKINNSYQSIYKQFSEILGSLGVVPVE  265

Query  461   TVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVKVSAGPGPAKPET  282
             TVGKPFDP+LHEAIMREDS E+++G+II+E+RKGF LGERLLRPSMVKVSAGPGPAKPET
Sbjct  266   TVGKPFDPMLHEAIMREDSTEYEDGIIIEEYRKGFLLGERLLRPSMVKVSAGPGPAKPET  325

Query  281   SDPAEEQGGFIETAEEGGSQPEGANET  201
                +E Q    E  E GG   EG++ET
Sbjct  326   GGQSEVQE---EVNENGGG--EGSSET  347



>ref|XP_002530954.1| Protein grpE, putative [Ricinus communis]
 gb|EEF31426.1| Protein grpE, putative [Ricinus communis]
Length=356

 Score =   315 bits (806),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 165/222 (74%), Positives = 195/222 (88%), Gaps = 0/222 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            I++ +L+SYR+AL +NDE++IAE+EAFLKS+EDEK +L RK+  L EELS EKDRVLRIS
Sbjct  135  IILTSLRSYREALASNDEARIAEIEAFLKSVEDEKNDLGRKVASLIEELSTEKDRVLRIS  194

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRT+RERLS  +NAQGEVVE LLPVLDNF+RAK QIK+E+EGEEKINNSYQSI
Sbjct  195  ADFDNFRKRTDRERLSLVSNAQGEVVENLLPVLDNFERAKAQIKLETEGEEKINNSYQSI  254

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQFVEILGSLGV PVET+G PFDPLLHEAIMREDS EF+EG+I+QEFRKGF+LG+RLLR
Sbjct  255  YKQFVEILGSLGVVPVETIGNPFDPLLHEAIMREDSTEFEEGIILQEFRKGFKLGDRLLR  314

Query  332  PSMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPEGAN  207
            PSMVKVSAGPGPAKPE ++ + E     ET++EG  +PE A+
Sbjct  315  PSMVKVSAGPGPAKPEQAESSAEVETAGETSQEGSPEPESAS  356



>ref|XP_004249350.1| PREDICTED: grpE protein homolog, mitochondrial [Solanum lycopersicum]
Length=352

 Score =   312 bits (799),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 195/301 (65%), Positives = 235/301 (78%), Gaps = 7/301 (2%)
 Frame = -2

Query  1094  HHSSGPAIRLPVSRSSGKFSLFASDGDVAETAQTepqeqdqvqdsevednqdVAPGSDDI  915
             HHS+   + L   RS  KF +FAS+ DVAE A+TE + +   +  +       A  S++ 
Sbjct  56    HHSANSIVPLQ-HRSVEKFVIFASNEDVAEAAETETETEQVEESEQEGSLDGAA--SEEA  112

Query  914   SNeadtttseetaSIVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllt  735
             S+E D   +EET S+V  +L+ YRDAL TND+SK+AE+E  LKSIEDEK+ L+ K+  LT
Sbjct  113   SDEDDNAAAEETLSVVAASLQLYRDALATNDDSKVAEIEISLKSIEDEKIELQTKVASLT  172

Query  734   eelsneKDRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVE  555
             +ELS+E+DRVLRISADFDNFRKRT+RER S  TNAQGEVVEKLL V+DNF+RAKTQIKV 
Sbjct  173   KELSSERDRVLRISADFDNFRKRTDRERASLVTNAQGEVVEKLLSVMDNFERAKTQIKVA  232

Query  554   SEGEEKINNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQ  375
             +EGEEKINNSYQSISKQF+EILGSLGV PVETVGKPFDPLLHEAIMREDS EF EGV+I+
Sbjct  233   TEGEEKINNSYQSISKQFMEILGSLGVEPVETVGKPFDPLLHEAIMREDSSEFKEGVVIE  292

Query  374   EFRKGFQLGERLLRPSMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQP--EGANET  201
             E+RKGF+LG+RLLRPSMVKVSAGPGPAKPET++P E++   IET E+    P  EG  E 
Sbjct  293   EYRKGFRLGDRLLRPSMVKVSAGPGPAKPETTEPKEKEQ--IETDEKTAETPGDEGTGEG  350

Query  200   G  198
             G
Sbjct  351   G  351



>ref|XP_010036281.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Eucalyptus 
grandis]
 gb|KCW47811.1| hypothetical protein EUGRSUZ_K01549 [Eucalyptus grandis]
Length=333

 Score =   308 bits (790),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            V+++L+SY++AL +NDESK+AE+EAFLKSIEDEK  LE K+  L+ ELS E+DR+LRISA
Sbjct  113  VLISLQSYKEALASNDESKVAEIEAFLKSIEDEKSALESKVSRLSAELSVERDRILRISA  172

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DF+NFR+RTERERLS  TNAQGEVVE LLPVLDNF+RAK QIKVE+EGEEKINNSYQ+IS
Sbjct  173  DFENFRRRTERERLSLVTNAQGEVVENLLPVLDNFERAKAQIKVETEGEEKINNSYQNIS  232

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQF+EILGSLGV PVETVG PFDPLLHEAIMRE+S E++EG+I+QEFRKGF+LGERLLRP
Sbjct  233  KQFIEILGSLGVVPVETVGTPFDPLLHEAIMREESTEYEEGIILQEFRKGFKLGERLLRP  292

Query  329  SMVKVSAGPGPAKPETSDPAEEQ  261
            SMVKVSAGPGPAKPE +   EE+
Sbjct  293  SMVKVSAGPGPAKPEAAPATEEE  315



>ref|XP_003520909.1| PREDICTED: grpE protein homolog, mitochondrial-like [Glycine 
max]
Length=335

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 169/222 (76%), Positives = 190/222 (86%), Gaps = 2/222 (1%)
 Frame = -2

Query  866  MMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISAD  687
            ++ L+SY++AL  NDE KIAELE+ LKS+EDEK+ LE K+  L+EELS EKDR+LRISAD
Sbjct  114  LLLLQSYKEALANNDEVKIAELESSLKSVEDEKIELEVKIASLSEELSVEKDRILRISAD  173

Query  686  FDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISK  507
            FDNFRKRTER+RLS  TNAQGEVVE LLPVLDNFDRAKTQIKVE+EGEEKINNSYQSI K
Sbjct  174  FDNFRKRTERDRLSLVTNAQGEVVESLLPVLDNFDRAKTQIKVETEGEEKINNSYQSIYK  233

Query  506  QFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPS  327
            QF+EIL SLGV PVETVG PFDPLLHEAIMREDS EF++G+IIQEFRKGF+LGERLLRPS
Sbjct  234  QFIEILNSLGVEPVETVGTPFDPLLHEAIMREDSDEFEDGIIIQEFRKGFKLGERLLRPS  293

Query  326  MVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPEGANET  201
            MVKVSAGPGPAKPE   P EE G   E +E+   Q EG+ ET
Sbjct  294  MVKVSAGPGPAKPEQEAPQEEHGN-TEISED-SKQNEGSTET  333



>gb|KHN42170.1| Protein grpE [Glycine soja]
Length=332

 Score =   305 bits (782),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 169/222 (76%), Positives = 190/222 (86%), Gaps = 2/222 (1%)
 Frame = -2

Query  866  MMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISAD  687
            ++ L+SY++AL  NDE KIAELE+ LKS+EDEK+ LE K+  L+EELS EKDR+LRISAD
Sbjct  111  LLLLQSYKEALANNDEVKIAELESSLKSVEDEKIELEVKIASLSEELSVEKDRILRISAD  170

Query  686  FDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISK  507
            FDNFRKRTER+RLS  TNAQGEVVE LLPVLDNFDRAKTQIKVE+EGEEKINNSYQSI K
Sbjct  171  FDNFRKRTERDRLSLVTNAQGEVVESLLPVLDNFDRAKTQIKVETEGEEKINNSYQSIYK  230

Query  506  QFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPS  327
            QF+EIL SLGV PVETVG PFDPLLHEAIMREDS EF++G+IIQEFRKGF+LGERLLRPS
Sbjct  231  QFIEILNSLGVEPVETVGTPFDPLLHEAIMREDSDEFEDGIIIQEFRKGFKLGERLLRPS  290

Query  326  MVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPEGANET  201
            MVKVSAGPGPAKPE   P EE G   E +E+   Q EG+ ET
Sbjct  291  MVKVSAGPGPAKPEQEAPQEEHGN-TEISED-SKQNEGSTET  330



>ref|XP_009762578.1| PREDICTED: grpE protein homolog, mitochondrial [Nicotiana sylvestris]
Length=296

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 166/224 (74%), Positives = 191/224 (85%), Gaps = 0/224 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +  +L+ YRDAL  ND+SK+AE+E  LKSIE+EK+ L+RK+  LTEELS+E+DRVLRISA
Sbjct  69   IATSLQLYRDALANNDDSKVAEIEISLKSIENEKIELQRKVASLTEELSSERDRVLRISA  128

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTERERLS  TNAQGEVVEKLL VLDNF+RAK QIKV +EGEEKINNSYQSIS
Sbjct  129  DFDNFRKRTERERLSLVTNAQGEVVEKLLSVLDNFERAKMQIKVATEGEEKINNSYQSIS  188

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQF EILG LGV  VETVGKPFDPLLHEAIMREDS EF+EGV+++E+RKGF+LG+RLLRP
Sbjct  189  KQFGEILGYLGVETVETVGKPFDPLLHEAIMREDSEEFEEGVVLEEYRKGFKLGDRLLRP  248

Query  329  SMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPEGANETG  198
            SMVKVSAGPGPAKPET++P EEQ    E  EEG ++  G   TG
Sbjct  249  SMVKVSAGPGPAKPETAEPKEEQNKVEEKNEEGTAETAGDEGTG  292



>gb|KDO46641.1| hypothetical protein CISIN_1g019043mg [Citrus sinensis]
Length=221

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  866  MMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISAD  687
            M  L+SY++AL +ND++K AE+EA LKS EDEK++LERK++ L+EELS E+ R+LRISAD
Sbjct  1    METLQSYKEALASNDDTKAAEIEALLKSFEDEKIDLERKVVNLSEELSAERARILRISAD  60

Query  686  FDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISK  507
            FDNFRKRTE+ERLS  TNAQGEV+E+LL VLDNF+RAKTQIKV++EGEEKINNSYQSI K
Sbjct  61   FDNFRKRTEKERLSLVTNAQGEVMERLLQVLDNFERAKTQIKVQTEGEEKINNSYQSIYK  120

Query  506  QFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPS  327
            Q VEILGSLGV PVETVG PFDPLLHEAIMREDS EFDEGVII+EFRKGF+LG+RLLRPS
Sbjct  121  QLVEILGSLGVVPVETVGNPFDPLLHEAIMREDSTEFDEGVIIEEFRKGFKLGDRLLRPS  180

Query  326  MVKVSAGPGPAKPETSDPAEEQGGFIETAE  237
            MVKVSAGPGPAKP+   P+E +   +ETA+
Sbjct  181  MVKVSAGPGPAKPKEEQPSEGEAAVVETAD  210



>ref|XP_008240630.1| PREDICTED: grpE protein homolog, mitochondrial [Prunus mume]
 ref|XP_008240631.1| PREDICTED: grpE protein homolog, mitochondrial [Prunus mume]
Length=343

 Score =   301 bits (771),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 162/220 (74%), Positives = 191/220 (87%), Gaps = 0/220 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            ++ +L+ Y++AL +NDESK+AE+E+FLKSIEDEK++LE+K+  L+EELS EK R+LRISA
Sbjct  124  IIASLQLYKEALASNDESKVAEIESFLKSIEDEKISLEKKVASLSEELSAEKVRILRISA  183

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DF+NFRKRT+RER+S  TNAQGEVVE LLPV+DNF+RAKTQIKVE+EGEEKINNSYQSI 
Sbjct  184  DFENFRKRTDRERISLVTNAQGEVVESLLPVVDNFERAKTQIKVETEGEEKINNSYQSIY  243

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQF EIL SLGV PVETVGKPFDPLLHEAIMREDS EF+EGVII EFRKGF+LG+RLLRP
Sbjct  244  KQFGEILSSLGVVPVETVGKPFDPLLHEAIMREDSTEFEEGVIIDEFRKGFKLGDRLLRP  303

Query  329  SMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPEGA  210
            SMVKVSAGPGPAKPE   P  E+    ET +EG ++ E A
Sbjct  304  SMVKVSAGPGPAKPEQQVPPSEEQDASETTQEGSTETESA  343



>ref|XP_010942073.1| PREDICTED: grpE protein homolog, mitochondrial [Elaeis guineensis]
Length=328

 Score =   300 bits (769),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 162/217 (75%), Positives = 188/217 (87%), Gaps = 3/217 (1%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            VM++L+SY++AL  ND+SKIAE+EAFL+SIE EK +L  K+  L+ ELS E+DR+LRISA
Sbjct  109  VMVSLQSYKEALANNDQSKIAEIEAFLQSIEAEKNSLATKVATLSVELSMERDRILRISA  168

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTERERLS  TNAQGEV+E LLPVLDNF+RAKTQIKVE+EGEEKINNSYQSI 
Sbjct  169  DFDNFRKRTERERLSLMTNAQGEVIESLLPVLDNFERAKTQIKVETEGEEKINNSYQSIY  228

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQF+EIL SLGV  VETVG PFDPLLHEAIMRE+S+EF+EG+IIQEFRKGF++GERLLRP
Sbjct  229  KQFLEILNSLGVETVETVGNPFDPLLHEAIMREESMEFEEGIIIQEFRKGFKIGERLLRP  288

Query  329  SMVKVSAGPGPAKPE-TSDPAEEQGGFI--ETAEEGG  228
            SMVKVSAGPGPAKPE     A+E GG    E+ +EGG
Sbjct  289  SMVKVSAGPGPAKPEGGGSTADEHGGEASEESTKEGG  325



>ref|XP_008810324.1| PREDICTED: grpE protein homolog, mitochondrial-like, partial 
[Phoenix dactylifera]
Length=270

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            VM++L+SY++AL  ND+SKIAE+EAFL+SIE+EK +L  ++  L+EELS E+DR+LRISA
Sbjct  51   VMVSLQSYKEALANNDQSKIAEIEAFLQSIEEEKNSLATEVASLSEELSTERDRILRISA  110

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTERERLS  TNAQG+V+E LLPVLDNF+RAK+QIKVE+EGEEKINNSYQSI 
Sbjct  111  DFDNFRKRTERERLSLMTNAQGQVIESLLPVLDNFERAKSQIKVETEGEEKINNSYQSIY  170

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQF+EI  SLGV  VETVG PFDPLLHEAIMRE+S+EF+EG+IIQEFRKGF+LGERLLRP
Sbjct  171  KQFLEIFDSLGVETVETVGNPFDPLLHEAIMREESMEFEEGIIIQEFRKGFKLGERLLRP  230

Query  329  SMVKVSAGPGPAKPET-SDPAEEQGG  255
            SMVKVSAGPGPAKPE    PA+E  G
Sbjct  231  SMVKVSAGPGPAKPEDGGSPADEGSG  256



>ref|XP_006339226.1| PREDICTED: grpE protein homolog, mitochondrial-like [Solanum 
tuberosum]
Length=357

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 184/267 (69%), Positives = 220/267 (82%), Gaps = 2/267 (1%)
 Frame = -2

Query  1094  HHSSGPAIRLPVSRSSGKFSLFASDGDVAETAQTepqeqdqvqdsevednqdVAPGSDDI  915
             HHS+   ++    RS  KF +FAS+ DVAE A+TE  E  QV +SE E+N D A  S++ 
Sbjct  56    HHSANSIVQFQ-HRSVEKFVIFASNEDVAEAAETETLEPQQVDESEQEENLDGA-ASEEA  113

Query  914   SNeadtttseetaSIVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllt  735
             S+E D   +EET S+V  +L+ YRDAL  ND+SK+AE+E  LKSIEDEK+ L+ K+  LT
Sbjct  114   SDEDDNAAAEETLSVVATSLQLYRDALANNDDSKVAEIEISLKSIEDEKIELQTKVASLT  173

Query  734   eelsneKDRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVE  555
             EELS+E+DRVLRISADFDNFRKRT+RER S  TNAQGEVVEKLL V+DNF+RAK QIKV 
Sbjct  174   EELSSERDRVLRISADFDNFRKRTDRERASLVTNAQGEVVEKLLSVMDNFERAKMQIKVA  233

Query  554   SEGEEKINNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQ  375
             +EGEEKI+NSYQSISKQF+EILGSLGV PVETVGKPFDPLLHEAIMREDS EF+EGV+++
Sbjct  234   TEGEEKISNSYQSISKQFMEILGSLGVEPVETVGKPFDPLLHEAIMREDSSEFEEGVVLE  293

Query  374   EFRKGFQLGERLLRPSMVKVSAGPGPA  294
             E+RKGF+LG+RLLRPSMVKVSAGPGPA
Sbjct  294   EYRKGFKLGDRLLRPSMVKVSAGPGPA  320



>ref|XP_007029907.1| Co-chaperone GrpE family protein [Theobroma cacao]
 gb|EOY10409.1| Co-chaperone GrpE family protein [Theobroma cacao]
Length=348

 Score =   299 bits (766),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            ++  L+SY++AL +NDESK+A++EAFLKSIEDEKV+LE K+  L EELS EKDR++RISA
Sbjct  113  IVSLLQSYKEALASNDESKVADIEAFLKSIEDEKVDLENKMASLLEELSIEKDRIIRISA  172

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTERERLS  TNAQGEV+E LLPVLDNF+RAK QIKVE+EGEEKINNSYQSI 
Sbjct  173  DFDNFRKRTERERLSLVTNAQGEVLENLLPVLDNFERAKAQIKVETEGEEKINNSYQSIC  232

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQF+EILGSLGV PVETVG PFDP+LHEAIMREDS EF+EG+I+QEFRKGF+LG+RLLRP
Sbjct  233  KQFMEILGSLGVEPVETVGNPFDPMLHEAIMREDSTEFEEGIILQEFRKGFKLGDRLLRP  292

Query  329  SMVKVSAGPGPAKPE  285
            SMVKVSAGPGPAKPE
Sbjct  293  SMVKVSAGPGPAKPE  307



>ref|XP_006484785.1| PREDICTED: grpE protein homolog, mitochondrial-like isoform X1 
[Citrus sinensis]
Length=344

 Score =   299 bits (765),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 189/219 (86%), Gaps = 0/219 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +M  L+SY++AL +ND++K AE+EA LKS EDEK++LERK++ L+EELS E+ R+LRISA
Sbjct  123  IMETLQSYKEALASNDDTKAAEIEALLKSFEDEKIDLERKVVNLSEELSAERARILRISA  182

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTE+ERLS  TNAQGEV+E+LL VLDNF+RAKTQIKV++EGEEKINNSYQSI 
Sbjct  183  DFDNFRKRTEKERLSLVTNAQGEVMERLLQVLDNFERAKTQIKVQTEGEEKINNSYQSIY  242

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQ VEILGSLGV PVETVG PFDPLLHEAIMREDS EFDEGVII+EFRKGF+LG+RLLRP
Sbjct  243  KQLVEILGSLGVVPVETVGNPFDPLLHEAIMREDSTEFDEGVIIEEFRKGFKLGDRLLRP  302

Query  329  SMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPEG  213
            SMVKVSAGPGPAKP+   P+E +   +ETA+    + E 
Sbjct  303  SMVKVSAGPGPAKPKEEQPSEGEAAVVETADSSTEEVEA  341



>gb|KDO46639.1| hypothetical protein CISIN_1g019043mg [Citrus sinensis]
Length=347

 Score =   299 bits (765),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 189/219 (86%), Gaps = 0/219 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +M  L+SY++AL +ND++K AE+EA LKS EDEK++LERK++ L+EELS E+ R+LRISA
Sbjct  126  IMETLQSYKEALASNDDTKAAEIEALLKSFEDEKIDLERKVVNLSEELSAERARILRISA  185

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTE+ERLS  TNAQGEV+E+LL VLDNF+RAKTQIKV++EGEEKINNSYQSI 
Sbjct  186  DFDNFRKRTEKERLSLVTNAQGEVMERLLQVLDNFERAKTQIKVQTEGEEKINNSYQSIY  245

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQ VEILGSLGV PVETVG PFDPLLHEAIMREDS EFDEGVII+EFRKGF+LG+RLLRP
Sbjct  246  KQLVEILGSLGVVPVETVGNPFDPLLHEAIMREDSTEFDEGVIIEEFRKGFKLGDRLLRP  305

Query  329  SMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPEG  213
            SMVKVSAGPGPAKP+   P+E +   +ETA+    + E 
Sbjct  306  SMVKVSAGPGPAKPKEEQPSEGEAAVVETADSSTEEVEA  344



>gb|KDP39624.1| hypothetical protein JCGZ_02644 [Jatropha curcas]
Length=350

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 190/215 (88%), Gaps = 8/215 (4%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            +++ +L+SY++AL +NDESKI E+EAFLKS+EDEK+NLE+K++ L+++LS EKDR+LRIS
Sbjct  124  VILASLQSYKEALASNDESKIVEIEAFLKSVEDEKINLEQKVVSLSQDLSTEKDRILRIS  183

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTERERLS  TNAQGEVVE LLPVLDNF+RAK+QIK+E+EGEEKINNSYQSI
Sbjct  184  ADFDNFRKRTERERLSLLTNAQGEVVESLLPVLDNFERAKSQIKLETEGEEKINNSYQSI  243

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQFVEILGSLGV PVET+GKPFDPLL EAIMREDS EF+EG+I+ EFRKGF+LG+RLLR
Sbjct  244  YKQFVEILGSLGVVPVETIGKPFDPLLQEAIMREDSTEFEEGIILDEFRKGFKLGDRLLR  303

Query  332  PSMVKVSAGPGPAKPETSDPAEEQG--GFIETAEE  234
            P+MVKVSAGPGPAK      AEE G  G  ETA E
Sbjct  304  PAMVKVSAGPGPAK------AEEAGSPGEAETASE  332



>ref|XP_002267243.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Vitis 
vinifera]
Length=338

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 162/220 (74%), Positives = 191/220 (87%), Gaps = 1/220 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +++AL+SY++AL +NDESK AE+EAF+K IEDEK++LE+K+  L+EELS++K+R+LRISA
Sbjct  116  IIVALRSYKEALVSNDESKAAEIEAFIKFIEDEKIDLEKKVAALSEELSSDKERILRISA  175

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRT+RERLS  TNAQGEV+E LLPVLDNF+RAK QIKVE+EGEEKINNSYQSI 
Sbjct  176  DFDNFRKRTDRERLSLVTNAQGEVLENLLPVLDNFERAKAQIKVETEGEEKINNSYQSIY  235

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQFVEILGSLGVTPVET+G PFDPL HEAIMREDS EF+E VIIQEFRKGF+LG+RLLRP
Sbjct  236  KQFVEILGSLGVTPVETIGNPFDPLFHEAIMREDSTEFEEDVIIQEFRKGFKLGDRLLRP  295

Query  329  SMVKVSAGPGPAKPETSDPAEEQGGFI-ETAEEGGSQPEG  213
            SMVKVSAGPGPAK E    +EE+   + ET   G   PEG
Sbjct  296  SMVKVSAGPGPAKAEAVGSSEEEAVRVTETETSGEGTPEG  335



>ref|XP_010245792.1| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Nelumbo 
nucifera]
Length=327

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 161/218 (74%), Positives = 186/218 (85%), Gaps = 1/218 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            ++  L++Y++AL  NDE K+AE+EA L+SIEDEK++L  K+  L+EE+S EKDR+LRISA
Sbjct  108  ILPLLETYKEALVGNDEPKVAEIEALLQSIEDEKISLANKVATLSEEMSMEKDRILRISA  167

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTERERLS  TNAQGEVVE LLPVLDNF+RAK+QIKVE+EGEEKINNSYQSI 
Sbjct  168  DFDNFRKRTERERLSLVTNAQGEVVESLLPVLDNFERAKSQIKVETEGEEKINNSYQSIC  227

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQF+EILGSLGV PVETVG  FDPLLHEAIMREDS EF+EG+IIQEFRKGF+LG+RLLRP
Sbjct  228  KQFIEILGSLGVVPVETVGNNFDPLLHEAIMREDSTEFEEGIIIQEFRKGFKLGDRLLRP  287

Query  329  SMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPE  216
            SMVKVSAGPGPAKP+   P E+  G  E  EEG  Q E
Sbjct  288  SMVKVSAGPGPAKPQEG-PLEDDDGSSERTEEGRMQGE  324



>ref|XP_010245791.1| PREDICTED: uncharacterized protein LOC104589240 isoform X1 [Nelumbo 
nucifera]
Length=364

 Score =   298 bits (763),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 161/218 (74%), Positives = 186/218 (85%), Gaps = 1/218 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            ++  L++Y++AL  NDE K+AE+EA L+SIEDEK++L  K+  L+EE+S EKDR+LRISA
Sbjct  145  ILPLLETYKEALVGNDEPKVAEIEALLQSIEDEKISLANKVATLSEEMSMEKDRILRISA  204

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTERERLS  TNAQGEVVE LLPVLDNF+RAK+QIKVE+EGEEKINNSYQSI 
Sbjct  205  DFDNFRKRTERERLSLVTNAQGEVVESLLPVLDNFERAKSQIKVETEGEEKINNSYQSIC  264

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQF+EILGSLGV PVETVG  FDPLLHEAIMREDS EF+EG+IIQEFRKGF+LG+RLLRP
Sbjct  265  KQFIEILGSLGVVPVETVGNNFDPLLHEAIMREDSTEFEEGIIIQEFRKGFKLGDRLLRP  324

Query  329  SMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPE  216
            SMVKVSAGPGPAKP+   P E+  G  E  EEG  Q E
Sbjct  325  SMVKVSAGPGPAKPQEG-PLEDDDGSSERTEEGRMQGE  361



>ref|XP_003554067.1| PREDICTED: grpE protein homolog, mitochondrial-like isoform X1 
[Glycine max]
 gb|KHN34620.1| Protein grpE [Glycine soja]
Length=338

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 168/222 (76%), Positives = 188/222 (85%), Gaps = 2/222 (1%)
 Frame = -2

Query  866  MMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISAD  687
            ++ L+SYR+AL  NDE KIAELE+ LKSIEDEK+ LE K+  L+EELS EKDR+LRISAD
Sbjct  116  LVILQSYREALANNDEVKIAELESSLKSIEDEKIELEGKIASLSEELSIEKDRILRISAD  175

Query  686  FDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISK  507
            FDNFRKRTER+RLS  TNAQGEVVE LLPVLDNF+RAKTQIKVE+EGEEKINNSYQSI K
Sbjct  176  FDNFRKRTERDRLSLVTNAQGEVVESLLPVLDNFERAKTQIKVETEGEEKINNSYQSIYK  235

Query  506  QFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPS  327
            QF EIL SLGV PVETVG PFDPLLHEAIMREDS EF++G+IIQEFRKGF+LG+RLLRPS
Sbjct  236  QFNEILTSLGVEPVETVGTPFDPLLHEAIMREDSDEFEDGIIIQEFRKGFKLGDRLLRPS  295

Query  326  MVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPEGANET  201
            MVKVSAGPGPAKPE   P EEQ    E +E+     EG+ ET
Sbjct  296  MVKVSAGPGPAKPEQEAPQEEQVN-TEISEDSKEN-EGSTET  335



>ref|XP_007202333.1| hypothetical protein PRUPE_ppa008162mg [Prunus persica]
 gb|EMJ03532.1| hypothetical protein PRUPE_ppa008162mg [Prunus persica]
Length=343

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            ++ +L+ Y++AL +NDESK+AE+E+FLK IEDEK++LE+K+  L+EELS EK R+LRISA
Sbjct  124  IIASLQLYKEALASNDESKVAEIESFLKYIEDEKISLEKKVASLSEELSAEKVRILRISA  183

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DF+NFRKRT+RER+S  TNAQGEVVE LLPV+DNF+RAKTQIKVE+EGEEKINNSYQSI 
Sbjct  184  DFENFRKRTDRERISLVTNAQGEVVESLLPVVDNFERAKTQIKVETEGEEKINNSYQSIY  243

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQF EIL SLGV PVETVGKPFDPLLHEAIMREDS EF+EGVII EFRKGF+LG+RLLRP
Sbjct  244  KQFGEILSSLGVVPVETVGKPFDPLLHEAIMREDSTEFEEGVIIDEFRKGFKLGDRLLRP  303

Query  329  SMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPEGA  210
            SMVKVSAGPGPAKP+   P  E+    ET +EG ++ E A
Sbjct  304  SMVKVSAGPGPAKPDQQVPPSEEQDASETTKEGSTETESA  343



>ref|XP_011047049.1| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Populus 
euphratica]
Length=337

 Score =   296 bits (758),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 187/219 (85%), Gaps = 0/219 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            +VM +L+SY++AL +NDES IAE+EAFLKSIEDEK++ ERK+  LTEELS E++RVLRIS
Sbjct  116  VVMASLRSYKEALASNDESIIAEIEAFLKSIEDEKIDNERKVASLTEELSIERERVLRIS  175

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTERERLS  TNAQGEVVE LL VLDNF+RAKTQIK  +EGEEKINNSYQ+I
Sbjct  176  ADFDNFRKRTERERLSLVTNAQGEVVENLLSVLDNFERAKTQIKTATEGEEKINNSYQNI  235

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQF+EILGSLGV PVETVGKPFDP+LHEAIMREDS E +EG +++E+RKGF+LG+RLLR
Sbjct  236  YKQFMEILGSLGVVPVETVGKPFDPMLHEAIMREDSDELEEGTVLEEYRKGFKLGDRLLR  295

Query  332  PSMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPE  216
            PSMVKVSAGPGP KPE  + ++E+        EGGS  E
Sbjct  296  PSMVKVSAGPGPVKPEQVEESQEEAEATSGTSEGGSTEE  334



>ref|XP_011047048.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Populus 
euphratica]
Length=338

 Score =   296 bits (758),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 187/219 (85%), Gaps = 0/219 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            +VM +L+SY++AL +NDES IAE+EAFLKSIEDEK++ ERK+  LTEELS E++RVLRIS
Sbjct  117  VVMASLRSYKEALASNDESIIAEIEAFLKSIEDEKIDNERKVASLTEELSIERERVLRIS  176

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTERERLS  TNAQGEVVE LL VLDNF+RAKTQIK  +EGEEKINNSYQ+I
Sbjct  177  ADFDNFRKRTERERLSLVTNAQGEVVENLLSVLDNFERAKTQIKTATEGEEKINNSYQNI  236

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQF+EILGSLGV PVETVGKPFDP+LHEAIMREDS E +EG +++E+RKGF+LG+RLLR
Sbjct  237  YKQFMEILGSLGVVPVETVGKPFDPMLHEAIMREDSDELEEGTVLEEYRKGFKLGDRLLR  296

Query  332  PSMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPE  216
            PSMVKVSAGPGP KPE  + ++E+        EGGS  E
Sbjct  297  PSMVKVSAGPGPVKPEQVEESQEEAEATSGTSEGGSTEE  335



>ref|XP_006437270.1| hypothetical protein CICLE_v10031794mg [Citrus clementina]
 gb|ESR50510.1| hypothetical protein CICLE_v10031794mg [Citrus clementina]
Length=387

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 158/220 (72%), Positives = 187/220 (85%), Gaps = 0/220 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
             +M   +SY++AL +ND++K AE+EA LKS EDEK++LERK++ L+EELS E+ R+LRIS
Sbjct  165  FIMETFQSYKEALASNDDTKAAEIEALLKSFEDEKIDLERKVVNLSEELSAERARILRIS  224

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTE+ERLS  TNAQGEV+E+LL VLDNF+RAKTQIKV++EGEEKINNSYQSI
Sbjct  225  ADFDNFRKRTEKERLSLVTNAQGEVMERLLQVLDNFERAKTQIKVQTEGEEKINNSYQSI  284

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQ VEILGSLGV PVETVG PFDPLLHEAIMREDS EFDEGVII+EFRKGF+LG RLLR
Sbjct  285  YKQLVEILGSLGVVPVETVGNPFDPLLHEAIMREDSTEFDEGVIIEEFRKGFKLGNRLLR  344

Query  332  PSMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPEG  213
            PSMVKVSAGPGPAKP+   P+E +   +ETA+    + E 
Sbjct  345  PSMVKVSAGPGPAKPKEEQPSEGEAAVVETADSSTEEVEA  384



>ref|XP_009380787.1| PREDICTED: grpE protein homolog, mitochondrial-like [Musa acuminata 
subsp. malaccensis]
Length=327

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 183/214 (86%), Gaps = 0/214 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            V+++L+SY++AL  ND++K+AE+E+FL+SIEDEK +L  K+  L EELS E+DR+LRISA
Sbjct  111  VLLSLQSYKEALANNDQTKVAEIESFLQSIEDEKNSLSSKVAALAEELSTEQDRILRISA  170

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTERERLS  TN QGEV+E LLPVLDNF+RAKTQIKVE+EGEEKINNSYQSI 
Sbjct  171  DFDNFRKRTERERLSLMTNVQGEVIESLLPVLDNFERAKTQIKVETEGEEKINNSYQSIY  230

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQF+EIL SLGV  VETVG  FDP+LHEAIMRE+S+EF+EG++IQEFRKGF+LGERLLRP
Sbjct  231  KQFLEILTSLGVETVETVGSTFDPMLHEAIMREESMEFEEGIVIQEFRKGFKLGERLLRP  290

Query  329  SMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGG  228
            SMVKVSAGPGP K    +   E G   E++EEGG
Sbjct  291  SMVKVSAGPGPQKAVDENVVVEDGEASESSEEGG  324



>gb|EYU35657.1| hypothetical protein MIMGU_mgv1a009214mg [Erythranthe guttata]
Length=349

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            +V+ +L  Y++AL  ND+SK+AE+E+FLKSIEDEK++LE K+  L+EELS+EK RVLRIS
Sbjct  126  VVIASLNLYKEALANNDDSKVAEVESFLKSIEDEKLDLESKVAALSEELSDEKVRVLRIS  185

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTERERLS  TNA+GEVVE LLPVLDNF+RAK QIK+E+EGEEKINNSYQSI
Sbjct  186  ADFDNFRKRTERERLSLVTNAKGEVVESLLPVLDNFERAKAQIKIENEGEEKINNSYQSI  245

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
            SKQF EILGSLGV PVETVGKPFDP+LHEAIMREDS E+++G+II+++RKGFQLG+RLLR
Sbjct  246  SKQFAEILGSLGVVPVETVGKPFDPMLHEAIMREDSTEYEDGIIIEQYRKGFQLGDRLLR  305

Query  332  PSMVKVSAGPGPAKPE  285
            PSMVKVSAGPGP KPE
Sbjct  306  PSMVKVSAGPGPTKPE  321



>ref|XP_008351439.1| PREDICTED: LOW QUALITY PROTEIN: grpE protein homolog, mitochondrial-like 
[Malus domestica]
Length=271

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 182/213 (85%), Gaps = 0/213 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +  +L+ Y++AL +NDESK+AE+E+FLKS EDEK+ LE K+  L+EELS EK R+LRISA
Sbjct  40   ITASLQLYKEALASNDESKVAEIESFLKSFEDEKIGLEMKVASLSEELSAEKVRILRISA  99

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTERER+S  TNAQGEVVE LLPV+DNF+RAK+QIKVE+EGEEKINNSYQSI 
Sbjct  100  DFDNFRKRTERERISLVTNAQGEVVESLLPVVDNFERAKSQIKVEAEGEEKINNSYQSIY  159

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQF EIL SLGV PVETVGKPFDPLLHEAIMREDS E++EG+II EFRKGF+LG+RLLRP
Sbjct  160  KQFGEILNSLGVVPVETVGKPFDPLLHEAIMREDSSEYEEGIIIDEFRKGFKLGDRLLRP  219

Query  329  SMVKVSAGPGPAKPETSDPAEEQGGFIETAEEG  231
            SMVKVSAGPGPAK E   P  E+    ET E+G
Sbjct  220  SMVKVSAGPGPAKVEQEVPPSEEQDASETTEKG  252



>ref|XP_002319738.1| co-chaperone grpE family protein [Populus trichocarpa]
 gb|EEE95661.1| co-chaperone grpE family protein [Populus trichocarpa]
Length=342

 Score =   291 bits (746),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 186/219 (85%), Gaps = 0/219 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            +VM +L+SY++AL +NDES IAE+EAFLKS+EDEK++ ERK+  LTEELS EK+RVLRIS
Sbjct  121  VVMASLRSYKEALASNDESIIAEIEAFLKSVEDEKIDNERKVASLTEELSIEKERVLRIS  180

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTERERLS  TNAQGEVVE LL VLDNF+RAKTQIK  +EGEEKINNSYQ+I
Sbjct  181  ADFDNFRKRTERERLSLVTNAQGEVVENLLSVLDNFERAKTQIKTATEGEEKINNSYQNI  240

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQF+EIL SLGV PVET+GKPFDP+LHEAIMREDS  F+EG +++E+RKGF+LG+RLLR
Sbjct  241  YKQFMEILVSLGVVPVETIGKPFDPMLHEAIMREDSDAFEEGTVLEEYRKGFKLGDRLLR  300

