BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27517_g1_i1 len=349 path=[1:0-348]

Length=349
                                                                      Score     E

ref|XP_009778747.1|  PREDICTED: uncharacterized protein At2g34160...  79.0    6e-16   
ref|XP_009626436.1|  PREDICTED: uncharacterized protein At2g34160...  79.0    6e-16   
ref|XP_009626435.1|  PREDICTED: uncharacterized protein At2g34160...  78.6    8e-16   
ref|XP_009626434.1|  PREDICTED: uncharacterized protein At2g34160...  79.0    2e-15   
gb|KDP32385.1|  hypothetical protein JCGZ_13310                       75.9    6e-15   
ref|XP_011093556.1|  PREDICTED: uncharacterized protein At2g34160...  74.3    3e-14   
ref|XP_002524472.1|  conserved hypothetical protein                   73.9    4e-14   Ricinus communis
gb|EYU23047.1|  hypothetical protein MIMGU_mgv1a016236mg              72.4    1e-13   
ref|XP_010093232.1|  Uncharacterized protein L484_022390              71.6    3e-13   
ref|XP_009407663.1|  PREDICTED: uncharacterized protein At2g34160...  71.6    3e-13   
ref|XP_008351650.1|  PREDICTED: uncharacterized protein At2g34160...  71.6    3e-13   
ref|XP_009388523.1|  PREDICTED: uncharacterized protein At2g34160...  70.9    5e-13   
ref|XP_009343699.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  70.5    1e-12   
emb|CDY17226.1|  BnaA05g09620D                                        70.1    1e-12   
ref|XP_008339666.1|  PREDICTED: uncharacterized protein At2g34160...  70.5    1e-12   
gb|KFK36323.1|  hypothetical protein AALP_AA4G107800                  69.3    2e-12   
emb|CBI36290.3|  unnamed protein product                              69.3    2e-12   
ref|XP_010549408.1|  PREDICTED: uncharacterized protein At2g34160...  68.2    4e-12   
ref|XP_006295225.1|  hypothetical protein CARUB_v10024310mg           68.2    5e-12   
emb|CDY50840.1|  BnaA10g28170D                                        68.6    5e-12   
ref|XP_010097254.1|  Uncharacterized protein L484_025803              68.2    5e-12   
ref|NP_564325.1|  Alba DNA/RNA-binding protein                        68.2    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010549407.1|  PREDICTED: uncharacterized protein At2g34160...  68.2    6e-12   
ref|XP_010499438.1|  PREDICTED: uncharacterized protein At2g34160...  67.8    7e-12   
ref|XP_006303421.1|  hypothetical protein CARUB_v10010630mg           67.8    7e-12   
ref|XP_002890797.1|  nucleic acid binding protein                     67.8    7e-12   
gb|KHN44168.1|  Hypothetical protein glysoja_031829                   67.8    8e-12   
ref|NP_001238733.1|  uncharacterized protein LOC100527358             67.8    8e-12   
gb|KHF98816.1|  hypothetical protein F383_17190                       67.8    8e-12   
ref|NP_565781.1|  Alba DNA/RNA-binding protein                        67.4    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469393.1|  PREDICTED: uncharacterized protein At2g34160...  67.4    1e-11   
ref|XP_010509790.1|  PREDICTED: uncharacterized protein At2g34160     67.0    1e-11   
ref|NP_001236521.1|  uncharacterized protein LOC100527472             67.0    1e-11   
ref|XP_008784950.1|  PREDICTED: uncharacterized protein At2g34160...  66.6    2e-11   
ref|NP_001236789.1|  uncharacterized protein LOC100305539             66.6    2e-11   
ref|XP_007013411.1|  Alba DNA/RNA-binding protein                     66.2    2e-11   
ref|XP_002879480.1|  nucleic acid binding protein                     66.2    3e-11   
emb|CDY07574.1|  BnaC06g14900D                                        65.9    3e-11   
emb|CDY30047.1|  BnaC05g09730D                                        65.9    3e-11   
ref|XP_004168112.1|  PREDICTED: uncharacterized protein At2g34160...  66.2    3e-11   
ref|XP_004150019.1|  PREDICTED: uncharacterized protein At2g34160...  66.2    3e-11   
ref|XP_009402892.1|  PREDICTED: uncharacterized protein At2g34160...  65.9    3e-11   
ref|XP_006450953.1|  hypothetical protein CICLE_v10009883mg           65.9    3e-11   
ref|XP_009143800.1|  PREDICTED: uncharacterized protein At2g34160     65.9    3e-11   
emb|CDY43106.1|  BnaC05g36710D                                        65.9    4e-11   
ref|XP_006410557.1|  hypothetical protein EUTSA_v10017416mg           65.9    4e-11   
ref|XP_006410558.1|  hypothetical protein EUTSA_v10017416mg           65.9    4e-11   
gb|KHN01341.1|  Hypothetical protein glysoja_009547                   65.5    5e-11   
gb|KHN47771.1|  Hypothetical protein glysoja_029189                   65.5    6e-11   
ref|XP_010413770.1|  PREDICTED: uncharacterized protein At2g34160...  65.1    7e-11   
ref|XP_010250057.1|  PREDICTED: uncharacterized protein At2g34160...  65.1    8e-11   
ref|XP_004506910.1|  PREDICTED: uncharacterized protein At2g34160...  64.7    9e-11   
ref|XP_007150730.1|  hypothetical protein PHAVU_005G176200g           64.7    9e-11   
gb|KFK44753.1|  hypothetical protein AALP_AA1G298400                  64.7    1e-10   
ref|XP_002285115.1|  PREDICTED: uncharacterized protein At2g34160     64.7    1e-10   Vitis vinifera
ref|XP_006450468.1|  hypothetical protein CICLE_v10009882mg           64.3    1e-10   
ref|XP_006483339.1|  PREDICTED: uncharacterized protein At2g34160...  64.3    1e-10   
ref|XP_006450467.1|  hypothetical protein CICLE_v10009882mg           64.3    1e-10   
ref|XP_009403457.1|  PREDICTED: uncharacterized protein At2g34160...  64.3    1e-10   
emb|CAN60466.1|  hypothetical protein VITISV_012496                   64.7    2e-10   Vitis vinifera
ref|XP_009381121.1|  PREDICTED: uncharacterized protein At2g34160...  63.9    2e-10   
pdb|1VM0|A  Chain A, X-Ray Structure Of Gene Product From Arabido...  63.9    2e-10   
ref|XP_010061927.1|  PREDICTED: uncharacterized protein At2g34160...  63.9    2e-10   
ref|XP_007215146.1|  hypothetical protein PRUPE_ppa013322mg           63.9    2e-10   
ref|XP_008243714.1|  PREDICTED: uncharacterized protein At2g34160...  63.5    2e-10   
ref|XP_010914880.1|  PREDICTED: uncharacterized protein At2g34160...  63.5    3e-10   
ref|XP_010254376.1|  PREDICTED: uncharacterized protein At2g34160...  63.5    3e-10   
emb|CDP10391.1|  unnamed protein product                              63.5    3e-10   
ref|XP_008792056.1|  PREDICTED: uncharacterized protein At2g34160...  63.5    3e-10   
ref|XP_007135740.1|  hypothetical protein PHAVU_010G154500g           63.5    3e-10   
ref|XP_008243713.1|  PREDICTED: uncharacterized protein At2g34160...  63.5    3e-10   
gb|ABK94195.1|  unknown                                               63.5    3e-10   Populus trichocarpa [western balsam poplar]
ref|XP_002324292.1|  hypothetical protein POPTR_0018s01550g           63.2    3e-10   Populus trichocarpa [western balsam poplar]
ref|XP_010538212.1|  PREDICTED: uncharacterized protein At2g34160...  63.2    3e-10   
gb|EYU24652.1|  hypothetical protein MIMGU_mgv1a016184mg              63.2    3e-10   
gb|KGN60668.1|  hypothetical protein Csa_2G006140                     62.8    4e-10   
gb|KEH28695.1|  alba DNA/RNA-binding protein                          63.2    4e-10   
emb|CDY43326.1|  BnaC03g58980D                                        63.2    4e-10   
gb|AGS17822.1|  hypothetical protein                                  63.5    4e-10   
ref|XP_008457716.1|  PREDICTED: uncharacterized protein At2g34160...  63.2    4e-10   
ref|XP_004139317.1|  PREDICTED: uncharacterized protein At2g34160...  63.2    4e-10   
ref|XP_009109679.1|  PREDICTED: uncharacterized protein At2g34160...  62.8    5e-10   
ref|XP_004302971.1|  PREDICTED: uncharacterized protein At2g34160...  62.8    5e-10   
ref|XP_006415602.1|  hypothetical protein EUTSA_v10009096mg           62.8    5e-10   
emb|CDY50785.1|  BnaA09g54140D                                        62.8    6e-10   
gb|KHF98627.1|  hypothetical protein F383_16439                       62.8    6e-10   
ref|XP_004968373.1|  PREDICTED: uncharacterized protein At2g34160...  62.8    6e-10   
gb|EPS62998.1|  hypothetical protein M569_11792                       62.4    6e-10   
ref|XP_006356205.1|  PREDICTED: uncharacterized protein At2g34160...  62.0    6e-10   
ref|XP_004241699.1|  PREDICTED: uncharacterized protein At2g34160...  62.4    6e-10   
ref|XP_011026458.1|  PREDICTED: uncharacterized protein At2g34160...  62.4    6e-10   
ref|XP_001768991.1|  predicted protein                                62.4    7e-10   
gb|ABK24162.1|  unknown                                               62.4    8e-10   Picea sitchensis
dbj|BAJ98262.1|  predicted protein                                    62.4    8e-10   
ref|XP_010049985.1|  PREDICTED: uncharacterized protein At2g34160...  62.4    1e-09   
gb|EAZ01574.1|  hypothetical protein OsI_23607                        60.5    1e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_006356204.1|  PREDICTED: uncharacterized protein At2g34160...  61.6    1e-09   
gb|AFK38642.1|  unknown                                               61.6    1e-09   
gb|AFK35646.1|  unknown                                               61.6    1e-09   
gb|ABK22189.1|  unknown                                               61.6    1e-09   Picea sitchensis
gb|KDP33611.1|  hypothetical protein JCGZ_07182                       61.6    2e-09   
ref|XP_002437246.1|  hypothetical protein SORBIDRAFT_10g023460        61.2    2e-09   Sorghum bicolor [broomcorn]
ref|XP_004965953.1|  PREDICTED: uncharacterized protein At2g34160...  61.2    2e-09   
ref|XP_002285046.1|  PREDICTED: uncharacterized protein At2g34160     61.2    2e-09   Vitis vinifera
ref|XP_007013844.1|  Alba DNA/RNA-binding protein                     60.8    2e-09   
ref|XP_009115263.1|  PREDICTED: uncharacterized protein At2g34160...  60.8    2e-09   
ref|XP_009102872.1|  PREDICTED: uncharacterized protein At2g34160...  60.8    3e-09   
ref|XP_002515535.1|  conserved hypothetical protein                   60.8    3e-09   Ricinus communis
emb|CDX99800.1|  BnaC05g22220D                                        60.8    3e-09   
ref|XP_006647046.1|  PREDICTED: uncharacterized protein At2g34160...  60.8    3e-09   
ref|NP_001058008.1|  Os06g0602600                                     60.5    3e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EMT03371.1|  hypothetical protein F775_28656                       60.5    3e-09   
emb|CBI17465.3|  unnamed protein product                              60.8    4e-09   
emb|CDO98136.1|  unnamed protein product                              60.1    5e-09   
ref|XP_006837817.1|  hypothetical protein AMTR_s00104p00132470        59.7    6e-09   
emb|CDX94654.1|  BnaC07g10040D                                        58.9    1e-08   
emb|CDY15643.1|  BnaA07g08140D                                        58.9    1e-08   
ref|XP_003563670.1|  PREDICTED: uncharacterized protein At2g34160...  58.9    1e-08   
ref|XP_009785780.1|  PREDICTED: uncharacterized protein At2g34160...  58.5    2e-08   
gb|AFW87068.1|  hypothetical protein ZEAMMB73_637233                  58.5    2e-08   
ref|XP_009408969.1|  PREDICTED: uncharacterized protein At2g34160...  58.5    2e-08   
ref|XP_008659718.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  58.5    2e-08   
ref|XP_011081297.1|  PREDICTED: uncharacterized protein At2g34160...  58.2    2e-08   
ref|XP_010925231.1|  PREDICTED: uncharacterized protein At2g34160...  58.2    2e-08   
ref|XP_010688018.1|  PREDICTED: uncharacterized protein At2g34160...  58.2    2e-08   
ref|XP_002873188.1|  hypothetical protein ARALYDRAFT_487296           58.5    3e-08   
ref|NP_001143331.1|  uncharacterized protein LOC100275927             58.2    3e-08   Zea mays [maize]
ref|XP_011039708.1|  PREDICTED: uncharacterized protein At2g34160...  57.8    4e-08   
ref|XP_006656212.1|  PREDICTED: uncharacterized protein At2g34160...  57.4    4e-08   
ref|XP_008219479.1|  PREDICTED: uncharacterized protein At2g34160...  57.4    4e-08   
ref|XP_009771917.1|  PREDICTED: uncharacterized protein At2g34160...  57.0    5e-08   
ref|XP_002308658.1|  hypothetical protein POPTR_0006s26820g           57.0    6e-08   Populus trichocarpa [western balsam poplar]
ref|XP_009606374.1|  PREDICTED: uncharacterized protein At2g34160...  56.6    8e-08   
ref|XP_008366692.1|  PREDICTED: uncharacterized protein At2g34160...  56.2    1e-07   
ref|XP_002453505.1|  hypothetical protein SORBIDRAFT_04g007020        56.2    1e-07   Sorghum bicolor [broomcorn]
ref|XP_007225832.1|  hypothetical protein PRUPE_ppa011574mg           56.6    1e-07   
ref|XP_004951528.1|  PREDICTED: uncharacterized protein At2g34160...  55.8    2e-07   
ref|XP_009627569.1|  PREDICTED: uncharacterized protein At2g34160...  55.5    2e-07   
ref|XP_007030533.1|  Alba DNA/RNA-binding protein                     55.5    2e-07   
dbj|BAJ87819.1|  predicted protein                                    55.5    2e-07   
gb|EMT17314.1|  hypothetical protein F775_31902                       55.5    3e-07   
ref|XP_004241771.1|  PREDICTED: uncharacterized protein At2g34160     54.7    3e-07   
ref|XP_006353694.1|  PREDICTED: uncharacterized protein At2g34160...  54.7    3e-07   
ref|XP_006353679.1|  PREDICTED: uncharacterized protein At2g34160...  54.7    3e-07   
emb|CDP13492.1|  unnamed protein product                              54.3    5e-07   
ref|XP_003571486.1|  PREDICTED: uncharacterized protein At2g34160...  54.3    6e-07   
dbj|BAD15498.1|  unknown protein                                      53.9    7e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004241781.1|  PREDICTED: uncharacterized protein At2g34160     53.5    9e-07   
ref|XP_003597872.1|  hypothetical protein MTR_2g103500                53.1    1e-06   
gb|ABK26422.1|  unknown                                               53.1    2e-06   Picea sitchensis
ref|XP_009111898.1|  PREDICTED: uncharacterized protein At2g34160...  52.8    2e-06   
ref|XP_009111897.1|  PREDICTED: uncharacterized protein At2g34160...  52.8    2e-06   
emb|CDY00026.1|  BnaC09g02750D                                        52.4    2e-06   
ref|XP_010550911.1|  PREDICTED: uncharacterized protein At2g34160     52.4    2e-06   
emb|CDY57017.1|  BnaA09g03470D                                        52.4    2e-06   
ref|XP_004486682.1|  PREDICTED: uncharacterized protein At2g34160...  52.4    2e-06   
ref|XP_004486681.1|  PREDICTED: uncharacterized protein At2g34160...  52.4    2e-06   
gb|AFK40867.1|  unknown                                               52.4    2e-06   
ref|XP_006395024.1|  hypothetical protein EUTSA_v10005588mg           52.4    3e-06   
ref|XP_003535371.1|  PREDICTED: uncharacterized protein At2g34160...  52.0    3e-06   
gb|AGT16645.1|  hypothetical protein SHCRBa_170_C07_R_130             52.0    3e-06   
ref|XP_010672114.1|  PREDICTED: uncharacterized protein At2g34160...  52.4    3e-06   
gb|KHF97780.1|  hypothetical protein F383_15777                       52.0    3e-06   
ref|XP_010526208.1|  PREDICTED: uncharacterized protein At2g34160...  51.2    5e-06   
ref|XP_010519975.1|  PREDICTED: uncharacterized protein At2g34160...  51.2    7e-06   
ref|XP_008456222.1|  PREDICTED: uncharacterized protein At2g34160     51.2    7e-06   
ref|XP_004291467.1|  PREDICTED: uncharacterized protein At2g34160...  51.2    7e-06   
ref|XP_004139384.1|  PREDICTED: uncharacterized protein At2g34160...  51.2    7e-06   
ref|XP_001769016.1|  predicted protein                                50.8    8e-06   
ref|XP_004968371.1|  PREDICTED: uncharacterized protein At2g34160...  50.8    9e-06   
ref|XP_002521944.1|  conserved hypothetical protein                   50.8    1e-05   Ricinus communis
ref|XP_004968372.1|  PREDICTED: uncharacterized protein At2g34160...  50.4    1e-05   
ref|XP_010525972.1|  PREDICTED: uncharacterized protein At2g34160...  50.1    1e-05   
ref|XP_008394068.1|  PREDICTED: uncharacterized protein At2g34160...  50.4    1e-05   
ref|XP_009348607.1|  PREDICTED: uncharacterized protein At2g34160...  50.1    1e-05   
ref|XP_004495605.1|  PREDICTED: uncharacterized protein At2g34160...  50.1    1e-05   
ref|NP_001141319.1|  uncharacterized protein LOC100273410             50.1    2e-05   Zea mays [maize]
ref|NP_001288491.1|  uncharacterized protein LOC103649688             50.1    2e-05   
ref|NP_001281224.1|  LOC100284257                                     50.1    2e-05   
ref|XP_002319085.2|  hypothetical protein POPTR_0013s04020g           50.1    2e-05   Populus trichocarpa [western balsam poplar]
emb|CDO99171.1|  unnamed protein product                              49.7    2e-05   
gb|KHG14530.1|  hypothetical protein F383_02218                       49.7    2e-05   
gb|KEH43002.1|  alba DNA/RNA-binding protein                          49.7    2e-05   
ref|XP_007206133.1|  hypothetical protein PRUPE_ppa013191mg           49.7    2e-05   
ref|XP_011038549.1|  PREDICTED: uncharacterized protein At2g34160...  49.7    2e-05   
ref|NP_001142884.1|  uncharacterized protein LOC100275297             49.7    2e-05   Zea mays [maize]
ref|XP_011032375.1|  PREDICTED: uncharacterized protein At2g34160     49.7    2e-05   
gb|ACN31274.1|  unknown                                               49.7    2e-05   Zea mays [maize]
emb|CDX86203.1|  BnaA06g29200D                                        49.7    2e-05   
ref|XP_009151257.1|  PREDICTED: uncharacterized protein At2g34160...  49.7    3e-05   
ref|XP_004304756.1|  PREDICTED: uncharacterized protein At2g34160...  49.3    3e-05   
gb|EMT05887.1|  hypothetical protein F775_20281                       49.3    3e-05   
ref|XP_006643815.1|  PREDICTED: uncharacterized protein At2g34160...  49.3    4e-05   
ref|XP_006299145.1|  hypothetical protein CARUB_v10015288mg           49.3    4e-05   
ref|XP_002280347.1|  PREDICTED: uncharacterized protein At2g34160...  48.9    4e-05   Vitis vinifera
emb|CDP06841.1|  unnamed protein product                              48.9    4e-05   
ref|XP_010102274.1|  Uncharacterized protein L484_024556              49.7    4e-05   
ref|XP_003555573.1|  PREDICTED: uncharacterized protein At2g34160...  48.5    4e-05   
ref|XP_002966653.1|  hypothetical protein SELMODRAFT_86023            48.1    6e-05   
emb|CDY41887.1|  BnaC05g47170D                                        48.5    6e-05   
ref|XP_002978089.1|  hypothetical protein SELMODRAFT_176795           48.1    6e-05   
emb|CBI26374.3|  unnamed protein product                              48.1    7e-05   
emb|CDY21118.1|  BnaA01g33490D                                        48.5    7e-05   
emb|CDY50744.1|  BnaAnng10510D                                        48.5    7e-05   
ref|XP_010027179.1|  PREDICTED: uncharacterized protein At2g34160     48.5    7e-05   
ref|XP_006408171.1|  hypothetical protein EUTSA_v10021676mg           48.5    7e-05   
ref|XP_009355722.1|  PREDICTED: uncharacterized protein At2g34160...  48.1    7e-05   
gb|KFK37876.1|  hypothetical protein AALP_AA3G040800                  48.5    7e-05   
ref|XP_006423982.1|  hypothetical protein CICLE_v10030008mg           47.8    7e-05   
ref|XP_009124986.1|  PREDICTED: uncharacterized protein At2g34160...  48.5    7e-05   
gb|KDP23684.1|  hypothetical protein JCGZ_23517                       48.1    7e-05   
ref|XP_009124184.1|  PREDICTED: uncharacterized protein At2g34160...  48.1    8e-05   
emb|CDY30010.1|  BnaC01g39980D                                        48.1    8e-05   
ref|XP_010417092.1|  PREDICTED: uncharacterized protein At2g34160...  48.1    9e-05   
ref|NP_187113.1|  DUO1-activated nucleic acid binding protein         48.1    9e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884455.1|  nucleic acid binding protein                     48.1    9e-05   
gb|KHG16323.1|  hypothetical protein F383_08228                       47.8    9e-05   
ref|XP_009134767.1|  PREDICTED: uncharacterized protein At2g34160...  48.1    9e-05   
ref|XP_010485843.1|  PREDICTED: uncharacterized protein At2g34160...  48.1    9e-05   
emb|CDX74179.1|  BnaA03g28680D                                        48.1    9e-05   
emb|CDY40664.1|  BnaC03g33800D                                        48.1    9e-05   
gb|ABR26175.1|  unknown                                               47.8    9e-05   Oryza sativa Indica Group [Indian rice]
gb|KDO48762.1|  hypothetical protein CISIN_1g038360mg                 47.8    9e-05   
ref|XP_010463944.1|  PREDICTED: uncharacterized protein At2g34160...  48.1    1e-04   
dbj|BAK08244.1|  predicted protein                                    48.5    1e-04   
ref|XP_006487872.1|  PREDICTED: uncharacterized protein At2g34160...  47.8    1e-04   
ref|XP_009364477.1|  PREDICTED: uncharacterized protein At2g34160...  47.8    1e-04   
ref|XP_011091961.1|  PREDICTED: uncharacterized protein At2g34160...  47.8    1e-04   
ref|XP_008370716.1|  PREDICTED: uncharacterized protein At2g34160...  47.4    1e-04   
ref|XP_008350636.1|  PREDICTED: uncharacterized protein At2g34160...  47.4    1e-04   
ref|XP_009372174.1|  PREDICTED: uncharacterized protein At2g34160     47.4    1e-04   
ref|XP_008656129.1|  PREDICTED: uncharacterized protein At2g34160...  48.1    1e-04   
gb|EYU30530.1|  hypothetical protein MIMGU_mgv1a015883mg              47.4    1e-04   
ref|XP_006382820.1|  hypothetical protein POPTR_0005s05780g           47.8    1e-04   
ref|XP_009355687.1|  PREDICTED: uncharacterized protein At2g34160...  47.0    1e-04   
ref|XP_011087389.1|  PREDICTED: uncharacterized protein At2g34160...  47.4    1e-04   
gb|AFK44427.1|  unknown                                               47.0    1e-04   
gb|AFW81391.1|  hypothetical protein ZEAMMB73_168635                  47.8    2e-04   
ref|XP_010675061.1|  PREDICTED: uncharacterized protein At2g34160     47.4    2e-04   
gb|AGU71361.1|  nucleic acid binding protein                          45.8    2e-04   
emb|CDM85818.1|  unnamed protein product                              47.8    2e-04   
ref|XP_007144839.1|  hypothetical protein PHAVU_007G1886001g          45.8    2e-04   
ref|XP_006664564.1|  PREDICTED: uncharacterized protein At2g34160...  47.4    2e-04   
ref|XP_010670649.1|  PREDICTED: uncharacterized protein At2g34160...  46.6    2e-04   
ref|XP_002455102.1|  hypothetical protein SORBIDRAFT_03g004340        46.6    3e-04   Sorghum bicolor [broomcorn]
ref|XP_003575507.1|  PREDICTED: uncharacterized protein At2g34160...  47.4    3e-04   
ref|XP_009396723.1|  PREDICTED: uncharacterized protein At2g34160...  46.6    3e-04   
dbj|BAJ86084.1|  predicted protein                                    46.6    3e-04   
ref|NP_001236091.1|  uncharacterized protein LOC100305998             46.2    3e-04   
gb|EAY72729.1|  hypothetical protein OsI_00594                        46.2    3e-04   Oryza sativa Indica Group [Indian rice]
gb|KHN43179.1|  Hypothetical protein glysoja_001762                   46.2    4e-04   
ref|XP_003610783.1|  hypothetical protein MTR_5g006970                46.2    4e-04   
ref|XP_007147186.1|  hypothetical protein PHAVU_006G103000g           47.0    4e-04   
gb|KHN31472.1|  Hypothetical protein glysoja_035579                   45.8    5e-04   
ref|XP_003520842.1|  PREDICTED: uncharacterized protein At2g34160...  45.8    5e-04   
ref|XP_006577294.1|  PREDICTED: uncharacterized protein At2g34160...  45.8    5e-04   
ref|XP_004230078.2|  PREDICTED: uncharacterized protein At2g34160     46.2    5e-04   
ref|NP_001042157.1|  Os01g0173100                                     45.8    5e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009790071.1|  PREDICTED: uncharacterized protein At2g34160     45.8    6e-04   
ref|XP_003569410.1|  PREDICTED: uncharacterized protein At2g34160...  45.8    6e-04   
ref|XP_006347728.1|  PREDICTED: uncharacterized protein At2g34160...  45.8    6e-04   
ref|XP_009630719.1|  PREDICTED: uncharacterized protein At2g34160     45.8    7e-04   
ref|XP_002962432.1|  hypothetical protein SELMODRAFT_141130           45.1    8e-04   
ref|XP_007134910.1|  hypothetical protein PHAVU_010G086100g           44.3    8e-04   
ref|XP_008345951.1|  PREDICTED: pentatricopeptide repeat-containi...  47.0    8e-04   