Query  332  PSMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPE  216
            PSMVKVSAGPGP KPE  + ++E+        EGGS  E
Sbjct  301  PSMVKVSAGPGPVKPEQVEESQEEAEATSGTSEGGSTEE  339



>ref|XP_004493254.1| PREDICTED: protein GrpE-like isoform X1 [Cicer arietinum]
Length=333

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 177/203 (87%), Gaps = 0/203 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +++ L+SY++AL  NDE K+AELE+ LKSI+DE V LE K+  L+EELS EKDR LRI A
Sbjct  110  LIVLLQSYKEALANNDEVKVAELESSLKSIDDEIVGLEGKIASLSEELSIEKDRKLRIGA  169

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDN+RKRTER+RLS  TNAQGEVVE LLPVLDNF+RAK QIKVE+EGEEKINNSYQSI 
Sbjct  170  DFDNYRKRTERDRLSLVTNAQGEVVESLLPVLDNFERAKAQIKVETEGEEKINNSYQSIY  229

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQF+EIL SLGV PVETVGKPFDP+LHEAIMREDS EF++G+IIQEFRKGFQLG+RLLRP
Sbjct  230  KQFIEILNSLGVEPVETVGKPFDPMLHEAIMREDSAEFEDGIIIQEFRKGFQLGDRLLRP  289

Query  329  SMVKVSAGPGPAKPETSDPAEEQ  261
            SMVKVSAGPGPAKPE     EEQ
Sbjct  290  SMVKVSAGPGPAKPEQEVSQEEQ  312



>ref|XP_004493255.1| PREDICTED: protein GrpE-like isoform X2 [Cicer arietinum]
Length=331

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 177/203 (87%), Gaps = 0/203 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +++ L+SY++AL  NDE K+AELE+ LKSI+DE V LE K+  L+EELS EKDR LRI A
Sbjct  108  LIVLLQSYKEALANNDEVKVAELESSLKSIDDEIVGLEGKIASLSEELSIEKDRKLRIGA  167

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDN+RKRTER+RLS  TNAQGEVVE LLPVLDNF+RAK QIKVE+EGEEKINNSYQSI 
Sbjct  168  DFDNYRKRTERDRLSLVTNAQGEVVESLLPVLDNFERAKAQIKVETEGEEKINNSYQSIY  227

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQF+EIL SLGV PVETVGKPFDP+LHEAIMREDS EF++G+IIQEFRKGFQLG+RLLRP
Sbjct  228  KQFIEILNSLGVEPVETVGKPFDPMLHEAIMREDSAEFEDGIIIQEFRKGFQLGDRLLRP  287

Query  329  SMVKVSAGPGPAKPETSDPAEEQ  261
            SMVKVSAGPGPAKPE     EEQ
Sbjct  288  SMVKVSAGPGPAKPEQEVSQEEQ  310



>ref|XP_007161911.1| hypothetical protein PHAVU_001G108000g [Phaseolus vulgaris]
 gb|ESW33905.1| hypothetical protein PHAVU_001G108000g [Phaseolus vulgaris]
Length=333

 Score =   288 bits (737),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 188/224 (84%), Gaps = 6/224 (3%)
 Frame = -2

Query  866  MMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISAD  687
            ++ L+SY++AL +NDE KI ELE+ LKSIEDE+ +LE K+  L+EELS EK R+LRISAD
Sbjct  111  VLLLQSYKEALASNDEVKITELESSLKSIEDEQKDLEGKIAALSEELSIEKVRILRISAD  170

Query  686  FDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISK  507
            FDNFRKRTER+RLS  TNAQGEVVE LLPVLDNF+RAKTQIKVE+EGEEK+NNSYQSI K
Sbjct  171  FDNFRKRTERDRLSLVTNAQGEVVESLLPVLDNFERAKTQIKVETEGEEKVNNSYQSIYK  230

Query  506  QFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPS  327
            QF EIL SLGV PVET+G PFDPLLHEAIMREDS EF++G+IIQEFRKGF+LG+RLLRPS
Sbjct  231  QFNEILTSLGVEPVETIGTPFDPLLHEAIMREDSAEFEDGIIIQEFRKGFKLGDRLLRPS  290

Query  326  MVKVSAGPGPAKPETSDPAEEQGGFIETAE-----EGGSQPEGA  210
            MVKVSAGPGPAKPE   P E++    E +E     EGG++ + A
Sbjct  291  MVKVSAGPGPAKPEQEAPQEDKVN-TEISEDSKEIEGGTEADSA  333



>ref|XP_010549722.1| PREDICTED: grpE protein homolog, mitochondrial-like [Tarenaya 
hassleriana]
Length=339

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 184/225 (82%), Gaps = 6/225 (3%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            +VM  L+SY++AL  NDE K+AE+EA LK+IEDEK+ L +K+  L++ELS E+DRVLRIS
Sbjct  117  VVMALLQSYKEALANNDEGKVAEIEASLKAIEDEKIQLGKKIASLSDELSVERDRVLRIS  176

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTERERLS  +NAQGEVVE LL VLDNF+RAKTQIKVESEGEEKI NSYQSI
Sbjct  177  ADFDNFRKRTERERLSLVSNAQGEVVENLLSVLDNFERAKTQIKVESEGEEKITNSYQSI  236

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQFVEILGSLGV PVETVGK FDP+ HEAIMREDS EF+EG+I++E+RKGF LG+RLLR
Sbjct  237  YKQFVEILGSLGVVPVETVGKQFDPMQHEAIMREDSSEFEEGIILEEYRKGFMLGDRLLR  296

Query  332  PSMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPEGANETG  198
            PSMVKVSAGPGPAK    D  E+ GG     E G S  EG +E  
Sbjct  297  PSMVKVSAGPGPAKAHQED--EKPGG----EEAGESNKEGEDEAA  335



>ref|XP_008455767.1| PREDICTED: grpE protein homolog, mitochondrial [Cucumis melo]
Length=335

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 187/224 (83%), Gaps = 0/224 (0%)
 Frame = -2

Query  935  APGSDDISNeadtttseetaSIVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnle  756
            A   +DIS++++    + T S+++ AL+SY+ AL  N+ ++I E+E+FLKSIEDEK+ +E
Sbjct  97   ATSDNDISDDSEVNAEDSTQSVIVAALQSYKQALSDNNGAQIVEIESFLKSIEDEKLAVE  156

Query  755  rkllllteelsneKDRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRA  576
            RKL  L EELS EKDRVLRISADFDNFRKRTERERLS   NAQGEVVE LL VLDNF+RA
Sbjct  157  RKLNSLIEELSVEKDRVLRISADFDNFRKRTERERLSLVKNAQGEVVETLLGVLDNFERA  216

Query  575  KTQIKVESEGEEKINNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEF  396
            + QIKVE+EGEEKIN SYQSI KQF EILGSLGV PVET+GKPFDPLLHEAIMREDS EF
Sbjct  217  RAQIKVETEGEEKINQSYQSIYKQFTEILGSLGVVPVETIGKPFDPLLHEAIMREDSTEF  276

Query  395  DEGVIIQEFRKGFQLGERLLRPSMVKVSAGPGPAKPETSDPAEE  264
            ++G+I+ EFRKGF LG+RLLRPSMVKVSAGPGP K + + PAEE
Sbjct  277  EDGIILDEFRKGFLLGDRLLRPSMVKVSAGPGPEKSDETAPAEE  320



>ref|XP_004144308.1| PREDICTED: protein GrpE-like [Cucumis sativus]
 gb|KGN54657.1| hypothetical protein Csa_4G417510 [Cucumis sativus]
Length=335

 Score =   286 bits (732),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 188/224 (84%), Gaps = 0/224 (0%)
 Frame = -2

Query  935  APGSDDISNeadtttseetaSIVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnle  756
            A   +DIS++++  T + T S+++ AL+SY+ AL  ND +++ E+E+FLKSIEDEK+ +E
Sbjct  97   ATSDNDISDDSEVNTEDSTQSVIIAALQSYKQALADNDGAQMVEIESFLKSIEDEKLAVE  156

Query  755  rkllllteelsneKDRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRA  576
            RKL  L EELS EKDRVLRISADFDNFRKRTERERLS   NAQGEVVE LL VLDNF+RA
Sbjct  157  RKLSSLIEELSVEKDRVLRISADFDNFRKRTERERLSLVKNAQGEVVETLLGVLDNFERA  216

Query  575  KTQIKVESEGEEKINNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEF  396
            + QIKVE+EGEEKIN SYQSI KQF EILGSLGV PVET+GKPFDPLLHEAIMREDS EF
Sbjct  217  RAQIKVETEGEEKINQSYQSIYKQFTEILGSLGVVPVETIGKPFDPLLHEAIMREDSTEF  276

Query  395  DEGVIIQEFRKGFQLGERLLRPSMVKVSAGPGPAKPETSDPAEE  264
            +EG+I+ EFRKGF LG+RLLRPSMVKVSAGPGP K + + PAE+
Sbjct  277  EEGIILDEFRKGFLLGDRLLRPSMVKVSAGPGPEKSDETAPAEK  320



>ref|XP_004157987.1| PREDICTED: protein GrpE-like [Cucumis sativus]
Length=335

 Score =   286 bits (731),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 188/224 (84%), Gaps = 0/224 (0%)
 Frame = -2

Query  935  APGSDDISNeadtttseetaSIVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnle  756
            A   +DIS++++  T + T S+++ AL+SY+ AL  ND +++ E+E+FLKSIEDEK+ +E
Sbjct  97   ATSDNDISDDSEVNTEDSTQSVIVAALQSYKQALADNDGAQMVEIESFLKSIEDEKLAVE  156

Query  755  rkllllteelsneKDRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRA  576
            RKL  L EELS EKDRVLRISADFDNFRKRTERERLS   NAQGEVVE LL VLDNF+RA
Sbjct  157  RKLSSLIEELSVEKDRVLRISADFDNFRKRTERERLSLVKNAQGEVVETLLGVLDNFERA  216

Query  575  KTQIKVESEGEEKINNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEF  396
            + QIKVE+EGEEKIN SYQSI KQF EILGSLGV PVET+GKPFDPLLHEAIMREDS EF
Sbjct  217  RAQIKVETEGEEKINQSYQSIYKQFTEILGSLGVVPVETIGKPFDPLLHEAIMREDSTEF  276

Query  395  DEGVIIQEFRKGFQLGERLLRPSMVKVSAGPGPAKPETSDPAEE  264
            +EG+I+ EFRKGF LG+RLLRPSMVKVSAGPGP K + + PAE+
Sbjct  277  EEGIILDEFRKGFLLGDRLLRPSMVKVSAGPGPEKSDETAPAEK  320



>ref|XP_006829866.1| hypothetical protein AMTR_s00119p00133730 [Amborella trichopoda]
 gb|ERM97282.1| hypothetical protein AMTR_s00119p00133730 [Amborella trichopoda]
Length=255

 Score =   281 bits (718),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 176/209 (84%), Gaps = 7/209 (3%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            V  +L+SYR+AL  NDES + E+E FL+SIE EK +L  K+  L+EELS+E+DRVLRISA
Sbjct  30   VKASLESYREALANNDESTLVEIEKFLQSIEVEKNSLSNKVAALSEELSSERDRVLRISA  89

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTERERLS  +NAQGEV+E LLP+LDNF+RAK QIKVE+EGEEKINNSYQSI 
Sbjct  90   DFDNFRKRTERERLSLVSNAQGEVIENLLPILDNFERAKAQIKVETEGEEKINNSYQSIY  149

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQFVEI+ SLGV  V+TVG PFDPLLHEAIMREDS EF+E +I+QEFRKGF+LG+RLLRP
Sbjct  150  KQFVEIMVSLGVVGVDTVGNPFDPLLHEAIMREDSTEFEESIILQEFRKGFKLGDRLLRP  209

Query  329  SMVKVSAGPGPAKP-------ETSDPAEE  264
            SMVKVSAGPGPAKP        + +PAEE
Sbjct  210  SMVKVSAGPGPAKPTDEVDSSASKEPAEE  238



>gb|KHG05284.1| Protein grpE [Gossypium arboreum]
Length=342

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            ++  L++Y++AL +NDESK+A++EAFL SIEDEKV+LE+K+  L+EELS EK+RVLRISA
Sbjct  115  IVSLLQTYKEALASNDESKVADIEAFLNSIEDEKVDLEKKMASLSEELSIEKERVLRISA  174

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTERERLS  +N QGEV+E LLPVLDNF+RAK QIK+E+EGEEKI+NSYQSI 
Sbjct  175  DFDNFRKRTERERLSLVSNTQGEVLENLLPVLDNFERAKAQIKIETEGEEKISNSYQSIY  234

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQF+EIL SLGV PVETVG  FDP+LHEAIMREDS EF+EG+I+QEFRKGF+LGERLLRP
Sbjct  235  KQFMEILSSLGVEPVETVGNLFDPMLHEAIMREDSTEFEEGIILQEFRKGFKLGERLLRP  294

Query  329  SMVKVSAGPGPAKPETSDPAE  267
            SMVKVSAGPGPAKPE  +  E
Sbjct  295  SMVKVSAGPGPAKPEQGESPE  315



>ref|XP_004287210.1| PREDICTED: protein GrpE-like [Fragaria vesca subsp. vesca]
Length=335

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 181/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            V+ +L+ Y++AL +NDESK+AE+E+FLKSIEDEK+ LE K+  L+EELS EK R+LRISA
Sbjct  117  VIASLQLYKEALASNDESKVAEIESFLKSIEDEKIGLEMKVASLSEELSAEKVRILRISA  176

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRT+RER+S  TNAQGEVVE LL VLDNF+RAK+QIK+E+EGEEKIN SYQSI 
Sbjct  177  DFDNFRKRTDRERVSLVTNAQGEVVESLLGVLDNFERAKSQIKIETEGEEKINKSYQSIY  236

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQF EIL SLGV PVETVGKPFDP+ HEAIMREDS EF+EG+I+ EFRKGF+LG+RLLRP
Sbjct  237  KQFGEILSSLGVLPVETVGKPFDPVFHEAIMREDSSEFEEGIILDEFRKGFKLGDRLLRP  296

Query  329  SMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGG  228
            +MVKVSAGPGPAKPE       +   IET E+G 
Sbjct  297  AMVKVSAGPGPAKPEQQVAPSVEDDAIETTEDGA  330



>ref|XP_010687147.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=342

 Score =   281 bits (720),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 179/212 (84%), Gaps = 0/212 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            V+ AL+ Y++AL+ NDE+ + ELEAF KSIEDEK  LERK+  ++E+LS E+DRVLRI A
Sbjct  117  VITALQLYKEALNNNDETTVGELEAFFKSIEDEKEMLERKVASMSEDLSVERDRVLRIGA  176

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTERER S  TNA+GEV+E  L VLDNF+RAK+QIK+ESE EEKI+NSYQSI 
Sbjct  177  DFDNFRKRTERERSSLVTNAKGEVIENFLGVLDNFERAKSQIKIESEAEEKISNSYQSIY  236

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQFVEILGS+GV PVETVGKPFDPLLHEAIMREDS  +DEGV+I+E+RKGF+LG+RLLRP
Sbjct  237  KQFVEILGSVGVVPVETVGKPFDPLLHEAIMREDSSVYDEGVVIEEYRKGFKLGDRLLRP  296

Query  329  SMVKVSAGPGPAKPETSDPAEEQGGFIETAEE  234
            SMVKVSAGPG  KPET + + +  G  E +EE
Sbjct  297  SMVKVSAGPGQEKPETVESSVQNEGPTEDSEE  328



>ref|XP_009353046.1| PREDICTED: grpE protein homolog, mitochondrial, partial [Pyrus 
x bretschneideri]
Length=335

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 178/213 (84%), Gaps = 0/213 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +  +L+ Y++AL +NDESK+ E+ +FLKS EDEK+ LE K+  L+EELS EK R+LRISA
Sbjct  119  ITASLQLYKEALASNDESKVTEIGSFLKSFEDEKIGLEMKVASLSEELSAEKVRILRISA  178

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTERER+S  TNAQGEVVE LLPV+DNF+RAK+QIKVE EGEEKINNSY+SI 
Sbjct  179  DFDNFRKRTERERISLVTNAQGEVVESLLPVVDNFERAKSQIKVEVEGEEKINNSYKSIY  238

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQF EIL SLGV PVE VGKPFDPLLHEAIMREDS E++EG+II EFRKGF+LG+RLLRP
Sbjct  239  KQFGEILNSLGVVPVELVGKPFDPLLHEAIMREDSSEYEEGIIIDEFRKGFKLGDRLLRP  298

Query  329  SMVKVSAGPGPAKPETSDPAEEQGGFIETAEEG  231
            SMVKVSAGPGPAK E   P  E+    ET E+G
Sbjct  299  SMVKVSAGPGPAKVEQEVPPSEEQDASETTEKG  331



>gb|EPS68474.1| hypothetical protein M569_06295, partial [Genlisea aurea]
Length=329

 Score =   277 bits (708),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 161/261 (62%), Positives = 211/261 (81%), Gaps = 4/261 (2%)
 Frame = -2

Query  1055  RSSGKFSLFASDGDVAETAQTepqeqdqvqdsevednqdVAP-GSDDISNeadtttseet  879
             RS  K SLFA +G   E+A+     Q++    E  + ++  P G+ D +  +  + +EE 
Sbjct  72    RSVPKLSLFAFNG---ESAEGRTDTQEKGPIPESSEEEEDEPQGNADSAAVSVESAAEEQ  128

Query  878   aSIVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLR  699
              S+++ +L+ Y++AL +ND  KIAE+E+FL+ IED+K++LER+++ LTEELS+EKDR++R
Sbjct  129   VSVILDSLQIYKEALASNDLPKIAEIESFLQKIEDDKLDLEREVVSLTEELSSEKDRIIR  188

Query  698   ISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQ  519
             ISADFDN+RKRTERER S  TNAQGEVVE+LL VLDNF+RAK QIKVE+E EEKI+NSYQ
Sbjct  189   ISADFDNYRKRTERERASLVTNAQGEVVERLLQVLDNFERAKAQIKVETESEEKISNSYQ  248

Query  518   SISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERL  339
             SI KQFVEILGSLGV PVETVGKPFDP+LHEAIMREDS  +++G++I+E+RKGF+LG+RL
Sbjct  249   SIYKQFVEILGSLGVVPVETVGKPFDPMLHEAIMREDSTAYEDGIVIEEYRKGFKLGDRL  308

Query  338   LRPSMVKVSAGPGPAKPETSD  276
             LRPSMVKVS+GPGP KPE +D
Sbjct  309   LRPSMVKVSSGPGPGKPEAND  329



>gb|EEE57358.1| hypothetical protein OsJ_07499 [Oryza sativa Japonica Group]
Length=332

 Score =   276 bits (705),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            +++ AL+SY++AL  +DE+K+AE+E FL SIE+EK +L  K+  L  EL+ E+DR+LRIS
Sbjct  107  VIVTALQSYKEALINDDETKVAEIEDFLFSIEEEKNSLLSKISTLGAELTTERDRILRIS  166

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDN+RKR ERE+LS  TN QGEV+E LLPVLDNF+RAKTQIKVE+E E KIN+SYQSI
Sbjct  167  ADFDNYRKRVEREKLSLMTNVQGEVIESLLPVLDNFERAKTQIKVETEQETKINDSYQSI  226

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQF++IL SLGV  VETVGKPFDP+LHEAIMRE+SVE++EGVI+QEFRKGF+LGERLLR
Sbjct  227  YKQFIDILNSLGVEDVETVGKPFDPMLHEAIMREESVEYEEGVILQEFRKGFKLGERLLR  286

Query  332  PSMVKVSAGPGPAKPETSDPA  270
            P+MVKVSAGPGP KP   DPA
Sbjct  287  PAMVKVSAGPGPEKPVYDDPA  307



>ref|XP_003575340.1| PREDICTED: grpE protein homolog, mitochondrial-like [Brachypodium 
distachyon]
Length=327

 Score =   275 bits (704),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 171/200 (86%), Gaps = 0/200 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            +++ AL+SY++AL    E+++AE+E+FL SIE+EK +L  ++  L  EL+ EKDR+LRIS
Sbjct  102  VLVTALQSYKEALMNEHEAQVAEIESFLLSIENEKNSLMSQITTLDAELTTEKDRILRIS  161

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDN+RKRTERE+LS  TN QGEVVE LLPVLDNF+RAKTQIKVE+E E KIN+SYQSI
Sbjct  162  ADFDNYRKRTEREKLSLMTNVQGEVVESLLPVLDNFERAKTQIKVETEREAKINDSYQSI  221

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQ +EIL SLGV  VETVGKPFDP+LHEAIMRE+SVE++EGVIIQEFRKGF+LGERLLR
Sbjct  222  YKQLIEILNSLGVEDVETVGKPFDPMLHEAIMREESVEYEEGVIIQEFRKGFKLGERLLR  281

Query  332  PSMVKVSAGPGPAKPETSDP  273
            P+MVKVSAGPGP K E  DP
Sbjct  282  PAMVKVSAGPGPEKSEDDDP  301



>gb|EEC73579.1| hypothetical protein OsI_08039 [Oryza sativa Indica Group]
Length=332

 Score =   276 bits (705),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            +++ AL+SY++AL  +DE+K+AE+E FL SIE+EK +L  K+  L  EL+ E+DR+LRIS
Sbjct  107  VIVTALQSYKEALINDDETKVAEIEDFLFSIEEEKNSLLSKISTLGAELTTERDRILRIS  166

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDN+RKR ERE+LS  TN QGEV+E LLPVLDNF+RAKTQIKVE+E E KIN+SYQSI
Sbjct  167  ADFDNYRKRVEREKLSLMTNVQGEVIESLLPVLDNFERAKTQIKVETEQETKINDSYQSI  226

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQF++IL SLGV  VETVGKPFDP+LHEAIMRE+SVE++EGVI+QEFRKGF+LGERLLR
Sbjct  227  YKQFIDILNSLGVEDVETVGKPFDPMLHEAIMREESVEYEEGVILQEFRKGFKLGERLLR  286

Query  332  PSMVKVSAGPGPAKPETSDPA  270
            P+MVKVSAGPGP KP   DPA
Sbjct  287  PAMVKVSAGPGPEKPVYDDPA  307



>dbj|BAD19686.1| putative co-chaperone CGE1 precursor isoform b [Oryza sativa 
Japonica Group]
Length=332

 Score =   276 bits (705),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            +++ AL+SY++AL  +DE+K+AE+E FL SIE+EK +L  K+  L  EL+ E+DR+LRIS
Sbjct  107  VIVTALQSYKEALINDDETKVAEIEDFLFSIEEEKNSLLSKISTLGAELTTERDRILRIS  166

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDN+RKR ERE+LS  TN QGEV+E LLPVLDNF+RAKTQIKVE+E E KIN+SYQSI
Sbjct  167  ADFDNYRKRVEREKLSLMTNVQGEVIESLLPVLDNFERAKTQIKVETEQETKINDSYQSI  226

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQF++IL SLGV  VETVGKPFDP+LHEAIMRE+SVE++EGVI+QEFRKGF+LGERLLR
Sbjct  227  YKQFIDILNSLGVEDVETVGKPFDPMLHEAIMREESVEYEEGVILQEFRKGFKLGERLLR  286

Query  332  PSMVKVSAGPGPAKPETSDPA  270
            P+MVKVSAGPGP KP   DPA
Sbjct  287  PAMVKVSAGPGPEKPVYDDPA  307



>gb|EMT25459.1| hypothetical protein F775_52685 [Aegilops tauschii]
Length=317

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            +++ AL+SY++AL  NDE+K+AE+E+FL SIEDEK +L  K+  L  EL+ E+DR+LRI 
Sbjct  92   VLITALQSYKEALMNNDEAKVAEIESFLLSIEDEKNSLMSKITALDAELTTERDRILRIG  151

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDN+RKRTERE+LS  TN QGEVVE LLPVLDNF+RAKTQIKVE+E E KIN+SYQSI
Sbjct  152  ADFDNYRKRTEREKLSLMTNVQGEVVESLLPVLDNFERAKTQIKVETEREAKINDSYQSI  211

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQ VEIL SLGV  VETVGKPFDP+LHEAIMRE+SVE+++GV++QEFRKGF+LGERLLR
Sbjct  212  YKQLVEILNSLGVEDVETVGKPFDPMLHEAIMREESVEYEDGVVLQEFRKGFKLGERLLR  271

Query  332  PSMVKVSAGPGPAK  291
            P+MVKVSAGPGP K
Sbjct  272  PAMVKVSAGPGPEK  285



>ref|NP_850840.1| embryo defective 1241 [Arabidopsis thaliana]
 emb|CAB40381.1| GrpE protein [Arabidopsis thaliana]
 dbj|BAB09570.1| GrpE protein [Arabidopsis thaliana]
 gb|AED92459.1| embryo defective 1241 [Arabidopsis thaliana]
Length=326

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 168/195 (86%), Gaps = 0/195 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            ++   LKSY++AL  N+E KIAE+EA LKSIEDEK  L  K+  L+ ELS E+DR++RIS
Sbjct  111  VITALLKSYKEALADNNEGKIAEIEASLKSIEDEKFLLADKVASLSNELSVERDRLIRIS  170

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTERERL+  +NAQGEVVE LL VLDNF+RAK+QIKVE+EGEEK+ NSYQSI
Sbjct  171  ADFDNFRKRTERERLNLVSNAQGEVVENLLAVLDNFERAKSQIKVETEGEEKVTNSYQSI  230

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQFVEILGSLGV  VETVGK FDP+LHEAIMREDS E++EG++++E+RKGF LGERLLR
Sbjct  231  YKQFVEILGSLGVIHVETVGKQFDPMLHEAIMREDSAEYEEGIVLEEYRKGFLLGERLLR  290

Query  332  PSMVKVSAGPGPAKP  288
            PSMVKVSAGPGP KP
Sbjct  291  PSMVKVSAGPGPEKP  305



>ref|NP_568356.1| embryo defective 1241 [Arabidopsis thaliana]
 gb|AAK44101.1|AF370286_1 putative chloroplast GrpE protein [Arabidopsis thaliana]
 gb|AAL34228.1| putative chloroplast GrpE protein [Arabidopsis thaliana]
 gb|AED92458.1| embryo defective 1241 [Arabidopsis thaliana]
Length=324

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 168/195 (86%), Gaps = 0/195 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            ++   LKSY++AL  N+E KIAE+EA LKSIEDEK  L  K+  L+ ELS E+DR++RIS
Sbjct  109  VITALLKSYKEALADNNEGKIAEIEASLKSIEDEKFLLADKVASLSNELSVERDRLIRIS  168

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTERERL+  +NAQGEVVE LL VLDNF+RAK+QIKVE+EGEEK+ NSYQSI
Sbjct  169  ADFDNFRKRTERERLNLVSNAQGEVVENLLAVLDNFERAKSQIKVETEGEEKVTNSYQSI  228

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQFVEILGSLGV  VETVGK FDP+LHEAIMREDS E++EG++++E+RKGF LGERLLR
Sbjct  229  YKQFVEILGSLGVIHVETVGKQFDPMLHEAIMREDSAEYEEGIVLEEYRKGFLLGERLLR  288

Query  332  PSMVKVSAGPGPAKP  288
            PSMVKVSAGPGP KP
Sbjct  289  PSMVKVSAGPGPEKP  303



>emb|CDY02695.1| BnaC02g07400D [Brassica napus]
Length=318

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 178/222 (80%), Gaps = 6/222 (3%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            + +  L SY++AL  N+E KIAE+EA LKSIEDEK  LE K+  LT ELS EKDR++RIS
Sbjct  102  VTIALLSSYKEALAENNEEKIAEIEASLKSIEDEKFQLEDKVASLTNELSVEKDRLIRIS  161

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTERERL+  +NAQGEVVE LL VLDNF+RAK+QIKVE+EGEEK+ NSYQSI
Sbjct  162  ADFDNFRKRTERERLNLVSNAQGEVVENLLAVLDNFERAKSQIKVETEGEEKVTNSYQSI  221

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQFVEILGSLGV  VETVGK FDP+LHEAIMREDS E++EG+I++E+RKGF LGERLLR
Sbjct  222  YKQFVEILGSLGVVTVETVGKQFDPMLHEAIMREDSAEYEEGIILEEYRKGFLLGERLLR  281

Query  332  PSMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPEGAN  207
            PSMVKVSAGPGP K       +E GG    A+  G + E A+
Sbjct  282  PSMVKVSAGPGPEK------TQEAGGEEAKAQGNGEEAEAAS  317



>ref|XP_003624768.1| Protein grpE [Medicago truncatula]
 gb|AES80986.1| co-chaperone GrpE family protein [Medicago truncatula]
Length=335

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 161/269 (60%), Positives = 198/269 (74%), Gaps = 11/269 (4%)
 Frame = -2

Query  1097  HHHSSGPAIRLPVSRSSGKFSLFASDGDVAETAQTepqeqdqvqdsevednqdVAPGSDD  918
             H  SS P +R        K   FA DGD       +  E   +  ++   + + + G D+
Sbjct  47    HRFSSIPTLRF------AKLVPFAFDGDTEAPQVQDSPEVQVLDSTDGAADVEESTGDDE  100

Query  917   ISNeadtttseetaSIVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllll  738
             +S+  +   S      +++ L+SY++AL  ND  K+AELE+ LKSI+DE V LE K+  L
Sbjct  101   VSDAGEIPASP-----LIVLLQSYKEALANNDSVKVAELESSLKSIDDEIVGLEGKIASL  155

Query  737   teelsneKDRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKV  558
             +EELS EKDR LRI ADFDN+RKRT+R+RLS  TNAQGEVVE LLPVLDNF+RAK QIKV
Sbjct  156   SEELSIEKDRKLRIGADFDNYRKRTDRDRLSLVTNAQGEVVESLLPVLDNFERAKAQIKV  215

Query  557   ESEGEEKINNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVII  378
             E+EGEEKINNSYQSI KQF+EIL SLGV PV+TVG PFDP+LHEAIMREDS EF++G+I+
Sbjct  216   ETEGEEKINNSYQSIYKQFIEILNSLGVEPVDTVGNPFDPMLHEAIMREDSDEFEDGIIL  275

Query  377   QEFRKGFQLGERLLRPSMVKVSAGPGPAK  291
             QEFRKGF+LG+RLLRPSMVKVSAGPGPAK
Sbjct  276   QEFRKGFKLGDRLLRPSMVKVSAGPGPAK  304



>gb|EMS64517.1| Protein grpE [Triticum urartu]
Length=253

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            +++ AL+SY++AL  +DE+KIAE+E+FL +IEDEK +L  K+  L  EL+ E+DR++RIS
Sbjct  28   VLITALQSYKEALMNDDEAKIAEIESFLLTIEDEKNSLMGKITALDAELTTERDRIVRIS  87

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            +DFDN+RKRTERE+LS  TN QGEVVE LLPVLDNF+RAKTQIKVE+E E KIN+SYQSI
Sbjct  88   SDFDNYRKRTEREKLSLMTNVQGEVVESLLPVLDNFERAKTQIKVETEREAKINDSYQSI  147

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQ VEIL SLGV  VETVGKPFDP+LHEAIMRE+SVE+++GV++QEFRKGF+LGERLLR
Sbjct  148  YKQLVEILKSLGVEDVETVGKPFDPMLHEAIMREESVEYEDGVVLQEFRKGFKLGERLLR  207

Query  332  PSMVKVSAGPGPAK  291
            P+MVKVSAGPGP K
Sbjct  208  PAMVKVSAGPGPEK  221



>ref|XP_006288204.1| hypothetical protein CARUB_v10001443mg [Capsella rubella]
 gb|EOA21102.1| hypothetical protein CARUB_v10001443mg [Capsella rubella]
Length=326

 Score =   273 bits (698),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +   L SY++AL  N+E KIAE+EA LKS+EDEK  L  K+  L+ ELS E+DR++RISA
Sbjct  112  ITALLNSYKEALAENNEGKIAEIEASLKSVEDEKFLLADKVASLSSELSVERDRLIRISA  171

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTERERL+  +NAQGEVVE LL VLDNF+RAK+QIKVE+EGEEK+ NSYQSI 
Sbjct  172  DFDNFRKRTERERLNLVSNAQGEVVENLLAVLDNFERAKSQIKVETEGEEKVTNSYQSIY  231

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQFVEILGSLGVT VETVGK FDP+LHEAIMREDS E++EG++++E+RKGF LGERLLRP
Sbjct  232  KQFVEILGSLGVTHVETVGKQFDPMLHEAIMREDSAEYEEGIVLEEYRKGFVLGERLLRP  291

Query  329  SMVKVSAGPGPAKP  288
            SMVKVSAGPGP KP
Sbjct  292  SMVKVSAGPGPEKP  305



>ref|XP_004953075.1| PREDICTED: grpE protein homolog, mitochondrial-like [Setaria 
italica]
Length=326

 Score =   273 bits (697),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 173/203 (85%), Gaps = 1/203 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            I++ AL+SY++AL  +DE+K AE+EAFL SIEDEK +   K+ +L  EL+ +++R+LRIS
Sbjct  103  IIVTALQSYKEALINDDEAKAAEIEAFLLSIEDEKNSFMNKITVLDAELATQRERILRIS  162

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTE E+L+  +N QGE++E  LPVLDNF+RAK+QIKVE+EGEEKINNSYQSI
Sbjct  163  ADFDNFRKRTENEKLNMMSNVQGELIENFLPVLDNFERAKSQIKVETEGEEKINNSYQSI  222

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQF+EIL SLGV  VETVGKPFDP+LHEAIMRE+S E++EG+I+QEFRKGF+LGERLLR
Sbjct  223  YKQFIEILNSLGVEDVETVGKPFDPMLHEAIMREESTEYEEGIILQEFRKGFKLGERLLR  282

Query  332  PSMVKVSAGPGPAKP-ETSDPAE  267
            P+MVKVSAGPGP K  +  DP E
Sbjct  283  PAMVKVSAGPGPEKSGDDEDPTE  305



>gb|AFW62939.1| grpE protein-like protein [Zea mays]
Length=328

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 176/224 (79%), Gaps = 9/224 (4%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            I++  L+SYR+AL  +DE+K AE+E+FL SIEDEK +L  K+  L  EL+ +++R+LRIS
Sbjct  103  IIVTTLQSYREALINDDEAKAAEIESFLLSIEDEKNSLLNKITALDAELATQRERILRIS  162

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTE E+L+   N QGE++E  LPVLDNF+RAK QIKVE+EGEEKINNSYQSI
Sbjct  163  ADFDNFRKRTENEKLNMMENVQGELIESFLPVLDNFERAKVQIKVETEGEEKINNSYQSI  222

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQF+EIL SLGV  VETVGKPFDP+LHEAIMRE+S EF+EG+I+QEFRKGF+LGERLLR
Sbjct  223  YKQFIEILNSLGVEDVETVGKPFDPMLHEAIMREESSEFEEGIILQEFRKGFKLGERLLR  282

Query  332  PSMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPEGANET  201
            P+MVKVSAGPGP K    DP         TA EG   P+  +E 
Sbjct  283  PAMVKVSAGPGPEKFGDDDP---------TAVEGSVAPQKVDEV  317



>ref|XP_002873846.1| EMB1241 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50105.1| EMB1241 [Arabidopsis lyrata subsp. lyrata]
Length=326

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 168/197 (85%), Gaps = 0/197 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            L SY++AL  N+E KIAE+EA LKSIEDEK  L  K+  L+ ELS E+DR++RISADFDN
Sbjct  116  LNSYKEALADNNEGKIAEIEASLKSIEDEKNLLADKVASLSNELSVERDRLIRISADFDN  175

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRKRTERERL+  +NAQGEVVE LL VLDNF+RAK+QIKVE+EGEEK+ NSYQSI KQFV
Sbjct  176  FRKRTERERLNLVSNAQGEVVENLLAVLDNFERAKSQIKVETEGEEKVTNSYQSIYKQFV  235

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EILGSLGV  VETVGK FDP+LHEAIMREDS E++EG++++E+RKGF LGERLLRPSMVK
Sbjct  236  EILGSLGVIHVETVGKQFDPMLHEAIMREDSAEYEEGIVLEEYRKGFLLGERLLRPSMVK  295

Query  317  VSAGPGPAKPETSDPAE  267
            VSAGPGP KP  ++  E
Sbjct  296  VSAGPGPEKPREAEVEE  312



>dbj|BAK06504.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=327

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            ++++AL+SY++AL  +DE+KIAE+E+FL SIEDEK++L  K+  L  EL+ E+DR+LRIS
Sbjct  102  VLIIALQSYKEALMNDDEAKIAEIESFLLSIEDEKISLMSKITALDAELTTERDRILRIS  161

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDN+RKRTERE+LS  TN QGEVVE LLPVLDNF+RAKTQIKVE+E E KIN+SYQ I
Sbjct  162  ADFDNYRKRTEREKLSLMTNVQGEVVESLLPVLDNFERAKTQIKVETEREAKINDSYQGI  221

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQ VEIL SLGV  V+TVGKPFDP+LHEAIMRE+SVE+++GV++QEFRKGF+LGERLLR
Sbjct  222  YKQLVEILNSLGVEDVKTVGKPFDPMLHEAIMREESVEYEDGVVLQEFRKGFKLGERLLR  281

Query  332  PSMVKVSAGPGPAK  291
            P+MVKVSAGPGP K
Sbjct  282  PAMVKVSAGPGPEK  295



>dbj|BAJ98546.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=327

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            ++++AL+SY++AL  +DE+KIAE+E+FL SIEDEK++L  K+  L  EL+ E+DR+LRIS
Sbjct  102  VLIIALQSYKEALMNDDEAKIAEIESFLLSIEDEKISLMSKITALGAELTTERDRILRIS  161

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDN+RKRTERE+LS  TN QGEVVE LLPVLDNF+RAKTQIKVE+E E KIN+SYQ I
Sbjct  162  ADFDNYRKRTEREKLSLMTNVQGEVVESLLPVLDNFERAKTQIKVETEREAKINDSYQGI  221

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQ VEIL SLGV  V+TVGKPFDP+LHEAIMRE+SVE+++GV++QEFRKGF+LGERLLR
Sbjct  222  YKQLVEILNSLGVEDVKTVGKPFDPMLHEAIMREESVEYEDGVVLQEFRKGFKLGERLLR  281

Query  332  PSMVKVSAGPGPAK  291
            P+MVKVSAGPGP K
Sbjct  282  PAMVKVSAGPGPEK  295



>ref|XP_006400314.1| hypothetical protein EUTSA_v10014120mg [Eutrema salsugineum]
 gb|ESQ41767.1| hypothetical protein EUTSA_v10014120mg [Eutrema salsugineum]
Length=322

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 168/195 (86%), Gaps = 0/195 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            + +  L SY++AL  N+E KIAE+EA LKSIEDEK  LE K+  LT E+S E+DR++RIS
Sbjct  104  VTIALLNSYKEALAENNEEKIAEIEASLKSIEDEKFQLEEKVASLTNEMSVERDRLIRIS  163

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTERERL+  +NAQG+VVE LL VLDNF+RAK+QIKVE+EGEEK+ NSYQSI
Sbjct  164  ADFDNFRKRTERERLNLVSNAQGQVVENLLAVLDNFERAKSQIKVETEGEEKVTNSYQSI  223

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQFVEILGSLGV  VETVG+ FDP+LHEAIMREDS E++EG++++E+RKGF LGERLLR
Sbjct  224  YKQFVEILGSLGVVTVETVGRQFDPMLHEAIMREDSAEYEEGIVLEEYRKGFLLGERLLR  283

Query  332  PSMVKVSAGPGPAKP  288
            PSMVKVSAGPGP KP
Sbjct  284  PSMVKVSAGPGPEKP  298



>emb|CDY59313.1| BnaAnng15980D [Brassica napus]
Length=318

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 172/205 (84%), Gaps = 3/205 (1%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            + +  L SY++AL  N+E KIAE+EA LKSIEDEK  LE K+  LT ELS E+DR++RIS
Sbjct  107  VTIALLSSYKEALAENNEEKIAEIEASLKSIEDEKFQLEDKVASLTNELSVERDRLIRIS  166

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTERERL+  +NAQGEVVE LL VLDNF+RAK+QIKVE+EGEEK+ NSYQSI
Sbjct  167  ADFDNFRKRTERERLNLVSNAQGEVVENLLAVLDNFERAKSQIKVETEGEEKVTNSYQSI  226

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQFVEILGSLGV  VETVGK FDP+LHEAIMREDS E++EG+I++E+RKGF LGERLLR
Sbjct  227  YKQFVEILGSLGVVTVETVGKQFDPMLHEAIMREDSAEYEEGIILEEYRKGFLLGERLLR  286

Query  332  PSMVKVSAGPGPAKPETSDPAEEQG  258
            PSMVKVSAGPG   PE +  A+ QG
Sbjct  287  PSMVKVSAGPG---PEKTQEAKAQG  308



>ref|XP_009126204.1| PREDICTED: grpE protein homolog, mitochondrial [Brassica rapa]
Length=304

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 168/196 (86%), Gaps = 0/196 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            + +  L SY++AL  N+E KIAE+EA LKSIEDEK  LE K+  LT ELS E+DR++RIS
Sbjct  107  VTIALLSSYKEALAENNEEKIAEIEASLKSIEDEKFQLEDKVASLTNELSVERDRLIRIS  166

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTERERL+  +NAQGEVVE LL VLDNF+RAK+QIKVE+EGEEK+ NSYQSI
Sbjct  167  ADFDNFRKRTERERLNLVSNAQGEVVESLLAVLDNFERAKSQIKVETEGEEKVTNSYQSI  226

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQFVEILGSLGV  VETVGK FDP+LHEAIMREDS E++EG+I++E+RKGF LGERLLR
Sbjct  227  YKQFVEILGSLGVVTVETVGKQFDPMLHEAIMREDSAEYEEGIILEEYRKGFLLGERLLR  286

Query  332  PSMVKVSAGPGPAKPE  285
            PSMVKVSAGPGP K +
Sbjct  287  PSMVKVSAGPGPEKTQ  302



>ref|XP_010492733.1| PREDICTED: grpE protein homolog, mitochondrial-like [Camelina 
sativa]
Length=322

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 168/195 (86%), Gaps = 0/195 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            ++   L SY++AL  N+E KIAE+EA LKSIEDEK  LE K+  L+ +LS E+DR++RIS
Sbjct  107  VITSLLSSYKEALADNNEGKIAEIEASLKSIEDEKFLLEDKVASLSNDLSVERDRLIRIS  166

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTERERL+  +NAQGEVVE LL VLDNF+RAK+QIKVE+EGEE++ NSYQSI
Sbjct  167  ADFDNFRKRTERERLNLVSNAQGEVVENLLAVLDNFERAKSQIKVETEGEERVTNSYQSI  226

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQFVEILGSLGV  VETVGK FDP+LHEAIMREDS E++EG++++E+RKGF LGERLLR
Sbjct  227  YKQFVEILGSLGVIHVETVGKQFDPMLHEAIMREDSAEYEEGIVLEEYRKGFLLGERLLR  286

Query  332  PSMVKVSAGPGPAKP  288
            PSMVKVSAGPGP KP
Sbjct  287  PSMVKVSAGPGPEKP  301



>ref|XP_010420501.1| PREDICTED: grpE protein homolog, mitochondrial-like [Camelina 
sativa]
Length=323

 Score =   270 bits (690),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +   L SY++AL  N+E KIAE+EA LKSIEDEK+ LE K+  L+ +LS E+DR++RISA
Sbjct  107  ITALLSSYKEALADNNEGKIAEIEATLKSIEDEKILLEDKVASLSNDLSVERDRLIRISA  166

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTERERL+  +NAQGEVVE LL VLDNF+RAK+QIKVE+EGEE++ NSYQSI 
Sbjct  167  DFDNFRKRTERERLNLVSNAQGEVVEDLLAVLDNFERAKSQIKVETEGEERVTNSYQSIY  226

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQFVEILGSLGV  VETVGK FDP+LHEAIMREDS E++EG++++E+RKGF LGERLLRP
Sbjct  227  KQFVEILGSLGVIHVETVGKQFDPMLHEAIMREDSTEYEEGIVLEEYRKGFLLGERLLRP  286

Query  329  SMVKVSAGPGPAKP  288
            SMVKVSAGPGP KP
Sbjct  287  SMVKVSAGPGPEKP  300



>ref|XP_010088171.1| Protein grpE [Morus notabilis]
 gb|EXB32137.1| Protein grpE [Morus notabilis]
Length=517

 Score =   276 bits (706),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            V+ +L+ YR+AL ++DESK+AE+E+FLKS EDEK+ LERKL  L+EEL  EKDR+LRISA
Sbjct  295  VVASLQLYREALASSDESKLAEIESFLKSFEDEKICLERKLASLSEELLIEKDRILRISA  354

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTERER S  TN +GEVVE LLPVLDNF+RAK QIKVE+ GEEKIN SYQSI 
Sbjct  355  DFDNFRKRTERERSSLVTNGKGEVVENLLPVLDNFERAKAQIKVETGGEEKINISYQSIY  414

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQ VEIL SLGV PVETVG PFDPLLHEAIMREDS+EF+E +IIQEFRKGF+LG+ LLRP
Sbjct  415  KQLVEILTSLGVVPVETVGNPFDPLLHEAIMREDSMEFEERIIIQEFRKGFKLGDILLRP  474

Query  329  SMVKVSAGPGPAKPETSDPAEEQ  261
            SMVKVSAGPGPAKPE +   E+Q
Sbjct  475  SMVKVSAGPGPAKPEQALQEEDQ  497



>ref|NP_001151179.1| protein grpE [Zea mays]
 gb|ACG41889.1| protein grpE [Zea mays]
Length=328

 Score =   270 bits (689),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 175/224 (78%), Gaps = 9/224 (4%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            I++  L+SYR+AL  +DE+K AE+E+ L SIEDEK +L  K+  L  EL+ +++R+LRIS
Sbjct  103  IIVTTLQSYREALINDDEAKAAEIESLLLSIEDEKNSLLNKITALDAELATQRERILRIS  162

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTE E+L+   N QGE++E  LPVLDNF+RAK QIKVE+EGEEKINNSYQSI
Sbjct  163  ADFDNFRKRTENEKLNMMENVQGELIESFLPVLDNFERAKVQIKVETEGEEKINNSYQSI  222

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQF+EIL SLGV  VETVGKPFDP+LHEAIMRE+S EF+EG+I+QEFRKGF+LGERLLR
Sbjct  223  YKQFIEILNSLGVEDVETVGKPFDPMLHEAIMREESSEFEEGIILQEFRKGFKLGERLLR  282

Query  332  PSMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPEGANET  201
            P+MVKVSAGPGP K    DP         TA EG   P+  +E 
Sbjct  283  PAMVKVSAGPGPEKFGDDDP---------TAVEGSVAPQKVDEV  317



>ref|XP_010453974.1| PREDICTED: grpE protein homolog, mitochondrial-like [Camelina 
sativa]
Length=320

 Score =   269 bits (688),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +   L SY++AL  N+E KIAE+EA LKSIEDEK  LE KL  L+ +LS E+DR++RISA
Sbjct  104  ITALLSSYKEALADNNEGKIAEIEASLKSIEDEKFLLEDKLASLSNDLSVERDRLIRISA  163

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTERERL+  +NAQGEVVE LL VLDNF+RAK+QIKVE+EGEE++ NSYQSI 
Sbjct  164  DFDNFRKRTERERLNLVSNAQGEVVENLLAVLDNFERAKSQIKVETEGEERVTNSYQSIY  223

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQFVEILGSLGV  VETVGK FDP+LHEAIMREDS E++EG++++E+RKGF LGERLLRP
Sbjct  224  KQFVEILGSLGVIHVETVGKQFDPMLHEAIMREDSAEYEEGIVLEEYRKGFLLGERLLRP  283

Query  329  SMVKVSAGPGPAKP  288
            SMVKVSAGPGP KP
Sbjct  284  SMVKVSAGPGPEKP  297



>ref|XP_002452436.1| hypothetical protein SORBIDRAFT_04g025770 [Sorghum bicolor]
 gb|EES05412.1| hypothetical protein SORBIDRAFT_04g025770 [Sorghum bicolor]
Length=335

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 165/192 (86%), Gaps = 0/192 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            I++  L+SYR+AL  +DE+K AE+E+FL SIEDEK +L  K+  L  EL+ +++R+LRIS
Sbjct  103  IIVTTLQSYREALINDDEAKAAEIESFLLSIEDEKNSLLNKITALNAELATQRERILRIS  162

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTE E+L+   N QGE++E  LPVLDNF+RAK QIKVE+EGEEKINNSYQSI
Sbjct  163  ADFDNFRKRTENEKLNMMENVQGELIESFLPVLDNFERAKMQIKVETEGEEKINNSYQSI  222

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQF+EIL SLGV  VETVGKPFDP+LHEAIMREDS E++EG+I+QEFRKGF+LGERLLR
Sbjct  223  YKQFIEILNSLGVEDVETVGKPFDPMLHEAIMREDSSEYEEGIILQEFRKGFKLGERLLR  282

Query  332  PSMVKVSAGPGP  297
            P+MVKVSAGPGP
Sbjct  283  PAMVKVSAGPGP  294



>gb|KFK25997.1| hypothetical protein AALP_AA8G189400 [Arabis alpina]
Length=319

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 170/197 (86%), Gaps = 0/197 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            L  Y++AL  N+E KIAE+EA LKSIEDEK+ LE K+  L++ELS E+DR++RISADFDN
Sbjct  106  LNLYKEALAENNEGKIAEIEASLKSIEDEKIQLENKVASLSDELSVERDRLIRISADFDN  165

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRKRTERERL+  +NAQGEVVE LL VLDNF+RAK+QIKVE+EGEEK+ NSYQSI KQFV
Sbjct  166  FRKRTERERLNLVSNAQGEVVENLLAVLDNFERAKSQIKVETEGEEKVTNSYQSIYKQFV  225

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+GSLGV  VETVGK FDP+LHEAIMREDS E++EG++++E+RKGF LGERLLRPSMVK
Sbjct  226  EIMGSLGVVHVETVGKQFDPMLHEAIMREDSAEYEEGIVLEEYRKGFVLGERLLRPSMVK  285

Query  317  VSAGPGPAKPETSDPAE  267
            VSAGPGP KP  ++  E
Sbjct  286  VSAGPGPEKPSEAEGEE  302



>ref|XP_009409781.1| PREDICTED: grpE protein homolog, mitochondrial-like [Musa acuminata 
subsp. malaccensis]
Length=332

 Score =   267 bits (683),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            VM++L+ Y++AL  ND SK++E+E FL+SIEDEK +L  K+  L EE S E+ RVLRISA
Sbjct  113  VMLSLQLYKEALANNDRSKVSEIETFLQSIEDEKNSLSTKIAALAEESSAERVRVLRISA  172

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTERE+LS  TN QGEV+E LLPVLDNF+RAK+QIKVE++ EEKIN+SYQSI 
Sbjct  173  DFDNFRKRTEREKLSLMTNVQGEVIESLLPVLDNFERAKSQIKVETQVEEKINSSYQSIY  232

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQF+EIL SLGV  VETVG  FDPL HEAIM E+S EF+EG+IIQEFRKGF+LGERLLRP
Sbjct  233  KQFLEILTSLGVEAVETVGSSFDPLFHEAIMHEESTEFEEGIIIQEFRKGFKLGERLLRP  292

Query  329  SMVKVSAGPGPAK  291
            SMVKVSAGPGP K
Sbjct  293  SMVKVSAGPGPEK  305



>emb|CDY16895.1| BnaC09g40220D [Brassica napus]
Length=321

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 168/197 (85%), Gaps = 0/197 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            L SY++AL  N+E KIAE+EA LKSIED+K  LE K+  L+ ELS E+DR++RISADFDN
Sbjct  110  LSSYKEALAENNEEKIAEIEASLKSIEDQKFQLEEKVATLSNELSVERDRLIRISADFDN  169

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRKR ERERL+  +NAQGEVVE LL VLDNF+RAK+QIKVE+EGEE++ NSYQSI KQFV
Sbjct  170  FRKRNERERLNLVSNAQGEVVENLLAVLDNFERAKSQIKVETEGEERVTNSYQSIYKQFV  229

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EILGSLGV  VETVGK FDP+LHEAIMREDS E++EG++++E+RKGF LGERLLRPSMVK
Sbjct  230  EILGSLGVVTVETVGKQFDPMLHEAIMREDSAEYEEGIVLEEYRKGFLLGERLLRPSMVK  289

Query  317  VSAGPGPAKPETSDPAE  267
            VSAGPGP K   ++ +E
Sbjct  290  VSAGPGPEKAGEAEGSE  306



>emb|CDY38454.1| BnaA10g17040D [Brassica napus]
Length=320

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 165/192 (86%), Gaps = 0/192 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            + +  L SY++AL  N+E KIAE+EA LKSIED+K  LE K+  L+ ELS E+DR++RIS
Sbjct  104  VTIALLSSYKEALAENNEEKIAEIEASLKSIEDQKFQLEEKVATLSNELSVERDRLIRIS  163

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKR ERERL+  +NAQGEVVE LL VLDNF+RAK+QIKVE+EGEE++ NSYQSI
Sbjct  164  ADFDNFRKRNERERLNLVSNAQGEVVENLLAVLDNFERAKSQIKVETEGEERVTNSYQSI  223

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQFVEILGSLGV  VETVGK FDP+LHEAIMREDS E++EG++++E+RKGF LGERLLR
Sbjct  224  YKQFVEILGSLGVVTVETVGKQFDPMLHEAIMREDSAEYEEGIVLEEYRKGFLLGERLLR  283

Query  332  PSMVKVSAGPGP  297
            PSMVKVSAGPGP
Sbjct  284  PSMVKVSAGPGP  295



>ref|XP_009121060.1| PREDICTED: grpE protein homolog, mitochondrial-like [Brassica 
rapa]
Length=319

 Score =   265 bits (677),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 164/192 (85%), Gaps = 0/192 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            + +  L SY++AL  N+E KIAE+EA L+SIED K  L+ K+  L+ ELS E+DR++RIS
Sbjct  103  VTIALLSSYKEALAENNEEKIAEIEASLQSIEDAKFQLQEKVATLSNELSVERDRLIRIS  162

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKR ERERL+  +NAQGEVVE LL VLDNF+RAK+QIKVE+EGEE++ NSYQSI
Sbjct  163  ADFDNFRKRNERERLNLVSNAQGEVVENLLAVLDNFERAKSQIKVETEGEERVTNSYQSI  222

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQFVEILGSLGV  VETVGK FDP+LHEAIMREDS E++EG++++E+RKGF LGERLLR
Sbjct  223  YKQFVEILGSLGVVTVETVGKQFDPMLHEAIMREDSAEYEEGIVLEEYRKGFLLGERLLR  282

Query  332  PSMVKVSAGPGP  297
            PSMVKVSAGPGP
Sbjct  283  PSMVKVSAGPGP  294



>gb|ACG38006.1| protein grpE [Zea mays]
Length=328

 Score =   265 bits (676),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 166/200 (83%), Gaps = 0/200 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
             ++  L+SYR+AL  +DE+K AE+E+FL SIEDEK +L  K+  L  EL+ +++R+LRIS
Sbjct  103  FIVTTLQSYREALINDDEAKAAEIESFLLSIEDEKNSLLSKITALDVELATQRERILRIS  162

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTE E+L+   N QGE++E  LPVLDNF+RAK QIKVE+EGEEKINNSYQSI
Sbjct  163  ADFDNFRKRTENEKLNMMENVQGELIESFLPVLDNFERAKMQIKVETEGEEKINNSYQSI  222

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
            +KQF+EIL SL V  VETVGKPFDP+LHEAIMRE+S E++EG+I+QEFRKGF+LGERLLR
Sbjct  223  NKQFIEILNSLSVEDVETVGKPFDPMLHEAIMREESSEYEEGIILQEFRKGFKLGERLLR  282

Query  332  PSMVKVSAGPGPAKPETSDP  273
            P+MVKVSAGPGP      DP
Sbjct  283  PAMVKVSAGPGPENSGDDDP  302



>ref|NP_001137005.1| uncharacterized protein LOC100217168 [Zea mays]
 gb|ACF83053.1| unknown [Zea mays]
 gb|AFW72302.1| grpE protein-like protein [Zea mays]
Length=328

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 167/200 (84%), Gaps = 0/200 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            I++  L+SYR AL  +D++K AE+E+FL SIEDEK +L  K+  L  EL+ +++R+LRIS
Sbjct  103  IIVTTLQSYRVALINDDDAKAAEIESFLLSIEDEKNSLLNKITALDVELATQRERILRIS  162

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTE E+L+   N QGE++E  LPVLDNF+RAK QIKVE+EGEEKINNSYQSI
Sbjct  163  ADFDNFRKRTENEKLNMMENVQGELIESFLPVLDNFERAKMQIKVETEGEEKINNSYQSI  222

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
            +KQF+EIL SLGV  VETVGKPFDP+LHEAIMRE+S E++EG+I+QEFRKGF+LGERLLR
Sbjct  223  NKQFIEILNSLGVEDVETVGKPFDPMLHEAIMREESSEYEEGIILQEFRKGFKLGERLLR  282

Query  332  PSMVKVSAGPGPAKPETSDP  273
            P+MVKVSAGPGP      DP
Sbjct  283  PAMVKVSAGPGPENSGDDDP  302



>ref|XP_010558942.1| PREDICTED: grpE protein homolog, mitochondrial-like, partial 
[Tarenaya hassleriana]
Length=360

 Score =   263 bits (673),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 166/197 (84%), Gaps = 0/197 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            +VM  L+SY++AL  NDE K++E+EA LK+IED K  LE+K   L++ELS E+DRVLR+S
Sbjct  141  VVMALLRSYKEALANNDEGKVSEIEASLKAIEDAKTQLEKKTSSLSDELSVERDRVLRVS  200

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRK+ E+ERLS  +NAQGEVVE LL VLDNF+RAK QIKVE+E EE+I NSYQSI
Sbjct  201  ADFDNFRKKMEKERLSLVSNAQGEVVENLLSVLDNFERAKAQIKVETEEEERITNSYQSI  260

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQF E+LGSLGV PVET+ K FDP+ HEAIMREDS EF+EG+I++E+RKGF LGERLLR
Sbjct  261  YKQFGELLGSLGVVPVETIRKQFDPMQHEAIMREDSTEFEEGIILEEYRKGFMLGERLLR  320

Query  332  PSMVKVSAGPGPAKPET  282
            PSMVKVSAGPGP + +T
Sbjct  321  PSMVKVSAGPGPCREKT  337



>emb|CAN65730.1| hypothetical protein VITISV_011922 [Vitis vinifera]
Length=369

 Score =   261 bits (666),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 172/207 (83%), Gaps = 22/207 (11%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +++AL+SY++AL +NDESK AE+EAF+K IEDEK++LE+K+  L+EELS++K+R+LRISA
Sbjct  140  IIVALRSYKEALVSNDESKAAEIEAFIKFIEDEKIDLEKKVAALSEELSSDKERILRISA  199

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRT+RERLS  TNAQGEV+E LLPVLDNF+RAK QIKVE+EGEEKINNSYQSI 
Sbjct  200  DFDNFRKRTDRERLSLVTNAQGEVLENLLPVLDNFERAKAQIKVETEGEEKINNSYQSIY  259

Query  509  KQFVEILGSLGVTPVETVGKPFDPLL----------------------HEAIMREDSVEF  396
            KQFVEILGSLGVTPVET+G PFDPL+                      HEAIMREDS EF
Sbjct  260  KQFVEILGSLGVTPVETIGNPFDPLVSFRAGSKFSLVLDELSRMLYQFHEAIMREDSTEF  319

Query  395  DEGVIIQEFRKGFQLGERLLRPSMVKV  315
            +E VIIQEFRKGF+LG+RLLRPSMVKV
Sbjct  320  EEDVIIQEFRKGFKLGDRLLRPSMVKV  346



>ref|XP_008794361.1| PREDICTED: grpE protein homolog, mitochondrial-like isoform X1 
[Phoenix dactylifera]
Length=258

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 159/194 (82%), Gaps = 0/194 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            VM++L+SY++AL  ND SK+AE+EAFL+ IE EK  L  K++ LT ELS E+DR+LRI A
Sbjct  63   VMVSLQSYKEALANNDPSKVAEVEAFLQLIEAEKNYLAAKVVTLTGELSKEQDRILRIRA  122

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKR ER+ LS  TN QGEV+E LLPVLD F+ AK +IKV+SEGEEKINNSYQSI 
Sbjct  123  DFDNFRKRMERKNLSLMTNLQGEVIESLLPVLDEFESAKAEIKVDSEGEEKINNSYQSIY  182

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            K+F+EIL SLGV  VETVG P+D  LHE IM E+S EF+EG+IIQE +KG++LGERLL P
Sbjct  183  KRFLEILNSLGVEVVETVGNPYDHSLHELIMLEESTEFEEGIIIQEVQKGYKLGERLLCP  242

Query  329  SMVKVSAGPGPAKP  288
            SMVKVS GPGPAKP
Sbjct  243  SMVKVSVGPGPAKP  256



>gb|ABK22476.1| unknown [Picea sitchensis]
Length=338

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 171/222 (77%), Gaps = 1/222 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            +V   L++Y++A+  +D+++++++E  L++IEDEK  L + +  LTEE S  KD++LR++
Sbjct  105  LVPTLLQAYKEAIANSDDTRVSDIEVQLQAIEDEKNALSKLVAALTEEASRGKDKLLRLN  164

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKR E+ERLS  +N QG+V+E LLP++D+F+RAKTQIK+++EGEEKI+ SYQ I
Sbjct  165  ADFDNFRKRAEKERLSLASNIQGDVIESLLPMVDDFERAKTQIKIQTEGEEKIDKSYQGI  224

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQFVEI+  L V  V+TVGKPFDP+LHEAI+ EDS  F+EG+II+EFR+GF LG++LLR
Sbjct  225  YKQFVEIMKGLHVNVVDTVGKPFDPMLHEAILHEDSTSFEEGIIIEEFRRGFILGDKLLR  284

Query  332  PSMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPEGAN  207
            P+MVKVSAGPGPAK +  D A +       AEE     + AN
Sbjct  285  PAMVKVSAGPGPAK-DAEDSANDAEHSANPAEECKETTKDAN  325



>ref|XP_001783635.1| predicted protein [Physcomitrella patens]
 gb|EDQ51530.1| predicted protein [Physcomitrella patens]
Length=251

 Score =   231 bits (589),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 161/199 (81%), Gaps = 1/199 (1%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            L++YR+A+  +DE  I+++E+ L++I +E+ +L  K+  L EE+S  KDR LR++ADFDN
Sbjct  48   LEAYREAVAADDEGAISDVESQLEAIANERDSLGLKVNSLIEEISTNKDRYLRLNADFDN  107

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            +RKR+ER+RL++  N +GEV+E LLP++DNF+RAKT IK E+E E+KI+N+YQ I KQFV
Sbjct  108  YRKRSERDRLATAGNVRGEVIESLLPMVDNFERAKTSIKTETEAEQKIDNAYQGIYKQFV  167

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ SLGV  VETVGKPFDP LHEAIMREDS EF E V+ QEFR+GF++G+RLLRP+MVK
Sbjct  168  EIMKSLGVVAVETVGKPFDPNLHEAIMREDSTEFAEDVVSQEFRRGFRIGDRLLRPAMVK  227

Query  317  VSAGPGPAKPETSD-PAEE  264
            VS+GPGPA    +D P EE
Sbjct  228  VSSGPGPAAATDTDLPIEE  246



>ref|XP_001780175.1| predicted protein [Physcomitrella patens]
 gb|EDQ55016.1| predicted protein [Physcomitrella patens]
Length=217

 Score =   228 bits (580),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 156/198 (79%), Gaps = 1/198 (1%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            L++YR+A+  NDE  I ++E+ L++I  E+ +L      L  E+S  KDR +R++ADFDN
Sbjct  16   LEAYREAVAVNDEEAITDVESQLEAIAIERDSLAENANALIGEVSTNKDRYIRLNADFDN  75

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            +RKR+ER+RL++  N +GEVVE LLP++DNF+RAKT IK E+EGE+KI+N+YQSI KQFV
Sbjct  76   YRKRSERDRLATAGNIRGEVVESLLPIVDNFERAKTSIKTETEGEQKIDNAYQSIYKQFV  135

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ SLGV  +ETVGK FDP LHEAIMREDS EF E ++ QEFR+GF++ +RLLRP+MVK
Sbjct  136  EIMKSLGVVAIETVGKSFDPNLHEAIMREDSTEFAEDIVSQEFRRGFRIEDRLLRPAMVK  195

Query  317  VSAGPGPAKPETSDPAEE  264
            VS+GPGPA  +T  P EE
Sbjct  196  VSSGPGPA-ADTDLPIEE  212



>gb|ADB23408.1| chloroplast CGE2 [Physcomitrella patens]
Length=307

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 156/198 (79%), Gaps = 1/198 (1%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            L++YR+A+  NDE  I ++E+ L++I  E+ +L      L  E+S  KDR +R++ADFDN
Sbjct  106  LEAYREAVAVNDEEAITDVESQLEAIAIERDSLAENANALIGEVSTNKDRYIRLNADFDN  165

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            +RKR+ER+RL++  N +GEVVE LLP++DNF+RAKT IK E+EGE+KI+N+YQSI KQFV
Sbjct  166  YRKRSERDRLATAGNIRGEVVESLLPIVDNFERAKTSIKTETEGEQKIDNAYQSIYKQFV  225

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ SLGV  +ETVGK FDP LHEAIMREDS EF E ++ QEFR+GF++ +RLLRP+MVK
Sbjct  226  EIMKSLGVVAIETVGKSFDPNLHEAIMREDSTEFAEDIVSQEFRRGFRIEDRLLRPAMVK  285

Query  317  VSAGPGPAKPETSDPAEE  264
            VS+GPGPA  +T  P EE
Sbjct  286  VSSGPGPA-ADTDLPIEE  302



>gb|ADB23407.1| chloroplast CGE1 [Physcomitrella patens]
Length=315

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 160/199 (80%), Gaps = 1/199 (1%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            L++YR+A+  +DE  I+++E+ L++I +E+ +L  K+  L EE+S  KDR LR++ADFDN
Sbjct  112  LEAYREAVAADDEGAISDVESQLEAIANERDSLGLKVNSLIEEISTNKDRYLRLNADFDN  171

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            +RKR+ER+RL++  N +GEV+E LLP++DNF+RAKT IK E+E E+KI+ +YQ I KQFV
Sbjct  172  YRKRSERDRLATAGNVRGEVIESLLPMVDNFERAKTSIKTETEAEQKIDXAYQGIYKQFV  231

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ SLGV  VETVGKPFDP LHEAIMREDS EF E V+ QEFR+GF++G+RLLRP+MVK
Sbjct  232  EIMKSLGVVAVETVGKPFDPNLHEAIMREDSTEFAEDVVSQEFRRGFRIGDRLLRPAMVK  291

Query  317  VSAGPGPAKPETSD-PAEE  264
            VS+GPGPA    +D P EE
Sbjct  292  VSSGPGPAAATDTDLPIEE  310



>ref|XP_009592594.1| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Nicotiana 
tomentosiformis]
Length=303

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 170/220 (77%), Gaps = 1/220 (0%)
 Frame = -2

Query  1094  HHSSGPAIRLPVSRSSGKFSLFASDGDVAETAQTepqeqdqvqdsevednqdVAPGSDDI  915
             HHS+   ++LP  RS  KF +FAS+GD AE AQTE QE +Q      ++       ++D 
Sbjct  53    HHSANTIVQLP-HRSVEKFIVFASNGDAAEAAQTETQEPEQEVQESEQEENVDGAAAEDA  111

Query  914   SNeadtttseetaSIVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllt  735
             S+E D   ++ETAS +  +L+ YRDAL  ND+SK+AE+E  LKSIE+EK+ L+RK+  LT
Sbjct  112   SDEGDNAAADETASFIATSLQLYRDALANNDDSKVAEIEISLKSIEEEKIELQRKVASLT  171

Query  734   eelsneKDRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVE  555
             EELS+E+DRVLRISADFDNFRKRTERERLS   NAQGEVVEKLL +LDNF+RAK QIKV 
Sbjct  172   EELSSERDRVLRISADFDNFRKRTERERLSLVKNAQGEVVEKLLSILDNFERAKMQIKVA  231

Query  554   SEGEEKINNSYQSISKQFVEILGSLGVTPVETVGKPFDPL  435
             +EGEEKINNSYQSISK+F EILGSLGV  VETVGKPFDPL
Sbjct  232   TEGEEKINNSYQSISKKFGEILGSLGVETVETVGKPFDPL  271



>ref|XP_002285824.1| PREDICTED: grpE protein homolog, mitochondrial [Vitis vinifera]
 emb|CBI19091.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 156/206 (76%), Gaps = 2/206 (1%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            +K+Y+DA+   DE  ++E+EA + +IE EK  L +K+  L+ E+++ K++ +R+ ADFDN
Sbjct  89   IKAYKDAVLDGDEKAVSEIEAMIDTIESEKAELAQKVSALSAEITSGKEKYIRLQADFDN  148

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRKR+E+ERL+  T+AQGEVVE LLP++DNF+RAK QIK E+E E+KI+ SYQ I KQFV
Sbjct  149  FRKRSEKERLTVRTDAQGEVVESLLPMIDNFERAKQQIKPETEKEKKIDTSYQGIYKQFV  208

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ S  V  V TVGKPFDP LHEAI RE+S EF EG+IIQE R+GF LG+RLLRP+MVK
Sbjct  209  EIMRSCHVAAVATVGKPFDPALHEAIAREESQEFKEGIIIQEIRRGFLLGDRLLRPAMVK  268

Query  317  VSAGPGPAKPETSDPAEEQGGFIETA  240
            VS GPG  K  TS  A++  G   TA
Sbjct  269  VSTGPGRKK--TSAVADKSTGQPATA  292



>ref|XP_006647500.1| PREDICTED: grpE protein homolog, mitochondrial-like [Oryza brachyantha]
Length=149

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  641  FTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFVEILGSLGVTPVE  462
             TN QGEV+E LLPVLDNF+RAKTQIKVE+E E KIN+SYQSI KQF+EIL SLGV  VE
Sbjct  1    MTNVQGEVIENLLPVLDNFERAKTQIKVETEQEAKINDSYQSIYKQFIEILNSLGVEDVE  60

Query  461  TVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVKVSAGPGPAKPET  282
            T+GKPFDP+LHEAIMRE+SVE++EGVIIQEFRKGF+LGERLLRP+MVKVSAGPGP KP  
Sbjct  61   TIGKPFDPMLHEAIMREESVEYEEGVIIQEFRKGFKLGERLLRPAMVKVSAGPGPEKPVY  120

Query  281  SDPA  270
             DPA
Sbjct  121  DDPA  124



>ref|XP_010036282.1| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Eucalyptus 
grandis]
 gb|KCW47812.1| hypothetical protein EUGRSUZ_K01549 [Eucalyptus grandis]
Length=291

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            V+++L+SY++AL +NDESK+AE+EAFLKSIEDEK  LE K+  L+ ELS E+DR+LRISA
Sbjct  113  VLISLQSYKEALASNDESKVAEIEAFLKSIEDEKSALESKVSRLSAELSVERDRILRISA  172

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DF+NFR+RTERERLS  TNAQGEVVE LLPVLDNF+RAK QIKVE+EGEEKINNSYQ+IS
Sbjct  173  DFENFRRRTERERLSLVTNAQGEVVENLLPVLDNFERAKAQIKVETEGEEKINNSYQNIS  232

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDE  390
            KQF+EILGSLGV PVETVG PFDPL++  +  + S   DE
Sbjct  233  KQFIEILGSLGVVPVETVGTPFDPLVNYRVGSKFSRVLDE  272



>ref|XP_010245060.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Nelumbo 
nucifera]
Length=319

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 148/197 (75%), Gaps = 0/197 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            +K Y++A+   DE  ++E+EA +  IE+EK  L  K+  L+ +  + KD+ LR+ ADF+N
Sbjct  102  IKVYKEAVLDGDEKTVSEIEAMICIIENEKNELVEKVAALSADTISGKDKYLRLKADFEN  161

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRKR+++E+L+   +AQGEV+E LLP++DNF+RAK QIK E+E E+ I+ SYQ I KQFV
Sbjct  162  FRKRSDKEKLTIIADAQGEVIESLLPMIDNFERAKQQIKTETEKEKSIDTSYQGIYKQFV  221

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ S+ V  V TVGKPFDP LHEAI RE+S EF EG+I+QEFR+GF LG+RLLRP+MVK
Sbjct  222  EIMKSMNVAVVPTVGKPFDPSLHEAIAREESTEFKEGIIVQEFRRGFFLGDRLLRPAMVK  281

Query  317  VSAGPGPAKPETSDPAE  267
            VSAGPG  K   S  +E
Sbjct  282  VSAGPGDKKAPVSSNSE  298



>ref|XP_009795641.1| PREDICTED: grpE protein homolog, mitochondrial [Nicotiana sylvestris]
Length=320

 Score =   212 bits (540),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 151/192 (79%), Gaps = 0/192 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            ++ Y++A+   D   I E+EA + S+E E+ +L +K+  L+ E+++ K++ +R+ ADFDN
Sbjct  114  MQVYKEAILVGDVKAIYEIEAAISSVEKERDDLAQKVSALSAEINSGKEKYIRLQADFDN  173

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRKR+E+ERL+  TNAQGE++E LLP++DNF+RAK QIK+E+E E+KI+ SYQ I KQFV
Sbjct  174  FRKRSEKERLTIRTNAQGEIIESLLPMVDNFERAKRQIKLETEMEKKIDASYQGIYKQFV  233

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ SL V  V TVGKPFDP LHEA+ RE+S EF +G+II+EFR+GF LG+RLLRP+MVK
Sbjct  234  EIMKSLRVAVVPTVGKPFDPALHEAVAREESQEFTDGIIIEEFRRGFLLGDRLLRPAMVK  293

Query  317  VSAGPGPAKPET  282
            VSAGPG   P +
Sbjct  294  VSAGPGKRIPSS  305



>ref|XP_009627883.1| PREDICTED: grpE protein homolog, mitochondrial [Nicotiana tomentosiformis]
Length=306