>ref|XP_009778747.1| PREDICTED: uncharacterized protein At2g34160-like isoform X2 
[Nicotiana sylvestris]
Length=128

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  224  LMEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            +MEE++EGV N+NIS GDLQKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MMEELSEGVNNMNISGGDLQKKNRIQVSNTKKPLFFYVNLAK  42



>ref|XP_009626436.1| PREDICTED: uncharacterized protein At2g34160-like isoform X3 
[Nicotiana tomentosiformis]
 ref|XP_009778746.1| PREDICTED: uncharacterized protein At2g34160-like isoform X1 
[Nicotiana sylvestris]
Length=131

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  224  LMEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            +MEE++EGV N+NIS GDLQKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MMEELSEGVNNMNISGGDLQKKNRIQVSNTKKPLFFYVNLAK  42



>ref|XP_009626435.1| PREDICTED: uncharacterized protein At2g34160-like isoform X2 
[Nicotiana tomentosiformis]
Length=132

 Score = 78.6 bits (192),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  224  LMEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            +MEE++EGV N+NIS GDLQKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MMEELSEGVNNMNISGGDLQKKNRIQVSNTKKPLFFYVNLAK  42



>ref|XP_009626434.1| PREDICTED: uncharacterized protein At2g34160-like isoform X1 
[Nicotiana tomentosiformis]
Length=202

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  224  LMEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            +MEE++EGV N+NIS GDLQKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MMEELSEGVNNMNISGGDLQKKNRIQVSNTKKPLFFYVNLAK  42



>gb|KDP32385.1| hypothetical protein JCGZ_13310 [Jatropha curcas]
Length=108

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV N+ I+ GDL KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNVTITGGDLHKKNRIQVSNTKKPLFFYVNLAK  41



>ref|XP_011093556.1| PREDICTED: uncharacterized protein At2g34160-like [Sesamum indicum]
Length=129

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGVTNI+IS GD QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVTNISIS-GDSQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_002524472.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37912.1| conserved hypothetical protein [Ricinus communis]
Length=130

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 38/41 (93%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV NIN+ AGDL KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNINL-AGDLHKKNRIQVSNTKKPLFFYVNLAK  40



>gb|EYU23047.1| hypothetical protein MIMGU_mgv1a016236mg [Erythranthe guttata]
Length=129

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 38/41 (93%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT GVTNI+I AGD QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITAGVTNISI-AGDAQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_010093232.1| Uncharacterized protein L484_022390 [Morus notabilis]
 gb|EXB53734.1| Uncharacterized protein L484_022390 [Morus notabilis]
Length=131

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV  INI +GD  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNAINIGSGDTYKKNRIQVSNTKKPLFFYVNLAK  41



>ref|XP_009407663.1| PREDICTED: uncharacterized protein At2g34160-like [Musa acuminata 
subsp. malaccensis]
Length=132

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV N++++A D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNLHVTAADSHKKNRIQVSNTKKPLFFYVNLAK  41



>ref|XP_008351650.1| PREDICTED: uncharacterized protein At2g34160-like [Malus domestica]
 ref|XP_009362527.1| PREDICTED: uncharacterized protein At2g34160-like [Pyrus x bretschneideri]
 ref|XP_009362536.1| PREDICTED: uncharacterized protein At2g34160-like [Pyrus x bretschneideri]
 ref|XP_009348776.1| PREDICTED: uncharacterized protein At2g34160-like [Pyrus x bretschneideri]
Length=131

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV NI ++A D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNITVNASDSHKKNRIQVSNTKKPLFFYVNLAK  41



>ref|XP_009388523.1| PREDICTED: uncharacterized protein At2g34160-like [Musa acuminata 
subsp. malaccensis]
Length=131

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV N++I+A D  K NRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNVHITAADAHKSNRIQVSNTKKPLFFYVNLAK  41



>ref|XP_009343699.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At2g34160-like 
[Pyrus x bretschneideri]
 ref|XP_009343704.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At2g34160-like 
[Pyrus x bretschneideri]
Length=161

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  IVEANQESLMEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            + EA     MEE+T+GV NI I+A D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  22   VFEAXLSIAMEEVTDGVNNITINASDSHKKNRIQVSNTKKPLFFYVNLAK  71



>emb|CDY17226.1| BnaA05g09620D [Brassica napus]
Length=130

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT+GV N+N+ AGD QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITDGVNNMNL-AGDSQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_008339666.1| PREDICTED: uncharacterized protein At2g34160-like [Malus domestica]
Length=161

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT+GV NI I+A D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  31   MEEITDGVNNITINASDSHKKNRIQVSNTKKPLFFYVNLAK  71



>gb|KFK36323.1| hypothetical protein AALP_AA4G107800 [Arabis alpina]
Length=129

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT+GV+NIN+S  D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITDGVSNINLSV-DSQKKNRIQVSNTKKPLFFYVNLAK  40



>emb|CBI36290.3| unnamed protein product [Vitis vinifera]
Length=129

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITE V NINIS  DL KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEAVNNINIS--DLHKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_010549408.1| PREDICTED: uncharacterized protein At2g34160 isoform X2 [Tarenaya 
hassleriana]
Length=118

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV N+N+ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNMNL-AVDTQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_006295225.1| hypothetical protein CARUB_v10024310mg [Capsella rubella]
 gb|EOA28123.1| hypothetical protein CARUB_v10024310mg [Capsella rubella]
Length=130

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT+GV+N+N+ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITDGVSNMNL-ANDSQKKNRIQVSNTKKPLFFYVNLAK  40



>emb|CDY50840.1| BnaA10g28170D [Brassica napus]
Length=140

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = +2

Query  212  NQESLMEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            NQ   MEEIT+GV  +N+ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  19   NQHPWMEEITDGVNKMNL-AIDSQKKNRIQVSNTKKPLFFYVNLAK  63



>ref|XP_010097254.1| Uncharacterized protein L484_025803 [Morus notabilis]
 gb|EXB67321.1| Uncharacterized protein L484_025803 [Morus notabilis]
Length=129

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT+GV NINIS  D QK+NRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITDGVNNINIS--DSQKRNRIQVSNTKKPLFFYVNLAK  39



>ref|NP_564325.1| Alba DNA/RNA-binding protein [Arabidopsis thaliana]
 gb|AAF88114.1|AC021043_7 Unknown protein [Arabidopsis thaliana]
 gb|AAK97729.1| At1g29250/F28N24_8 [Arabidopsis thaliana]
 gb|AAL31130.1| At1g29250/F28N24_8 [Arabidopsis thaliana]
 gb|AAM63005.1| unknown [Arabidopsis thaliana]
 gb|AEE31065.1| Alba DNA/RNA-binding protein [Arabidopsis thaliana]
Length=130

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV N+N+ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNMNL-AVDTQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_010549407.1| PREDICTED: uncharacterized protein At2g34160 isoform X1 [Tarenaya 
hassleriana]
Length=130

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV N+N+ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNMNL-AVDTQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_010499438.1| PREDICTED: uncharacterized protein At2g34160-like [Camelina sativa]
 ref|XP_010460695.1| PREDICTED: uncharacterized protein At2g34160-like [Camelina sativa]
 ref|XP_010478281.1| PREDICTED: uncharacterized protein At2g34160-like [Camelina sativa]
Length=128

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV N+N+ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNMNL-AVDTQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_006303421.1| hypothetical protein CARUB_v10010630mg [Capsella rubella]
 gb|EOA36319.1| hypothetical protein CARUB_v10010630mg [Capsella rubella]
Length=130

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV N+N+ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNMNL-AVDTQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_002890797.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67056.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
Length=130

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV N+N+ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNMNL-AVDTQKKNRIQVSNTKKPLFFYVNLAK  40



>gb|KHN44168.1| Hypothetical protein glysoja_031829 [Glycine soja]
Length=133

 Score = 67.8 bits (164),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV NINI+  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEGITEGVNNININISDSYKKNRIQVSNTKKPLFFYVNLAK  41