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 150/190 (79%), Gaps = 0/190 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            ++ Y++A+   D   I E+EA + S+E E+ +L +K+  L+ E+ + K++ +R+ ADFDN
Sbjct  100  MQVYKEAILIGDVKAIYEIEAAISSVEKERDDLAQKVSALSAEIDSGKEKYIRLQADFDN  159

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRKR+E+ERL+  TNAQGE++E LLP++DNF+RAK QIK+E+E E+KI+ SYQ I KQFV
Sbjct  160  FRKRSEKERLTIRTNAQGEIIESLLPMVDNFERAKRQIKLETETEKKIDASYQGIYKQFV  219

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ SL V  V TVGKPF+P LHEA+ RE+S EF++G+II+EFR+GF LG+RLLRP+MVK
Sbjct  220  EIMKSLRVAAVPTVGKPFNPALHEAVAREESQEFNDGIIIEEFRRGFLLGDRLLRPAMVK  279

Query  317  VSAGPGPAKP  288
            VSAGPG   P
Sbjct  280  VSAGPGRRIP  289



>gb|EYU23933.1| hypothetical protein MIMGU_mgv1a009924mg [Erythranthe guttata]
Length=327

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 151/190 (79%), Gaps = 0/190 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            LK+Y++A+   D     E+E  L ++E EK+ L  K+L L+ E+S+ K+++LR+ ADFDN
Sbjct  120  LKAYKEAILDGDRKFTYEVEDLLFTMEKEKIELSHKVLALSAEISSGKEKLLRLQADFDN  179

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            +RKR+E+ERL+  +NAQGEV+E LLP++D+F+RAK Q+K+++E E+KI+ SYQ I KQ V
Sbjct  180  YRKRSEKERLTVRSNAQGEVIESLLPMVDSFERAKQQLKLDTEKEKKIDTSYQGIYKQLV  239

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ SL V  V TVGKPFDPL+HEAI RE+S EF EG+IIQEFR+GF LG+RLLRP+MVK
Sbjct  240  EIMRSLRVAAVPTVGKPFDPLMHEAIAREESQEFKEGIIIQEFRRGFYLGDRLLRPAMVK  299

Query  317  VSAGPGPAKP  288
            VS+GPG  KP
Sbjct  300  VSSGPGKKKP  309



>gb|KDP32732.1| hypothetical protein JCGZ_12024 [Jatropha curcas]
Length=311

 Score =   209 bits (533),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = -2

Query  848  YRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDNFRK  669
            Y+ A+   DE  IA++EA +K IE E   L +++  L+ E+++ K++ +R+ ADFDNFRK
Sbjct  109  YKAAVLHGDERTIADIEARIKIIESENYELVQRVSALSAEIASGKEKYIRLQADFDNFRK  168

Query  668  RTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFVEIL  489
            R+E+ERL+  ++AQGEV+E LLP++DNF+RAK Q+K E+E E+KI+ SYQ I KQFVEI+
Sbjct  169  RSEKERLNVRSDAQGEVIESLLPMVDNFERAKQQLKPETEKEKKIDTSYQGIYKQFVEIM  228

Query  488  GSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVKVSA  309
             SL V  V TVGKPFDP LHEAI RE+S E++EG+IIQEFR+GF LG+RLLRP+MVKVS+
Sbjct  229  RSLQVAVVATVGKPFDPSLHEAIAREESQEYEEGIIIQEFRRGFLLGDRLLRPAMVKVSS  288

Query  308  GPGPAK  291
            GPG  K
Sbjct  289  GPGRKK  294



>ref|XP_011074901.1| PREDICTED: grpE protein homolog, mitochondrial [Sesamum indicum]
Length=321

 Score =   209 bits (533),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 151/192 (79%), Gaps = 0/192 (0%)
 Frame = -2

Query  863  MALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADF  684
            + +++Y++A+   D   I ELE  +  +E EK  L +K+  ++ E+S+ K++++R+ ADF
Sbjct  110  LIMQAYKEAVLDGDRKAIYELEDMIFMMEKEKNELAQKVAAMSAEISSGKEKLVRLQADF  169

Query  683  DNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQ  504
            DN+RKR+E+ERL+  ++AQGEV+E LLP++D+F+RAK QIK+E+E E+KI+ SYQ I KQ
Sbjct  170  DNYRKRSEKERLTVRSDAQGEVIESLLPMVDSFERAKQQIKLETEMEKKIDTSYQGIYKQ  229

Query  503  FVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSM  324
            FVEI+ SL V  V TVGKPFDP +HEAI RE+S EF EG++IQEFR+GF LG+RLLRP+M
Sbjct  230  FVEIMRSLRVAAVPTVGKPFDPKMHEAIAREESYEFKEGIVIQEFRRGFYLGDRLLRPAM  289

Query  323  VKVSAGPGPAKP  288
            VKVS+GPG  KP
Sbjct  290  VKVSSGPGKKKP  301



>ref|XP_006847037.1| hypothetical protein AMTR_s00017p00181540 [Amborella trichopoda]
 gb|ERN08618.1| hypothetical protein AMTR_s00017p00181540 [Amborella trichopoda]
Length=274

 Score =   208 bits (529),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 151/191 (79%), Gaps = 0/191 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            V+    +Y++A+   D  KI+++E  L +IE EK  LE+++  L+ ELS+ K++ L + A
Sbjct  50   VITLFHAYKEAIVEGDLHKISDIETKLYAIETEKNALEQQITSLSAELSSGKEKFLWLKA  109

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DF+NFRKR+E++RL+  ++ QG+V+E LLP++DNF+RAK Q+K E+E E+KI+ SYQ I 
Sbjct  110  DFENFRKRSEKDRLTLTSDVQGDVIESLLPMVDNFERAKQQLKPETEKEKKIDGSYQGIY  169

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQFVEI+ SL V  VETVGKPFDP LHEAI RE+SVE+ EG+IIQEFR+GF LG+RLLRP
Sbjct  170  KQFVEIMRSLKVAVVETVGKPFDPSLHEAIAREESVEYKEGIIIQEFRRGFVLGDRLLRP  229

Query  329  SMVKVSAGPGP  297
            +MVKVSAGPGP
Sbjct  230  AMVKVSAGPGP  240



>ref|XP_006366929.1| PREDICTED: grpE protein homolog, mitochondrial-like [Solanum 
tuberosum]
Length=317

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 150/192 (78%), Gaps = 0/192 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            ++ Y++A+   D   I+E+EA + S++ E+ ++ +K+  L+ ++++ K++ +R+ ADFDN
Sbjct  111  MQVYKEAILVGDVKLISEIEAVISSVDKERDDMSQKVSALSADINSGKEKYIRLQADFDN  170

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            +RKR+E E+L   TNAQGE++E LLP++DNF+RAK QIK+E+E E+KI+ SYQ I KQFV
Sbjct  171  YRKRSENEKLRIRTNAQGEIIESLLPMVDNFERAKRQIKLETEMEKKIDASYQGIYKQFV  230

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ SL V  V TVGKPFDP LHEAI RE+S EF EG++I+EFR+GF LG+RLLRP+MVK
Sbjct  231  EIMRSLRVAVVPTVGKPFDPALHEAIAREESQEFSEGIVIEEFRRGFLLGDRLLRPAMVK  290

Query  317  VSAGPGPAKPET  282
            VS+GPG   P +
Sbjct  291  VSSGPGKRVPSS  302



>gb|KHG12283.1| Protein grpE [Gossypium arboreum]
Length=301

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 155/197 (79%), Gaps = 0/197 (0%)
 Frame = -2

Query  848  YRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDNFRK  669
            YR+AL   D+  ++E+E+ +  +E+EK  LE+++L L+ E+++ K++ +R+ ADFDN+RK
Sbjct  102  YREALLNGDDRIVSEIESRISILENEKNGLEKQVLELSAEITSGKEKYIRLQADFDNYRK  161

Query  668  RTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFVEIL  489
            R+E+ERL++ ++A+GEV+E LLP++D+F+RAK QIK E+E E+KI+ SYQ I KQFVEI+
Sbjct  162  RSEKERLTARSDAKGEVMESLLPMVDSFERAKQQIKPETEKEKKIDMSYQGIYKQFVEIM  221

Query  488  GSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVKVSA  309
             SL V  V TVGKPFDP LHEAI RE+S EF EG+IIQEFR+GF LG+RLLRP+MVKVS+
Sbjct  222  RSLQVAVVPTVGKPFDPSLHEAIAREESQEFKEGIIIQEFRRGFLLGDRLLRPAMVKVSS  281

Query  308  GPGPAKPETSDPAEEQG  258
            GPG +K  T    E  G
Sbjct  282  GPGSSKKATVVTHESSG  298



>ref|XP_004307232.1| PREDICTED: protein GrpE-like [Fragaria vesca subsp. vesca]
Length=303

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            LK Y+DA+   DE  +AE+EA ++ +E+++  L +K+  ++ E+++ K++++R+ ADFDN
Sbjct  95   LKVYKDAIFNGDEQTVAEIEAKIEIVENKQNELVQKVSSMSAEVTSGKEKLIRLQADFDN  154

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
             RKR E+ERL+  T+AQGEV+E LLP++DNF+RAK QIK E+E E+KI+ SYQ I KQFV
Sbjct  155  CRKRFEKERLNVRTDAQGEVIESLLPMVDNFERAKQQIKPETEKEKKIDTSYQGIYKQFV  214

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ SL V  V T+GKPFDP +HEAI RE+S EF +G++IQE R+GF LG RLLRP++VK
Sbjct  215  EIMRSLRVASVPTLGKPFDPSVHEAIAREESQEFPDGIVIQEIRRGFLLGGRLLRPALVK  274

Query  317  VSAGPGPAK  291
            VS GPG  K
Sbjct  275  VSIGPGSKK  283



>emb|CBI31184.3| unnamed protein product [Vitis vinifera]
Length=290

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +++AL+SY++AL +NDESK AE+EAF+K IEDEK++LE+K+  L+EELS++K+R+LRISA
Sbjct  116  IIVALRSYKEALVSNDESKAAEIEAFIKFIEDEKIDLEKKVAALSEELSSDKERILRISA  175

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRT+RERLS  TNAQGEV+E LLPVLDNF+RAK QIKVE+EGEEKINNSYQSI 
Sbjct  176  DFDNFRKRTDRERLSLVTNAQGEVLENLLPVLDNFERAKAQIKVETEGEEKINNSYQSIY  235

Query  509  KQFVEILGSLGVTPVETVGKPFDPLL  432
            KQFVEILGSLGVTPVET+G PFDPL+
Sbjct  236  KQFVEILGSLGVTPVETIGNPFDPLV  261



>ref|XP_002513845.1| Protein grpE, putative [Ricinus communis]
 gb|EEF48428.1| Protein grpE, putative [Ricinus communis]
Length=315

 Score =   204 bits (520),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 144/186 (77%), Gaps = 0/186 (0%)
 Frame = -2

Query  848  YRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDNFRK  669
            Y++A+   DE  + ++EA +K IE+    L +K+  L+ E+++ K++ +R+ ADFDNFRK
Sbjct  113  YKEAILLGDERTVTDIEARIKIIENTNYELVQKVSDLSTEITSGKEKYIRLQADFDNFRK  172

Query  668  RTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFVEIL  489
            R+E+ER +  ++AQGEV+E LLP++D+F+RAK QIK E+E E+KI+ SYQ I KQFVEI+
Sbjct  173  RSEKERHTIRSDAQGEVIESLLPMVDSFERAKQQIKPETEMEKKIDTSYQGIYKQFVEIM  232

Query  488  GSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVKVSA  309
             SL V  V TVGKPFDP LHEAI RE+S E+ EG+IIQEFR+GF LG RLLRP+MVKVSA
Sbjct  233  RSLQVAVVATVGKPFDPSLHEAIAREESQEYKEGIIIQEFRRGFLLGGRLLRPAMVKVSA  292

Query  308  GPGPAK  291
            GPG  K
Sbjct  293  GPGRKK  298



>ref|XP_010653155.1| PREDICTED: uncharacterized protein LOC100251893 isoform X2 [Vitis 
vinifera]
Length=294

 Score =   204 bits (518),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +++AL+SY++AL +NDESK AE+EAF+K IEDEK++LE+K+  L+EELS++K+R+LRISA
Sbjct  116  IIVALRSYKEALVSNDESKAAEIEAFIKFIEDEKIDLEKKVAALSEELSSDKERILRISA  175

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRT+RERLS  TNAQGEV+E LLPVLDNF+RAK QIKVE+EGEEKINNSYQSI 
Sbjct  176  DFDNFRKRTDRERLSLVTNAQGEVLENLLPVLDNFERAKAQIKVETEGEEKINNSYQSIY  235

Query  509  KQFVEILGSLGVTPVETVGKPFDPLL  432
            KQFVEILGSLGVTPVET+G PFDPL+
Sbjct  236  KQFVEILGSLGVTPVETIGNPFDPLV  261



>emb|CDP08484.1| unnamed protein product [Coffea canephora]
Length=328

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 151/199 (76%), Gaps = 2/199 (1%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            + +Y++A+   DE  I++ E  +  +E E+  L  K+ +L++E+  +KD+ +R+ ADFDN
Sbjct  112  ISAYKEAILNGDEKSISDFEEIIHMVEKERNELLEKVSVLSDEIGAQKDKYVRLQADFDN  171

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRKRTE E+L+  +NAQGEV+E LLP++DNF+RAK  +K+E+E E+KI+ SYQ I KQFV
Sbjct  172  FRKRTENEKLTIRSNAQGEVIESLLPMVDNFERAKQHMKLETEQEKKIDASYQGIYKQFV  231

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ +LGV+ V TVG  FDP+LHEAI +E+S EF EGVII+EFR+GF L +RLLRP+MVK
Sbjct  232  EIMKNLGVSVVPTVGTLFDPVLHEAIAQEESEEFKEGVIIEEFRRGFLLVDRLLRPAMVK  291

Query  317  VSAGPGPAKPETSDPAEEQ  261
            VS+GPG  +P  S  A EQ
Sbjct  292  VSSGPGVRQP--SSAASEQ  308



>ref|XP_009367021.1| PREDICTED: grpE protein homolog, mitochondrial-like [Pyrus x 
bretschneideri]
Length=323

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            L+ Y++A+   D   ++E+EA ++ IE+EK  L +K+   + E+++ K++++R+ ADFDN
Sbjct  121  LQIYKEAIFNGDGKTVSEVEAIIEVIENEKNELVKKVSSASAEITSGKEKLIRLQADFDN  180

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
             RKR E+ERL+  T+AQGEV+E LLP++DNF+RAK  +K E+E EEKI+ SYQ I KQF+
Sbjct  181  CRKRFEKERLTVRTDAQGEVIESLLPMVDNFERAKQYLKPETEREEKIDASYQGIYKQFI  240

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ SL V  V TVG PFDP LHEAI RE+S EF EG+IIQE R+GF LG RLLRP+MVK
Sbjct  241  EIMRSLRVAVVPTVGMPFDPSLHEAIAREESQEFTEGIIIQEIRRGFLLGGRLLRPAMVK  300

Query  317  VSAGPGPAK  291
            VS+GPG  K
Sbjct  301  VSSGPGSKK  309



>ref|XP_009344252.1| PREDICTED: grpE protein homolog, mitochondrial-like [Pyrus x 
bretschneideri]
Length=323

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            L+ Y++A+   D   ++E+EA ++ IE+EK  L +K+   + E+++ K++++R+ ADFDN
Sbjct  121  LQIYKEAIFNGDGKTVSEVEAIIEVIENEKNELVKKVSSASAEITSGKEKLIRLQADFDN  180

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
             RKR E+ERL+  T+AQGEV+E LLP++DNF+RAK  +K E+E EEKI+ SYQ I KQF+
Sbjct  181  CRKRFEKERLTVRTDAQGEVIESLLPMVDNFERAKQYLKPETEREEKIDVSYQGIYKQFI  240

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ SL V  V TVG PFDP LHEAI RE+S EF EG+IIQE R+GF LG RLLRP+MVK
Sbjct  241  EIMRSLRVAVVPTVGMPFDPSLHEAIAREESQEFTEGIIIQEIRRGFLLGGRLLRPAMVK  300

Query  317  VSAGPGPAK  291
            VS+GPG  K
Sbjct  301  VSSGPGSKK  309



>ref|XP_006604279.1| PREDICTED: grpE protein homolog, mitochondrial-like isoform X2 
[Glycine max]
Length=293

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -2

Query  866  MMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISAD  687
            ++ L+SYR+AL  NDE KIAELE+ LKSIEDEK+ LE K+  L+EELS EKDR+LRISAD
Sbjct  116  LVILQSYREALANNDEVKIAELESSLKSIEDEKIELEGKIASLSEELSIEKDRILRISAD  175

Query  686  FDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISK  507
            FDNFRKRTER+RLS  TNAQGEVVE LLPVLDNF+RAKTQIKVE+EGEEKINNSYQSI K
Sbjct  176  FDNFRKRTERDRLSLVTNAQGEVVESLLPVLDNFERAKTQIKVETEGEEKINNSYQSIYK  235

Query  506  QFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDE  390
            QF EIL SLGV PVETVG PFDPL  + +  + +   DE
Sbjct  236  QFNEILTSLGVEPVETVGTPFDPLARKPVGSKFNYVLDE  274



>ref|XP_009367332.1| PREDICTED: grpE protein homolog, mitochondrial-like [Pyrus x 
bretschneideri]
Length=321

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 142/190 (75%), Gaps = 0/190 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            LK Y++A+   D    +E+EA ++ IE+EK  L  K+   + E+++ K++++R+ ADFDN
Sbjct  119  LKVYKEAIFNGDGKTASEVEAIIRVIENEKKELVEKVSSASAEITSGKEKLIRLQADFDN  178

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
             RKR E+ERL+  T+AQGEV+E LLP++DNF+RA+  +K E+E E+KI+ SYQ I KQFV
Sbjct  179  CRKRFEKERLTVRTDAQGEVIESLLPMVDNFERARQYLKPETEKEKKIDASYQGIYKQFV  238

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ SL V  V TVGKPFDP LHEAI RE+S E  EG+IIQE R+GF LG RLLRP+ VK
Sbjct  239  EIMRSLHVAIVPTVGKPFDPSLHEAIAREESQELREGIIIQEIRRGFLLGGRLLRPATVK  298

Query  317  VSAGPGPAKP  288
            VS+GPG  KP
Sbjct  299  VSSGPGSKKP  308



>ref|XP_011027640.1| PREDICTED: grpE protein homolog, mitochondrial [Populus euphratica]
Length=311

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            +K+YR A+   DE  I ++EA + +IE E     +K+  L+ E+++ K++ +R+ ADFDN
Sbjct  104  MKTYRQAIFYGDEKTILDIEAKVGTIEKENHEFLQKVSSLSAEITSGKEKYIRLQADFDN  163

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRKR+++ER+   ++AQGEV+E LLP++D+F+RAK QI+ E+E E+KI++SYQ I KQ V
Sbjct  164  FRKRSDKERVKIRSDAQGEVIESLLPMVDSFERAKQQIQPETEKEKKIDSSYQGIYKQLV  223

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            +I+ +L V  V TVGKPFDP LHEAI RE+S E+ EG+IIQEFR+GF +G RL+RP+MVK
Sbjct  224  DIMRNLHVAAVPTVGKPFDPSLHEAIAREESQEYKEGIIIQEFRRGFLIGNRLIRPAMVK  283

Query  317  VSAGPGPAK  291
            VS+GPG  K
Sbjct  284  VSSGPGNKK  292



>ref|XP_002301021.2| hypothetical protein POPTR_0002s09060g [Populus trichocarpa]
 gb|EEE80294.2| hypothetical protein POPTR_0002s09060g [Populus trichocarpa]
Length=311

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            +K YR A+   DE  I ++EA + +IE E     +K+  L+ E+++ K++ +R+ ADFDN
Sbjct  104  MKIYRQAIFYGDEKTILDIEAKVATIEKENHEFLQKVSSLSAEITSGKEKYIRLQADFDN  163

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRKR+++ER++  ++AQGEV+E LLP++D+F+RAK QI+ E+E E+KI++SYQ I KQ V
Sbjct  164  FRKRSDKERVNIRSDAQGEVIESLLPMVDSFERAKQQIQPETEKEKKIDSSYQGIYKQLV  223

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            +I+ +L V  V TVGKPFDP LHEAI RE+S E+ EG+IIQEFR+GF +G RL+RP+MVK
Sbjct  224  DIMRNLQVAAVPTVGKPFDPSLHEAIAREESQEYKEGIIIQEFRRGFLIGNRLIRPAMVK  283

Query  317  VSAGPGPAK  291
            VS+GPG  K
Sbjct  284  VSSGPGNKK  292



>ref|XP_010672791.1| PREDICTED: grpE protein homolog, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=318

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 140/186 (75%), Gaps = 0/186 (0%)
 Frame = -2

Query  848  YRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDNFRK  669
            Y++A+   D   I E+E     +E EK +L  KL  + EE+++ KDR +R+ ADFDNFRK
Sbjct  112  YKEAVLAGDYQTITEIETVFYRLETEKNDLVEKLATMKEEITSGKDRHIRLQADFDNFRK  171

Query  668  RTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFVEIL  489
            R+E+ERLS  ++AQGEV+E  L ++D+F+RAK QIK E++ E++I+ SYQ I KQFVEI+
Sbjct  172  RSEKERLSVRSDAQGEVIESFLSMVDSFERAKQQIKPETDREKQIDTSYQGIYKQFVEIM  231

Query  488  GSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVKVSA  309
             SL V  + TVGKPFDP LHEAI RE+S EF EG+IIQEFR+GF LG+RLLRP+ VKVS+
Sbjct  232  RSLRVASIATVGKPFDPSLHEAIAREESDEFKEGIIIQEFRRGFLLGDRLLRPATVKVSS  291

Query  308  GPGPAK  291
            GPG  K
Sbjct  292  GPGKKK  297



>ref|XP_007018915.1| GrpE protein, putative [Theobroma cacao]
 gb|EOY16140.1| GrpE protein, putative [Theobroma cacao]
Length=311

 Score =   196 bits (499),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 155/201 (77%), Gaps = 2/201 (1%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            +K Y++AL   D+  ++E+E+ +  ++ EK  LE+K+L L+ E++  K++ +R+ ADFDN
Sbjct  103  IKVYKEALLNGDDRIVSEIESRISILQIEKNGLEKKVLELSAEITTGKEKYIRLQADFDN  162

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRKR+E+ERL++ ++A+G+V+E LLP++D+F+RAK QIK E+E E+KI+ SYQ I KQFV
Sbjct  163  FRKRSEKERLTTRSDAKGDVIENLLPMVDSFERAKQQIKPETEKEKKIDMSYQGIYKQFV  222

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EIL SL V  V TVGKPFDP LHEAI RE+S EF EG+IIQEFR+GF LG+RL+RP+MVK
Sbjct  223  EILRSLQVAVVPTVGKPFDPSLHEAIAREESQEFKEGIIIQEFRRGFLLGDRLVRPAMVK  282

Query  317  VSAGPGPAKPETSDPAEEQGG  255
            VS+G G  K   S  AE+  G
Sbjct  283  VSSGLGSQK--ASVAAEKSSG  301



>ref|XP_002983121.1| hypothetical protein SELMODRAFT_117407, partial [Selaginella 
moellendorffii]
 gb|EFJ15930.1| hypothetical protein SELMODRAFT_117407, partial [Selaginella 
moellendorffii]
Length=237

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 155/210 (74%), Gaps = 7/210 (3%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            ++ + L++Y +A+  ND++ ++ ++A L+ I+ E+ +L + +  LTEE +  K+R+LR++
Sbjct  20   VIEVLLRNYSEAVLGNDQAAMSTIQAELEVIQKERDSLSQLVANLTEESALAKERLLRLN  79

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKR+ RE+ S     +G+VVE LLP++DNF+RAK  IK E++GE KI++SYQ I
Sbjct  80   ADFDNFRKRSGREKDSLRETVKGDVVESLLPMIDNFERAKGAIKAETDGERKIDSSYQGI  139

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQFV+I+ SLGV  ++TVGK F+P LHEAIMRE+S E+DEG++ QEFR+GF LGE+LLR
Sbjct  140  YKQFVDIMKSLGVKVIDTVGKEFNPELHEAIMREESSEYDEGIVTQEFRRGFLLGEKLLR  199

Query  332  PSMVKVSAG-------PGPAKPETSDPAEE  264
             +MVKVS+G         P   E + P++E
Sbjct  200  AAMVKVSSGKQSNSPAAAPQDSEETTPSDE  229



>ref|XP_008347771.1| PREDICTED: grpE protein homolog, mitochondrial-like [Malus domestica]
Length=316

 Score =   196 bits (498),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            LK Y++A+   D   ++E+EA ++ IE+EK  L  K+   + E+++ K++++R+ ADFDN
Sbjct  114  LKVYKEAIFNGDGKTVSEVEAIIQVIENEKKELVEKVSSASAEITSGKEKLIRLQADFDN  173

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
             RKR ++ERL+  T+AQGEV+E LLP++DNF+RA+  +K E+E E+KI+ SYQ I KQFV
Sbjct  174  CRKRFDKERLTVRTDAQGEVIESLLPMVDNFERARQYLKPETEQEKKIDASYQGIYKQFV  233

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ SL V  V TVGKPFDP LHEAI RE+S E  EG+IIQE R+GF LG RLLRP+ VK
Sbjct  234  EIMRSLDVAVVPTVGKPFDPSLHEAIAREESQELKEGIIIQEIRRGFLLGGRLLRPATVK  293

Query  317  VSAGPGPAK  291
            VS+GPG  K
Sbjct  294  VSSGPGSXK  302



>ref|XP_002965873.1| hypothetical protein SELMODRAFT_83859, partial [Selaginella moellendorffii]
 gb|EFJ33293.1| hypothetical protein SELMODRAFT_83859, partial [Selaginella moellendorffii]
Length=237

 Score =   194 bits (492),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 155/210 (74%), Gaps = 7/210 (3%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            ++ + L++Y +A+  ND++ ++ ++A L+ I+ E+ +L + +  LTEE +  K+R+LR++
Sbjct  20   VIEVLLRNYSEAVLGNDQAAMSTIQAELEVIQKERDSLSQLVANLTEESALAKERLLRLN  79

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKR+ RE+ S     +G+VVE LLP++DNF+RAK  IK E++GE KI++SYQ I
Sbjct  80   ADFDNFRKRSGREKDSLRETVKGDVVESLLPMIDNFERAKGAIKAETDGERKIDSSYQGI  139

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLR  333
             KQFV+I+ SLGV  ++TVGK F+P LHEAIMRE+S E+DEG++ QEFR+GF LGE+LLR
Sbjct  140  YKQFVDIMKSLGVKVIDTVGKEFNPELHEAIMREESSEYDEGIVTQEFRRGFLLGEKLLR  199

Query  332  PSMVKVSAG-------PGPAKPETSDPAEE  264
             +MVKVS+G         P   E + P++E
Sbjct  200  AAMVKVSSGKPSNSPAAAPQDSEETTPSDE  229



>ref|XP_010687148.1| PREDICTED: uncharacterized protein LOC104901293 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=294

 Score =   195 bits (496),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 135/171 (79%), Gaps = 2/171 (1%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            V+ AL+ Y++AL+ NDE+ + ELEAF KSIEDEK  LERK+  ++E+LS E+DRVLRI A
Sbjct  117  VITALQLYKEALNNNDETTVGELEAFFKSIEDEKEMLERKVASMSEDLSVERDRVLRIGA  176

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTERER S  TNA+GEV+E  L VLDNF+RAK+QIK+ESE EEKI+NSYQSI 
Sbjct  177  DFDNFRKRTERERSSLVTNAKGEVIENFLGVLDNFERAKSQIKIESEAEEKISNSYQSIY  236

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGF  357
            KQFVEILGS+GV PVETVGKPFDPL+   +    S  F  G +IQ   +GF
Sbjct  237  KQFVEILGSVGVVPVETVGKPFDPLVGNQVGLNFSRVF--GKMIQFLNRGF  285



>ref|XP_010064014.1| PREDICTED: grpE protein homolog, mitochondrial [Eucalyptus grandis]
 ref|XP_010064015.1| PREDICTED: grpE protein homolog, mitochondrial [Eucalyptus grandis]
 gb|KCW71297.1| hypothetical protein EUGRSUZ_F04384 [Eucalyptus grandis]
Length=316

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 144/186 (77%), Gaps = 0/186 (0%)
 Frame = -2

Query  848  YRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDNFRK  669
            +R+A  + DE  + E+EA + SIE  +  L  ++  L+EE+++ K+  +R+ ADFDN+RK
Sbjct  110  FREAFLSGDEKTVDEVEARMCSIEVLRKQLVEQVSTLSEEMTSGKENYIRLQADFDNYRK  169

Query  668  RTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFVEIL  489
            R+E+ERL+  +NAQ E++E LLP++DNF+RAK QIK E++ E+KI+ SYQ I KQFVE++
Sbjct  170  RSEKERLTISSNAQRELIESLLPMVDNFERAKQQIKPETDEEKKIDASYQGIYKQFVEVM  229

Query  488  GSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVKVSA  309
             SL V+ + ++GKPFDPL HEAI RE+S EF EG++IQE R+GF+LG+R+LRP+ VKVSA
Sbjct  230  RSLHVSAIASLGKPFDPLQHEAIGREESQEFREGIVIQEIRRGFRLGDRVLRPAKVKVSA  289

Query  308  GPGPAK  291
            GPG  K
Sbjct  290  GPGSKK  295



>ref|XP_006484786.1| PREDICTED: grpE protein homolog, mitochondrial-like isoform X2 
[Citrus sinensis]
Length=301

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 140/172 (81%), Gaps = 1/172 (1%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +M  L+SY++AL +ND++K AE+EA LKS EDEK++LERK++ L+EELS E+ R+LRISA
Sbjct  123  IMETLQSYKEALASNDDTKAAEIEALLKSFEDEKIDLERKVVNLSEELSAERARILRISA  182

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTE+ERLS  TNAQGEV+E+LL VLDNF+RAKTQIKV++EGEEKINNSYQSI 
Sbjct  183  DFDNFRKRTEKERLSLVTNAQGEVMERLLQVLDNFERAKTQIKVQTEGEEKINNSYQSIY  242

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDE-GVIIQEFRKGF  357
            KQ VEILGSLGV PVETVG PFDPL+   +  + S   DE   I+ +   GF
Sbjct  243  KQLVEILGSLGVVPVETVGNPFDPLVKPRVGLKISRVLDEFSQILNQVCSGF  294



>gb|KDO46640.1| hypothetical protein CISIN_1g019043mg [Citrus sinensis]
Length=310

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 140/172 (81%), Gaps = 1/172 (1%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +M  L+SY++AL +ND++K AE+EA LKS EDEK++LERK++ L+EELS E+ R+LRISA
Sbjct  126  IMETLQSYKEALASNDDTKAAEIEALLKSFEDEKIDLERKVVNLSEELSAERARILRISA  185

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRTE+ERLS  TNAQGEV+E+LL VLDNF+RAKTQIKV++EGEEKINNSYQSI 
Sbjct  186  DFDNFRKRTEKERLSLVTNAQGEVMERLLQVLDNFERAKTQIKVQTEGEEKINNSYQSIY  245

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDE-GVIIQEFRKGF  357
            KQ VEILGSLGV PVETVG PFDPL+   +  + S   DE   I+ +   GF
Sbjct  246  KQLVEILGSLGVVPVETVGNPFDPLVKPRVGLKISRVLDEFSQILNQVCSGF  297



>ref|XP_009596390.1| PREDICTED: uncharacterized protein LOC104092484, partial [Nicotiana 
tomentosiformis]
Length=318

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = -2

Query  932  PGSDDISNeadtttseetaSIVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnler  753
              ++D S+E D   ++ETAS +  +L+ YRDAL  ND+SK+AE+E  LKSIE+EK+ L+R
Sbjct  6    AAAEDASDEGDNAAADETASFIATSLQLYRDALANNDDSKVAEIEISLKSIEEEKIELQR  65

Query  752  kllllteelsneKDRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAK  573
            K+  LTEELS+E+DRVLRI+ADFDNFRKRTERERLS   NAQGEVVEKLL +LDNF+RAK
Sbjct  66   KVASLTEELSSERDRVLRINADFDNFRKRTERERLSLVKNAQGEVVEKLLSILDNFERAK  125

Query  572  TQIKVESEGEEKINNSYQSISKQFVEILGSLGVTPVETVGKPFDPL  435
             QIKV +EGEEKINNSYQSISK+F EILGSLGV  VETVGKPFDPL
Sbjct  126  MQIKVATEGEEKINNSYQSISKKFGEILGSLGVETVETVGKPFDPL  171



>ref|XP_006437269.1| hypothetical protein CICLE_v10031794mg [Citrus clementina]
 gb|ESR50509.1| hypothetical protein CICLE_v10031794mg [Citrus clementina]
Length=344

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 139/173 (80%), Gaps = 1/173 (1%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
             +M   +SY++AL +ND++K AE+EA LKS EDEK++LERK++ L+EELS E+ R+LRIS
Sbjct  165  FIMETFQSYKEALASNDDTKAAEIEALLKSFEDEKIDLERKVVNLSEELSAERARILRIS  224

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTE+ERLS  TNAQGEV+E+LL VLDNF+RAKTQIKV++EGEEKINNSYQSI
Sbjct  225  ADFDNFRKRTEKERLSLVTNAQGEVMERLLQVLDNFERAKTQIKVQTEGEEKINNSYQSI  284

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDE-GVIIQEFRKGF  357
             KQ VEILGSLGV PVETVG PFDPL+   +  + S   DE   I+ +   GF
Sbjct  285  YKQLVEILGSLGVVPVETVGNPFDPLVKPRVGLKISRVLDEFSQILNQVCSGF  337



>ref|XP_008352692.1| PREDICTED: LOW QUALITY PROTEIN: grpE protein homolog, mitochondrial-like 
[Malus domestica]
Length=302

 Score =   191 bits (485),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 139/189 (74%), Gaps = 0/189 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            L+ Y++A    D   ++E+EA ++ IE+EK  L +K+   + E+++ K++++R+ ADFDN
Sbjct  109  LQIYKEAXFNGDGKTVSEVEAIIEVIENEKNELVKKVSSASAEITSGKEKLIRLQADFDN  168

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
             RKR E+ERL+  T+AQGE +E LLP++DNF+RAK  +K E+E EEKI+ SYQ I KQFV
Sbjct  169  CRKRFEKERLTVRTDAQGEXIESLLPMVDNFERAKQYLKPETEREEKIDASYQGIYKQFV  228

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+  L V  V TVGKPFDP LHEAI RE+S EF EG+IIQE   GF  G RLLRP+MVK
Sbjct  229  EIMRGLSVAVVPTVGKPFDPSLHEAIAREESQEFTEGIIIQESAVGFXXGGRLLRPAMVK  288

Query  317  VSAGPGPAK  291
            VS+GPG  K
Sbjct  289  VSSGPGSKK  297



>ref|XP_004493256.1| PREDICTED: protein GrpE-like isoform X3 [Cicer arietinum]
Length=288

 Score =   191 bits (484),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +++ L+SY++AL  NDE K+AELE+ LKSI+DE V LE K+  L+EELS EKDR LRI A
Sbjct  110  LIVLLQSYKEALANNDEVKVAELESSLKSIDDEIVGLEGKIASLSEELSIEKDRKLRIGA  169

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDN+RKRTER+RLS  TNAQGEVVE LLPVLDNF+RAK QIKVE+EGEEKINNSYQSI 
Sbjct  170  DFDNYRKRTERDRLSLVTNAQGEVVESLLPVLDNFERAKAQIKVETEGEEKINNSYQSIY  229

Query  509  KQFVEILGSLGVTPVETVGKPFDPL  435
            KQF+EIL SLGV PVETVGKPFDP+
Sbjct  230  KQFIEILNSLGVEPVETVGKPFDPM  254



>ref|XP_008233940.1| PREDICTED: grpE protein homolog, mitochondrial [Prunus mume]
Length=313

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 139/189 (74%), Gaps = 0/189 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            LK Y++A+   DE  ++E+EA ++ +E+EK  L +K+   + E ++ K++ +R+ ADFDN
Sbjct  105  LKVYKEAIFNGDEETVSEVEAKIEILENEKNKLVKKVSSSSAETTSGKEKFIRLQADFDN  164

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
             RKR E+ERL+  T+AQ EV+E LLP++DNF+RAK  IK E++ E+KI+ SYQ I KQ V
Sbjct  165  CRKRFEKERLTVRTDAQEEVIESLLPMVDNFERAKQYIKPETDKEKKIDASYQGIYKQLV  224

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            E + SL V  V TVGK FDP LHEA+ RE+S EF EG+IIQE R+GF LG RLLRP+MVK
Sbjct  225  ETMKSLHVAVVPTVGKSFDPSLHEAVAREESQEFKEGIIIQEIRRGFLLGGRLLRPAMVK  284

Query  317  VSAGPGPAK  291
            VS GPG  K
Sbjct  285  VSTGPGSKK  293



>ref|XP_006434089.1| hypothetical protein CICLE_v10001980mg [Citrus clementina]
 gb|ESR47329.1| hypothetical protein CICLE_v10001980mg [Citrus clementina]
Length=302

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 156/211 (74%), Gaps = 2/211 (1%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            +++Y++A+   DE  ++++EA +  ++ EK  L +K+  L+ E+++ K++ +R+ ADF+N
Sbjct  90   IEAYKEAVSNGDEKAVSDIEARIFIVQYEKNELLQKVSSLSAEITSGKEKCIRLQADFEN  149

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
             RKR+E+ERL+  ++AQGEV+E+LL ++D+F+RA+ QIK E+E E+KI+ SYQ I KQFV
Sbjct  150  SRKRSEKERLAVRSDAQGEVIERLLLLVDSFERARLQIKPETEKEKKIDTSYQGIYKQFV  209

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ S+ V  V TVGKPFDP +HEAI RE+S EF EG+II+E R+GF LG+RL+RP+ VK
Sbjct  210  EIMRSMQVAVVPTVGKPFDPAVHEAIAREESEEFKEGIIIEETRRGFLLGDRLIRPARVK  269

Query  317  VSAGPGPAKPETSDPAEEQGGFIETAEEGGS  225
            VS GPG  K   ++  E+  G   TA E GS
Sbjct  270  VSVGPGRKKASVAN--EKSAGQPATAAEEGS  298



>ref|XP_006472690.1| PREDICTED: grpE protein homolog, mitochondrial-like isoform X2 
[Citrus sinensis]
Length=302

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 155/211 (73%), Gaps = 2/211 (1%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            +++Y++A+   DE  ++++EA +  +++EK  L RK+  L+ E+++ K++  R+ ADF+N
Sbjct  90   IEAYKEAVSNGDEKAVSDIEARIFVVQNEKNELLRKVSSLSAEITSGKEKCTRLQADFEN  149

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
             RKR+E+ERL+  ++AQGEV+E+LL ++D+F+RA+ QIK E+E E+KI+ SYQ I KQFV
Sbjct  150  SRKRSEKERLAVRSDAQGEVIERLLLLVDSFERARLQIKPETEKEKKIDTSYQGIYKQFV  209

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ S+    V TVGKPFDP +HEAI RE+S EF+EG+II+E R+GF LG+RL+RP+ VK
Sbjct  210  EIMRSMQAAAVPTVGKPFDPAVHEAIAREESEEFNEGIIIEETRRGFLLGDRLIRPARVK  269

Query  317  VSAGPGPAKPETSDPAEEQGGFIETAEEGGS  225
            VS GPG  K   S   E+  G   TA E GS
Sbjct  270  VSVGPGRKK--ASVATEKSAGQPATAAEEGS  298



>ref|XP_006472689.1| PREDICTED: grpE protein homolog, mitochondrial-like isoform X1 
[Citrus sinensis]
Length=303

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 155/211 (73%), Gaps = 2/211 (1%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            +++Y++A+   DE  ++++EA +  +++EK  L RK+  L+ E+++ K++  R+ ADF+N
Sbjct  90   IEAYKEAVSNGDEKAVSDIEARIFVVQNEKNELLRKVSSLSAEITSGKEKCTRLQADFEN  149

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
             RKR+E+ERL+  ++AQGEV+E+LL ++D+F+RA+ QIK E+E E+KI+ SYQ I KQFV
Sbjct  150  SRKRSEKERLAVRSDAQGEVIERLLLLVDSFERARLQIKPETEKEKKIDTSYQGIYKQFV  209

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ S+    V TVGKPFDP +HEAI RE+S EF+EG+II+E R+GF LG+RL+RP+ VK
Sbjct  210  EIMRSMQAAAVPTVGKPFDPAVHEAIAREESEEFNEGIIIEETRRGFLLGDRLIRPARVK  269

Query  317  VSAGPGPAKPETSDPAEEQGGFIETAEEGGS  225
            VS GPG  K   S   E+  G   TA E GS
Sbjct  270  VSVGPGRKK--ASVATEKSAGQPATAAEEGS  298



>ref|XP_006472691.1| PREDICTED: grpE protein homolog, mitochondrial-like isoform X3 
[Citrus sinensis]
Length=301

 Score =   188 bits (477),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 154/209 (74%), Gaps = 2/209 (1%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            +++Y++A+   DE  ++++EA +  +++EK  L RK+  L+ E+++ K++  R+ ADF+N
Sbjct  90   IEAYKEAVSNGDEKAVSDIEARIFVVQNEKNELLRKVSSLSAEITSGKEKCTRLQADFEN  149

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
             RKR+E+ERL+  ++AQGEV+E+LL ++D+F+RA+ QIK E+E E+KI+ SYQ I KQFV
Sbjct  150  SRKRSEKERLAVRSDAQGEVIERLLLLVDSFERARLQIKPETEKEKKIDTSYQGIYKQFV  209

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            EI+ S+    V TVGKPFDP +HEAI RE+S EF+EG+II+E R+GF LG+RL+RP+ VK
Sbjct  210  EIMRSMQAAAVPTVGKPFDPAVHEAIAREESEEFNEGIIIEETRRGFLLGDRLIRPARVK  269

Query  317  VSAGPGPAKPETSDPAEEQGGFIETAEEG  231
            VS GPG  K   S   E+  G   TA EG
Sbjct  270  VSVGPGRKK--ASVATEKSAGQPATAAEG  296



>ref|XP_007225704.1| hypothetical protein PRUPE_ppa008776mg [Prunus persica]
 gb|EMJ26903.1| hypothetical protein PRUPE_ppa008776mg [Prunus persica]
Length=319

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 140/189 (74%), Gaps = 0/189 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            L+ Y++A+   DE  ++E+EA ++ +E+EK  L +K+   + E+++ K++ +R+ ADFDN
Sbjct  111  LQVYKEAIFNGDEETVSEVEAKIEILENEKNKLVKKVSSSSAEITSGKEKFIRLQADFDN  170

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
             RKR E+ERL+  T+AQGEV+E LLP++DNF+RAK  IK E++ E+K++ SYQ I KQ V
Sbjct  171  CRKRFEKERLTVRTDAQGEVIESLLPMVDNFERAKQYIKPETDKEKKVDASYQGIYKQLV  230

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            E + SL V  V TVGK FDP LHEA+ RE+S EF EG+IIQE R+GF L  RLLRP+MVK
Sbjct  231  ETMKSLHVAVVPTVGKSFDPSLHEAVAREESQEFKEGIIIQEIRRGFLLEGRLLRPAMVK  290

Query  317  VSAGPGPAK  291
            VS GPG  K
Sbjct  291  VSTGPGSKK  299



>ref|XP_006400315.1| hypothetical protein EUTSA_v10014120mg [Eutrema salsugineum]
 gb|ESQ41768.1| hypothetical protein EUTSA_v10014120mg [Eutrema salsugineum]
Length=252

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            + +  L SY++AL  N+E KIAE+EA LKSIEDEK  LE K+  LT E+S E+DR++RIS
Sbjct  104  VTIALLNSYKEALAENNEEKIAEIEASLKSIEDEKFQLEEKVASLTNEMSVERDRLIRIS  163

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTERERL+  +NAQG+VVE LL VLDNF+RAK+QIKVE+EGEEK+ NSYQSI
Sbjct  164  ADFDNFRKRTERERLNLVSNAQGQVVENLLAVLDNFERAKSQIKVETEGEEKVTNSYQSI  223

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLL  432
             KQFVEILGSLGV  VETVG+ FDP++
Sbjct  224  YKQFVEILGSLGVVTVETVGRQFDPMV  250



>gb|KEH23550.1| co-chaperone GrpE family protein [Medicago truncatula]
Length=290

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 151/221 (68%), Gaps = 11/221 (5%)
 Frame = -2

Query  1097  HHHSSGPAIRLPVSRSSGKFSLFASDGDVAETAQTepqeqdqvqdsevednqdVAPGSDD  918
             H  SS P +R        K   FA DGD       +  E   +  ++   + + + G D+
Sbjct  47    HRFSSIPTLRF------AKLVPFAFDGDTEAPQVQDSPEVQVLDSTDGAADVEESTGDDE  100

Query  917   ISNeadtttseetaSIVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllll  738
             +S+  +   S      +++ L+SY++AL  ND  K+AELE+ LKSI+DE V LE K+  L
Sbjct  101   VSDAGEIPASP-----LIVLLQSYKEALANNDSVKVAELESSLKSIDDEIVGLEGKIASL  155

Query  737   teelsneKDRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKV  558
             +EELS EKDR LRI ADFDN+RKRT+R+RLS  TNAQGEVVE LLPVLDNF+RAK QIKV
Sbjct  156   SEELSIEKDRKLRIGADFDNYRKRTDRDRLSLVTNAQGEVVESLLPVLDNFERAKAQIKV  215

Query  557   ESEGEEKINNSYQSISKQFVEILGSLGVTPVETVGKPFDPL  435
             E+EGEEKINNSYQSI KQF+EIL SLGV PV+TVG PFDP+
Sbjct  216   ETEGEEKINNSYQSIYKQFIEILNSLGVEPVDTVGNPFDPM  256



>gb|AFK33471.1| unknown [Lotus japonicus]
Length=313

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 143/193 (74%), Gaps = 0/193 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +M+ +++Y+DA+ + DE  ++++E  L  + +EK  L ++L  L+    + K++ LR+ A
Sbjct  100  LMVLIEAYKDAILSGDEVTVSQIEERLHLVANEKNKLAQELSTLSANQVSSKEKYLRLQA  159

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKR ++E+L+   +AQ E +EKLL ++DNF+RAK QIK  +E E+KI+ SYQ I 
Sbjct  160  DFDNFRKRYDKEKLNIQADAQKEFIEKLLLMVDNFERAKQQIKAHTEKEKKIDVSYQGIY  219

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            +QFVE+L S  V+ V TVGKPF+PLLHEAI RE+S EF EG+II+E R+GF L +++LRP
Sbjct  220  RQFVEVLRSHQVSVVATVGKPFNPLLHEAIAREESAEFKEGIIIKERRRGFLLKDQVLRP  279

Query  329  SMVKVSAGPGPAK  291
            + VKVS+GPG  K
Sbjct  280  AQVKVSSGPGNKK  292



>ref|XP_010431202.1| PREDICTED: grpE protein homolog, mitochondrial-like [Camelina 
sativa]
Length=268

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = -2

Query  872  IVMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRIS  693
            ++   L SY++AL  N++ KIAE+EA LKSIED K  LE K+  L+ +LS E+DR++RIS
Sbjct  25   VITALLSSYKEALADNNDGKIAEIEASLKSIEDAKFLLEDKVASLSNDLSVERDRLIRIS  84

Query  692  ADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSI  513
            ADFDNFRKRTERE L+  +NAQGEVVE LL VLDNF+RAK+QIKVE+EGEE++ NSYQSI
Sbjct  85   ADFDNFRKRTEREWLNLVSNAQGEVVENLLAVLDNFERAKSQIKVETEGEERVTNSYQSI  144

Query  512  SKQFVEILGSLGVTPVETVGKPFDPLLHEA  423
             KQFVEILGSLGV  VETVGK FDP+  EA
Sbjct  145  YKQFVEILGSLGVIHVETVGKQFDPMEKEA  174



>gb|KHN09159.1| Protein grpE [Glycine soja]
Length=303

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 147/204 (72%), Gaps = 1/204 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +M+ L++Y++A    D++ +A++E  + SI + K  L +KL  L+ + +  K   LR+ A
Sbjct  90   LMILLEAYKEAFFNGDQNTVAQIEEGIYSIANRKNKLIQKLSSLSADKAASKKSYLRLQA  149

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRT++ERL+  ++AQ +V+EKLL ++DNF+R + QIK  +E E+KI  SYQ I 
Sbjct  150  DFDNFRKRTDKERLNIQSDAQQQVIEKLLLMVDNFERTQQQIKAATEKEKKIGVSYQGIY  209

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQFVE+L +  V+ V TVGKPF+PL HEA+ RE+S EF +G+II+E R+GF L +R+LRP
Sbjct  210  KQFVEVLRNHNVSVVATVGKPFNPLQHEAVAREESTEFKKGIIIKESRRGFLLRDRVLRP  269

Query  329  SMVKVSAGPGPAK-PETSDPAEEQ  261
            ++VKVS GPG  K P + D + EQ
Sbjct  270  ALVKVSLGPGNKKSPVSPDKSVEQ  293



>ref|XP_003526604.2| PREDICTED: grpE protein homolog, mitochondrial-like [Glycine 
max]
Length=335

 Score =   183 bits (465),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 147/204 (72%), Gaps = 1/204 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +M+ L++Y++A    D++ +A++E  + SI + K  L +KL  L+ + +  K   LR+ A
Sbjct  122  LMILLEAYKEAFFNGDQNTVAQIEEGIYSIANRKNKLIQKLSSLSADKAASKKSYLRLQA  181

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKRT++ERL+  ++AQ +V+EKLL ++DNF+R + QIK  +E E+KI  SYQ I 
Sbjct  182  DFDNFRKRTDKERLNIQSDAQQQVIEKLLLMVDNFERTQQQIKAATEKEKKIGVSYQGIY  241

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQFVE+L +  V+ V TVGKPF+PL HEA+ RE+S EF +G+II+E R+GF L +R+LRP
Sbjct  242  KQFVEVLRNHNVSVVATVGKPFNPLQHEAVAREESTEFKKGIIIKESRRGFLLRDRVLRP  301

Query  329  SMVKVSAGPGPAK-PETSDPAEEQ  261
            ++VKVS GPG  K P + D + EQ
Sbjct  302  ALVKVSLGPGNKKSPVSPDKSVEQ  325



>ref|XP_004150939.1| PREDICTED: protein GrpE-like [Cucumis sativus]
 gb|KGN62181.1| hypothetical protein Csa_2G315400 [Cucumis sativus]
Length=316

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 141/194 (73%), Gaps = 0/194 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            ++ YR+A    D+  ++E+EA +K I  EK  L RKL+ ++ E+++ K++ +R+ ADFDN
Sbjct  109  IEVYREAFLDGDQKTVSEVEARIKIIGREKDELSRKLMNISTEMTSGKEKYIRLQADFDN  168

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRKR+E+E+ +   NAQ EV+E LLP++D+FD+A+ QI  +++ E+KI+ SYQ I KQFV
Sbjct  169  FRKRSEKEQHTVKNNAQKEVLESLLPMIDHFDKARQQIVPQTDKEKKIDISYQGIYKQFV  228

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            E L S  V+ V TVG+PFDP LHEA+ RE+S E  EG+IIQE R+GF LGERLLRP+ VK
Sbjct  229  ETLRSWRVSAVATVGRPFDPSLHEAVAREESQEIKEGIIIQELRRGFLLGERLLRPARVK  288

Query  317  VSAGPGPAKPETSD  276
            VS GPG     T D
Sbjct  289  VSKGPGRKSSRTVD  302



>ref|XP_002307407.2| hypothetical protein POPTR_0005s16330g [Populus trichocarpa]
 gb|EEE94403.2| hypothetical protein POPTR_0005s16330g [Populus trichocarpa]
Length=239

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 136/189 (72%), Gaps = 0/189 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            LK YR ++   DE  + ++EA +  IE E     +K+   + E+++ K++ +R+ ADFDN
Sbjct  36   LKIYRQSISCGDEKTMLDIEAKIGIIEKENNESVKKVSPPSAEITSGKEKCIRLQADFDN  95

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
             RKRTE+E+L+  ++AQGEV+E LLPV+D+F+RAK Q++ E++ E+KI+  YQ   K F 
Sbjct  96   VRKRTEKEKLNIRSDAQGEVIESLLPVVDSFERAKQQVQPETDKEKKIDTGYQGRYKHFA  155

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            +++ SL V  V TVGKPFDP LHEAI RE+S+E+ EG+IIQEFR+ F LG RL++P+ VK
Sbjct  156  DMMRSLQVAAVPTVGKPFDPSLHEAIAREESLEYKEGIIIQEFRRVFLLGNRLIKPATVK  215

Query  317  VSAGPGPAK  291
            VS+G G  K
Sbjct  216  VSSGLGSKK  224



>ref|XP_004168166.1| PREDICTED: LOW QUALITY PROTEIN: protein GrpE-like [Cucumis sativus]
Length=316

 Score =   181 bits (458),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 140/194 (72%), Gaps = 0/194 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            ++ YR+A    D+  ++E+EA  K I  EK  L RKL+ ++ E+++ K++ +R+ ADFDN
Sbjct  109  IEVYREAFLDGDQKTVSEVEARXKIIGREKDELSRKLMNISTEMTSGKEKYIRLQADFDN  168

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRKR+E+E+ +   NAQ EV+E LLP++D+FD+A+ QI  +++ E+KI+ SYQ I KQFV
Sbjct  169  FRKRSEKEQHTVKNNAQKEVLESLLPMIDHFDKARQQIVPQTDKEKKIDISYQGIYKQFV  228

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            E L S  V+ V TVG+PFDP LHEA+ RE+S E  EG+IIQE R+GF LGERLLRP+ VK
Sbjct  229  ETLRSWRVSAVATVGRPFDPSLHEAVAREESQEIKEGIIIQELRRGFLLGERLLRPARVK  288

Query  317  VSAGPGPAKPETSD  276
            VS GPG     T D
Sbjct  289  VSKGPGRKSSRTVD  302



>ref|XP_010930882.1| PREDICTED: grpE protein homolog, mitochondrial [Elaeis guineensis]
Length=325

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 155/227 (68%), Gaps = 7/227 (3%)
 Frame = -2

Query  863  MALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADF  684
            M +++Y+ A+   DE+ + E+E  L + E+EK +L  K   +T E+++ KDR+LR+ ADF
Sbjct  106  MLIQAYKKAILDGDENSVCEMEVVLCAAENEKNDLSVKFTEITAEIASGKDRLLRLKADF  165

Query  683  DNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQ  504
            +N RK++E+ RL+  ++ Q EVV+ LLP++D+F+ AK +IK E++ E+KI+ SYQ I KQ
Sbjct  166  ENLRKQSEKYRLNFTSDIQEEVVQSLLPMVDSFENAKQKIKPETDKEKKIDTSYQGIYKQ  225

Query  503  FVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSM  324
            FVEI+ SL V+ VETVGKPFDP +HEA+ RE+S +F  G++ QE R+GF LG+RLLRP+ 
Sbjct  226  FVEIMRSLHVSVVETVGKPFDPAIHEAVAREESPQFKAGIVSQEIRRGFFLGDRLLRPAQ  285

Query  323  VKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPEGANETG*ESNS  183
            VKVS G G  K   +D A E    +E  EE     E +  T   SNS
Sbjct  286  VKVSTGSGVVK---ADSATEDS--MEQLEEASEPAEDSTHTS--SNS  325



>ref|XP_008445362.1| PREDICTED: grpE protein homolog, mitochondrial [Cucumis melo]
Length=316

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  848  YRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDNFRK  669
            YR+A    D+  ++E+EA +K I  EK  L RKL  +  E+++ K++ +R+ ADFDNFRK
Sbjct  112  YREAFLDGDQKTVSEVEARIKIIGREKDELSRKLSNILTEMTSGKEKYIRLQADFDNFRK  171

Query  668  RTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFVEIL  489
            R+E+E+ +   NAQ EV+E LLP++D+F++A+ QI  +++ E+KI+ SYQ I KQFVE L
Sbjct  172  RSEKEQHNVKNNAQKEVIESLLPMIDHFEKARQQIVPQTDKEKKIDISYQGIYKQFVETL  231

Query  488  GSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVKVSA  309
             S  V+ V TVG+PFDP LHEA+ RE+S E  EG++IQE R+GF LGERLLRP+ VKVS 
Sbjct  232  RSWRVSAVATVGRPFDPSLHEAVAREESQEIKEGIVIQELRRGFLLGERLLRPARVKVSK  291

Query  308  GPGPAKPETSDPAEE  264
            GPG     T D  ++
Sbjct  292  GPGRKSSRTIDGKQQ  306



>ref|XP_010095505.1| Protein grpE [Morus notabilis]
 gb|EXB60479.1| Protein grpE [Morus notabilis]
Length=328

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 145/183 (79%), Gaps = 0/183 (0%)
 Frame = -2

Query  848  YRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDNFRK  669
            Y++A+   DE  + ++EA +  I +++  L  K+  LTEE+ + K++ +R+ ADFDNFRK
Sbjct  127  YKEAILDGDEQTVFDIEARIDVIGNDQDKLVEKVSTLTEEIKSGKEKYVRLQADFDNFRK  186

Query  668  RTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFVEIL  489
            R+E+ERLS  ++AQGEV+E LLP++DNF+RAK QIK E+E E++I+ SYQ I KQFVEIL
Sbjct  187  RSEKERLSVRSDAQGEVIESLLPMVDNFERAKQQIKPETEKEKQIDASYQGIYKQFVEIL  246

Query  488  GSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVKVSA  309
             SL V  V TVGKPFDP LHEAI RE+S EF+EG+II+EFR+GF LG+RL+RPSMVKVS+
Sbjct  247  RSLRVAVVPTVGKPFDPSLHEAIAREESQEFEEGIIIEEFRRGFILGDRLIRPSMVKVSS  306

Query  308  GPG  300
            GPG
Sbjct  307  GPG  309



>ref|XP_007136196.1| hypothetical protein PHAVU_009G026300g [Phaseolus vulgaris]
 gb|ESW08190.1| hypothetical protein PHAVU_009G026300g [Phaseolus vulgaris]
Length=303

 Score =   177 bits (449),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 145/204 (71%), Gaps = 1/204 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +M+ L++Y++A    DE+ +A +E  + S  + K  L +K+  L+ + +  KDR  R+ A
Sbjct  90   LMVLLEAYKEAFFNGDENVVALIEEKIYSELNRKNKLIQKVSSLSADKATSKDRYFRLQA  149

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKR ++ERLS  ++AQ E++EKLL ++D+F++ K  IK  +E E+KI+ SYQ I 
Sbjct  150  DFDNFRKRFDKERLSIQSDAQQELIEKLLLMVDSFEKTKQHIKAATEKEKKIDVSYQGIY  209

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQFVEIL S  V+ V TVGKPF+PL HEAI RE+S EF +G+II+E R+GF L +R+LRP
Sbjct  210  KQFVEILRSHHVSVVATVGKPFNPLQHEAIAREESTEFKKGIIIKESRRGFLLRDRVLRP  269

Query  329  SMVKVSAGPGPAK-PETSDPAEEQ  261
            ++VKVS GPG  K P + D + EQ
Sbjct  270  ALVKVSLGPGTKKSPLSPDNSMEQ  293



>ref|XP_002893916.1| co-chaperone grpE family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70175.1| co-chaperone grpE family protein [Arabidopsis lyrata subsp. lyrata]
Length=272

 Score =   176 bits (447),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 148/202 (73%), Gaps = 2/202 (1%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            V   ++SY+ AL   DE+ +A++E     IE EK  +++K+L L+ ++++EK+  +R+ A
Sbjct  68   VNTLIRSYKQALFNGDETSVAQIETMFCKIEKEKNKMDQKVLSLSMKIASEKETKIRLQA  127

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDN RK+  ++RLS+ +NA+ ++++ LLP++D+F+RAK Q++V++E E+KI+ SYQ I 
Sbjct  128  DFDNTRKKLGKDRLSTESNAKVQIMKSLLPIIDSFERAKLQVRVDTEKEKKIDTSYQGIY  187

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            +QFVE+L  L ++ + TVGKPFDPLLHEAI RE+S     G+I +E ++GF LG+R+LRP
Sbjct  188  RQFVEVLRHLRLSAIATVGKPFDPLLHEAISREESEVVKAGIITEELKRGFVLGDRVLRP  247

Query  329  SMVKVSAGPGPAKPETSDPAEE  264
            + VKVS   GP K +T  PAEE
Sbjct  248  AKVKVSL--GPVKKKTPSPAEE  267



>ref|XP_008781554.1| PREDICTED: grpE protein homolog, mitochondrial [Phoenix dactylifera]
 ref|XP_008781555.1| PREDICTED: grpE protein homolog, mitochondrial [Phoenix dactylifera]
Length=323

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 152/223 (68%), Gaps = 4/223 (2%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            + M +++Y+ A+   DE  + E+E  L + E+EK +L  K   +  E+++ +DR+LR+ A
Sbjct  102  MKMLIQAYKKAIIDGDEKSVCEMEVALCAAENEKNDLSAKCTEIAAEIASGRDRLLRLKA  161

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRK+ E++ L+  ++ Q EV + LLP++D+F++AK ++K E++ E+KI+ SYQ I 
Sbjct  162  DFDNFRKKFEKDCLNFTSDIQEEVFQSLLPMVDSFEQAKQKMKPETDKEKKIDASYQGIY  221

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQFVEI+ S  V+ VET+GKPFDP +HEA+ RE+S  F  G++ QE R+GF LG+RLLRP
Sbjct  222  KQFVEIMRSFRVSVVETIGKPFDPAIHEAVAREESPLFKAGIVSQEIRRGFFLGDRLLRP  281

Query  329  SMVKVSAGPGPAKP--ETSDPAEEQGGFIETAEEGGSQPEGAN  207
            + VKVS G G AK   +T D  E+     E AE+  S P  +N
Sbjct  282  AQVKVSTGSGVAKTASDTEDSIEQLEEAAEPAED--STPTSSN  322



>gb|KFK22893.1| hypothetical protein AALP_AAs71746U000500 [Arabis alpina]
Length=295

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 144/198 (73%), Gaps = 2/198 (1%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            ++ Y+ AL   DE  I+E+E   + IE EK  +++K+L L+ ++++EK+  +R+ ADFDN
Sbjct  90   IRVYKQALLDGDEITISEIETVFRRIEIEKNKMDQKVLSLSMKIASEKETKIRLQADFDN  149

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
             RK+ +++RLS+ +NA+ ++++ LLP++D+F+RAK Q+K++++ E+KI+ SYQ I +QFV
Sbjct  150  TRKKLDKDRLSTESNAKVQILKSLLPIIDSFERAKQQVKIDTDKEKKIDTSYQGIYRQFV  209

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            E+L  L V  + TVGKPFDPLLHEAI RE+S     G+I +E  +GF LG+R+LRP+ VK
Sbjct  210  EVLRHLRVAAIATVGKPFDPLLHEAISREESEAVKVGIITEELNRGFMLGDRVLRPAKVK  269

Query  317  VSAGPGPAKPETSDPAEE  264
            VS GP   K  T  PAEE
Sbjct  270  VSLGPISKK--TPSPAEE  285



>ref|XP_010544336.1| PREDICTED: LOW QUALITY PROTEIN: grpE protein homolog, mitochondrial 
[Tarenaya hassleriana]
Length=306

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 131/194 (68%), Gaps = 4/194 (2%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteels----neKDRVL  702
            V   ++ Y++AL   DE  I+E+EA    IE       ++       +       K+  +
Sbjct  93   VKTLIRVYQEALSNGDEKVISEIEAVFCEIEKASTGEAQRXESRVLIIHGFLFIMKESYV  152

Query  701  RISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSY  522
            R+ ADF+N RK+ +++RLS+ +NA+GEV+++LLP++D+F+RA+ QIK ESE E+KI+ SY
Sbjct  153  RLQADFENTRKKFDKDRLSTESNAKGEVMKRLLPIVDSFERARQQIKPESEKEKKIDTSY  212

Query  521  QSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGER  342
            Q I +QFVE+L SL V+ + TVGKPFDPLLHEAI RE+S E   G + QE  +GF LG+R
Sbjct  213  QGIYRQFVEVLRSLRVSAIATVGKPFDPLLHEAISREESREIKAGTVTQELSRGFLLGDR  272

Query  341  LLRPSMVKVSAGPG  300
            +LRP+ V VSAG G
Sbjct  273  VLRPAKVIVSAGLG  286



>ref|XP_009413410.1| PREDICTED: grpE protein homolog, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=307

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 133/189 (70%), Gaps = 0/189 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            +++Y+ A+   DE    E E  +   E EK NL  K   +T E+++ K+  LR+ ADF+N
Sbjct  91   IQAYKKAIIDGDEKSAQENETLICITEIEKNNLTAKFAEITAEIASGKESFLRLKADFEN  150

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRK++E++RL+  ++ QG+V+E LLP++D+F+  K +IK E+E E+KI  SYQ I KQFV
Sbjct  151  FRKQSEKDRLNFTSDIQGDVIESLLPMVDSFENTKKEIKPETEKEKKIETSYQGIYKQFV  210

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            E++ SLGV  VET GKPFDP +HEAI RE+S +F  G++ QE R+GF LGERLLR + VK
Sbjct  211  EVMRSLGVALVETEGKPFDPSIHEAIAREESQQFKAGIVSQELRRGFVLGERLLRTATVK  270

Query  317  VSAGPGPAK  291
            VS GPG  K
Sbjct  271  VSTGPGQVK  279



>ref|XP_006383482.1| hypothetical protein POPTR_0005s16330g [Populus trichocarpa]
 gb|ERP61279.1| hypothetical protein POPTR_0005s16330g [Populus trichocarpa]
Length=189

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 110/141 (78%), Gaps = 0/141 (0%)
 Frame = -2

Query  713  DRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKI  534
            ++ +R+ ADFDN RKRTE+E+L+  ++AQGEV+E LLPV+D+F+RAK Q++ E++ E+KI
Sbjct  34   EKCIRLQADFDNVRKRTEKEKLNIRSDAQGEVIESLLPVVDSFERAKQQVQPETDKEKKI  93

Query  533  NNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQ  354
            +  YQ   K F +++ SL V  V TVGKPFDP LHEAI RE+S+E+ EG+IIQEFR+ F 
Sbjct  94   DTGYQGRYKHFADMMRSLQVAAVPTVGKPFDPSLHEAIAREESLEYKEGIIIQEFRRVFL  153

Query  353  LGERLLRPSMVKVSAGPGPAK  291
            LG RL++P+ VKVS+G G  K
Sbjct  154  LGNRLIKPATVKVSSGLGSKK  174



>ref|XP_008794362.1| PREDICTED: uncharacterized protein LOC103710438 isoform X2 [Phoenix 
dactylifera]
Length=234

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            VM++L+SY++AL  ND SK+AE+EAFL+ IE EK  L  K++ LT ELS E+DR+LRI A
Sbjct  63   VMVSLQSYKEALANNDPSKVAEVEAFLQLIEAEKNYLAAKVVTLTGELSKEQDRILRIRA  122

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKR ER+ LS  TN QGEV+E LLPVLD F+ AK +IKV+SEGEEKINNSYQSI 
Sbjct  123  DFDNFRKRMERKNLSLMTNLQGEVIESLLPVLDEFESAKAEIKVDSEGEEKINNSYQSIY  182

Query  509  KQFVEILGSLGVTPVETVGKPFD  441
            K+F+EIL SLGV  VETVG P+D
Sbjct  183  KRFLEILNSLGVEVVETVGNPYD  205



>ref|NP_564475.1| Co-chaperone GrpE family protein [Arabidopsis thaliana]
 ref|NP_849751.1| Co-chaperone GrpE family protein [Arabidopsis thaliana]
 gb|AAG52200.1|AC021199_6 putative heat shock protein; 54606-52893 [Arabidopsis thaliana]
 gb|AAL38838.1| putative heat shock protein [Arabidopsis thaliana]
 gb|AAM51251.1| putative heat shock protein [Arabidopsis thaliana]
 gb|AEE31864.1| Co-chaperone GrpE family protein [Arabidopsis thaliana]
 gb|AEE31865.1| Co-chaperone GrpE family protein [Arabidopsis thaliana]
Length=279

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 145/202 (72%), Gaps = 2/202 (1%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            V   ++SY+ AL   DE+ + E+E     IE EK  +++K+L L+ ++++EK+  +R+ A
Sbjct  75   VKTLIRSYKQALLNGDETSVTEIETMFCKIEKEKNKMDQKVLSLSMKIASEKEMKIRLQA  134

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDN RK+ +++RLS+ +NA+ ++++ LLP++D+F++AK Q++V+++ E+KI+ SYQ I 
Sbjct  135  DFDNTRKKLDKDRLSTESNAKVQILKSLLPIIDSFEKAKLQVRVDTDKEKKIDTSYQGIY  194

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            +QFVE+L  L V+ + TVGKPFDPLLHEAI RE+S     G+I +E  KGF LG+R+LRP
Sbjct  195  RQFVEVLRYLRVSVIATVGKPFDPLLHEAISREESEAVKAGIITEELNKGFVLGDRVLRP  254

Query  329  SMVKVSAGPGPAKPETSDPAEE  264
            + VKVS GP   K  T   AEE
Sbjct  255  AKVKVSLGPVNKK--TPSAAEE  274



>gb|AAM65596.1| putative heat shock protein [Arabidopsis thaliana]
Length=279

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 145/202 (72%), Gaps = 2/202 (1%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            V   ++SY+ AL   DE+ + E+E     IE EK  +++K+L L+ ++++EK+  +R+ A
Sbjct  75   VKTLIRSYKQALLNGDETSVTEIETMFCKIEKEKNKMDQKVLSLSMKIASEKEMKIRLQA  134

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDN RK+ +++RLS+ +NA+ ++++ LLP++D+F++AK Q++V+++ E+KI+ SYQ I 
Sbjct  135  DFDNTRKKLDKDRLSTESNAKVQILKSLLPIIDSFEKAKLQVRVDTDKEKKIDTSYQGIY  194

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            +QFVE+L  L V+ + TVGKPFDPLLHEAI RE+S     G+I +E  KGF LG+R+LRP
Sbjct  195  RQFVEVLRYLRVSVIATVGKPFDPLLHEAISREESEAVKAGIITEELNKGFVLGDRVLRP  254

Query  329  SMVKVSAGPGPAKPETSDPAEE  264
            + VKVS GP   K  T   AEE
Sbjct  255  AKVKVSLGPVNKK--TPSAAEE  274



>ref|XP_003601139.1| Protein grpE [Medicago truncatula]
 gb|AES71390.1| co-chaperone GrpE family protein [Medicago truncatula]
 gb|AFK44823.1| unknown [Medicago truncatula]
Length=304

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 137/193 (71%), Gaps = 0/193 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +++ +K+Y+ A   +D      +E  + S  +E+  L +K   L+ +  + K++ LR+ A
Sbjct  91   LLVLIKAYKKAFLNSDRKTALLIEEIIHSKANERNKLIQKASTLSVDKVSCKEQYLRLQA  150

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKR E+ER+S  ++AQ E V+KLL ++D+F+R K QI+ E+E E+KI+ SYQS+ 
Sbjct  151  DFDNFRKRCEKERISIQSDAQQEFVKKLLLMVDSFERVKQQIEAETEKEKKIDASYQSLY  210

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQFVE L S  V+ V TVGKPF+PLLHEA+ RE+S  F EG+II+E R+GF L ++++RP
Sbjct  211  KQFVETLRSHHVSVVATVGKPFNPLLHEAVGREESEVFKEGIIIKESRRGFMLKDKVVRP  270

Query  329  SMVKVSAGPGPAK  291
            ++VKVS GPG  K
Sbjct  271  ALVKVSLGPGNKK  283



>ref|XP_010500077.1| PREDICTED: grpE protein homolog, mitochondrial-like [Camelina 
sativa]
Length=300

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 145/202 (72%), Gaps = 0/202 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            V   ++ Y++AL   DE+ +AE+E     I+ EK  +++K+L L+ ++++EK+  +R++A
Sbjct  94   VKTLIRVYKEALFNGDETSVAEIETMFCKIDKEKNKMDQKVLSLSMKVASEKEMKIRLTA  153

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DF+N RK+ +++RLS+ +NA+ ++++ LLP++D+F++AK Q++V+++ E+KI+ SYQ I 
Sbjct  154  DFENTRKKLDKDRLSTESNAKVQIMKSLLPIIDSFEKAKLQVQVDTDKEKKIDTSYQGIY  213

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            +QFVE+L  L V  + TVGKPFDPLLHEAI RE+S     GVI +E  +GF LG+R+LRP
Sbjct  214  RQFVEVLRHLRVAAIATVGKPFDPLLHEAISREESETVKAGVITEELNRGFLLGDRVLRP  273

Query  329  SMVKVSAGPGPAKPETSDPAEE  264
            + VKVS GP   K   S   EE
Sbjct  274  AKVKVSLGPANNKKTPSAAPEE  295



>ref|XP_010461358.1| PREDICTED: grpE protein homolog, mitochondrial [Camelina sativa]
Length=289

 Score =   169 bits (427),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 142/193 (74%), Gaps = 0/193 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            V   ++ Y++AL   DE+ +AE+E     I+ EK  +++K+L L+ ++++EK+  +R++A
Sbjct  92   VKTLIRVYKEALFNGDETSVAEIETMFCKIDKEKNKMDQKVLSLSMKIASEKEMKIRLTA  151

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DF+N RK+ +++RLS+ +NA+ ++++ LLP++D+F++AK Q++V+++ E+KI+ SYQ I 
Sbjct  152  DFENTRKKLDKDRLSTESNAKVQIMKSLLPIIDSFEKAKLQVQVDTDKEKKIDTSYQGIY  211