>ref|NP_001238733.1| uncharacterized protein LOC100527358 [Glycine max]
 gb|ACU16443.1| unknown [Glycine max]
Length=133

 Score = 67.8 bits (164),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV NINI+  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEGITEGVNNININISDSYKKNRIQVSNTKKPLFFYVNLAK  41



>gb|KHF98816.1| hypothetical protein F383_17190 [Gossypium arboreum]
Length=132

 Score = 67.8 bits (164),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT+GV NIN++A D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITQGVNNINLAA-DSHKKNRIQVSNTKKPLFFYVNLAK  40



>ref|NP_565781.1| Alba DNA/RNA-binding protein [Arabidopsis thaliana]
 sp|O22969.1|Y2416_ARATH RecName: Full=Uncharacterized protein At2g34160 [Arabidopsis 
thaliana]
 gb|AAB67633.1| expressed protein [Arabidopsis thaliana]
 gb|AAM60985.1| unknown [Arabidopsis thaliana]
 dbj|BAC42164.1| unknown protein [Arabidopsis thaliana]
 gb|ABH04611.1| At2g34160 [Arabidopsis thaliana]
 gb|AEC08926.1| Alba DNA/RNA-binding protein [Arabidopsis thaliana]
Length=130

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT+GV N+N+ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITDGVNNMNL-ATDSQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_010469393.1| PREDICTED: uncharacterized protein At2g34160-like [Camelina sativa]
Length=130

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT+GV N+N+ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITDGVNNMNL-ATDSQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_010509790.1| PREDICTED: uncharacterized protein At2g34160 [Camelina sativa]
Length=130

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT+GV N+N+ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITDGVNNMNL-ATDSQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|NP_001236521.1| uncharacterized protein LOC100527472 [Glycine max]
 gb|ACU16564.1| unknown [Glycine max]
 gb|KHN22459.1| Hypothetical protein glysoja_024968 [Glycine soja]
Length=131

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME+ITEGV NINIS  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEDITEGVNNINIS--DSYKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_008784950.1| PREDICTED: uncharacterized protein At2g34160-like [Phoenix dactylifera]
Length=129

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV N++++  DL KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNLSVT--DLNKKNRIQVSNTKKPLFFYVNLAK  39



>ref|NP_001236789.1| uncharacterized protein LOC100305539 [Glycine max]
 gb|ACU13271.1| unknown [Glycine max]
Length=144

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 2/51 (4%)
 Frame = +2

Query  197  LIVEANQESLMEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            L+   +  + ME ITEGV NINIS  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  2    LLFSHSHTTAMEAITEGVNNINIS--DSYKKNRIQVSNTKKPLFFYVNLAK  50



>ref|XP_007013411.1| Alba DNA/RNA-binding protein [Theobroma cacao]
 gb|EOY31030.1| Alba DNA/RNA-binding protein [Theobroma cacao]
Length=130

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT+GV N+N+ A D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITQGVNNMNLGA-DSHKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_002879480.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55739.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
Length=130

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT+GV N+N+ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITDGVNNMNL-AVDSQKKNRIQVSNTKKPLFFYVNLAK  40



>emb|CDY07574.1| BnaC06g14900D [Brassica napus]
Length=108

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT+GV N+N+ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITDGVNNMNL-AVDSQKKNRIQVSNTKKPLFFYVNLAK  40



>emb|CDY30047.1| BnaC05g09730D [Brassica napus]
 emb|CDY07573.1| BnaC06g14910D [Brassica napus]
Length=108

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT+GV N+N+ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITDGVNNMNL-AVDSQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_004168112.1| PREDICTED: uncharacterized protein At2g34160-like [Cucumis sativus]
Length=129

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV +I ++A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNSITLTA-DSQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_004150019.1| PREDICTED: uncharacterized protein At2g34160-like [Cucumis sativus]
 ref|XP_008444017.1| PREDICTED: uncharacterized protein At2g34160-like [Cucumis melo]
 gb|KGN65316.1| hypothetical protein Csa_1G320340 [Cucumis sativus]
Length=130

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV +I ++A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNSITLTA-DSQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_009402892.1| PREDICTED: uncharacterized protein At2g34160-like [Musa acuminata 
subsp. malaccensis]
Length=127

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEI EGV N++I+A D  K NRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEIAEGVNNLHIAAPDSYKNNRIQVSNTKKPLFFYVNLAK  41



>ref|XP_006450953.1| hypothetical protein CICLE_v10009883mg [Citrus clementina]
 ref|XP_006475824.1| PREDICTED: uncharacterized protein At2g34160-like [Citrus sinensis]
 gb|ESR64193.1| hypothetical protein CICLE_v10009883mg [Citrus clementina]
 gb|KDO80280.1| hypothetical protein CISIN_1g032942mg [Citrus sinensis]
Length=130

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV N+N+ A D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNMNL-AVDANKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_009143800.1| PREDICTED: uncharacterized protein At2g34160 [Brassica rapa]
 emb|CDY63142.1| BnaCnng41440D [Brassica napus]
Length=130

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT+GV N+N+ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITDGVNNMNL-AVDSQKKNRIQVSNTKKPLFFYVNLAK  40



>emb|CDY43106.1| BnaC05g36710D [Brassica napus]
Length=113

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT+GV N+N+ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITDGVNNMNL-AVDSQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_006410557.1| hypothetical protein EUTSA_v10017416mg [Eutrema salsugineum]
 gb|ESQ52010.1| hypothetical protein EUTSA_v10017416mg [Eutrema salsugineum]
Length=126

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT GV N+N++  D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITAGVNNMNLAVDD-QKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_006410558.1| hypothetical protein EUTSA_v10017416mg [Eutrema salsugineum]
 gb|ESQ52011.1| hypothetical protein EUTSA_v10017416mg [Eutrema salsugineum]
Length=130

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT GV N+N++  D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITAGVNNMNLAVDD-QKKNRIQVSNTKKPLFFYVNLAK  40



>gb|KHN01341.1| Hypothetical protein glysoja_009547 [Glycine soja]
Length=134

 Score = 65.5 bits (158),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV NINIS  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEAITEGVNNINIS--DSYKKNRIQVSNTKKPLFFYVNLAK  39



>gb|KHN47771.1| Hypothetical protein glysoja_029189 [Glycine soja]
Length=133

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV NINIS  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEAITEGVNNINIS--DSYKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_010413770.1| PREDICTED: uncharacterized protein At2g34160-like [Camelina sativa]
Length=130

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT+GV ++N+ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITDGVNSMNL-ATDSQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_010250057.1| PREDICTED: uncharacterized protein At2g34160-like [Nelumbo nucifera]
 ref|XP_010250058.1| PREDICTED: uncharacterized protein At2g34160-like [Nelumbo nucifera]
Length=129

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TEGV N+ IS  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEVTEGVNNLAIS--DSHKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_004506910.1| PREDICTED: uncharacterized protein At2g34160-like [Cicer arietinum]
Length=133

 Score = 64.7 bits (156),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV NINIS  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEAITEGVNNINIS--DSIKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_007150730.1| hypothetical protein PHAVU_005G176200g [Phaseolus vulgaris]
 gb|ESW22724.1| hypothetical protein PHAVU_005G176200g [Phaseolus vulgaris]
Length=129

 Score = 64.7 bits (156),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV NINI+  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEAITEGVNNINIT--DSYKKNRIQVSNTKKPLFFYVNLAK  39



>gb|KFK44753.1| hypothetical protein AALP_AA1G298400 [Arabis alpina]
Length=130

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV N+++ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNMSL-AIDNQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_002285115.1| PREDICTED: uncharacterized protein At2g34160 [Vitis vinifera]
 emb|CBI28181.3| unnamed protein product [Vitis vinifera]
Length=130

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV ++NI+  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNSMNIA--DSHKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_006450468.1| hypothetical protein CICLE_v10009882mg [Citrus clementina]
 gb|ESR63708.1| hypothetical protein CICLE_v10009882mg [Citrus clementina]
Length=126

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  227  MEEITEGVTNINIS-AGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV NINIS A    KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEVITEGVNNINISDASAASKKNRIQVSNTKKPLFFYVNLAK  42



>ref|XP_006483339.1| PREDICTED: uncharacterized protein At2g34160-like [Citrus sinensis]
 gb|KDO61694.1| hypothetical protein CISIN_1g032962mg [Citrus sinensis]
Length=130

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  227  MEEITEGVTNINIS-AGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV NINIS A    KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEVITEGVNNINISDASAASKKNRIQVSNTKKPLFFYVNLAK  42



>ref|XP_006450467.1| hypothetical protein CICLE_v10009882mg [Citrus clementina]
 gb|ESR63707.1| hypothetical protein CICLE_v10009882mg [Citrus clementina]
Length=130

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  227  MEEITEGVTNINIS-AGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV NINIS A    KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEVITEGVNNINISDASAASKKNRIQVSNTKKPLFFYVNLAK  42



>ref|XP_009403457.1| PREDICTED: uncharacterized protein At2g34160-like [Musa acuminata 
subsp. malaccensis]
Length=129

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT+GV N++++A D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITDGVNNLSVTA-DSYKKNRIQVSNTKKPLFFYVNLAK  40



>emb|CAN60466.1| hypothetical protein VITISV_012496 [Vitis vinifera]
Length=161

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV ++NI+  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNSMNIA--DSHKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_009381121.1| PREDICTED: uncharacterized protein At2g34160-like [Musa acuminata 
subsp. malaccensis]
Length=129

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TEG+ N++++A D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEVTEGINNLSVNA-DSYKKNRIQVSNTKKPLFFYVNLAK  40



>pdb|1VM0|A Chain A, X-Ray Structure Of Gene Product From Arabidopsis Thaliana 
At2g34160
 pdb|1VM0|B Chain B, X-Ray Structure Of Gene Product From Arabidopsis Thaliana 
At2g34160
 pdb|2Q3V|A Chain A, Ensemble Refinement Of The Protein Crystal Structure 
Of Gene Product From Arabidopsis Thaliana At2g34160
 pdb|2Q3V|B Chain B, Ensemble Refinement Of The Protein Crystal Structure 
Of Gene Product From Arabidopsis Thaliana At2g34160
Length=130

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 1/40 (3%)
 Frame = +2

Query  230  EEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            EEIT+GV N N+ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  2    EEITDGVNNXNL-ATDSQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_010061927.1| PREDICTED: uncharacterized protein At2g34160-like [Eucalyptus 
grandis]
 gb|KCW68973.1| hypothetical protein EUGRSUZ_F02537 [Eucalyptus grandis]
Length=129

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TEG+ NI I+  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEVTEGINNIAIT--DSHKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_007215146.1| hypothetical protein PRUPE_ppa013322mg [Prunus persica]
 gb|EMJ16345.1| hypothetical protein PRUPE_ppa013322mg [Prunus persica]
Length=129

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV NI I+  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNIIIA--DSHKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_008243714.1| PREDICTED: uncharacterized protein At2g34160-like isoform X2 
[Prunus mume]
Length=129

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV NI I+  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNIIIA--DSHKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_010914880.1| PREDICTED: uncharacterized protein At2g34160-like [Elaeis guineensis]
Length=129

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV N++++  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNLSVT--DSNKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_010254376.1| PREDICTED: uncharacterized protein At2g34160-like [Nelumbo nucifera]
Length=129

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV NI I   D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNIAII--DSHKKNRIQVSNTKKPLFFYVNLAK  39



>emb|CDP10391.1| unnamed protein product [Coffea canephora]
Length=137

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 36/48 (75%), Gaps = 7/48 (15%)
 Frame = +2