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            +QFVE+L  L V  + TVGKPFDPLLHEAI RE+S     GVI +E  +GF LG+R+LRP
Sbjct  212  RQFVEVLRHLRVAAIATVGKPFDPLLHEAISREESETVKAGVITEELNRGFLLGDRVLRP  271

Query  329  SMVKVSAGPGPAK  291
            + VKVS GP   K
Sbjct  272  AKVKVSLGPANKK  284



>emb|CDY52462.1| BnaC08g47050D [Brassica napus]
Length=298

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 141/202 (70%), Gaps = 2/202 (1%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            V   +K+Y+ AL   D+  + E+E F   IE EK   + K+L L+ ++++EKD  +R+ A
Sbjct  94   VKTLIKAYKQALFNGDQLSLTEIEMFFCEIEKEKNRFDHKVLSLSMKVASEKDTKIRLQA  153

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDN RK+ +++RLS+ +NA+  +++ LLP++D+F+ A+ QIK ++E E+KI+ SYQ I 
Sbjct  154  DFDNTRKKLDKDRLSTESNAKVHIMKSLLPLIDSFESARQQIKPDTETEKKIDTSYQGIY  213

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            +QFVE+L  L V  + TVGKPFDPLLHEAI RE+S     G+I +E  +GF LG+R+LRP
Sbjct  214  RQFVEVLRHLRVKAIPTVGKPFDPLLHEAISREESEAVKVGMITEELTRGFLLGDRVLRP  273

Query  329  SMVKVSAGPGPAKPETSDPAEE  264
            + VKVS   GP K +T  PA+E
Sbjct  274  AKVKVSL--GPIKKKTVSPADE  293



>ref|XP_010511131.1| PREDICTED: grpE protein homolog, mitochondrial-like [Camelina 
sativa]
Length=291

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 138/182 (76%), Gaps = 0/182 (0%)
 Frame = -2

Query  848  YRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDNFRK  669
            Y++AL   DE+ ++E+E  L  IE EK  ++ K+L L+ ++++EK+  +R++ADF+N RK
Sbjct  100  YKEALFNGDETSVSEIETMLCKIEKEKNKMDHKVLSLSMKIASEKEMKIRLTADFENTRK  159

Query  668  RTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFVEIL  489
            + +++RLS+ +NA+ ++++ LLP++D+F++AK Q++V+++ E+KI+ SYQ I +QFVE+L
Sbjct  160  KLDKDRLSTESNAKVQIMKSLLPIIDSFEKAKLQVQVDTDKEKKIDTSYQGIYRQFVEVL  219

Query  488  GSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVKVSA  309
              L V  + TVGKPFDPLLHEAI RE+S     GVI +E  +GF LG+R+LRP+ VKVS 
Sbjct  220  RHLRVAAIATVGKPFDPLLHEAISREESETVKAGVITEELNRGFLLGDRVLRPAKVKVSL  279

Query  308  GP  303
            GP
Sbjct  280  GP  281



>ref|XP_009107901.1| PREDICTED: grpE protein homolog, mitochondrial [Brassica rapa]
 emb|CDY47434.1| BnaA08g29730D [Brassica napus]
Length=298

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 141/202 (70%), Gaps = 2/202 (1%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            V   +K+Y+ AL   D+  + E+E F   IE EK   + K+L L+ ++++EKD  +R+ A
Sbjct  94   VKTLIKAYKQALFNGDQLTLTEIELFFCEIEKEKNRFDHKVLSLSMKIASEKDTKIRLQA  153

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDN RK+ +++RLS+ +NA+ +V++ LLP++D+F+ A+ QI+ ++E E+KI+ SYQ I 
Sbjct  154  DFDNTRKKLDKDRLSTESNAKVQVMKSLLPLIDSFESARQQIRPDTETEKKIDTSYQGIY  213

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            +QFVE+L  L V  + TVGKPFDPLLHEAI RE S     G+I +E  +GF LG+R+LRP
Sbjct  214  RQFVEVLRHLRVKAIPTVGKPFDPLLHEAISREKSEAVKVGMITEELTRGFCLGDRVLRP  273

Query  329  SMVKVSAGPGPAKPETSDPAEE  264
            + VKVS   GP K +T  PA+E
Sbjct  274  AKVKVSL--GPIKKKTVSPADE  293



>ref|XP_006305497.1| hypothetical protein CARUB_v10009969mg [Capsella rubella]
 gb|EOA38395.1| hypothetical protein CARUB_v10009969mg [Capsella rubella]
Length=278

 Score =   166 bits (419),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 137/185 (74%), Gaps = 0/185 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            ++ Y++AL   DES + E+E     IE EK  +++K+L L+ ++++EK+  +R++ADF+N
Sbjct  78   IRVYKEALFNGDESSVVEIERMFCRIEKEKNKMDQKVLSLSMKIASEKEMKIRLTADFEN  137

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
             RK+ +++RLS+ +NA+ +++  LLP++D+F++AK Q+ V++E E+KI+ SYQ I +QFV
Sbjct  138  TRKKLDKDRLSTESNAKVQIMRSLLPLIDSFEKAKLQVSVDTEKEKKIDTSYQGIYRQFV  197

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            E+L  L V  + TVGKPFDPLLHEAI RE+S     G+I +E  +GF LG+R+LRP+ VK
Sbjct  198  EVLRHLRVAAIATVGKPFDPLLHEAISREESETVKAGIITEELNRGFLLGDRVLRPAKVK  257

Query  317  VSAGP  303
            VS GP
Sbjct  258  VSLGP  262



>dbj|BAJ95108.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=288

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 131/186 (70%), Gaps = 0/186 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            ++ Y+ A    +E  ++++E  + S+E+E+     +   +T E+++ K++ LR++AD +N
Sbjct  81   IRLYKKAFLDGNEDVVSDIEKAITSMEEERSKAASQFDSITAEITSGKNKFLRLNADLEN  140

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRK+TE++R    +N Q E+V+ LLP++D+F++   ++ +E+E E+KI+ SYQ I KQ V
Sbjct  141  FRKQTEKDRAKFTSNIQVELVQSLLPLVDSFEKTNVEVTLETEKEQKISTSYQGIYKQLV  200

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            E L SLGV  VETVGKPFDP++HEAI RE+S EF  G++  E  +GF L ER+LRP+ VK
Sbjct  201  ETLKSLGVGVVETVGKPFDPVVHEAIAREESTEFKAGIVSHEVHRGFLLRERVLRPAAVK  260

Query  317  VSAGPG  300
            VS GPG
Sbjct  261  VSTGPG  266



>ref|XP_001692412.1| GrpE nucleotide release factor [Chlamydomonas reinhardtii]
 gb|AAK96223.1|AF406935_1 co-chaperone CGE1 precursor isoform a [Chlamydomonas reinhardtii]
 gb|EDP03890.1| GrpE nucleotide release factor [Chlamydomonas reinhardtii]
Length=258

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 129/195 (66%), Gaps = 7/195 (4%)
 Frame = -2

Query  857  LKSYRDALDTNDESK------IAELEAFLKSIEDekvnlerkllllteelsneKDRVLRI  696
            L+  + ALD+    K      +AELEA +  ++        +   L   L++ KD+ LR+
Sbjct  59   LERAKKALDSETLDKDVLTAALAELEAEMGRLQSAANEANDRAKSLEASLASAKDQYLRL  118

Query  695  SADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQS  516
            +ADFDNFR+RT  E  +   + +G+V++++LP++DNF+ A+TQ+K E+E E+KINNSYQ 
Sbjct  119  NADFDNFRRRTREESAALTDSVRGDVIKEMLPIVDNFELARTQVKAETEAEQKINNSYQG  178

Query  515  ISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLL  336
            + KQ V+++ + GV  V T G PFDP +H+AIMRE S    +G ++QEFRKGF +G +L+
Sbjct  179  LYKQMVDLMRTQGVEAVPTTGTPFDPNIHDAIMREPSNSHPDGTVLQEFRKGFAIGGKLI  238

Query  335  RPSMVKVS-AGPGPA  294
            RP+MVKVS    GPA
Sbjct  239  RPAMVKVSYTEDGPA  253



>ref|XP_001692413.1| GrpE nucleotide release factor [Chlamydomonas reinhardtii]
 gb|AAK96224.1|AF406936_1 co-chaperone CGE1 precursor isoform b [Chlamydomonas reinhardtii]
 gb|EDP03891.1| GrpE nucleotide release factor [Chlamydomonas reinhardtii]
Length=260

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 129/195 (66%), Gaps = 7/195 (4%)
 Frame = -2

Query  857  LKSYRDALDTNDESK------IAELEAFLKSIEDekvnlerkllllteelsneKDRVLRI  696
            L+  + ALD+    K      +AELEA +  ++        +   L   L++ KD+ LR+
Sbjct  61   LERAKKALDSETLDKDVLTAALAELEAEMGRLQSAANEANDRAKSLEASLASAKDQYLRL  120

Query  695  SADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQS  516
            +ADFDNFR+RT  E  +   + +G+V++++LP++DNF+ A+TQ+K E+E E+KINNSYQ 
Sbjct  121  NADFDNFRRRTREESAALTDSVRGDVIKEMLPIVDNFELARTQVKAETEAEQKINNSYQG  180

Query  515  ISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLL  336
            + KQ V+++ + GV  V T G PFDP +H+AIMRE S    +G ++QEFRKGF +G +L+
Sbjct  181  LYKQMVDLMRTQGVEAVPTTGTPFDPNIHDAIMREPSNSHPDGTVLQEFRKGFAIGGKLI  240

Query  335  RPSMVKVS-AGPGPA  294
            RP+MVKVS    GPA
Sbjct  241  RPAMVKVSYTEDGPA  255



>ref|XP_006414526.1| hypothetical protein EUTSA_v10025813mg [Eutrema salsugineum]
 gb|ESQ55979.1| hypothetical protein EUTSA_v10025813mg [Eutrema salsugineum]
Length=305

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 141/202 (70%), Gaps = 2/202 (1%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            V   +++Y+ A+   DE+ ++E+E     IE EK   + K+L L+ ++++EK+  +R+ A
Sbjct  101  VKALIRAYKQAISNGDETTVSEIETIFCGIEKEKNRFDNKVLSLSMKIASEKETKIRLQA  160

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDN RK+ +++RLS+ +NA+ +++  LLP++D+F++A+ QIK ++E E+KI+ SYQ I 
Sbjct  161  DFDNTRKKLDKDRLSTESNAKVQIMTSLLPLIDSFEKARQQIKPDTEKEKKIDTSYQGIY  220

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            +QFVE+L  L V  + TVGKPFDPLLHEAI RE+S     G+I +E  +GF LG+R+LRP
Sbjct  221  RQFVEVLRHLRVKAIATVGKPFDPLLHEAISREESEVVKAGIITEELNRGFLLGDRVLRP  280

Query  329  SMVKVSAGPGPAKPETSDPAEE  264
            + VKVS   G  K +T   AEE
Sbjct  281  AKVKVSL--GTIKKKTPSAAEE  300



>ref|XP_002951735.1| hypothetical protein VOLCADRAFT_109146 [Volvox carteri f. nagariensis]
 gb|EFJ47186.1| hypothetical protein VOLCADRAFT_109146 [Volvox carteri f. nagariensis]
Length=262

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 119/174 (68%), Gaps = 1/174 (1%)
 Frame = -2

Query  812  IAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDNFRKRTERERLSSFTN  633
            +AELE  ++ +  E      +   L    ++ KD+ +R++ADF+NFR+RT  E      N
Sbjct  84   LAELELEMERMRAEASATMERASALEASANSAKDQYVRLTADFENFRRRTREENAQLTDN  143

Query  632  AQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFVEILGSLGVTPVETVG  453
             +G+V+++LLP++DNF+ A+TQ+K E+EGE KINNSYQ + KQ V+++ SLGV  V T G
Sbjct  144  VRGDVIKELLPIVDNFELARTQVKAETEGEAKINNSYQGLYKQMVDMMRSLGVEAVPTTG  203

Query  452  KPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVKVS-AGPGPA  294
              FDP +H+AIMRE S    +G ++QEFRKGF +G +LLRP+MVKVS    GPA
Sbjct  204  TAFDPNIHDAIMREPSNSHPDGTVLQEFRKGFSIGGKLLRPAMVKVSYTEEGPA  257



>ref|XP_004515658.1| PREDICTED: protein GrpE-like [Cicer arietinum]
Length=313

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 137/193 (71%), Gaps = 0/193 (0%)
 Frame = -2

Query  869  VMMALKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISA  690
            +++  + Y+ +    +E   +++E  ++S  ++K  L +K+  L+ +  + K++ LR+ A
Sbjct  102  LVVLFEEYKKSFLNGNEKTASQIEERIQSKANKKNKLSQKVSSLSADKVSCKEQYLRLQA  161

Query  689  DFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSIS  510
            DFDNFRKR ++ER+S  ++AQ E ++KLL ++D+F+R K Q +  +E E+KI+ SYQSI 
Sbjct  162  DFDNFRKRCDKERISIQSDAQLEFIKKLLFMVDHFERVKQQSEAATEKEKKIDASYQSIY  221

Query  509  KQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            KQFVE L S  V+ V TVGKPF+PLLHEA+ RE+S  F EG+II+E R+GF L +++LRP
Sbjct  222  KQFVETLRSHHVSVVATVGKPFNPLLHEAVAREESDVFKEGIIIKESRRGFLLRDKVLRP  281

Query  329  SMVKVSAGPGPAK  291
            ++VKVS GPG  K
Sbjct  282  ALVKVSLGPGNKK  294



>ref|XP_006652297.1| PREDICTED: grpE protein homolog, mitochondrial-like [Oryza brachyantha]
Length=279

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 138/200 (69%), Gaps = 4/200 (2%)
 Frame = -2

Query  857  LKSYRDA-LDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFD  681
            ++ Y+ A LD N+E+ +  +E+ + ++E E+ +   +L  +T E+++ KD+ LRI+AD +
Sbjct  72   IRLYKKAFLDGNNEA-LGGIESAIIAMEKERSSSAAQLESITTEITSGKDKFLRINADLE  130

Query  680  NFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQF  501
            NFRK+TE++R    +N Q EVV+ LL + D+F++   +I  E+E E+KI+ SYQ I KQ 
Sbjct  131  NFRKQTEKDRARFTSNIQVEVVQSLLTLADSFEKVNQEITPETEKEQKISTSYQGIYKQL  190

Query  500  VEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMV  321
            VE L SLGV  VETVGKPFDP +HEAI RE+S +F  G++  E R+GF L ERLLRP+ V
Sbjct  191  VETLRSLGVGVVETVGKPFDPSIHEAIAREESHQFKAGIVSHEVRRGFLLRERLLRPATV  250

Query  320  KVSAGPGPAKPETSDPAEEQ  261
            KVS G G    ETS P+ E+
Sbjct  251  KVSTGSG--NQETSSPSSEK  268



>gb|EAY94163.1| hypothetical protein OsI_15938 [Oryza sativa Indica Group]
Length=288

 Score =   160 bits (406),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 136/200 (68%), Gaps = 4/200 (2%)
 Frame = -2

Query  857  LKSYRDA-LDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFD  681
            L+ Y+ A LD NDE+ +  +E+ + +IE E+ N   +   +  E+++ KD+ LRI+AD +
Sbjct  81   LRLYKKAFLDGNDEA-LGGIESAIIAIEKERSNSAAQYESIATEITSGKDKFLRINADLE  139

Query  680  NFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQF  501
            NFRK+TE+ER    +N Q +VV+ LL ++D+F++   +I  E++ E+ I+ SYQ I KQ 
Sbjct  140  NFRKQTEKERARFTSNIQVDVVQSLLTLVDSFEKVNQEITPETDKEQTISTSYQGIYKQL  199

Query  500  VEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMV  321
            VE L SLGV  VETVGKPFDP +HEAI RE+S +F  G++  E ++GF L ERLLRP+ V
Sbjct  200  VETLRSLGVGVVETVGKPFDPSIHEAIAREESHQFKAGIVSHEVKRGFLLRERLLRPATV  259

Query  320  KVSAGPGPAKPETSDPAEEQ  261
            KVS G G    ETS P+ E+
Sbjct  260  KVSTGSGTQ--ETSSPSTEK  277



>ref|NP_001052822.1| Os04g0431100 [Oryza sativa Japonica Group]
 emb|CAE03031.1| OSJNBa0084A10.6 [Oryza sativa Japonica Group]
 dbj|BAF14736.1| Os04g0431100 [Oryza sativa Japonica Group]
 emb|CAH67008.1| OSIGBa0160I14.6 [Oryza sativa Indica Group]
 gb|EAZ30785.1| hypothetical protein OsJ_14850 [Oryza sativa Japonica Group]
 dbj|BAG95319.1| unnamed protein product [Oryza sativa Japonica Group]
Length=290

 Score =   160 bits (406),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 136/200 (68%), Gaps = 4/200 (2%)
 Frame = -2

Query  857  LKSYRDA-LDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFD  681
            L+ Y+ A LD NDE+ +  +E+ + +IE E+ N   +   +  E+++ KD+ LRI+AD +
Sbjct  83   LRLYKKAFLDGNDEA-LGGIESAIIAIEKERSNSAAQYESIATEITSGKDKFLRINADLE  141

Query  680  NFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQF  501
            NFRK+TE+ER    +N Q +VV+ LL ++D+F++   +I  E++ E+ I+ SYQ I KQ 
Sbjct  142  NFRKQTEKERARFTSNIQVDVVQSLLTLVDSFEKVNQEITPETDKEQTISTSYQGIYKQL  201

Query  500  VEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMV  321
            VE L SLGV  VETVGKPFDP +HEAI RE+S +F  G++  E ++GF L ERLLRP+ V
Sbjct  202  VETLRSLGVGVVETVGKPFDPSIHEAIAREESHQFKAGIVSHEVKRGFLLRERLLRPATV  261

Query  320  KVSAGPGPAKPETSDPAEEQ  261
            KVS G G    ETS P+ E+
Sbjct  262  KVSTGSGTQ--ETSSPSTEK  279



>ref|XP_003579761.1| PREDICTED: grpE protein homolog, mitochondrial [Brachypodium 
distachyon]
Length=286

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 131/187 (70%), Gaps = 2/187 (1%)
 Frame = -2

Query  857  LKSYRDA-LDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFD  681
            ++ Y+ A LD ND+  ++++E  +  +E EK     +   +T E+ + K + LR++AD +
Sbjct  79   IRLYKKAFLDGNDDV-VSDIEKAIIGMEQEKSKAASQFESITAEIISGKSKFLRLNADLE  137

Query  680  NFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQF  501
            NFRK+TE++R    +N Q E+V+ LLP++D+F++A  ++ +E++ E+KI+ SYQ I KQ 
Sbjct  138  NFRKQTEKDRAKFTSNIQVELVQSLLPLVDSFEKANLELTLETDKEQKISTSYQGIYKQL  197

Query  500  VEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMV  321
            VE L  LGV  VETVGKPFDPL+HEAI RE+SV+F  G++  E  +GF L ER+LRP+ V
Sbjct  198  VETLKGLGVGVVETVGKPFDPLVHEAIAREESVQFKAGIVSHEVHRGFLLRERVLRPATV  257

Query  320  KVSAGPG  300
            KVS GPG
Sbjct  258  KVSTGPG  264



>ref|XP_001419369.1| chloroplast GrpE-like protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97662.1| chloroplast GrpE-like protein [Ostreococcus lucimarinus CCE9901]
Length=274

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = -2

Query  713  DRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKI  534
            D+ LR++ADFDNFRKRT +E+ +  ++A+G+ V+ LLPVLDNFD A+  IK  +EGEEKI
Sbjct  138  DQYLRLNADFDNFRKRTLKEKENLASSAKGDFVKALLPVLDNFDLAEKNIKGSTEGEEKI  197

Query  533  NNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQ  354
               YQ++ KQ +EIL S G+  V  VG+PFDP  HEAIMRE++ E DE  II+EFRKG++
Sbjct  198  LTGYQNMHKQLMEILSSQGLQVVAGVGEPFDPNDHEAIMREENDEMDEDTIIEEFRKGYK  257

Query  353  LGERLLRPSMVKVSAGP  303
            +G  L+R SMVKVS  P
Sbjct  258  IGSSLIRASMVKVSTKP  274



>ref|WP_023171568.1| co-chaperone GrpE [Gloeobacter kilaueensis]
 ref|YP_008710263.1| GrpE protein [Gloeobacter kilaueensis JS1]
 gb|AGY56556.1| GrpE protein [Gloeobacter kilaueensis JS1]
Length=199

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 108/141 (77%), Gaps = 4/141 (3%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERER--LSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEK  537
            + LR+ ADFDNFRKRT+RE+  L +F +A+  +++++LPVLDNFDRA+T ++ E+E EEK
Sbjct  61   KYLRLLADFDNFRKRTQREKDELGAFVSAR--LLQEILPVLDNFDRARTHVQPENEREEK  118

Query  536  INNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGF  357
            ++NSYQ + +QF+ IL   GV  +E VG+PF+P LHEAI+RE+S E  +  ++ E +KG+
Sbjct  119  LHNSYQQVYRQFLAILEKQGVQLLEVVGQPFNPALHEAILREESSEVSQETVVAELQKGY  178

Query  356  QLGERLLRPSMVKVSAGPGPA  294
             LGER+LRP+MVKV+    PA
Sbjct  179  SLGERVLRPAMVKVAVPAHPA  199



>ref|WP_017298327.1| co-chaperone GrpE [Nodosilinea nodulosa]
Length=233

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = -2

Query  704  LRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNS  525
            +RI+ADF+N+RKRT +E+    T  +G+ + +LLPV+DNF+RA++QIK ++E E  I+ S
Sbjct  83   MRIAADFENYRKRTSKEKDDLATQIKGDTIIELLPVVDNFERARSQIKPQTEAEMTIHKS  142

Query  524  YQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGE  345
            YQS+ KQ VE L  LGV+ +   G+ FDPLLHEA+MRE + ++ EGV+I+EF +G+QLG+
Sbjct  143  YQSVYKQLVETLKRLGVSAMRAEGQEFDPLLHEAVMREPTADYPEGVVIEEFVRGYQLGD  202

Query  344  RLLRPSMVKVSAGPGPAKPET  282
            R+LR +MVKV+A P  A  E 
Sbjct  203  RVLRHAMVKVAAPPEDASHEA  223



>ref|XP_004975635.1| PREDICTED: grpE protein homolog, mitochondrial-like [Setaria 
italica]
Length=283

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 129/187 (69%), Gaps = 2/187 (1%)
 Frame = -2

Query  857  LKSYRDA-LDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFD  681
            ++ Y+ A LD NDE  + E+E  + S+E EK  +  +   +T E+++ K++ +R++AD +
Sbjct  83   IQLYKTAFLDGNDEV-LGEVEKAITSVEKEKSRVASQFESVTAEITSGKEKFIRLNADLE  141

Query  680  NFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQF  501
            NFRK+TE+ER    +N Q EVV+ LLP++D+F++   +   E+E E+KI+ SYQ I KQ 
Sbjct  142  NFRKQTEKERAKFTSNIQVEVVQSLLPLVDSFEKTNLENTPETEKEQKISTSYQGIYKQL  201

Query  500  VEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMV  321
            VE L  LGV  VETVGKPFDP +HEAI RE+S +F  G++  E R+GF L ERLLRP+ V
Sbjct  202  VETLRYLGVGVVETVGKPFDPSVHEAIAREESSQFKAGIVSHEIRRGFLLKERLLRPATV  261

Query  320  KVSAGPG  300
            KVS G G
Sbjct  262  KVSTGSG  268



>ref|WP_035990298.1| co-chaperone GrpE [Leptolyngbya sp. KIOST-1]
Length=236

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 110/150 (73%), Gaps = 4/150 (3%)
 Frame = -2

Query  704  LRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNS  525
            +RI+ADF+N+RKRT +E+    +  +G+ + +LLPV+DNF+RA++QIK ++E E  I+ S
Sbjct  87   MRIAADFENYRKRTSKEKDDLASQIKGDTIIELLPVVDNFERARSQIKPQTEAEMTIHKS  146

Query  524  YQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGE  345
            YQS+ KQ VE L  LGV+ +   G+ FDPLLHEA+MRE + +  EGV+I+EF +G+QLG+
Sbjct  147  YQSVYKQLVETLKRLGVSAMRAEGQEFDPLLHEAVMREPTADHPEGVVIEEFVRGYQLGD  206

Query  344  RLLRPSMVKVSA----GPGPAKPETSDPAE  267
            R+LR +MVKV+A     PG A P  +D AE
Sbjct  207  RVLRHAMVKVAAPPEDAPGEAVPGDTDLAE  236



>ref|XP_002447849.1| hypothetical protein SORBIDRAFT_06g016920 [Sorghum bicolor]
 gb|EES12177.1| hypothetical protein SORBIDRAFT_06g016920 [Sorghum bicolor]
Length=275

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 127/186 (68%), Gaps = 0/186 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            ++ YR A    ++  + E+E  + ++E EK  +  +   +T E+++ K++ +R++AD +N
Sbjct  84   IQLYRTAFQQGNDEVLGEVEKAITAVEKEKSRVASQFESITTEITSGKEKFIRLNADLEN  143

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRK+TE++R    +N + +VV+ LLP++D+F++   +   E+E E+KI+ SYQ I KQ V
Sbjct  144  FRKQTEKDRAKFTSNMRVQVVQSLLPLVDSFEKTNLENTPETEKEQKISTSYQGIYKQLV  203

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            E L  LGV  VETVGKPFDP +HEAI RE S++F  G+++ E R+GF L ERLLRP+ VK
Sbjct  204  ETLRYLGVGVVETVGKPFDPSVHEAISREASMQFKAGIVMHEVRRGFHLKERLLRPATVK  263

Query  317  VSAGPG  300
            VS G G
Sbjct  264  VSTGSG  269



>ref|XP_008671294.1| PREDICTED: grpE protein homolog, mitochondrial [Zea mays]
Length=196

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 126/186 (68%), Gaps = 0/186 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            ++ YR A    +E  +  +E  + ++E EK  +  +   +T E+++ K++ +R++AD +N
Sbjct  5    IQLYRTAFLEGNEEVLGVVEKAITAVEKEKSTIASQFESITTEITSGKEKFIRLNADLEN  64

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRK+TE++R    +N + EVV+ LLP++D+F++   +   E+E E+KI+ SYQ I KQ V
Sbjct  65   FRKQTEKDRAKLTSNIRVEVVQSLLPLVDSFEKTNLENTPETEKEQKISASYQGIYKQLV  124

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            E L  LGV  VETVGKPFDP +HEAI RE S++F  G+++ E R+GF L ERLLRP+ VK
Sbjct  125  ETLRYLGVGVVETVGKPFDPSVHEAISREASMQFKAGIVMHEVRRGFHLKERLLRPATVK  184

Query  317  VSAGPG  300
            VS G G
Sbjct  185  VSTGSG  190



>ref|XP_005846367.1| hypothetical protein CHLNCDRAFT_36141 [Chlorella variabilis]
 gb|EFN54265.1| hypothetical protein CHLNCDRAFT_36141 [Chlorella variabilis]
Length=176

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = -2

Query  713  DRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKI  534
            D+ LR+ ADFDNFRKRT  E+ +   + +G+ V +LLP++DNF+ AK Q+K+E+EGE+++
Sbjct  14   DKFLRLQADFDNFRKRTAGEKDALRVSVRGDTVAELLPLVDNFELAKAQLKLETEGEKRV  73

Query  533  NNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQ  354
            + +YQ + KQ VE+   LG+  V  VG PFDP LH+AIMRE S +  +G +++EFRKGF 
Sbjct  74   DAAYQGLYKQMVELFRGLGLEAVPGVGSPFDPNLHDAIMREASEDVPDGTVLEEFRKGFV  133

Query  353  LGERLLRPSMVKVS  312
            +G++LLRP+MVKVS
Sbjct  134  IGDKLLRPAMVKVS  147



>ref|XP_008338873.1| PREDICTED: grpE protein homolog, mitochondrial-like [Malus domestica]
Length=139

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = -2

Query  623  EVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFVEILGSLGVTPVETVGKPF  444
            EV+E LLP++DNF+RAK  +K E+E EEKI+ SYQ I KQFVEI+  L V  V TVGKPF
Sbjct  15   EVIESLLPMVDNFERAKQYLKPETEREEKIDASYQGIYKQFVEIMRGLSVAVVPTVGKPF  74

Query  443  DPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVKVSAGPGPAK  291
            DP LHEAI RE+S EF EG+IIQE R+GF LG RLLRP+MVKVS+GPG  K
Sbjct  75   DPSLHEAIAREESQEFTEGIIIQEIRRGFLLGGRLLRPAMVKVSSGPGSKK  125



>ref|WP_017661959.1| co-chaperone GrpE [Geitlerinema sp. PCC 7105]
Length=252

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 103/138 (75%), Gaps = 0/138 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +R+ ADFDNFRKRTE+ER +    A+ EV+++LLPV+DNF+RA+TQIK +++GE  I+
Sbjct  101  QYVRLQADFDNFRKRTEKEREALEERAKCEVLQELLPVVDNFERARTQIKPQTDGETNIH  160

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQS+ K  V+ L  LGV P+   G+ FDP LHEA+MRE + E+ EG ++ E  +G+ L
Sbjct  161  KSYQSVYKLMVDCLKRLGVAPMRPEGEEFDPNLHEAVMREATDEYPEGTVMGELMRGYTL  220

Query  350  GERLLRPSMVKVSAGPGP  297
            G+R+LR +MVKV+A P P
Sbjct  221  GDRVLRHAMVKVAAPPEP  238



>tpg|DAA37763.1| TPA: hypothetical protein ZEAMMB73_896904 [Zea mays]
Length=275

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 126/186 (68%), Gaps = 0/186 (0%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            ++ YR A    +E  +  +E  + ++E EK  +  +   +T E+++ K++ +R++AD +N
Sbjct  84   IQLYRTAFLEGNEEVLGVVEKAITAVEKEKSTIASQFESITTEITSGKEKFIRLNADLEN  143

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRK+TE++R    +N + EVV+ LLP++D+F++   +   E+E E+KI+ SYQ I KQ V
Sbjct  144  FRKQTEKDRAKLTSNIRVEVVQSLLPLVDSFEKTNLENTPETEKEQKISASYQGIYKQLV  203

Query  497  EILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVK  318
            E L  LGV  VETVGKPFDP +HEAI RE S++F  G+++ E R+GF L ERLLRP+ VK
Sbjct  204  ETLRYLGVGVVETVGKPFDPSVHEAISREASMQFKAGIVMHEVRRGFHLKERLLRPATVK  263

Query  317  VSAGPG  300
            VS G G
Sbjct  264  VSTGSG  269



>ref|XP_003058911.1| mitochondrial protein translocase family [Micromonas pusilla 
CCMP1545]
 gb|EEH57366.1| mitochondrial protein translocase family [Micromonas pusilla 
CCMP1545]
Length=303

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 124/184 (67%), Gaps = 2/184 (1%)
 Frame = -2

Query  833  DTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDNFRKRTERE  654
            ++ D  ++AEL A +K+IE    +L+   + L ++    KD+ LR++ADFDNF+KRT +E
Sbjct  121  ESMDAPELAELAAEVKAIETAFKDLQAANVGLEDQTGALKDQYLRLNADFDNFKKRTIKE  180

Query  653  RLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFVEILGSLGV  474
            +    TNA+  V E +LP LDNFD AK  +K E+EGEEKI  SY+ +    + IL + G+
Sbjct  181  KEQLATNAKSRVFEAMLPALDNFDLAKANLKTENEGEEKIAKSYEGLVDGLMTILSAQGL  240

Query  473  TPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGE-RLLRPSMVKVSAGPGP  297
            + V  VG PFDP  HEAIMRE+S E  E  I +EFRKG+++GE +L+R +MVKVS+GP P
Sbjct  241  STVAGVGSPFDPNFHEAIMREESEEHPEDTISEEFRKGYKMGEDQLVRAAMVKVSSGP-P  299

Query  296  AKPE  285
            A  E
Sbjct  300  ASEE  303



>ref|WP_009556482.1| co-chaperone GrpE [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ69572.1| molecular chaperone GrpE (heat shock protein) [Oscillatoriales 
cyanobacterium JSC-12]
Length=253

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 104/139 (75%), Gaps = 0/139 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADFDN+RKRT+RE+       +   + +LLPV+DNF+RA++Q+K ++E E  I+
Sbjct  102  QYMRIAADFDNYRKRTQREKEEFEQQIKCSTINELLPVVDNFERARSQLKPQTEQETAIH  161

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQS+ KQ V+ L  +GV+P+ + GK FDP LHEA+MR+ + E+ EG +I+E ++G+ L
Sbjct  162  KSYQSVYKQLVDCLKRIGVSPMRSEGKEFDPTLHEAVMRQPTDEYPEGTVIEELQRGYML  221

Query  350  GERLLRPSMVKVSAGPGPA  294
            GER+LR ++VKV+A P PA
Sbjct  222  GERVLRHALVKVAAPPEPA  240



>ref|WP_024124393.1| co-chaperone GrpE [Thermosynechococcus sp. NK55a]
 ref|YP_008899495.1| heat shock protein GrpE [Thermosynechococcus sp. NK55a]
 gb|AHB87982.1| heat shock protein GrpE [Thermosynechococcus sp. NK55a]
Length=231

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 104/146 (71%), Gaps = 0/146 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +R++ADF+NFRKRT+RE+       +  V+  LLPV+D+F+ A+T I+ E+E EEKI+
Sbjct  79   QYMRLAADFENFRKRTQREKEELELQIKCSVIADLLPVVDSFELARTHIQTETEAEEKIH  138

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ VE L  +GV+ ++  GKPFDP LHEA++RE + E  EG +I+E ++G+ L
Sbjct  139  RSYQGVYKQLVECLKRIGVSAMQAKGKPFDPNLHEAVLREATNEHPEGTVIEELKRGYML  198

Query  350  GERLLRPSMVKVSAGPGPAKPETSDP  273
            G+R+LR +MVKV+A P     + ++P
Sbjct  199  GDRVLRHAMVKVAAPPEEGSADNTNP  224



>gb|EMS49120.1| Protein grpE [Triticum urartu]
Length=298

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 131/208 (63%), Gaps = 22/208 (11%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            ++ Y+ A    +E  ++++E  + S+E+E+     +   +T E+++ K++ LR++AD +N
Sbjct  69   IRLYKKAFLDGNEDVVSDIEKAITSMEEERSKAASQFESITAEIASGKNKFLRLNADLEN  128

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRK+TE++R    +N Q E+V+ LLP++D+F++   +I +E+E E+KI+ SYQ I KQ V
Sbjct  129  FRKQTEKDRAKFTSNIQVELVQSLLPLVDSFEKTNVEITLETEKEQKISASYQGIYKQLV  188

Query  497  EILGSLGVTPVETVGKPFDPLL----------------------HEAIMREDSVEFDEGV  384
            E L +LGV  VETVGKPFDP+L                      HEAI RE+S EF  G+
Sbjct  189  ETLKNLGVGVVETVGKPFDPVLDCSHSAGQTILSYLQPGSYSVVHEAIAREESTEFKAGI  248

Query  383  IIQEFRKGFQLGERLLRPSMVKVSAGPG  300
            +  E  +GF L ER+LRP+ VKVS GPG
Sbjct  249  VSHEVHRGFLLRERVLRPAAVKVSNGPG  276



>ref|WP_036009021.1| co-chaperone GrpE [Leptolyngbya sp. JSC-1]
Length=247

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 104/139 (75%), Gaps = 0/139 (0%)
 Frame = -2

Query  713  DRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKI  534
            ++ +RI+ADF+NFRKRT++E+       +   +++LLPV+DNF+RA++QIK +++ E  I
Sbjct  99   NQYMRIAADFENFRKRTQKEKEEQEQQIKCTTLKELLPVVDNFERARSQIKPQTDAEMNI  158

Query  533  NNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQ  354
            + SYQS+ KQ VE L  +GV+P+ + GKPFDP LHEA+MRE + E  EG +++E  +G+ 
Sbjct  159  HKSYQSVYKQLVESLKRIGVSPMRSEGKPFDPNLHEAVMRESTTEHPEGTVLEELVRGYL  218

Query  353  LGERLLRPSMVKVSAGPGP  297
            LGER+LR +MVKV+A P P
Sbjct  219  LGERVLRHAMVKVAAAPEP  237



>ref|WP_022608172.1| co-chaperone GrpE [Rubidibacter lacunae]
 gb|ERN40731.1| molecular chaperone GrpE (heat shock protein) [Rubidibacter lacunae 
KORDI 51-2]
Length=271

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 107/149 (72%), Gaps = 0/149 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + LRI+ADF+NFRKRT++ER       +  ++ +LLPV+DNF+RA+ QIK +++GE  I+
Sbjct  115  QALRIAADFENFRKRTQKEREELDRQVKINIINELLPVIDNFERARAQIKPQTDGEMSIH  174

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQS+ KQ V+ L  +GV+P+ + G+ FDP  HEA+MRE + E+ EGV+I++  +G+ L
Sbjct  175  KSYQSVYKQLVDGLKRMGVSPMRSEGQEFDPTYHEAVMREPTDEYAEGVVIEQLVRGYLL  234

Query  350  GERLLRPSMVKVSAGPGPAKPETSDPAEE  264
            GER+LR ++VKV+  P P     ++P +E
Sbjct  235  GERVLRHALVKVAVAPEPVIGSETEPVDE  263



>ref|WP_011057154.1| co-chaperone GrpE [Thermosynechococcus elongatus]
 ref|NP_682104.1| heat shock protein [Thermosynechococcus elongatus BP-1]
 sp|Q8DJB3.1|GRPE_THEEB RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor [Thermosynechococcus 
elongatus BP-1]
 dbj|BAC08866.1| heat shock protein [Thermosynechococcus elongatus BP-1]
Length=252

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 103/146 (71%), Gaps = 0/146 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +R++ADF+NFRKRT+RE+       +  V+  LLPV+D+F+ A+T I+ E+E EEKI+
Sbjct  100  QYIRLAADFENFRKRTQREKEELELQIKCSVIADLLPVVDSFELARTHIQTETEAEEKIH  159

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ VE L  +GV+ ++  GKPFDP LHEA++RE + E  EG +I+E ++G+ L
Sbjct  160  RSYQGVYKQLVECLKRIGVSAMQAKGKPFDPNLHEAVLREATNEHPEGTVIEELKRGYML  219

Query  350  GERLLRPSMVKVSAGPGPAKPETSDP  273
            G+R+LR +MVKV+A P       ++P
Sbjct  220  GDRVLRHAMVKVAAPPEEGSASNTNP  245



>gb|AGT16068.1| hypothetical protein SHCRBa_185_O22_R_90 [Saccharum hybrid cultivar 
R570]
Length=275

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 127/185 (69%), Gaps = 2/185 (1%)
 Frame = -2

Query  857  LKSYRDA-LDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFD  681
            ++ YR A L+ NDE  + E+E  + ++E EK  +  +   +T E+++ K++ +R++AD +
Sbjct  84   IQLYRTAFLEGNDEV-LGEIEKAITAVEKEKSRVASQFESITTEITSGKEKFIRLNADLE  142

Query  680  NFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQF  501
            NF+K+TE+ER    +N + EVV+ LLP++D+F++   +   E+E E+KI+ SYQ I KQ 
Sbjct  143  NFQKQTEKERAKFTSNIRVEVVQSLLPLVDSFEKTNLENTPETEKEQKISTSYQGIYKQL  202

Query  500  VEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMV  321
            VE L  LGV  VETVGKPFDP +HEAI RE S++F  G++  E  +GF L ERLLRP+ V
Sbjct  203  VETLRYLGVGVVETVGKPFDPSVHEAISREASMQFKAGIVTHEVCRGFHLKERLLRPATV  262

Query  320  KVSAG  306
            +VS G
Sbjct  263  RVSTG  267



>gb|EMT30761.1| Protein grpE [Aegilops tauschii]
Length=310

 Score =   150 bits (380),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 131/208 (63%), Gaps = 22/208 (11%)
 Frame = -2

Query  857  LKSYRDALDTNDESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDN  678
            ++ Y+ A    +E  ++++E  + S+E+E+     +   +T E+++ K++ LR++AD +N
Sbjct  81   IRLYKKAFLDGNEDVVSDIEKAITSMEEERSKAASQFESITAEIASGKNKFLRLNADLEN  140

Query  677  FRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFV  498
            FRK+TE++R    +N Q E+V+ LLP++D+F++   ++ +E+E E+KI+ SYQ I KQ V
Sbjct  141  FRKQTEKDRAKFTSNIQVELVQSLLPLVDSFEKTNVEVTLETEKEQKISASYQGIYKQLV  200

Query  497  EILGSLGVTPVETVGKPFDP----------------------LLHEAIMREDSVEFDEGV  384
            E L +LGV  VETVGKPFDP                      ++HEAI RE+S EF  G+
Sbjct  201  ETLKNLGVGVVETVGKPFDPVVDCWQSAGQTILSYLQPGSYSVVHEAIAREESTEFKAGI  260

Query  383  IIQEFRKGFQLGERLLRPSMVKVSAGPG  300
            +  E  +GF L ER+LRP+ VKVS GPG
Sbjct  261  VSHEVHRGFLLRERVLRPAAVKVSNGPG  288



>ref|WP_019487096.1| co-chaperone GrpE [Kamptonema formosum]
Length=257

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 102/140 (73%), Gaps = 0/140 (0%)
 Frame = -2

Query  704  LRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNS  525
            LR++ADF+NFR+RT +E+       +   + +LLPV+DNF+RA++ IK +++GE  I+ S
Sbjct  114  LRLAADFENFRRRTAKEKEELDLQVKCATIMELLPVIDNFERARSHIKPQTDGEMGIHKS  173

Query  524  YQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGE  345
            YQS+ KQ V+ L  +GV+P+   G+PFDP LHEA+MRE + +++EG + +E  +G+ LGE
Sbjct  174  YQSVYKQMVDCLKRVGVSPMRPEGQPFDPNLHEAVMREPTDQYEEGTVAEELVRGYMLGE  233

Query  344  RLLRPSMVKVSAGPGPAKPE  285
            R+LR +MVKV+A P PA  E
Sbjct  234  RVLRHAMVKVAAAPEPASEE  253



>ref|WP_012161085.1| co-chaperone GrpE [Acaryochloris marina]
 ref|YP_001514792.1| co-chaperone GrpE [Acaryochloris marina MBIC11017]
 gb|ABW25478.1| co-chaperone GrpE [Acaryochloris marina MBIC11017]
Length=262

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 101/134 (75%), Gaps = 0/134 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADF+NFR+RT RE+       + E + +LLPV+D+FDRA++ IK +++ EE I+
Sbjct  104  QYVRIAADFENFRRRTAREKTDLEQRVKRETLSELLPVIDSFDRARSHIKPQTDQEENIH  163

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
            NSYQ + KQ V+ L  +GV P+ + G+PFDP LHEA+MRE + EF+EG++++E   G+ L
Sbjct  164  NSYQGVYKQLVDCLKRIGVAPMRSKGQPFDPNLHEAVMREPTNEFEEGMVVEELVSGYLL  223

Query  350  GERLLRPSMVKVSA  309
            GE++LR +MVKV+A
Sbjct  224  GEQVLRHAMVKVAA  237



>ref|WP_010473392.1| co-chaperone GrpE [Acaryochloris sp. CCMEE 5410]
Length=262

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 101/134 (75%), Gaps = 0/134 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADF+NFR+RT RE+       + E + +LLPV+D+FDRA++ IK +++ EE I+
Sbjct  104  QYVRIAADFENFRRRTAREKTDLEQRVKRETLSELLPVIDSFDRARSHIKPQTDQEENIH  163

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
            NSYQ + KQ V+ L  +GV P+ + G+PFDP LHEA+MRE + EF+EG++++E   G+ L
Sbjct  164  NSYQGVYKQLVDCLKRIGVAPMRSKGQPFDPNLHEAVMREPTNEFEEGMVVEELVSGYLL  223

Query  350  GERLLRPSMVKVSA  309
            GE++LR +MVKV+A
Sbjct  224  GEQVLRHAMVKVAA  237



>ref|WP_014274815.1| co-chaperone GrpE [Arthrospira platensis]
 ref|YP_005067887.1| heat shock protein GrpE [Arthrospira platensis NIES-39]
 dbj|BAI89349.1| heat shock protein GrpE [Arthrospira platensis NIES-39]
Length=245

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 103/146 (71%), Gaps = 5/146 (3%)
 Frame = -2

Query  701  RISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSY  522
            R++ADF+NFRKRT++E+     N +   + +LLPV+DNF+RA+  IK +++GE  I+ SY
Sbjct  97   RLAADFENFRKRTQKEKEDLELNIKCSTIGQLLPVIDNFERARAHIKPQNDGEMNIHKSY  156

Query  521  QSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGER  342
            Q + KQ VE L  +GV+P+   G+PFDP LHEA+MRE + E+ EG +I+E  +G+ LG+R
Sbjct  157  QGVYKQMVECLKQIGVSPMRPEGEPFDPNLHEAVMREPTSEYPEGTVIEELMRGYILGDR  216

Query  341  LLRPSMVKVSAGPGPAKPETSDPAEE  264
            +LR +MVKV+      +PE SD  EE
Sbjct  217  VLRHAMVKVA-----TEPELSDTTEE  237



>ref|WP_008049500.1| co-chaperone GrpE [Arthrospira sp. PCC 8005]
 emb|CCE15571.1| Protein grpE (HSP-70 cofactor) [Arthrospira sp. PCC 8005]
 emb|CDM94141.1| Protein grpE (HSP-70 cofactor) [Arthrospira sp. PCC 8005]
Length=253

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 103/146 (71%), Gaps = 5/146 (3%)
 Frame = -2

Query  701  RISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSY  522
            R++ADF+NFRKRT++E+     N +   + +LLPV+DNF+RA+  IK +++GE  I+ SY
Sbjct  105  RLAADFENFRKRTQKEKEDLELNIKCSTIGQLLPVIDNFERARAHIKPQNDGEMNIHKSY  164

Query  521  QSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGER  342
            Q + KQ VE L  +GV+P+   G+PFDP LHEA+MRE + E+ EG +I+E  +G+ LG+R
Sbjct  165  QGVYKQMVECLKQIGVSPMRPEGEPFDPNLHEAVMREPTSEYPEGTVIEELMRGYILGDR  224

Query  341  LLRPSMVKVSAGPGPAKPETSDPAEE  264
            +LR +MVKV+      +PE SD  EE
Sbjct  225  VLRHAMVKVA-----TEPELSDTTEE  245



>ref|WP_006620080.1| co-chaperone GrpE [Arthrospira platensis]
 gb|KDR58319.1| protein GrpE [Arthrospira platensis str. Paraca]
Length=253

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 103/146 (71%), Gaps = 5/146 (3%)
 Frame = -2

Query  701  RISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSY  522
            R++ADF+NFRKRT++E+     N +   + +LLPV+DNF+RA+  IK +++GE  I+ SY
Sbjct  105  RLAADFENFRKRTQKEKEDLELNIKCSTIGQLLPVIDNFERARAHIKPQNDGEMNIHKSY  164

Query  521  QSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGER  342
            Q + KQ VE L  +GV+P+   G+PFDP LHEA+MRE + E+ EG +I+E  +G+ LG+R
Sbjct  165  QGVYKQMVECLKQIGVSPMRPEGEPFDPNLHEAVMREPTSEYPEGTVIEELMRGYILGDR  224

Query  341  LLRPSMVKVSAGPGPAKPETSDPAEE  264
            +LR +MVKV+      +PE SD  EE
Sbjct  225  VLRHAMVKVA-----TEPELSDTTEE  245



>ref|WP_015170455.1| co-chaperone GrpE [Geitlerinema sp. PCC 7407]
 ref|YP_007107939.1| GrpE protein HSP-70 cofactor [Geitlerinema sp. PCC 7407]
 gb|AFY64887.1| GrpE protein [Geitlerinema sp. PCC 7407]
Length=234

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 99/138 (72%), Gaps = 0/138 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADFDN+RKRT +E+      A+   + +LLPV+D+F+RA++QIK ++EGE  I+
Sbjct  83   QCVRIAADFDNYRKRTAKEKEDLDQQARSRAITELLPVVDSFERARSQIKPQNEGEMGIH  142

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ VE L  LGV P+ + G  FDP LHEA+MRE + E  EG +++E  +G+ +
Sbjct  143  KSYQGVYKQLVESLKRLGVAPMRSEGTEFDPNLHEAVMRETTDEHPEGTVLEELVRGYMI  202

Query  350  GERLLRPSMVKVSAGPGP  297
            G+R+LR +MVKV+A P P
Sbjct  203  GDRVLRHAMVKVAAAPEP  220



>ref|WP_012630041.1| co-chaperone GrpE [Cyanothece sp. PCC 7425]
 ref|YP_002485360.1| heat shock protein GrpE [Cyanothece sp. PCC 7425]
 gb|ACL46999.1| GrpE protein [Cyanothece sp. PCC 7425]
Length=246

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 100/145 (69%), Gaps = 0/145 (0%)
 Frame = -2

Query  701  RISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSY  522
            R+ ADFDNFRKRTE+E+       + + + +LLPV+D+FD A+TQIK ++E E  I+ SY
Sbjct  102  RLVADFDNFRKRTEKEKEDLDNQVKRKTLSELLPVVDSFDLARTQIKPQTEAETSIHKSY  161

Query  521  QSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGER  342
            Q + KQ V+ L  +GV P+   GKPFDP +HEA++RE + E+ EG +++E ++G+ LG+R
Sbjct  162  QGVYKQLVDCLKRIGVAPMRPEGKPFDPTMHEAVLREPTDEYPEGTVLEELKRGYLLGDR  221

Query  341  LLRPSMVKVSAGPGPAKPETSDPAE  267
            +LR +MVKV+A P     E    AE
Sbjct  222  VLRYAMVKVAAAPEGTDKENESQAE  246



>gb|EPS60511.1| hypothetical protein M569_14294 [Genlisea aurea]
Length=297

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 128/189 (68%), Gaps = 2/189 (1%)
 Frame = -2

Query  863  MALKSYRDALDTN-DESKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISAD  687
            + L +YR+A+    DES I  L+  + +IE ++ +L  KL  L+ ++S+E+   +R+ AD
Sbjct  90   IKLSAYRNAISAGADESTIIHLQHQISTIETDRTSLALKLSSLSSQISDERRSRIRLQAD  149

Query  686  FDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISK  507
            FD +RK +E+E     ++A+ EV+ ++L + D+F+RA+ + K E+E E++I  SY+ I K
Sbjct  150  FDEYRKISEKEASKLRSDARREVIRRMLSIADSFERARGETKAETEAEKRIEGSYRGIYK  209

Query  506  QFVEILGSLGVTPVET-VGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRP  330
            QFVE++ S  V  V    GK FDP +HEA+ RE+S E  EG IIQE R+GF LGERLLRP
Sbjct  210  QFVEVMRSFDVAAVPAGAGKRFDPSVHEAVAREESTELKEGAIIQELRRGFFLGERLLRP  269

Query  329  SMVKVSAGP  303
            + VKVS+GP
Sbjct  270  AKVKVSSGP  278



>ref|WP_007101115.1| co-chaperone GrpE [Synechococcus sp. RS9917]
 gb|EAQ70304.1| Heat shock protein GrpE [Synechococcus sp. RS9917]
Length=244

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 106/165 (64%), Gaps = 2/165 (1%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADFDNFRKR  R++           + ++LPV+DNF+RA+ Q+  ESE  + ++
Sbjct  78   QYMRIAADFDNFRKRQSRDQDDLKLQITCSTLSEILPVVDNFERARQQLNPESEEAQSLH  137

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ V++L  LGV P+  VG+ FDP LHEA++RE S E  E V+I+E ++G+ L
Sbjct  138  RSYQGLYKQLVDVLKQLGVAPMRVVGQEFDPTLHEAVLREPSDEHGEDVVIEELQRGYHL  197

Query  350  GERLLRPSMVKVSAGPGPAKPETSDPAEEQGGFIETAEEGGSQPE  216
              R+LR +MVKVS GPGP     +  A E     E+AE  G QP+
Sbjct  198  QGRVLRHAMVKVSMGPGPQVQAGATSATE--ASAESAEPEGGQPD  240



>ref|WP_015227089.1| co-chaperone GrpE [Halothece sp. PCC 7418]
 ref|YP_007169431.1| GrpE protein HSP-70 cofactor [Halothece sp. PCC 7418]
 gb|AFZ45217.1| GrpE protein [Halothece sp. PCC 7418]
Length=239

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = -2

Query  701  RISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSY  522
            R++ADF+NFR+R+E ++     N + E + K+L ++DNF+RA++QIK  +EGE+ I+ SY
Sbjct  88   RLAADFENFRRRSETQKEEIKQNEKRETLSKILEIVDNFERARSQIKPTTEGEKNIHKSY  147

Query  521  QSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGER  342
            Q + KQ VE L SLGV+ +   G+PFDP  HEA++RE S E+ EG +I++ R G+ LG+ 
Sbjct  148  QGVYKQLVEALKSLGVSKMRPEGEPFDPYYHEAMLREPSSEYAEGTVIEQLRSGYMLGDG  207

Query  341  LLRPSMVKVSAGPGPA  294
            +LR +MVKV+A P P+
Sbjct  208  VLRHAMVKVAAAPEPS  223



>ref|WP_037223932.1| heat shock protein GrpE [Richelia intracellularis]
 emb|CDN16315.1| Heat shock protein GrpE [Richelia intracellularis]
Length=226

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 107/153 (70%), Gaps = 2/153 (1%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADF+N+RKRT++E+       +   + +LL V+DNF+RA++QIK +++GE  I+
Sbjct  74   QYMRIAADFENYRKRTQKEKEELDVQVKRNTITELLSVVDNFERARSQIKPQNDGEMNIH  133

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + K  V+ L  LGV+P+   G+PFDP LHEA+MRE + E  EG +++E  +G+ L
Sbjct  134  KSYQGVYKLLVDSLKRLGVSPMRPEGEPFDPNLHEAVMREPTDEHPEGTVLEELVRGYYL  193

Query  350  GERLLRPSMVKVSAGPGPAKP--ETSDPAEEQG  258
            G+R+LR +MVKV+A P  A P  E S P+E+ G
Sbjct  194  GDRVLRHAMVKVAAPPEDAPPVQEESQPSEDNG  226



>ref|WP_017288853.1| co-chaperone GrpE [Leptolyngbya boryana]
Length=227

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 105/152 (69%), Gaps = 5/152 (3%)
 Frame = -2

Query  713  DRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKI  534
            ++ +RI+ADF+NFR+RT+RE+    T  +   V++LLPV+DNF+RA++QIK +++GE  I
Sbjct  81   NQYMRIAADFENFRRRTQREKEELETQIKCSTVKELLPVVDNFERARSQIKPQTDGEANI  140

Query  533  NNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQ  354
            + SYQ + K  V+ L  +GV P+   GK FDP LHEA+MRE + E  EG +I+E  +G+ 
Sbjct  141  HKSYQGVYKDMVDRLKKVGVAPMRAEGKEFDPNLHEAVMREPTSEHPEGTVIEELMRGYM  200

Query  353  LGERLLRPSMVKVSAGPGPAKPETSDPAEEQG  258
            L +++LR +MVKV+     A PE  D AE +G
Sbjct  201  LEDKVLRHAMVKVA-----APPEDGDSAETEG  227



>ref|WP_015146536.1| co-chaperone GrpE [Oscillatoria acuminata]
 ref|YP_007083806.1| molecular chaperone GrpE [Oscillatoria acuminata PCC 6304]
 gb|AFY79886.1| molecular chaperone GrpE (heat shock protein) [Oscillatoria acuminata 
PCC 6304]
Length=262

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 98/136 (72%), Gaps = 0/136 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            +  R++ADFDNFRKRT++E+L     A+   + +LL V+DNF+RAK QIK +++GE  ++
Sbjct  109  QYARLAADFDNFRKRTQKEKLELEAQAKCATIRELLTVVDNFERAKEQIKPQNDGEMNLH  168

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SY S+ KQ VE L  +GV+ +   G+ FDP  HEA+MRE + E+ EG++  EFR+G+ L
Sbjct  169  KSYLSVYKQMVESLKRIGVSAMYPKGEEFDPNFHEAVMREPTREYAEGIVTDEFRRGYML  228

Query  350  GERLLRPSMVKVSAGP  303
            G+R+LR +MVKV+A P
Sbjct  229  GDRVLRHAMVKVAAAP  244



>ref|XP_005644635.1| GrpE nucleotide exchange factor, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20091.1| GrpE nucleotide exchange factor, partial [Coccomyxa subellipsoidea 
C-169]
Length=181

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -2

Query  713  DRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKI  534
            +R LR++ADFDNFRKRT  E+       + E V+ LL V+D+F+ AK  +K ESEGE+KI
Sbjct  32   ERYLRLNADFDNFRKRTAAEKDQVKDRTKAETVKALLAVVDSFEMAKGSLKPESEGEKKI  91

Query  533  NNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQ  354
            + +YQ + KQ VE   SLGV  V  VG PFDP  HEAIMRE+  +  +G +++EFR+GF+
Sbjct  92   DGAYQGVYKQMVEAFRSLGVETVAGVGTPFDPEFHEAIMREERDDVPDGTVLKEFRRGFR  151

Query  353  LGERLLRPSMVKV  315
            LG +LLR +MV+V
Sbjct  152  LGSQLLRAAMVQV  164



>ref|WP_009783906.1| co-chaperone GrpE [Lyngbya sp. PCC 8106]
 gb|EAW37448.1| GrpE protein [Lyngbya sp. PCC 8106]
Length=255

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -2

Query  701  RISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSY  522
            R++ADF+NFRKRT++E+       +   ++KLLPV+DNF+RA++ IK ++E E  I+ SY
Sbjct  106  RLAADFENFRKRTQKEKEDLEVQIKCNTIKKLLPVIDNFERARSHIKPQTESEMNIHKSY  165

Query  521  QSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGER  342
            QS+ KQ VE L  LGV+ +   G+PFDP LHEA+MRE S    EG +I+E  +G+ +GER
Sbjct  166  QSVYKQMVESLKQLGVSAMRPDGEPFDPNLHEAVMREASETHPEGTVIEEMMRGYMIGER  225

Query  341  LLRPSMVKVSAGP  303
            +LR +MVKV+  P
Sbjct  226  VLRHAMVKVATAP  238



>ref|WP_015109887.1| co-chaperone GrpE [Cyanobium gracile]
 ref|YP_007046788.1| molecular chaperone GrpE [Cyanobium gracile PCC 6307]
 gb|AFY29447.1| molecular chaperone GrpE (heat shock protein) [Cyanobium gracile 
PCC 6307]
Length=244

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 98/139 (71%), Gaps = 0/139 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADFDNFRKR  R++     +     + ++LPV+DNFDRA+ Q+  +SE  + ++
Sbjct  89   QYMRIAADFDNFRKRQSRDKEDQRLHITCTTLTEILPVVDNFDRARQQLNPQSEEAQSLH  148

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ++ KQ V++   LGV+P+   G+PFDP LHEA++RE S E  E V+I+E ++G+ L
Sbjct  149  RSYQNLYKQLVDVFKQLGVSPMRVEGEPFDPSLHEAVLREPSEEHPEDVVIEELQRGYHL  208

Query  350  GERLLRPSMVKVSAGPGPA  294
              R+LR ++VKVS GPGPA
Sbjct  209  DGRVLRHALVKVSMGPGPA  227



>ref|WP_012194572.1| co-chaperone GrpE [Prochlorococcus marinus]
 ref|YP_001549901.1| heat shock protein GrpE [Prochlorococcus marinus str. MIT 9211]
 sp|A9B9L4.1|GRPE_PROM4 RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor [Prochlorococcus 
marinus str. MIT 9211]
 gb|ABX07947.1| Heat shock protein GrpE [Prochlorococcus marinus str. MIT 9211]
Length=247

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 94/138 (68%), Gaps = 0/138 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADFDNFRKR  R++       Q   +  +LPV+DNFDRA+ Q+  E E  + ++
Sbjct  82   QYMRIAADFDNFRKRQSRDQDDLRLQLQCNTLSSILPVVDNFDRARQQLNPEGEEAQALH  141

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ V++L  LGV P+  VG+ FDP LHEA++RE S E  E +I++E ++G+ L
Sbjct  142  KSYQGLYKQLVDVLKQLGVAPMRVVGQTFDPSLHEAVLREPSDELAEDIIVEELQRGYHL  201

Query  350  GERLLRPSMVKVSAGPGP  297
              R+LR ++VKVS GPGP
Sbjct  202  NGRVLRHALVKVSMGPGP  219



>ref|WP_023068665.1| co-chaperone GrpE [Lyngbya aestuarii]
 gb|ERT05057.1| grpE family protein [Lyngbya aestuarii BL J]
Length=255

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -2

Query  701  RISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSY  522
            R++ADF+NFRKRT++E+       +   ++KLLPV+DNF+RA++ IK ++E E  I+ SY
Sbjct  106  RLAADFENFRKRTQKEKEDLEVQIKCNTIKKLLPVIDNFERARSHIKPQTESEMNIHKSY  165

Query  521  QSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGER  342
            QS+ KQ VE L  LGV+ +   G+PFDP LHEA+MRE S    EG +I+E  +G+ +GER
Sbjct  166  QSVYKQMVESLKQLGVSAMRPDGEPFDPNLHEAVMREASETHPEGTVIEEMMRGYMIGER  225

Query  341  LLRPSMVKVSAGP  303
            +LR +MVKV+  P
Sbjct  226  VLRHAMVKVATAP  238



>ref|WP_006620592.1| MULTISPECIES: co-chaperone GrpE [Arthrospira]
 gb|EDZ94358.1| GrpE protein [Arthrospira maxima CS-328]
 gb|EKD11207.1| GrpE protein [Arthrospira platensis C1]
Length=253

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 102/146 (70%), Gaps = 5/146 (3%)
 Frame = -2

Query  701  RISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSY  522
            R++ADF+NFRKRT++E+     N +   + +LLPV+DNF+RA+  IK +++GE  I+ SY
Sbjct  105  RLAADFENFRKRTQKEKEDLELNIKCSTIAQLLPVIDNFERARAHIKPQNDGEMNIHKSY  164

Query  521  QSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGER  342
            Q + KQ VE L  +GV+P+   G+ FDP LHEA+MR+ + E+ EG +I+E  +G+ LG+R
Sbjct  165  QGVYKQMVECLKQIGVSPMRPEGEQFDPNLHEAVMRQPTSEYPEGTVIEELMRGYILGDR  224

Query  341  LLRPSMVKVSAGPGPAKPETSDPAEE  264
            +LR +MVKV+      +PE SD  EE
Sbjct  225  VLRHAMVKVA-----TEPELSDTTEE  245



>ref|WP_035139980.1| co-chaperone GrpE [Fischerella sp. PCC 9605]
Length=249

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 98/134 (73%), Gaps = 0/134 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADF+N+RKRT +E+       +   + +LLPV+DNF+RA+ QIK +++GE  I+
Sbjct  98   QYMRIAADFENYRKRTIKEKEDLEVQMKRNAITELLPVVDNFERARAQIKPQNDGEMAIH  157

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ V+ L  LGV+P+   G+PFDP LHEA+MRE + E+ EG +++E  +G+ L
Sbjct  158  KSYQGVYKQLVDCLKRLGVSPMRPEGQPFDPNLHEAVMREHTDEYPEGTVLEELVRGYYL  217

Query  350  GERLLRPSMVKVSA  309
            G+R+LR +MVKV+A
Sbjct  218  GDRVLRHAMVKVAA  231



>gb|AIE73784.1| Heat shock protein GrpE [Synechocystis sp. PCC 6714]
Length=245

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 95/136 (70%), Gaps = 0/136 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            R + ++A+FDNFRKRT+RE+       +G  + +LLPV+DNF+RA+TQIK  SEGE +I+
Sbjct  95   RYVALAAEFDNFRKRTQREKEEQAKVIKGRTITELLPVVDNFERARTQIKPNSEGENQIH  154

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + K  V+ L SLGV P+   GKPFDP  HEA++RE + E+ E  +I+E  +G+ L
Sbjct  155  KSYQGVYKNLVDSLKSLGVAPMRPEGKPFDPKYHEAMLREPTAEYPEDTVIEELVRGYLL  214

Query  350  GERLLRPSMVKVSAGP  303
             + +LR SMVKV+  P
Sbjct  215  DDMVLRHSMVKVAVAP  230



>ref|WP_038024536.1| co-chaperone GrpE [Synechococcus sp. RS9916]
Length=245

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 94/138 (68%), Gaps = 0/138 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADFDNFRKR  R++           + ++LPV+DNF+RA+ Q+  E E  + ++
Sbjct  76   QYMRIAADFDNFRKRQSRDQDDLKLQLTCNTLSEILPVVDNFERARQQLNPEGEEAQALH  135

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ VE+L  LGV P+  VG+ FDP LHEA++RE S E  E V+I+E ++G+ L
Sbjct  136  RSYQGLYKQLVEVLKQLGVAPMRVVGQEFDPTLHEAVLREPSEEHHEDVVIEELQRGYHL  195

Query  350  GERLLRPSMVKVSAGPGP  297
              R+LR +MVKVS GPGP
Sbjct  196  NGRVLRHAMVKVSMGPGP  213



>ref|WP_006457178.1| co-chaperone GrpE [Synechococcus sp. PCC 7335]
 gb|EDX87370.1| co-chaperone GrpE, putative [Synechococcus sp. PCC 7335]
Length=239

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = -2

Query  701  RISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSY  522
            R++ADFDNFRKRT +ER +     +   +  LL V+DNF+RA++QIK + EGE  I+ SY
Sbjct  100  RLTADFDNFRKRTVKERETLEEQVKCNTISGLLEVVDNFERARSQIKPQGEGELSIHKSY  159

Query  521  QSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGER  342
            Q + KQ VE L  LGV+P+   GK FDP LHEA+MRE + ++ EG +I+EF +G+ LGER
Sbjct  160  QGVYKQLVEALKKLGVSPMRCEGKEFDPNLHEAVMREPTNDYPEGTVIEEFVRGYVLGER  219

Query  341  LLRPSMVKVS  312
            +LR +MVKV+
Sbjct  220  VLRHAMVKVA  229



>gb|EAU75353.1| molecular chaperone GrpE, heat shock protein [Synechococcus sp. 
RS9916]
Length=252

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 94/138 (68%), Gaps = 0/138 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADFDNFRKR  R++           + ++LPV+DNF+RA+ Q+  E E  + ++
Sbjct  83   QYMRIAADFDNFRKRQSRDQDDLKLQLTCNTLSEILPVVDNFERARQQLNPEGEEAQALH  142

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ VE+L  LGV P+  VG+ FDP LHEA++RE S E  E V+I+E ++G+ L
Sbjct  143  RSYQGLYKQLVEVLKQLGVAPMRVVGQEFDPTLHEAVLREPSEEHHEDVVIEELQRGYHL  202

Query  350  GERLLRPSMVKVSAGPGP  297
              R+LR +MVKVS GPGP
Sbjct  203  NGRVLRHAMVKVSMGPGP  220



>ref|WP_026722301.1| co-chaperone GrpE [Fischerella sp. PCC 9431]
Length=247

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 99/134 (74%), Gaps = 0/134 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADF+N+RKRT +E+      A+   + +LLPV+DNF+RA++QIK +++GE  I+
Sbjct  97   QYMRIAADFENYRKRTNKEKEDLEAQAKRNAINELLPVVDNFERARSQIKPQNDGEMGIH  156

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + K  V+ L  LGV+P+   G+PFDP LHEA+MRE + E+ EG +++E  +G+ L
Sbjct  157  KSYQGVYKLLVDSLKRLGVSPMRPEGQPFDPNLHEAVMREPTDEYPEGTVLEELVRGYYL  216

Query  350  GERLLRPSMVKVSA  309
            G+R+LR +MVKV+A
Sbjct  217  GDRVLRHAMVKVAA  230



>ref|WP_010313990.1| co-chaperone GrpE [Synechococcus sp. CB0205]
Length=224

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 97/139 (70%), Gaps = 0/139 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADFDNFRKR  R++    T      + ++LPV+DNF+RA+ Q+  ++E  + I+
Sbjct  68   QYMRIAADFDNFRKRQSRDQEDQRTLIACSTLSEILPVVDNFERARQQLDPQAEEAQAIH  127

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ V++   LGV+P+   G+PFDP LHEA++RE S E  E ++I E ++G+ L
Sbjct  128  RSYQGLYKQLVDVFKQLGVSPMRVEGEPFDPTLHEAVLREPSDEHAEDLVIAELQRGYHL  187

Query  350  GERLLRPSMVKVSAGPGPA  294
             +R+LR ++VKVS GPGP+
Sbjct  188  NDRVLRHALVKVSMGPGPS  206



>ref|WP_016865116.1| co-chaperone GrpE [Fischerella muscicola]
Length=246

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 99/134 (74%), Gaps = 0/134 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADF+N+RKRT +E+      A+   + +LLPV+DNF+RA++QIK +++GE  I+
Sbjct  95   QYMRIAADFENYRKRTIKEKEDLEAQAKRNAITELLPVVDNFERARSQIKPQNDGEMAIH  154

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + K  V+ L  LGV+P+   G+PFDP LHEA+MRE + E+ EG +++E  +G+ L
Sbjct  155  KSYQGVYKLLVDSLKRLGVSPMRPEGQPFDPNLHEAVMREPTDEYPEGTVLEELVRGYYL  214

Query  350  GERLLRPSMVKVSA  309
            G+R+LR +MVKV+A
Sbjct  215  GDRVLRHAMVKVAA  228



>ref|XP_003080808.1| co-chaperone CGE1 precursor isoform b (ISS) [Ostreococcus tauri]
 emb|CAL54976.1| GrpE nucleotide exchange factor, coiled-coil [Ostreococcus tauri]
Length=272

 Score =   141 bits (356),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 100/137 (73%), Gaps = 0/137 (0%)
 Frame = -2

Query  713  DRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKI  534
            D+ LR++ADFDNFRKRT +E+  +   A+G  V+ +LPVLDNFD A+  IK  +EGEEKI
Sbjct  136  DQYLRLNADFDNFRKRTAKEKADAANTAKGAFVKAMLPVLDNFDLAEKNIKGNNEGEEKI  195

Query  533  NNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQ  354
               YQ+I KQ  EI  S G+  V  VG+ FDP+ HEAIMRE++ E +E  II+EFRKG++
Sbjct  196  LTGYQNIVKQMYEIFESQGLVTVPGVGEKFDPMDHEAIMREETDEVEEETIIEEFRKGYK  255

Query  353  LGERLLRPSMVKVSAGP  303
            +G+ L+RPSMVKVS  P
Sbjct  256  IGDSLIRPSMVKVSTKP  272



>ref|WP_009456789.1| co-chaperone GrpE [Fischerella sp. JSC-11]
 gb|EHC13940.1| Protein grpE [Fischerella sp. JSC-11]
Length=247

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 99/134 (74%), Gaps = 0/134 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADF+N+RKRT +E+      A+   + +LLPV+DNF+RA++QIK +++GE  I+
Sbjct  96   QYMRIAADFENYRKRTIKEKEDLEAQAKRNAITELLPVVDNFERARSQIKPQNDGEMGIH  155

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + K  V+ L  LGV+P+   G+PFDP LHEA+MRE + E+ EG +++E  +G+ L
Sbjct  156  KSYQGVYKLLVDSLKRLGVSPMRPEGQPFDPNLHEAVMREPTDEYPEGTVLEELVRGYYL  215

Query  350  GERLLRPSMVKVSA  309
            G+R+LR +MVKV+A
Sbjct  216  GDRVLRHAMVKVAA  229



>ref|WP_016872218.1| co-chaperone GrpE [Fischerella thermalis]
Length=246

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 99/134 (74%), Gaps = 0/134 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADF+N+RKRT +E+      A+   + +LLPV+DNF+RA++QIK +++GE  I+
Sbjct  95   QYMRIAADFENYRKRTIKEKEDLEAQAKRNAITELLPVVDNFERARSQIKPQNDGEMGIH  154

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + K  V+ L  LGV+P+   G+PFDP LHEA+MRE + E+ EG +++E  +G+ L
Sbjct  155  KSYQGVYKLLVDSLKRLGVSPMRPEGQPFDPNLHEAVMREPTDEYPEGTVLEELVRGYYL  214

Query  350  GERLLRPSMVKVSA  309
            G+R+LR +MVKV+A
Sbjct  215  GDRVLRHAMVKVAA  228



>ref|WP_016859578.1| co-chaperone GrpE [Fischerella muscicola]
Length=247

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 99/134 (74%), Gaps = 0/134 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADF+N+RKRT +E+      A+   + +LLPV+DNF+RA++QIK +++GE  I+
Sbjct  97   QYMRIAADFENYRKRTIKEKEDLEAQAKRNAINELLPVVDNFERARSQIKPQNDGEMGIH  156

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + K  V+ L  LGV+P+   G+PFDP LHEA+MRE + E+ EG +++E  +G+ L
Sbjct  157  KSYQGVYKLLVDSLKRLGVSPMRPEGQPFDPNLHEAVMREPTDEYPEGTVLEELVRGYYL  216

Query  350  GERLLRPSMVKVSA  309
            G+R+LR +MVKV+A
Sbjct  217  GDRVLRHAMVKVAA  230



>ref|WP_039727327.1| hypothetical protein [Lyngbya confervoides]
 gb|KIF15306.1| hypothetical protein QP59_33220 [Aphanocapsa montana BDHKU210001]
 gb|KIF41887.1| hypothetical protein QQ91_26110 [Lyngbya confervoides BDU141951]
Length=244

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 100/147 (68%), Gaps = 0/147 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADF+N+R+R  +ER       +   + +LLPV+DNF+RA+ QIK ++E E  I+
Sbjct  95   QYMRIAADFENYRRRNSKERDEQEVQIKRNTITELLPVIDNFERARAQIKPQTEAEMTIH  154