Query  227  MEEITEGVTNINISAG-------DLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+T  V NINIS G       DL KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEVTAAVNNINISGGGGGGGGGDLHKKNRIQVSNTKKPLFFYVNLAK  48



>ref|XP_008792056.1| PREDICTED: uncharacterized protein At2g34160-like [Phoenix dactylifera]
Length=129

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV N+  S  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNL--SVADSNKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_007135740.1| hypothetical protein PHAVU_010G154500g [Phaseolus vulgaris]
 gb|ESW07734.1| hypothetical protein PHAVU_010G154500g [Phaseolus vulgaris]
Length=131

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV NINI+  +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEAITEGVNNINIT--EAYKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_008243713.1| PREDICTED: uncharacterized protein At2g34160-like isoform X1 
[Prunus mume]
Length=156

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV NI I+  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNNIIIA--DSHKKNRIQVSNTKKPLFFYVNLAK  39



>gb|ABK94195.1| unknown [Populus trichocarpa]
Length=133

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 3/44 (7%)
 Frame = +2

Query  227  MEEITEGVTNINISAG---DLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGVTN+NI+A       KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEGITEGVTNLNITAAADSGNNKKNRIQVSNTKKPLFFYVNLAK  44



>ref|XP_002324292.1| hypothetical protein POPTR_0018s01550g [Populus trichocarpa]
 gb|EEF02857.1| hypothetical protein POPTR_0018s01550g [Populus trichocarpa]
Length=133

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 3/44 (7%)
 Frame = +2

Query  227  MEEITEGVTNINISAG---DLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGVTN+NI+A       KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEGITEGVTNLNITAAADSGNNKKNRIQVSNTKKPLFFYVNLAK  44



>ref|XP_010538212.1| PREDICTED: uncharacterized protein At2g34160-like [Tarenaya hassleriana]
Length=130

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV  +N+ AGD  KKN IQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVNKMNL-AGDTYKKNLIQVSNTKKPLFFYVNLAK  40



>gb|EYU24652.1| hypothetical protein MIMGU_mgv1a016184mg [Erythranthe guttata]
Length=131

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV  INI+  D  KKNRIQVS+TKKPLFFYVNL+K
Sbjct  4    MEEITEGVNKINIA--DSPKKNRIQVSNTKKPLFFYVNLSK  42



>gb|KGN60668.1| hypothetical protein Csa_2G006140 [Cucumis sativus]
Length=100

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEI EGV +IN+S+ D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEIVEGVNSINLSS-DSFKKNRIQVSNTKKPLFFYVNLAK  40



>gb|KEH28695.1| alba DNA/RNA-binding protein [Medicago truncatula]
Length=133

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV N+NI+  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEAITEGVNNVNIT--DSIKKNRIQVSNTKKPLFFYVNLAK  39



>emb|CDY43326.1| BnaC03g58980D [Brassica napus]
Length=130

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV N+++ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEGITEGVNNMSL-AVDSQKKNRIQVSNTKKPLFFYVNLAK  40



>gb|AGS17822.1| hypothetical protein, partial [Elaeis guineensis]
Length=175

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 4/49 (8%)
 Frame = +2

Query  203  VEANQESLMEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            V AN    MEEITEGV N++++  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  17   VSANHP--MEEITEGVNNLSVT--DSNKKNRIQVSNTKKPLFFYVNLAK  61



>ref|XP_008457716.1| PREDICTED: uncharacterized protein At2g34160-like [Cucumis melo]
Length=131

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEI EGV +IN+S+ D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEIVEGVNSINLSS-DSFKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_004139317.1| PREDICTED: uncharacterized protein At2g34160-like [Cucumis sativus]
 ref|XP_004159379.1| PREDICTED: uncharacterized protein At2g34160-like [Cucumis sativus]
Length=131

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEI EGV +IN+S+ D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEIVEGVNSINLSS-DSFKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_009109679.1| PREDICTED: uncharacterized protein At2g34160-like [Brassica rapa]
 emb|CDX90176.1| BnaA08g18080D [Brassica napus]
Length=130

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV N+++ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEGITEGVNNMSL-AVDSQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_004302971.1| PREDICTED: uncharacterized protein At2g34160-like [Fragaria vesca 
subsp. vesca]
Length=136

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  233  EITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            EITE + N+NI+  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  6    EITEAMNNVNINNSDSHKKNRIQVSNTKKPLFFYVNLAK  44



>ref|XP_006415602.1| hypothetical protein EUTSA_v10009096mg [Eutrema salsugineum]
 gb|ESQ33955.1| hypothetical protein EUTSA_v10009096mg [Eutrema salsugineum]
Length=130

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV N+++ A D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEGITEGVNNMSL-AVDSQKKNRIQVSNTKKPLFFYVNLAK  40



>emb|CDY50785.1| BnaA09g54140D [Brassica napus]
Length=130

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV N+++   D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEGITEGVNNMSLGV-DTQKKNRIQVSNTKKPLFFYVNLAK  40



>gb|KHF98627.1| hypothetical protein F383_16439 [Gossypium arboreum]
Length=125

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME IT+GV NIN+ A D  KKNRIQVS++KKPLFFYVNLAK
Sbjct  1    MEAITQGVNNINM-ATDSHKKNRIQVSNSKKPLFFYVNLAK  40



>ref|XP_004968373.1| PREDICTED: uncharacterized protein At2g34160-like isoform X3 
[Setaria italica]
Length=134

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  224  LMEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ++EEITEGV N+++ AGD    NRIQVS+TKKPLFFYVNLAK
Sbjct  2    VVEEITEGVKNLSV-AGDAAASNRIQVSNTKKPLFFYVNLAK  42



>gb|EPS62998.1| hypothetical protein M569_11792, partial [Genlisea aurea]
Length=115

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME+ITEGV  I IS  + QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEQITEGVDKIKIS--ESQKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_006356205.1| PREDICTED: uncharacterized protein At2g34160-like isoform X2 
[Solanum tuberosum]
Length=94

 Score = 62.0 bits (149),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+ EGV+N+N+   D Q+KNRIQVS+TKKPLFFYVNL+K
Sbjct  1    MEELAEGVSNLNLV--DSQRKNRIQVSNTKKPLFFYVNLSK  39



>ref|XP_004241699.1| PREDICTED: uncharacterized protein At2g34160-like [Solanum lycopersicum]
Length=127

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+ EGV+N+N+   D QKKNRIQVS+TKKPLFFYVNL+K
Sbjct  1    MEELAEGVSNLNLV--DSQKKNRIQVSNTKKPLFFYVNLSK  39



>ref|XP_011026458.1| PREDICTED: uncharacterized protein At2g34160-like [Populus euphratica]
Length=133

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 3/44 (7%)
 Frame = +2

Query  227  MEEITEGVTNINIS-AGDL--QKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGVTN+NI+ A D    KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEGITEGVTNLNITVAADSGNNKKNRIQVSNTKKPLFFYVNLAK  44



>ref|XP_001768991.1| predicted protein [Physcomitrella patens]
 ref|XP_001769017.1| predicted protein [Physcomitrella patens]
 gb|EDQ66189.1| predicted protein [Physcomitrella patens]
 gb|EDQ66215.1| predicted protein [Physcomitrella patens]
Length=131

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITEGV ++++   D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITEGVADMSVY--DAHKKNRIQVSNTKKPLFFYVNLAK  39



>gb|ABK24162.1| unknown [Picea sitchensis]
 gb|ACN41069.1| unknown [Picea sitchensis]
Length=142

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  206  EANQESLMEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            E  ++  MEEI+EG+ N+N++  + QKKNRIQVS+TK+PLFFYVNLAK
Sbjct  6    EVPRKEAMEEISEGMANVNLNDNN-QKKNRIQVSNTKQPLFFYVNLAK  52



>dbj|BAJ98262.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96821.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=132

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TEGV N+ ++  + QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEVTEGVKNLAVT--EPQKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_010049985.1| PREDICTED: uncharacterized protein At2g34160-like [Eucalyptus 
grandis]
 gb|KCW82825.1| hypothetical protein EUGRSUZ_C04193 [Eucalyptus grandis]
Length=147

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 3/44 (7%)
 Frame = +2

Query  227  MEEITEGVTNINISAGD---LQKKNRIQVSSTKKPLFFYVNLAK  349
            ME+ITEGV++I ++ GD   ++K NRIQVS+TKKPLFFYVNLAK
Sbjct  3    MEQITEGVSSIALTDGDSSSVKKNNRIQVSNTKKPLFFYVNLAK  46



>gb|EAZ01574.1| hypothetical protein OsI_23607 [Oryza sativa Indica Group]
Length=61

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TE V+N++I+  +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEVTEAVSNLSIT--EPHKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_006356204.1| PREDICTED: uncharacterized protein At2g34160-like isoform X1 
[Solanum tuberosum]
Length=127

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+ EGV+N+N+   D Q+KNRIQVS+TKKPLFFYVNL+K
Sbjct  1    MEELAEGVSNLNLV--DSQRKNRIQVSNTKKPLFFYVNLSK  39



>gb|AFK38642.1| unknown [Lotus japonicus]
Length=135

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITE V NI+IS  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEAITEAVNNIDIS--DSYKKNRIQVSNTKKPLFFYVNLAK  39



>gb|AFK35646.1| unknown [Lotus japonicus]
Length=135

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITE V NI+IS  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEAITEAVNNIDIS--DSYKKNRIQVSNTKKPLFFYVNLAK  39



>gb|ABK22189.1| unknown [Picea sitchensis]
Length=132

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEITE V N++++  D+ KKNRIQVS+TKKPLFFYVNLAK
Sbjct  3    MEEITERVGNMDLN--DVHKKNRIQVSNTKKPLFFYVNLAK  41



>gb|KDP33611.1| hypothetical protein JCGZ_07182 [Jatropha curcas]
Length=131

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  227  MEEITEGVTNINIS-AGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV N+NI+      KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEGITEGVNNLNITDPASANKKNRIQVSNTKKPLFFYVNLAK  42



>ref|XP_002437246.1| hypothetical protein SORBIDRAFT_10g023460 [Sorghum bicolor]
 gb|EER88613.1| hypothetical protein SORBIDRAFT_10g023460 [Sorghum bicolor]
Length=129

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TEGV N+ I+  +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEVTEGVNNLAIT--EPHKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_004965953.1| PREDICTED: uncharacterized protein At2g34160-like [Setaria italica]
Length=130

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TEGV N+ I+  +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEVTEGVNNLAIT--EPHKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_002285046.1| PREDICTED: uncharacterized protein At2g34160 [Vitis vinifera]
 emb|CBI21021.3| unnamed protein product [Vitis vinifera]
Length=130

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME +TEGV  +NIS   L KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MENLTEGVNKLNISDSSL-KKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_007013844.1| Alba DNA/RNA-binding protein [Theobroma cacao]
 gb|EOY31463.1| Alba DNA/RNA-binding protein [Theobroma cacao]
Length=130

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQ-KKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV N+NI+      KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEGITEGVNNLNITDSSASNKKNRIQVSNTKKPLFFYVNLAK  42



>ref|XP_009115263.1| PREDICTED: uncharacterized protein At2g34160-like [Brassica rapa]
Length=130

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV N+++   D QKKNRI+VS+TKKPLFFYVNLAK
Sbjct  1    MEGITEGVNNMSLGV-DTQKKNRIKVSNTKKPLFFYVNLAK  40



>ref|XP_009102872.1| PREDICTED: uncharacterized protein At2g34160-like [Brassica rapa]
 emb|CDY15644.1| BnaA07g08150D [Brassica napus]
Length=130

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV ++++   D QKKNRIQVS TKKPLFFYVNLAK
Sbjct  1    MEGITEGVNSMSLGV-DTQKKNRIQVSHTKKPLFFYVNLAK  40