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQS+ KQ V+ L  LGV+ +   G+ FDP LHEA+MRE + +  EG +++E  +G+ +
Sbjct  155  KSYQSVYKQLVDCLKRLGVSAMRAEGQEFDPNLHEAVMREPTADHPEGTVMEELVRGYMI  214

Query  350  GERLLRPSMVKVSAGPGPAKPETSDPA  270
            G+R+LR +MVKV+A P P+    +D A
Sbjct  215  GDRVLRHAMVKVAAEPEPSSGAANDEA  241



>ref|WP_006102976.1| co-chaperone GrpE [Coleofasciculus chthonoplastes]
 gb|EDX73731.1| co-chaperone GrpE, putative [Coleofasciculus chthonoplastes PCC 
7420]
Length=249

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 97/136 (71%), Gaps = 0/136 (0%)
 Frame = -2

Query  704  LRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNS  525
            +R++ADFDNFRKRT +E+       +   + +LL V+DNF+RA++QIK +++GE  ++ S
Sbjct  100  MRMAADFDNFRKRTAKEKEDLDHQVKRNTLGELLSVVDNFERARSQIKPQNDGEMAVHKS  159

Query  524  YQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGE  345
            YQ I KQ VE    LGV+P+   G  FDP  HEA+MR+ S E+DEG++I++  +G+ LG+
Sbjct  160  YQGIYKQLVESFKRLGVSPMRPEGTEFDPNFHEAVMRQPSEEYDEGIVIEQLMRGYFLGD  219

Query  344  RLLRPSMVKVSAGPGP  297
            R+LR +MVKV+A P P
Sbjct  220  RVLRHAMVKVAAAPEP  235



>ref|WP_038551933.1| co-chaperone GrpE [Synechococcus sp. KORDI-52]
 gb|AII48004.1| molecular chaperone GrpE [Synechococcus sp. KORDI-52]
Length=221

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADFDNFRKR  R++           + ++LPV+DNF+RA+ Q+  E E  + ++
Sbjct  67   QYVRIAADFDNFRKRQSRDQDDMRQQLVCSTLTEILPVVDNFERARQQLNPEGEEAQALH  126

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ V++L   GV  +E VG+ FDP LHEA++RE+SVEF E V+ +E ++G+  
Sbjct  127  RSYQGLYKQLVDVLKQQGVARMEVVGQDFDPNLHEAVLREESVEFAEDVVCEELQRGYHR  186

Query  350  GERLLRPSMVKVSAGPGPAKPETS  279
              R+LR +MVKVS GPGP+ P ++
Sbjct  187  DGRVLRHAMVKVSMGPGPSDPTSA  210



>ref|WP_036901875.1| co-chaperone GrpE [Prochlorococcus sp. MIT 0601]
 gb|KGG13376.1| Heat shock protein GrpE [Prochlorococcus sp. MIT 0601]
Length=247

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 95/140 (68%), Gaps = 0/140 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADFDNFRKR  R++       +   +  +LPV+DNF+RA+ Q+  E E  + ++
Sbjct  82   QYVRIAADFDNFRKRQSRDQDDLRLQLKCNTLSDILPVVDNFERARQQLNPEGEEAQALH  141

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ V++L  LGV P+  VG+ FDP LHEA++RE S E  E ++I+E ++G+ L
Sbjct  142  KSYQGLYKQLVDVLKQLGVAPMRVVGQSFDPNLHEAVLREPSEEMAEDIVIEELQRGYHL  201

Query  350  GERLLRPSMVKVSAGPGPAK  291
              R+LR ++VKVS GPGP K
Sbjct  202  NGRVLRHALVKVSTGPGPTK  221



>ref|WP_015162376.1| co-chaperone GrpE [Chamaesiphon minutus]
 ref|YP_007099820.1| molecular chaperone GrpE (heat shock protein) [Chamaesiphon minutus 
PCC 6605]
 gb|AFY96293.1| molecular chaperone GrpE (heat shock protein) [Chamaesiphon minutus 
PCC 6605]
Length=253

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 97/136 (71%), Gaps = 0/136 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + LRI+ADFDNFRKR  +E+       +   + +LL V+DNF+RA+TQIK ++EGE  I+
Sbjct  102  QYLRIAADFDNFRKRNSKEKEDIEVRTKVATLVELLSVVDNFERARTQIKPQNEGEMGIH  161

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ VE L  +GV+P+   G+ FDP LHEA+MR+ + E  EG +I+E ++G+ L
Sbjct  162  KSYQGVYKQLVESLKRIGVSPMRPEGQQFDPNLHEAVMRQPTEEHPEGTVIEELQRGYYL  221

Query  350  GERLLRPSMVKVSAGP  303
            G+R+LR S+VKV+A P
Sbjct  222  GDRILRHSLVKVAAPP  237



>ref|WP_035830812.1| co-chaperone GrpE, partial [Cyanobium sp. CACIAM 14]
Length=231

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 96/139 (69%), Gaps = 0/139 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADFDNFRKR  R++     +     + ++LPV+DNFDRA+ Q+  +SE  + ++
Sbjct  93   QYMRIAADFDNFRKRQSRDQDEQRLHITCTTLTEILPVVDNFDRARQQLNPQSEEAQSLH  152

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ++ KQ V++   LGV+P+   G+PFDP LHEA++RE S    E V+I+E ++G+ L
Sbjct  153  RSYQNLYKQLVDVFKQLGVSPMRVEGEPFDPKLHEAVLREPSEHHPEDVVIEELQRGYHL  212

Query  350  GERLLRPSMVKVSAGPGPA  294
              R+LR ++VKVS GPGP 
Sbjct  213  NGRVLRHALVKVSMGPGPG  231



>ref|WP_017312974.1| co-chaperone GrpE [Fischerella sp. PCC 9339]
Length=247

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 99/134 (74%), Gaps = 0/134 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADF+N+RKRT +E+      A+   + +LLPV+DNF+RA++QIK +++GE  I+
Sbjct  97   QYMRIAADFENYRKRTIKEKEDLEVQAKRNAINELLPVVDNFERARSQIKPQNDGEMGIH  156

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + K  V+ L  LGV+P+   G+PFDP LHEA+MRE + E+ EG +++E  +G+ L
Sbjct  157  KSYQGVYKLLVDSLKRLGVSPMRPEGQPFDPNLHEAVMREPTDEYPEGTVLEELVRGYYL  216

Query  350  GERLLRPSMVKVSA  309
            G+R+LR +MVKV+A
Sbjct  217  GDRVLRHAMVKVAA  230



>ref|WP_015228005.1| co-chaperone GrpE [Dactylococcopsis salina]
 ref|YP_007170349.1| molecular chaperone GrpE [Dactylococcopsis salina PCC 8305]
 gb|AFZ48992.1| molecular chaperone GrpE (heat shock protein) [Dactylococcopsis 
salina PCC 8305]
Length=241

 Score =   140 bits (353),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 98/139 (71%), Gaps = 0/139 (0%)
 Frame = -2

Query  701  RISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSY  522
            R++ADF+NFR+R+E ++     N + E + K+L ++DNF+RA++QIK  +EGE+ I+ SY
Sbjct  87   RLAADFENFRRRSETQKEEIKQNEKRETLSKILEIVDNFERARSQIKPATEGEKNIHKSY  146

Query  521  QSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGER  342
            Q + KQ VE + SLGV+ +   G+PFDP  HEA++RE + E  EG +I+E R G+ L + 
Sbjct  147  QGVYKQLVEAMKSLGVSKMRPEGEPFDPYYHEAMLREPTNEHPEGTVIEELRSGYMLEDT  206

Query  341  LLRPSMVKVSAGPGPAKPE  285
            +LR +MVKV+A P P+  E
Sbjct  207  VLRHAMVKVAAAPEPSSQE  225



>ref|WP_011131654.1| co-chaperone GrpE [Prochlorococcus marinus]
 ref|NP_892137.1| heat shock protein GrpE [Prochlorococcus marinus subsp. pastoris 
str. CCMP1986]
 sp|Q7V3Q4.1|GRPE_PROMP RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor [Prochlorococcus 
marinus subsp. pastoris str. CCMP1986]
 emb|CAE18475.1| Heat shock protein GrpE [Prochlorococcus marinus subsp. pastoris 
str. CCMP1986]
 gb|KGF88237.1| Heat shock protein GrpE [Prochlorococcus marinus str. EQPAC1]
Length=239

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 102/152 (67%), Gaps = 3/152 (2%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADFDNFRKR  R++         + +  +LP++DNF+RA+ Q+K ESE  + ++
Sbjct  76   QYVRIAADFDNFRKRQSRDQDDLKVQLVSKALTAILPIVDNFERARQQLKPESEEAQTLH  135

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ VE+L   GV+P+  V + FDP LHEA++RE S EF+E +II+E ++G+ L
Sbjct  136  RSYQGLYKQLVEVLKQQGVSPMRVVAQQFDPKLHEAVLREPSQEFNEDIIIEELQRGYHL  195

Query  350  GERLLRPSMVKVSAGPGP---AKPETSDPAEE  264
              ++LR ++VKVS GPG     +PE  D  EE
Sbjct  196  EGKVLRHALVKVSMGPGQQNSQEPEEKDKVEE  227



>ref|WP_015123320.1| co-chaperone GrpE [Synechococcus sp. PCC 6312]
 ref|YP_007060319.1| molecular chaperone GrpE [Synechococcus sp. PCC 6312]
 gb|AFY59776.1| molecular chaperone GrpE (heat shock protein) [Synechococcus 
sp. PCC 6312]
Length=243

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = -2

Query  701  RISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSY  522
            R++ADFDNFRKRT+RE+       +   + +LLPV+D+F+RA+  I  ++E EE I+ SY
Sbjct  95   RLAADFDNFRKRTQREKDELTEQIKCSTITELLPVVDSFERARAHIAPQTEAEETIHRSY  154

Query  521  QSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGER  342
            Q + KQ V+ L  +GV  +   GKPFDP LHEA+MRE S E+ EG ++++  +G+ LGER
Sbjct  155  QGVYKQLVDCLKRVGVAAMRPEGKPFDPNLHEAVMREVSSEYPEGTVLEQLVRGYILGER  214

Query  341  LLRPSMVKVSAGPGPAKP  288
            +LR +MVKVS  PG + P
Sbjct  215  VLRHAMVKVSI-PGESHP  231



>ref|WP_013191068.1| co-chaperone GrpE [Trichormus azollae]
 ref|YP_003721174.1| GrpE protein HSP-70 cofactor ['Nostoc azollae' 0708]
 gb|ADI64051.1| GrpE protein ['Nostoc azollae' 0708]
Length=223

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 104/150 (69%), Gaps = 4/150 (3%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADF+N+RKRT +E+    T+ +   + +LLPV+DNF+RA+  +K ++EGE  I+
Sbjct  72   QYMRIAADFENYRKRTSKEKEDMETHMKRNTIMELLPVVDNFERARAHLKPQTEGEMTIH  131

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ V+ L  LGV+P+   G+ FDP LHEA+MRE + E  EG +++E  +G+ L
Sbjct  132  KSYQGVYKQLVDCLKRLGVSPMRPEGQEFDPNLHEAVMREPTNEHQEGTVLEELVRGYFL  191

Query  350  GERLLRPSMVKVSAGPGPAKPETSDPAEEQ  261
            G+R+LR +MVKV+A     K +T  P E++
Sbjct  192  GDRVLRHAMVKVAA----PKEDTPTPEEDE  217



>ref|WP_009149230.1| co-chaperone GrpE [Moorea producens]
 gb|EGJ30642.1| molecular chaperone GrpE [Moorea producens 3L]
Length=265

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 98/138 (71%), Gaps = 0/138 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADF+NFRKR+ +E+       +G  + +LL V+DNF+RA+TQIK +++GE  I+
Sbjct  114  QYIRIAADFENFRKRSTKEKEDLEHQVKGNTITELLSVVDNFERARTQIKPQNDGEMSIH  173

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ V+ L  LGV  +   G+ FDP LHEA+MRE + ++ EGV+I++  +G+ L
Sbjct  174  KSYQGVYKQLVDSLKRLGVAAMRPEGQEFDPNLHEAVMREPTDDYPEGVVIEQLMRGYLL  233

Query  350  GERLLRPSMVKVSAGPGP  297
            GER+LR +MVKV+A   P
Sbjct  234  GERVLRHAMVKVAAAAEP  251



>ref|WP_011144178.1| co-chaperone GrpE [Gloeobacter violaceus]
 ref|NP_927140.1| heat shock protein [Gloeobacter violaceus PCC 7421]
 sp|Q7NDP1.1|GRPE_GLOVI RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor [Gloeobacter 
violaceus PCC 7421]
 dbj|BAC92135.1| heat shock protein [Gloeobacter violaceus PCC 7421]
Length=196

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 100/135 (74%), Gaps = 4/135 (3%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERER--LSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEK  537
            +  R+ ADFDNFRKRT+RE+  L+ F +A+  +++ +LPV DNFDRA+   + ++E EEK
Sbjct  58   KYTRLMADFDNFRKRTQREKDELAYFVSAK--LLKDILPVFDNFDRARAFAQPDNEREEK  115

Query  536  INNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGF  357
            ++NSYQ + +QF+ +L  +GVT +E +G+PFDP  HEAI+RE+S    +  ++ E +KG+
Sbjct  116  LHNSYQQVYRQFLSVLEKMGVTAMEAIGQPFDPAQHEAILREESAGVSQETVVAELQKGY  175

Query  356  QLGERLLRPSMVKVS  312
             L +++LRP+MVKV+
Sbjct  176  LLADKVLRPAMVKVA  190



>ref|WP_015140726.1| co-chaperone GrpE [Nostoc sp. PCC 7524]
 ref|YP_007077913.1| molecular chaperone GrpE [Nostoc sp. PCC 7524]
 gb|AFY50316.1| molecular chaperone GrpE (heat shock protein) [Nostoc sp. PCC 
7524]
Length=248

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 99/141 (70%), Gaps = 0/141 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADF+N+RKRT++E+      A+   + +LLPV+DNF+RA+  +K ++EGE  I+
Sbjct  97   QYMRIAADFENYRKRTQKEKEELDIQAKRNTIMELLPVVDNFERARAHLKPQTEGEMTIH  156

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ V+ L  LGV+P+   G+ FDP LHEA+MRE + E  EG +++E  +G+ L
Sbjct  157  KSYQGVYKQLVDSLKRLGVSPMRPEGQEFDPNLHEAVMREPTDEHPEGTVLEELVRGYYL  216

Query  350  GERLLRPSMVKVSAGPGPAKP  288
            G+R+LR SMVKV+A    A P
Sbjct  217  GDRVLRHSMVKVAAPKEDAPP  237



>ref|WP_015180928.1| co-chaperone GrpE [Microcoleus sp. PCC 7113]
 ref|YP_007120174.1| molecular chaperone GrpE [Microcoleus sp. PCC 7113]
 gb|AFZ16768.1| molecular chaperone GrpE (heat shock protein) [Microcoleus sp. 
PCC 7113]
Length=261

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 97/134 (72%), Gaps = 0/134 (0%)
 Frame = -2

Query  704  LRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNS  525
            +RI+ADFDNFRKRT +E+       +   + +LLPV+DNF+RA++QIK + +GE  I+ S
Sbjct  112  MRIAADFDNFRKRTTKEKEDLEQQIKRVTLSELLPVVDNFERARSQIKPQDDGEMGIHKS  171

Query  524  YQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGE  345
            YQ + KQ V+ L  +GV+ +   GK FDP LHEA+MRE + E+ EGV+I++  +G+ LGE
Sbjct  172  YQGVYKQLVDCLKRIGVSAMRPEGKEFDPNLHEAVMREATNEYPEGVVIEQLVRGYFLGE  231

Query  344  RLLRPSMVKVSAGP  303
            R+LR +MVKV++ P
Sbjct  232  RVLRHAMVKVASAP  245



>ref|WP_015216330.1| co-chaperone GrpE [Anabaena cylindrica]
 ref|YP_007158624.1| Protein grpE [Anabaena cylindrica PCC 7122]
 gb|AFZ59714.1| Protein grpE [Anabaena cylindrica PCC 7122]
Length=248

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = -2

Query  713  DRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKI  534
            ++ +RI+ADF+N+RKRT +E+       +   + +LLPV+DNF+RA++ +K +SEGE  I
Sbjct  96   NQYMRIAADFENYRKRTSKEKEDMEMQMKRNTIMELLPVVDNFERARSHLKPQSEGEMTI  155

Query  533  NNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQ  354
            + SYQ + KQ V+ L  LGV+P+   G+ FDP LHEA+MRE + E  EG +++E  +G+ 
Sbjct  156  HKSYQGVYKQLVDCLKRLGVSPMRPEGEEFDPNLHEAVMREPTNEHPEGTVLEELVRGYY  215

Query  353  LGERLLRPSMVKVSA  309
            LGER+LR +MVKV+A
Sbjct  216  LGERVLRHAMVKVAA  230



>gb|AII46582.1| molecular chaperone GrpE [Synechococcus sp. KORDI-49]
Length=226

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 95/139 (68%), Gaps = 0/139 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADFDNFRKR  R++           + ++LPV+DNF+RA+ Q+  E E  + ++
Sbjct  65   QYMRIAADFDNFRKRQSRDQDDLRQQLVCSTLSEILPVVDNFERARQQLNPEGEEAQALH  124

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ VE+L   GV  +E VG+ FDP LHEA++RE++ E  E V+I+E ++G+ L
Sbjct  125  RSYQGLYKQLVEVLKQQGVARMEVVGQEFDPTLHEAVLREENTEHPEDVVIEELQRGYHL  184

Query  350  GERLLRPSMVKVSAGPGPA  294
              R+LR +MVKVS GPGP+
Sbjct  185  NGRVLRHAMVKVSMGPGPS  203



>gb|KEF42392.1| molecular chaperone GrpE [Cyanobium sp. CACIAM 14]
Length=249

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 96/139 (69%), Gaps = 0/139 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADFDNFRKR  R++     +     + ++LPV+DNFDRA+ Q+  +SE  + ++
Sbjct  93   QYMRIAADFDNFRKRQSRDQDEQRLHITCTTLTEILPVVDNFDRARQQLNPQSEEAQSLH  152

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ++ KQ V++   LGV+P+   G+PFDP LHEA++RE S    E V+I+E ++G+ L
Sbjct  153  RSYQNLYKQLVDVFKQLGVSPMRVEGEPFDPKLHEAVLREPSEHHPEDVVIEELQRGYHL  212

Query  350  GERLLRPSMVKVSAGPGPA  294
              R+LR ++VKVS GPGP 
Sbjct  213  NGRVLRHALVKVSMGPGPG  231



>ref|WP_016922736.1| co-chaperone GrpE [Prochlorothrix hollandica]
Length=249

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = -2

Query  713  DRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKI  534
            ++ +RI+ADF+NFR RT++E+      A+   + ++LPVLDNF+RAK  +  + E   +I
Sbjct  99   EQYVRIAADFENFRNRTQKEKDDLREQAKCTALGEVLPVLDNFERAKDHLVPQGEEALQI  158

Query  533  NNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQ  354
            + SYQ + KQFVE L   GV P+   GKPFDP+LH+A++RE + E++EG+++ E ++G+ 
Sbjct  159  HKSYQGLYKQFVESLKRAGVAPMRAEGKPFDPMLHDAMLREPTAEYEEGIVMAELQRGYM  218

Query  353  LGERLLRPSMVKVSAGP  303
            LG+R+LR +MVKV+A P
Sbjct  219  LGDRVLRHAMVKVAAPP  235



>ref|XP_005829336.1| GrpE nucleotide exchange factor, chloroplastic, partial [Guillardia 
theta CCMP2712]
 gb|EKX42356.1| GrpE nucleotide exchange factor, chloroplastic, partial [Guillardia 
theta CCMP2712]
Length=304

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 125/187 (67%), Gaps = 6/187 (3%)
 Frame = -2

Query  818  SKIAELEAFLKSIEDekvnlerkllllteelsneKDRVLRISADFDNFRKRTERERLSSF  639
            +K+ +LEA  KS+ED K     KL    E      +  +R++ADF+N+RKRT  + + + 
Sbjct  117  AKLQDLEADAKSLEDLKARGILKLASAVELK----ETYIRLAADFENYRKRTASDLVRAN  172

Query  638  TNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSYQSISKQFVEILGSLGVTPVET  459
              A   VV++LL VLD F+RA + IK E++ E+ INNSYQ+++K+ +++L  L V  +E 
Sbjct  173  DMATVNVVKELLVVLDTFERAGSAIKCETDREQSINNSYQAVNKELLKVLNKLNVEAIEP  232

Query  458  VGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGERLLRPSMVKVSAGPGPAKP--E  285
            +G+ FDP +H AI + +S E+ E V+ Q  ++G+++G+R++RP++V VS+GPGP +   E
Sbjct  233  LGQEFDPNMHNAIQQLESKEYKENVVCQALQRGYKIGDRVVRPALVVVSSGPGPEESGEE  292

Query  284  TSDPAEE  264
            TS P+E+
Sbjct  293  TSAPSEQ  299



>ref|WP_038107479.1| co-chaperone GrpE [Tolypothrix bouteillei]
 gb|KIE07824.1| heat shock protein GrpE [Tolypothrix bouteillei VB521301]
Length=250

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 101/145 (70%), Gaps = 1/145 (1%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADF+N+RKR ++E+       +   + +LLPV+DNF+RA+ QIK +++GE  I+
Sbjct  99   QYMRIAADFENYRKRNQKEKEDLEQQLKRNTITELLPVVDNFERARAQIKPQNDGEMTIH  158

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + K  V+ L  LGV+P+   G+PFDP LHEA++RE + E+ EG +++E  +G+ L
Sbjct  159  KSYQGVYKLLVDCLKRLGVSPMRPEGQPFDPNLHEAVLREPTDEYPEGTVLEELVRGYYL  218

Query  350  GERLLRPSMVKVSAGPGPAKPETSD  276
            GER+LR +MVKV+A P    P + D
Sbjct  219  GERVLRHAMVKVAA-PKEDTPSSED  242



>ref|WP_011611384.1| co-chaperone GrpE [Trichodesmium erythraeum]
 ref|YP_721482.1| heat shock protein GrpE [Trichodesmium erythraeum IMS101]
 sp|Q114R5.1|GRPE_TRIEI RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor [Trichodesmium 
erythraeum IMS101]
 gb|ABG51009.1| GrpE protein [Trichodesmium erythraeum IMS101]
Length=242

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -2

Query  701  RISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNSY  522
            R+ ADFDNFRKRT++E+    T  +   + +LLPV+DNF+RA++ IK  ++GE  I+ SY
Sbjct  96   RLGADFDNFRKRTQKEKEDLDTQVKCSTIMELLPVIDNFERARSHIKPANDGEMAIHKSY  155

Query  521  QSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGER  342
            QS+ KQ V+ L  LGV+ +   G+ FDP LHEA+MRE + E  EG +I+E  +G+ LGER
Sbjct  156  QSVYKQMVDSLKRLGVSVMRPEGQEFDPNLHEAVMREATAEHPEGTVIEELVRGYILGER  215

Query  341  LLRPSMVKVSAGP  303
            +LR +MVKV+  P
Sbjct  216  VLRHAMVKVATAP  228



>ref|WP_010873518.1| co-chaperone GrpE [Synechocystis sp. PCC 6803]
 ref|NP_442221.1| heat shock protein GrpE [Synechocystis sp. PCC 6803]
 ref|YP_005384089.1| heat shock protein GrpE [Synechocystis sp. PCC 6803 substr. GT-I]
 ref|YP_005387258.1| heat shock protein GrpE [Synechocystis sp. PCC 6803 substr. PCC-P]
 ref|YP_005409965.1| heat shock protein GrpE [Synechocystis sp. PCC 6803 substr. PCC-N]
 ref|YP_005652281.1| heat shock protein GrpE [Synechocystis sp. PCC 6803]
 ref|YP_007452097.1| heat shock protein GrpE [Synechocystis sp. PCC 6803]
 sp|Q59978.1|GRPE_SYNY3 RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor [Synechocystis 
sp. PCC 6803 substr. Kazusa]
 dbj|BAA10291.1| heat shock protein; GrpE [Synechocystis sp. PCC 6803]
 dbj|BAK51076.1| heat shock protein GrpE [Synechocystis sp. PCC 6803]
 dbj|BAL30074.1| heat shock protein GrpE [Synechocystis sp. PCC 6803 substr. GT-I]
 dbj|BAL33243.1| heat shock protein GrpE [Synechocystis sp. PCC 6803 substr. PCC-N]
 dbj|BAL36412.1| heat shock protein GrpE [Synechocystis sp. PCC 6803 substr. PCC-P]
 dbj|BAM54359.1| heat shock protein GrpE [Synechocystis sp. PCC 6803]
 gb|AGF52583.1| heat shock protein GrpE [Synechocystis sp. PCC 6803]
Length=249

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 94/136 (69%), Gaps = 0/136 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            R + ++A+FDNFRKRT+RE+       +G  + +LLPV+DNF+RA+TQIK  S+GE +I+
Sbjct  99   RYVALAAEFDNFRKRTQREKEEQAKLIKGRTITELLPVVDNFERARTQIKPNSDGENQIH  158

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + K  V+ L  LGV P+   GKPFDP  HEA++RE + E+ E  +I+E  +G+ L
Sbjct  159  KSYQGVYKNLVDSLKGLGVAPMRPEGKPFDPKYHEAMLREPTAEYPEDTVIEELVRGYLL  218

Query  350  GERLLRPSMVKVSAGP  303
             + +LR SMVKV+  P
Sbjct  219  DDIVLRHSMVKVAVAP  234



>ref|WP_015197478.1| co-chaperone GrpE [Calothrix parietina]
 ref|YP_007136803.1| protein grpE [Calothrix sp. PCC 6303]
 gb|AFZ00831.1| Protein grpE [Calothrix sp. PCC 6303]
Length=215

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 99/135 (73%), Gaps = 0/135 (0%)
 Frame = -2

Query  713  DRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKI  534
            ++ +RI+ADF+N+RKRT++E+       +   + +LLP++DNF+RA+ QIK +++GE  I
Sbjct  63   NQYMRIAADFENYRKRTQKEKEDLEVQIRRNTIMELLPIVDNFERARAQIKPQNDGEMGI  122

Query  533  NNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQ  354
            + SYQ + KQ V+ L  LGV+P+   G+ FDP LHEA+MRE + E+ EG +++E  +G+ 
Sbjct  123  HKSYQGVYKQLVDSLKRLGVSPMRPEGEMFDPNLHEAVMREPTDEYPEGTVLEELVRGYN  182

Query  353  LGERLLRPSMVKVSA  309
            LG+R+LR +MVKV+A
Sbjct  183  LGDRVLRHAMVKVAA  197



>ref|WP_017742971.1| co-chaperone GrpE [Scytonema hofmanni]
Length=250

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 101/145 (70%), Gaps = 1/145 (1%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADF+N+RKR ++E+       +   + +LLPV+DNF+RA+ QIK +++GE  I+
Sbjct  99   QYMRIAADFENYRKRNQKEKEDLEQQLKRNTITELLPVVDNFERARAQIKPQNDGEMTIH  158

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + K  V+ L  LGV+P+   G+PFDP LHEA++RE + E+ EG +++E  +G+ L
Sbjct  159  KSYQGVYKLLVDCLKRLGVSPMRPDGQPFDPNLHEAVLREPTDEYPEGTVLEELVRGYYL  218

Query  350  GERLLRPSMVKVSAGPGPAKPETSD  276
            GER+LR +MVKV+A P    P + D
Sbjct  219  GERVLRHAMVKVAA-PKEDAPSSED  242



>gb|EHA59121.1| Protein grpE [Synechococcus sp. WH 8016]
Length=268

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 108/168 (64%), Gaps = 1/168 (1%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADFDNFRKR  R++           + ++LPV+DNF+RA+ Q+  + E  + ++
Sbjct  100  QYVRIAADFDNFRKRQSRDQDDLKLQITCSTLSEILPVVDNFERARQQLDPQGEEAQSLH  159

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ V++L  LGV P+  VG+ FDP LHEA++RE S E  E V+++E ++G+ L
Sbjct  160  RSYQGLYKQLVDVLKQLGVAPMRVVGQEFDPSLHEAVLREPSDEHPEDVVVEELQRGYHL  219

Query  350  GERLLRPSMVKVSAGPGPAKPETSDPAEEQGGFIET-AEEGGSQPEGA  210
              ++LR ++VKVS GPGP + +++    E G    T  ++G S PE +
Sbjct  220  SGKVLRHALVKVSMGPGPQQSDSAALGTEGGDSAPTQGDDGSSTPEAS  267



>gb|AIQ94045.1| Heat shock protein GrpE [Prochlorococcus sp. MIT 0604]
Length=239

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 97/138 (70%), Gaps = 0/138 (0%)
 Frame = -2

Query  713  DRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKI  534
            ++ +RISADFDNFRKR  R++         + +  +LP++DNF+RA+ Q+K ESE  + +
Sbjct  75   NQYIRISADFDNFRKRQSRDQDDLKVQLVSKTLTSILPIVDNFERARQQLKPESEEAQAL  134

Query  533  NNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQ  354
            + SYQ + KQ VE+L   GV+P+  VG+ FDP LHEA++RE S +F+E  II+E ++G+ 
Sbjct  135  HRSYQGLYKQLVEVLKQQGVSPMRVVGQQFDPSLHEAVLREPSEQFNEDFIIEELQRGYH  194

Query  353  LGERLLRPSMVKVSAGPG  300
            L  ++LR ++VKVS GPG
Sbjct  195  LEGKILRHALVKVSMGPG  212



>ref|WP_028082414.1| co-chaperone GrpE [Dolichospermum circinale]
Length=222

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 95/134 (71%), Gaps = 0/134 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADF+N+RKRT +E+       +   + +LLPV+DNF+RA++ +K +SEGE  I+
Sbjct  76   QYMRIAADFENYRKRTSKEKEEIDLQVKRNTITELLPVVDNFERARSHLKPQSEGEMTIH  135

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ VE L  LGV P+   G+ FDP LHEA+MRE + E+ EG +++E  +G+  
Sbjct  136  KSYQGVYKQLVECLKRLGVAPMRPEGQQFDPNLHEAVMREATDEYPEGTVLEELVRGYYF  195

Query  350  GERLLRPSMVKVSA  309
            G+R+LR +MVKV+A
Sbjct  196  GDRVLRHAMVKVAA  209



>ref|WP_038014957.1| co-chaperone GrpE [Synechococcus sp. WH 8016]
Length=241

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 108/168 (64%), Gaps = 1/168 (1%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADFDNFRKR  R++           + ++LPV+DNF+RA+ Q+  + E  + ++
Sbjct  73   QYVRIAADFDNFRKRQSRDQDDLKLQITCSTLSEILPVVDNFERARQQLDPQGEEAQSLH  132

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ V++L  LGV P+  VG+ FDP LHEA++RE S E  E V+++E ++G+ L
Sbjct  133  RSYQGLYKQLVDVLKQLGVAPMRVVGQEFDPSLHEAVLREPSDEHPEDVVVEELQRGYHL  192

Query  350  GERLLRPSMVKVSAGPGPAKPETSDPAEEQGGFIET-AEEGGSQPEGA  210
              ++LR ++VKVS GPGP + +++    E G    T  ++G S PE +
Sbjct  193  SGKVLRHALVKVSMGPGPQQSDSAALGTEGGDSAPTQGDDGSSTPEAS  240



>ref|WP_011429854.1| co-chaperone GrpE [Synechococcus sp. JA-3-3Ab]
 ref|YP_474434.1| heat shock protein GrpE [Synechococcus sp. JA-3-3Ab]
 sp|Q2JVR0.1|GRPE_SYNJA RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor [Synechococcus 
sp. JA-3-3Ab]
 gb|ABC99171.1| co-chaperone GrpE [Synechococcus sp. JA-3-3Ab]
Length=237

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 107/145 (74%), Gaps = 0/145 (0%)
 Frame = -2

Query  704  LRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKINNS  525
            +R+ ADF+N+R+RT+RE+       + + V ++LPV+D+F+RA+ Q+K+E++ E +++NS
Sbjct  74   IRLYADFENYRRRTQREKEEFSQKERQKFVLEILPVVDSFERAQQQLKLETDREREVHNS  133

Query  524  YQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQLGE  345
            YQS+ +  VE L  +GV+ +++VG+PFDP LHEAI R+ S E+ E V+  E++ G++LG+
Sbjct  134  YQSVYRLLVECLKKMGVSRMKSVGQPFDPNLHEAIARQPSSEYPEDVVAVEYQPGYKLGD  193

Query  344  RLLRPSMVKVSAGPGPAKPETSDPA  270
             ++R +MV VS+G   ++P  SDPA
Sbjct  194  LVIRHAMVAVSSGSPTSEPSPSDPA  218



>ref|XP_008803238.1| PREDICTED: grpE protein homolog, mitochondrial-like [Phoenix 
dactylifera]
Length=194

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -2

Query  713  DRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKI  534
            D +LRI  DFDNFRKRTE+E LS  T AQG+V+E LLPVLDNF+R KTQIKVE+   +K+
Sbjct  48   DHILRIIVDFDNFRKRTEKEGLSLMTKAQGQVIESLLPVLDNFERDKTQIKVETGRRKKV  107

Query  533  NNSYQSISKQFVEILGSLGVTPVETVGKPFDPL  435
            +NSYQSI +QF+EIL SLGV  VETVG PFDPL
Sbjct  108  HNSYQSIYEQFLEILSSLGVERVETVGNPFDPL  140



>ref|WP_015186828.1| co-chaperone GrpE [Gloeocapsa sp. PCC 7428]
 ref|YP_007126111.1| Protein grpE [Gloeocapsa sp. PCC 7428]
 gb|AFZ28951.1| Protein grpE [Gloeocapsa sp. PCC 7428]
Length=229

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI ADF+NFRKR ++E+       + + + +LLPV+DNF+RA++QIK +++ E  I+
Sbjct  82   QYIRIGADFENFRKRMQKEKEEIEQKIKRDTITELLPVVDNFERARSQIKPQTDAEMTIH  141

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQS+ KQ V+ L  LGV+ + + G PFDP  HEA+MRE + E  EG +++E  +G+ L
Sbjct  142  KSYQSVYKQMVDTLKRLGVSAMRSEGSPFDPNYHEAVMREPTDEHPEGTVLEELVRGYFL  201

Query  350  GERLLRPSMVKVSAGPGPAK  291
            G+R+LR ++VKV+A P P +
Sbjct  202  GDRVLRHALVKVAAAPEPGE  221



>ref|WP_032519874.1| co-chaperone GrpE [Prochlorococcus marinus]
 gb|KGG08548.1| Heat shock protein GrpE [Prochlorococcus marinus str. SB]
Length=238

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 97/138 (70%), Gaps = 0/138 (0%)
 Frame = -2

Query  713  DRVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKI  534
            ++ +RISADFDNFRKR  R++         + +  +LP++DNF+RA+ Q+K E+E  + +
Sbjct  74   NQYVRISADFDNFRKRQSRDQDDLKIQLVSKTITAILPIVDNFERARQQLKPENEEAQAL  133

Query  533  NNSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQ  354
            + SYQ + KQ VE+L   GV+P+  VG+ FDP LHEA++RE S EF+E  II+E ++G+ 
Sbjct  134  HRSYQGLYKQLVEVLKQQGVSPMRVVGQQFDPNLHEAVLREPSEEFEEDYIIEELQRGYH  193

Query  353  LGERLLRPSMVKVSAGPG  300
            L  ++LR ++VKVS GPG
Sbjct  194  LEGKVLRHALVKVSMGPG  211



>ref|WP_011363064.1| co-chaperone GrpE [Synechococcus sp. CC9605]
 ref|YP_380357.1| heat shock protein GrpE [Synechococcus sp. CC9605]
 sp|Q3ANN0.1|GRPE_SYNSC RecName: Full=Protein GrpE; AltName: Full=HSP-70 cofactor [Synechococcus 
sp. CC9605]
 gb|ABB33802.1| putative heat shock protein GrpE [Synechococcus sp. CC9605]
Length=225

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 95/141 (67%), Gaps = 0/141 (0%)
 Frame = -2

Query  710  RVLRISADFDNFRKRTERERLSSFTNAQGEVVEKLLPVLDNFDRAKTQIKVESEGEEKIN  531
            + +RI+ADFDNFRKR  R++           + ++LPV+DNF+RA+ Q+  E E  + ++
Sbjct  67   QYMRIAADFDNFRKRQSRDQDDMRKQLVCSTLTEILPVVDNFERARQQLNPEGEEAQALH  126

Query  530  NSYQSISKQFVEILGSLGVTPVETVGKPFDPLLHEAIMREDSVEFDEGVIIQEFRKGFQL  351
             SYQ + KQ VE+L   GV  ++ VG+ FDP LHEA++RE+S EF E V+ +E ++G+  
Sbjct  127  RSYQGLYKQLVEVLKQQGVARMDVVGQEFDPNLHEAVLREESSEFAEDVVSEELQRGYHR  186

Query  350  GERLLRPSMVKVSAGPGPAKP  288
              R+LR +MVKVS GPGP+ P
Sbjct  187  DGRVLRHAMVKVSMGPGPSDP  207



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3524261125780