>ref|XP_002515535.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46984.1| conserved hypothetical protein [Ricinus communis]
Length=128

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME +TEGV N+NI+     KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEAVTEGVNNMNINDAS-NKKNRIQVSNTKKPLFFYVNLAK  40



>emb|CDX99800.1| BnaC05g22220D [Brassica napus]
Length=130

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV ++++   D QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEGITEGVKSMSLGV-DTQKKNRIQVSNTKKPLFFYVNLAK  40



>ref|XP_006647046.1| PREDICTED: uncharacterized protein At2g34160-like [Oryza brachyantha]
Length=138

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 34/45 (76%), Gaps = 4/45 (9%)
 Frame = +2

Query  227  MEEITEGVTNINISAG----DLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TE V N+ I  G    +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEVTEAVGNLAIEGGAAGAEAHKKNRIQVSNTKKPLFFYVNLAK  45



>ref|NP_001058008.1| Os06g0602600 [Oryza sativa Japonica Group]
 dbj|BAD35458.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF19922.1| Os06g0602600 [Oryza sativa Japonica Group]
 gb|EAZ01577.1| hypothetical protein OsI_23611 [Oryza sativa Indica Group]
 gb|EAZ37563.1| hypothetical protein OsJ_21893 [Oryza sativa Japonica Group]
 dbj|BAH00577.1| unnamed protein product [Oryza sativa Japonica Group]
Length=132

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TE V+N++I+  +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEVTEAVSNLSIT--EPHKKNRIQVSNTKKPLFFYVNLAK  39



>gb|EMT03371.1| hypothetical protein F775_28656 [Aegilops tauschii]
Length=132

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TEGV N+ ++  +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEVTEGVKNLAVT--EPHKKNRIQVSNTKKPLFFYVNLAK  39



>emb|CBI17465.3| unnamed protein product [Vitis vinifera]
Length=211

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            +EEIT+GV N+NI+  D  KKN+IQVS+TKKPLFFYVNLAK
Sbjct  74   VEEITKGVNNMNIA--DSHKKNQIQVSNTKKPLFFYVNLAK  112



>emb|CDO98136.1| unnamed protein product [Coffea canephora]
Length=140

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 2/43 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAG--DLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT+GV NINI+    DLQKKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEITDGVNNININNSNNDLQKKNRIQVSNTKKPLFFYVNLAK  43



>ref|XP_006837817.1| hypothetical protein AMTR_s00104p00132470 [Amborella trichopoda]
 gb|ERN00386.1| hypothetical protein AMTR_s00104p00132470 [Amborella trichopoda]
Length=132

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            +EE+TE V+N+++S  +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  4    IEEVTEAVSNLHVS--ESHKKNRIQVSNTKKPLFFYVNLAK  42



>emb|CDX94654.1| BnaC07g10040D [Brassica napus]
Length=130

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV ++++   D QKK+RIQVS TKKPLFFYVNLAK
Sbjct  1    MEGITEGVNSMSLGV-DTQKKSRIQVSHTKKPLFFYVNLAK  40



>emb|CDY15643.1| BnaA07g08140D [Brassica napus]
Length=130

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV ++++   D QKK+RIQVS TKKPLFFYVNLAK
Sbjct  1    MEGITEGVNSMSLGV-DTQKKSRIQVSHTKKPLFFYVNLAK  40



>ref|XP_003563670.1| PREDICTED: uncharacterized protein At2g34160-like [Brachypodium 
distachyon]
Length=132

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TE V N+ I+  +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEVTEAVNNLAIT--EPHKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_009785780.1| PREDICTED: uncharacterized protein At2g34160-like [Nicotiana 
sylvestris]
Length=127

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV N+++S    QKKNRIQVS+TK+ LFFYVNLAK
Sbjct  1    MEGITEGVNNMSVSEIQNQKKNRIQVSNTKRSLFFYVNLAK  41



>gb|AFW87068.1| hypothetical protein ZEAMMB73_637233 [Zea mays]
Length=122

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TEGV N+ I+  + Q KN+IQVS+TKKPLFFYVNLAK
Sbjct  14   MEELTEGVNNLAIT--EPQMKNKIQVSNTKKPLFFYVNLAK  52



>ref|XP_009408969.1| PREDICTED: uncharacterized protein At2g34160-like [Musa acuminata 
subsp. malaccensis]
Length=128

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME+ITEGV N++++A D  K+NRI VS+TKKPLFFYVNLAK
Sbjct  1    MEQITEGVNNLSVAA-DSFKENRILVSNTKKPLFFYVNLAK  40



>ref|XP_008659718.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At2g34160-like 
[Zea mays]
Length=129

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TEGV N+ I+  + Q KN+IQVS+TKKPLFFYVNLAK
Sbjct  1    MEELTEGVNNLAIT--EPQMKNKIQVSNTKKPLFFYVNLAK  39



>ref|XP_011081297.1| PREDICTED: uncharacterized protein At2g34160-like [Sesamum indicum]
Length=127

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEI +G+  +NI+  + QKKNRIQVS+TKKPLFFYVNL+K
Sbjct  1    MEEIADGLNKMNIA--ESQKKNRIQVSNTKKPLFFYVNLSK  39



>ref|XP_010925231.1| PREDICTED: uncharacterized protein At2g34160-like [Elaeis guineensis]
Length=133

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 2/43 (5%)
 Frame = +2

Query  227  MEEITEGVTNINI--SAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            M+ ITEGV N+++  S  D  K+NRIQVS+TKKPLFFYVNLAK
Sbjct  1    MDAITEGVNNLSVTDSNTDSNKENRIQVSNTKKPLFFYVNLAK  43



>ref|XP_010688018.1| PREDICTED: uncharacterized protein At2g34160-like [Beta vulgaris 
subsp. vulgaris]
Length=132

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            +E+ITEGV N+++   D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  4    VEQITEGVNNLSVI--DSGKKNRIQVSNTKKPLFFYVNLAK  42



>ref|XP_002873188.1| hypothetical protein ARALYDRAFT_487296 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49447.1| hypothetical protein ARALYDRAFT_487296 [Arabidopsis lyrata subsp. 
lyrata]
Length=200

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEEIT GV N+N+ A D QKK+RIQ+S+TKK LFFYVNLAK
Sbjct  99   MEEITNGVNNMNL-AVDSQKKSRIQISNTKKRLFFYVNLAK  138



>ref|NP_001143331.1| uncharacterized protein LOC100275927 [Zea mays]
 gb|ACG30858.1| hypothetical protein [Zea mays]
 gb|ACR37059.1| unknown [Zea mays]
 gb|AFW66116.1| (uaz270(357)), mRNA [Zea mays]
Length=139

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 8/49 (16%)
 Frame = +2

Query  227  MEEITEGVTNINISAG--------DLQKKNRIQVSSTKKPLFFYVNLAK  349
            M+E+TE V N+NIS          +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MDEVTEAVNNLNISGVGAAGVAGAEGHKKNRIQVSNTKKPLFFYVNLAK  49



>ref|XP_011039708.1| PREDICTED: uncharacterized protein At2g34160-like [Populus euphratica]
Length=134

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 33/45 (73%), Gaps = 4/45 (9%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQ----KKNRIQVSSTKKPLFFYVNLAK  349
            ME ITE V N+NI+         KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEVITEAVNNLNIAGATTDSANNKKNRIQVSNTKKPLFFYVNLAK  45



>ref|XP_006656212.1| PREDICTED: uncharacterized protein At2g34160-like [Oryza brachyantha]
Length=132

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TE V ++  S  +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEVTEAVNSL--SLAEAHKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_008219479.1| PREDICTED: uncharacterized protein At2g34160-like [Prunus mume]
Length=136

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQ-KKNRIQVSSTKKPLFFYVNLAK  349
            ME +TEGV N+ I+      KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEGVTEGVNNLQITDSSYNNKKNRIQVSNTKKPLFFYVNLAK  42



>ref|XP_009771917.1| PREDICTED: uncharacterized protein At2g34160-like [Nicotiana 
sylvestris]
Length=127

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV NI+++  + QKKNRIQVS+TKK LFFYVNL+K
Sbjct  1    MEGITEGVKNISVT--ETQKKNRIQVSNTKKSLFFYVNLSK  39



>ref|XP_002308658.1| hypothetical protein POPTR_0006s26820g [Populus trichocarpa]
 gb|ABK95401.1| unknown [Populus trichocarpa]
 gb|EEE92181.1| hypothetical protein POPTR_0006s26820g [Populus trichocarpa]
Length=136

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 36/49 (73%), Gaps = 10/49 (20%)
 Frame = +2

Query  227  MEEITEGVTNINI--------SAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV N+NI        SA +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEVITEGVNNLNIAAAAATTDSANN--KKNRIQVSNTKKPLFFYVNLAK  47



>ref|XP_009606374.1| PREDICTED: uncharacterized protein At2g34160-like [Nicotiana 
tomentosiformis]
Length=127

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV ++++S    QKKNRIQVS+TK+ LFFYVNLAK
Sbjct  1    MEGITEGVNSMSVSEIQNQKKNRIQVSNTKRSLFFYVNLAK  41



>ref|XP_008366692.1| PREDICTED: uncharacterized protein At2g34160-like [Malus domestica]
Length=133

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDL-QKKNRIQVSSTKKPLFFYVNLAK  349
            ME + EGV N+ I+     +KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEGLAEGVNNLRITDASYNKKKNRIQVSNTKKPLFFYVNLAK  42



>ref|XP_002453505.1| hypothetical protein SORBIDRAFT_04g007020 [Sorghum bicolor]
 gb|EES06481.1| hypothetical protein SORBIDRAFT_04g007020 [Sorghum bicolor]
Length=141

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 10/51 (20%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDL----------QKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TE V N++IS G             KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEVTEAVNNLSISGGGATAGAGAGAEGHKKNRIQVSNTKKPLFFYVNLAK  51



>ref|XP_007225832.1| hypothetical protein PRUPE_ppa011574mg [Prunus persica]
 gb|EMJ27031.1| hypothetical protein PRUPE_ppa011574mg [Prunus persica]
Length=205

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQ-KKNRIQVSSTKKPLFFYVNLAK  349
            M+ +TEGV N+ I+      KKNRIQVS+TKKPLFFYVNLAK
Sbjct  70   MDGVTEGVNNLQITDSSYNNKKNRIQVSNTKKPLFFYVNLAK  111



>ref|XP_004951528.1| PREDICTED: uncharacterized protein At2g34160-like [Setaria italica]
Length=143

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 36/53 (68%), Gaps = 12/53 (23%)
 Frame = +2

Query  227  MEEITEGVTNINISAG------------DLQKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TE V N++IS G            +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEVTEAVNNLSISGGGAAAAAADDAGAEGHKKNRIQVSNTKKPLFFYVNLAK  53



>ref|XP_009627569.1| PREDICTED: uncharacterized protein At2g34160-like [Nicotiana 
tomentosiformis]
Length=127

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV NI+++  +  KKNRIQVS+TKK LFFYVNL+K
Sbjct  1    MEGITEGVKNISVT--ETHKKNRIQVSNTKKSLFFYVNLSK  39



>ref|XP_007030533.1| Alba DNA/RNA-binding protein [Theobroma cacao]
 gb|EOY11035.1| Alba DNA/RNA-binding protein [Theobroma cacao]
Length=125

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  245  GVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
             V  +  + GD QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  2    AVETVAAAEGDAQKKNRIQVSNTKKPLFFYVNLAK  36



>dbj|BAJ87819.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=139

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 34/48 (71%), Gaps = 7/48 (15%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDL-------QKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TE V N+ I+ G          KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEVTEAVNNLTIAEGAAATAGAEGHKKNRIQVSNTKKPLFFYVNLAK  48



>gb|EMT17314.1| hypothetical protein F775_31902 [Aegilops tauschii]
Length=164

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 34/48 (71%), Gaps = 7/48 (15%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDL-------QKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TE V N+ I+ G          KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEVTEAVNNLTIAEGAAATAGAEGHKKNRIQVSNTKKPLFFYVNLAK  48



>ref|XP_004241771.1| PREDICTED: uncharacterized protein At2g34160 [Solanum lycopersicum]
Length=128

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV  +++S  + QKKNRIQVS+TKK LFFYVNL+K
Sbjct  1    MEGITEGVNKMSVS--ETQKKNRIQVSNTKKSLFFYVNLSK  39



>ref|XP_006353694.1| PREDICTED: uncharacterized protein At2g34160-like [Solanum tuberosum]
Length=128

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV  +++S  + QKKNRIQVS+TKK LFFYVNL+K
Sbjct  1    MEGITEGVNKMSVS--ETQKKNRIQVSNTKKSLFFYVNLSK  39



>ref|XP_006353679.1| PREDICTED: uncharacterized protein At2g34160-like [Solanum tuberosum]
Length=128

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV  +++S  + QKKNRIQVS+TKK LFFYVNL+K
Sbjct  1    MEGITEGVNKMSVS--ETQKKNRIQVSNTKKSLFFYVNLSK  39



>emb|CDP13492.1| unnamed protein product [Coffea canephora]
Length=130

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV  +N++    QK+NRIQVS+TKK LFFYVNLAK
Sbjct  1    MEGITEGVKKVNLNET-TQKRNRIQVSNTKKSLFFYVNLAK  40



>ref|XP_003571486.1| PREDICTED: uncharacterized protein At2g34160-like [Brachypodium 
distachyon]
Length=143

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 35/52 (67%), Gaps = 11/52 (21%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDL-----------QKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TE V N++I+ G              KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEVTEAVNNLSIAEGAAGAAAAAPGAEGHKKNRIQVSNTKKPLFFYVNLAK  52



>dbj|BAD15498.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEC72700.1| hypothetical protein OsI_06285 [Oryza sativa Indica Group]
 gb|EEE56518.1| hypothetical protein OsJ_05802 [Oryza sativa Japonica Group]
Length=145

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 36/51 (71%), Gaps = 10/51 (20%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDL----------QKKNRIQVSSTKKPLFFYVNLAK  349
            MEE+TE V N+ I+AG+            KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEEVTEAVGNLTIAAGEAAGAGGGAAEAHKKNRIQVSNTKKPLFFYVNLAK  51



>ref|XP_004241781.1| PREDICTED: uncharacterized protein At2g34160 [Solanum lycopersicum]
Length=128

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME IT+GV  +++S  + QKKNRIQVS+TKK LFFYVNL+K
Sbjct  1    MEGITDGVNKMSVS--ETQKKNRIQVSNTKKSLFFYVNLSK  39



>ref|XP_003597872.1| hypothetical protein MTR_2g103500 [Medicago truncatula]
 gb|AES68123.1| alba DNA/RNA-binding protein [Medicago truncatula]
 gb|AFK35428.1| unknown [Medicago truncatula]
Length=136

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 3/44 (7%)
 Frame = +2

Query  227  MEEITEGVTNINISA---GDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV NINI+     D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEGITEGVNNININNNNNSDSYKKNRIQVSNTKKPLFFYVNLAK  44



>gb|ABK26422.1| unknown [Picea sitchensis]
Length=154

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 8/49 (16%)
 Frame = +2

Query  227  MEEITEGVTNINISA--------GDLQKKNRIQVSSTKKPLFFYVNLAK  349
            +EE+TEG+  + ++A         +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  15   VEEVTEGMEKLKVAAINNNNAVSNENYKKNRIQVSNTKKPLFFYVNLAK  63



>ref|XP_009111898.1| PREDICTED: uncharacterized protein At2g34160-like isoform X2 
[Brassica rapa]
Length=152

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 3/41 (7%)
 Frame = +2

Query  236  ITEGVTNINISAG---DLQKKNRIQVSSTKKPLFFYVNLAK  349
            +T   +N+ ISA    + QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  13   VTSPASNLIISATTAVETQKKNRIQVSNTKKPLFFYVNLAK  53



>ref|XP_009111897.1| PREDICTED: uncharacterized protein At2g34160-like isoform X1 
[Brassica rapa]
Length=154

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 3/41 (7%)
 Frame = +2

Query  236  ITEGVTNINISAG---DLQKKNRIQVSSTKKPLFFYVNLAK  349
            +T   +N+ ISA    + QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  13   VTSPASNLIISATTAVETQKKNRIQVSNTKKPLFFYVNLAK  53



>emb|CDY00026.1| BnaC09g02750D [Brassica napus]
Length=123

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 3/41 (7%)
 Frame = +2

Query  236  ITEGVTNINISAG---DLQKKNRIQVSSTKKPLFFYVNLAK  349
            +T   +N+ ISA    + QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  13   VTSPASNLIISATTAVETQKKNRIQVSNTKKPLFFYVNLAK  53



>ref|XP_010550911.1| PREDICTED: uncharacterized protein At2g34160 [Tarenaya hassleriana]
Length=143

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  260  NISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            N+ A + QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  20   NVVAAENQKKNRIQVSNTKKPLFFYVNLAK  49



>emb|CDY57017.1| BnaA09g03470D [Brassica napus]
Length=123

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 3/41 (7%)
 Frame = +2

Query  236  ITEGVTNINISAG---DLQKKNRIQVSSTKKPLFFYVNLAK  349
            +T   +N+ ISA    + QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  13   VTSPASNLIISATTAVETQKKNRIQVSNTKKPLFFYVNLAK  53



>ref|XP_004486682.1| PREDICTED: uncharacterized protein At2g34160-like isoform X2 
[Cicer arietinum]
Length=134

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISA-GDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEG+ NINI+   D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEGITEGLNNININNNSDSYKKNRIQVSNTKKPLFFYVNLAK  42



>ref|XP_004486681.1| PREDICTED: uncharacterized protein At2g34160-like isoform X1 
[Cicer arietinum]
Length=136

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISA-GDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEG+ NINI+   D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEGITEGLNNININNNSDSYKKNRIQVSNTKKPLFFYVNLAK  42



>gb|AFK40867.1| unknown [Lotus japonicus]
Length=136

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 35/43 (81%), Gaps = 2/43 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAG--DLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV NINIS    D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEAITEGVNNINISTNNNDSFKKNRIQVSNTKKPLFFYVNLAK  43



>ref|XP_006395024.1| hypothetical protein EUTSA_v10005588mg [Eutrema salsugineum]
 gb|ESQ32310.1| hypothetical protein EUTSA_v10005588mg [Eutrema salsugineum]
Length=159

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 3/41 (7%)
 Frame = +2

Query  236  ITEGVTNINISAG---DLQKKNRIQVSSTKKPLFFYVNLAK  349
            +T   +NI +SA    + QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  13   VTSPASNILLSATTVVETQKKNRIQVSNTKKPLFFYVNLAK  53



>ref|XP_003535371.1| PREDICTED: uncharacterized protein At2g34160-like [Glycine max]
 gb|KHN14838.1| Hypothetical protein glysoja_021011 [Glycine soja]
Length=132

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +2

Query  263  ISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ++A D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  10   LTANDSHKKNRIQVSNTKKPLFFYVNLAK  38



>gb|AGT16645.1| hypothetical protein SHCRBa_170_C07_R_130 [Saccharum hybrid cultivar 
R570]
Length=147

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 35/56 (63%), Gaps = 15/56 (27%)
 Frame = +2

Query  224  LMEEITEGVTNINISAGD--------------LQKKNRIQVSSTKKPLFFYVNLAK  349
            ++EEITEGV N+ + AGD                  NRIQVS+TKKPLFFYVNLAK
Sbjct  2    VVEEITEGVKNLAV-AGDAAAVSGGEGQRRGGGGSSNRIQVSNTKKPLFFYVNLAK  56



>ref|XP_010672114.1| PREDICTED: uncharacterized protein At2g34160-like [Beta vulgaris 
subsp. vulgaris]
Length=174

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +2

Query  200  IVEANQESLMEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            +V+A     M+ + E + ++ I+  D+ KKNRIQVS+TKKPLFFY+NLAK
Sbjct  16   VVQALVSDSMDMVAESLASVKINE-DVHKKNRIQVSNTKKPLFFYLNLAK  64



>gb|KHF97780.1| hypothetical protein F383_15777 [Gossypium arboreum]
Length=134

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 4/45 (9%)
 Frame = +2

Query  227  MEEITEGVTNINI----SAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ME ITEGV N+NI     + +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEGITEGVNNLNIMDSSPSNNNNKKNRIQVSNTKKPLFFYVNLAK  45



>ref|XP_010526208.1| PREDICTED: uncharacterized protein At2g34160-like [Tarenaya hassleriana]
Length=126

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 3/41 (7%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            M  + EG+  ++I+     KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MAAVVEGMQKLSIADA---KKNRIQVSNTKKPLFFYVNLAK  38



>ref|XP_010519975.1| PREDICTED: uncharacterized protein At2g34160-like [Tarenaya hassleriana]
Length=161

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +2

Query  266  SAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            +A + QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  28   AAAENQKKNRIQVSNTKKPLFFYVNLAK  55



>ref|XP_008456222.1| PREDICTED: uncharacterized protein At2g34160 [Cucumis melo]
Length=142

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  269  AGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            A + QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  12   ATETQKKNRIQVSNTKKPLFFYVNLAK  38



>ref|XP_004291467.1| PREDICTED: uncharacterized protein At2g34160-like [Fragaria vesca 
subsp. vesca]
Length=134

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 5/46 (11%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKN-----RIQVSSTKKPLFFYVNLAK  349
            ME +TE V +++++     KKN     RIQVS+TKKPLFFYVNLAK
Sbjct  1    MEGLTEAVNDMHVTESAANKKNHRLQNRIQVSNTKKPLFFYVNLAK  46



>ref|XP_004139384.1| PREDICTED: uncharacterized protein At2g34160-like [Cucumis sativus]
 ref|XP_004173075.1| PREDICTED: uncharacterized protein At2g34160-like [Cucumis sativus]
 gb|KGN60788.1| hypothetical protein Csa_2G010240 [Cucumis sativus]
Length=143

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  269  AGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            A + QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  13   ATETQKKNRIQVSNTKKPLFFYVNLAK  39



>ref|XP_001769016.1| predicted protein [Physcomitrella patens]
 gb|EDQ66214.1| predicted protein [Physcomitrella patens]
Length=121

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  263  ISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            +S  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MSVYDAHKKNRIQVSNTKKPLFFYVNLAK  29



>ref|XP_004968371.1| PREDICTED: uncharacterized protein At2g34160-like isoform X1 
[Setaria italica]
Length=152

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 35/59 (59%), Gaps = 17/59 (29%)
 Frame = +2

Query  224  LMEEITEGVTNINIS-----------------AGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ++EEITEGV N++++                  G     NRIQVS+TKKPLFFYVNLAK
Sbjct  2    VVEEITEGVKNLSVAGDAAASGAGNGGEGQKRGGSGGSSNRIQVSNTKKPLFFYVNLAK  60



>ref|XP_002521944.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40348.1| conserved hypothetical protein [Ricinus communis]
Length=153

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  260  NISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            N +A   QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  35   NNAAQTQQKKNRIQVSNTKKPLFFYVNLAK  64



>ref|XP_004968372.1| PREDICTED: uncharacterized protein At2g34160-like isoform X2 
[Setaria italica]
Length=138

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 35/59 (59%), Gaps = 17/59 (29%)
 Frame = +2

Query  224  LMEEITEGVTNINIS-----------------AGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ++EEITEGV N++++                  G     NRIQVS+TKKPLFFYVNLAK
Sbjct  2    VVEEITEGVKNLSVAGDAAASGAGNGGEGQKRGGSGGSSNRIQVSNTKKPLFFYVNLAK  60



>ref|XP_010525972.1| PREDICTED: uncharacterized protein At2g34160-like [Tarenaya hassleriana]
Length=125

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 3/41 (7%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            M  + EG+  ++I+     +KNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MAAVIEGMKKLSIADA---RKNRIQVSNTKKPLFFYVNLAK  38



>ref|XP_008394068.1| PREDICTED: uncharacterized protein At2g34160-like [Malus domestica]
Length=138

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 2/43 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQK--KNRIQVSSTKKPLFFYVNLAK  349
            ME + E V N+ I+     K  KNRIQVS+TKKP+FFYVNLAK
Sbjct  1    MEGLAEEVNNLQITDASYNKNNKNRIQVSNTKKPVFFYVNLAK  43



>ref|XP_009348607.1| PREDICTED: uncharacterized protein At2g34160-like [Pyrus x bretschneideri]
Length=135

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 2/43 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQK--KNRIQVSSTKKPLFFYVNLAK  349
            ME + E V N+ I+     K  KNRIQVS+TKKP+FFYVNLAK
Sbjct  1    MEGLAEEVNNLQITDASYNKNNKNRIQVSNTKKPVFFYVNLAK  43



>ref|XP_004495605.1| PREDICTED: uncharacterized protein At2g34160-like isoform X1 
[Cicer arietinum]
 ref|XP_004495606.1| PREDICTED: uncharacterized protein At2g34160-like isoform X2 
[Cicer arietinum]
Length=135

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  260  NISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            N +  D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  15   NGNGNDSHKKNRIQVSNTKKPLFFYVNLAK  44



>ref|NP_001141319.1| uncharacterized protein LOC100273410 [Zea mays]
 gb|ACF86067.1| unknown [Zea mays]
 gb|ACG48793.1| hypothetical protein [Zea mays]
 tpg|DAA53234.1| TPA: hypothetical protein ZEAMMB73_180985 [Zea mays]
Length=146

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 14/55 (25%)
 Frame = +2

Query  224  LMEEITEGVTNINISAGD-------------LQKKNRIQVSSTKKPLFFYVNLAK  349
            ++EEI EGV N+ ++ GD                 NRIQVS+TKKPLFFYVNLAK
Sbjct  2    VVEEIAEGVKNLTVT-GDAAASGGEGQRRGGGGSSNRIQVSNTKKPLFFYVNLAK  55



>ref|NP_001288491.1| uncharacterized protein LOC103649688 [Zea mays]
 gb|ACF79101.1| unknown [Zea mays]
 gb|ACR38281.1| unknown [Zea mays]
 tpg|DAA53231.1| TPA: hypothetical protein ZEAMMB73_528502 [Zea mays]
Length=146

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 14/55 (25%)
 Frame = +2

Query  224  LMEEITEGVTNINISAGDL-------------QKKNRIQVSSTKKPLFFYVNLAK  349
            ++EEI EGV N+ ++ GD                 NRIQVS+TKKPLFFYVNLAK
Sbjct  2    VVEEIAEGVKNLTVT-GDAAASGGEGQRRGGGGSSNRIQVSNTKKPLFFYVNLAK  55



>ref|NP_001281224.1| LOC100284257 [Zea mays]
 gb|ACG39714.1| hypothetical protein [Zea mays]
Length=146

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 14/55 (25%)
 Frame = +2

Query  224  LMEEITEGVTNINISAGD-------------LQKKNRIQVSSTKKPLFFYVNLAK  349
            ++EEI EGV N+ ++ GD                 NRIQVS+TKKPLFFYVNLAK
Sbjct  2    VVEEIAEGVKNLTVT-GDAAASGGEGQRRGGGGSSNRIQVSNTKKPLFFYVNLAK  55



>ref|XP_002319085.2| hypothetical protein POPTR_0013s04020g [Populus trichocarpa]
 gb|EEE95008.2| hypothetical protein POPTR_0013s04020g [Populus trichocarpa]
Length=157

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  242  EGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            E V N    A   QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  27   ETVNNDTAIALAQQKKNRIQVSNTKKPLFFYVNLAK  62



>emb|CDO99171.1| unnamed protein product [Coffea canephora]
Length=110

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDL-QKKNRIQVSSTKKPLFFYVNLAK  349
            ME  T   +N N S  D  QKKNRIQVS+TK+PLFFY+NLAK
Sbjct  1    MENNTATKSNENNSTKDQNQKKNRIQVSNTKRPLFFYLNLAK  42



>gb|KHG14530.1| hypothetical protein F383_02218 [Gossypium arboreum]
Length=130

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  275  DLQKKNRIQVSSTKKPLFFYVNLAK  349
            + QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  17   EAQKKNRIQVSNTKKPLFFYVNLAK  41



>gb|KEH43002.1| alba DNA/RNA-binding protein [Medicago truncatula]
Length=130

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +2

Query  266  SAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            +A +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  11   TANESHKKNRIQVSNTKKPLFFYVNLAK  38



>ref|XP_007206133.1| hypothetical protein PRUPE_ppa013191mg [Prunus persica]
 ref|XP_008218286.1| PREDICTED: uncharacterized protein At2g34160 [Prunus mume]
 gb|EMJ07332.1| hypothetical protein PRUPE_ppa013191mg [Prunus persica]
Length=135

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  275  DLQKKNRIQVSSTKKPLFFYVNLAK  349
            D  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  20   DAAKKNRIQVSNTKKPLFFYVNLAK  44



>ref|XP_011038549.1| PREDICTED: uncharacterized protein At2g34160-like [Populus euphratica]
Length=149

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  281  QKKNRIQVSSTKKPLFFYVNLAK  349
            QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  32   QKKNRIQVSNTKKPLFFYVNLAK  54



>ref|NP_001142884.1| uncharacterized protein LOC100275297 [Zea mays]
 gb|ACG27306.1| hypothetical protein [Zea mays]
Length=146

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 33/53 (62%), Gaps = 14/53 (26%)
 Frame = +2

Query  230  EEITEGVTNINISAGDLQ-------------KKNRIQVSSTKKPLFFYVNLAK  349
            EEITEG+ N+ ++ GD                 NRIQVS+TKKPLFFYVNLAK
Sbjct  4    EEITEGLKNLTVT-GDAAASGGEGQRRGGGISSNRIQVSNTKKPLFFYVNLAK  55



>ref|XP_011032375.1| PREDICTED: uncharacterized protein At2g34160 [Populus euphratica]
Length=150

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  281  QKKNRIQVSSTKKPLFFYVNLAK  349
            QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  35   QKKNRIQVSNTKKPLFFYVNLAK  57



>gb|ACN31274.1| unknown [Zea mays]
 gb|AFW80169.1| hypothetical protein ZEAMMB73_176081 [Zea mays]
Length=146

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 33/53 (62%), Gaps = 14/53 (26%)
 Frame = +2

Query  230  EEITEGVTNINISAGDLQ-------------KKNRIQVSSTKKPLFFYVNLAK  349
            EEITEG+ N+ ++ GD                 NRIQVS+TKKPLFFYVNLAK
Sbjct  4    EEITEGLKNLTVT-GDAAASGGEGQRRGGGISSNRIQVSNTKKPLFFYVNLAK  55



>emb|CDX86203.1| BnaA06g29200D [Brassica napus]
Length=155

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 4/37 (11%)
 Frame = +2

Query  251  TNINISAG----DLQKKNRIQVSSTKKPLFFYVNLAK  349
            TN+ +SA     +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  18   TNLIVSATTTAVETHKKNRIQVSNTKKPLFFYVNLAK  54



>ref|XP_009151257.1| PREDICTED: uncharacterized protein At2g34160-like [Brassica rapa]
Length=160

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 4/37 (11%)
 Frame = +2

Query  251  TNINISAG----DLQKKNRIQVSSTKKPLFFYVNLAK  349
            TN+ +SA     +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  18   TNLIVSATTTAVETHKKNRIQVSNTKKPLFFYVNLAK  54



>ref|XP_004304756.1| PREDICTED: uncharacterized protein At2g34160-like [Fragaria vesca 
subsp. vesca]
Length=157

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  281  QKKNRIQVSSTKKPLFFYVNLAK  349
            QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  43   QKKNRIQVSNTKKPLFFYVNLAK  65



>gb|EMT05887.1| hypothetical protein F775_20281 [Aegilops tauschii]
Length=138

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +2

Query  251  TNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
             +I   AG   KKNRIQVS+ KKPL+FYVNLAK
Sbjct  68   ADIEAEAGVSAKKNRIQVSTNKKPLYFYVNLAK  100



>ref|XP_006643815.1| PREDICTED: uncharacterized protein At2g34160-like [Oryza brachyantha]
Length=147

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 34/57 (60%), Gaps = 18/57 (32%)
 Frame = +2

Query  227  MEEITEGVTNINI----------------SAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            +EE+TEGV N+ +                +AG     NRIQVS+TKKPLFFYVNLAK
Sbjct  3    VEEVTEGVRNLTVEGDAAGAAAGEGAVRRAAGS--SSNRIQVSNTKKPLFFYVNLAK  57



>ref|XP_006299145.1| hypothetical protein CARUB_v10015288mg [Capsella rubella]
 gb|EOA32043.1| hypothetical protein CARUB_v10015288mg [Capsella rubella]
Length=160

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 3/38 (8%)
 Frame = +2

Query  236  ITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ++   T +N+   +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  21   LSPATTTVNV---ETHKKNRIQVSNTKKPLFFYVNLAK  55



>ref|XP_002280347.1| PREDICTED: uncharacterized protein At2g34160-like [Vitis vinifera]
Length=144

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 36/51 (71%), Gaps = 6/51 (12%)
 Frame = +2

Query  197  LIVEANQESLMEEITEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ++V  N E  M++ + G      +A + QKKNRIQVS++KKPLFFY+NLAK
Sbjct  4    IVVAENLEESMKKSSLG------NATETQKKNRIQVSNSKKPLFFYINLAK  48



>emb|CDP06841.1| unnamed protein product [Coffea canephora]
Length=128

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  281  QKKNRIQVSSTKKPLFFYVNLAK  349
            Q+KNRIQVS+TKKPLFFYVNLAK
Sbjct  15   QRKNRIQVSNTKKPLFFYVNLAK  37



>ref|XP_010102274.1| Uncharacterized protein L484_024556 [Morus notabilis]
 gb|EXB93217.1| Uncharacterized protein L484_024556 [Morus notabilis]
Length=195

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  281  QKKNRIQVSSTKKPLFFYVNLAK  349
            QKKNRIQVS+TKKPLFFYVNLAK
Sbjct  15   QKKNRIQVSNTKKPLFFYVNLAK  37



>ref|XP_003555573.1| PREDICTED: uncharacterized protein At2g34160-like [Glycine max]
 gb|KHN14706.1| Hypothetical protein glysoja_038115 [Glycine soja]
Length=132

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  263  ISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            ++A D  KK RIQVS+TKKPLFFYVNLAK
Sbjct  10   LTANDSHKKYRIQVSNTKKPLFFYVNLAK  38



>ref|XP_002966653.1| hypothetical protein SELMODRAFT_86023 [Selaginella moellendorffii]
 gb|EFJ32680.1| hypothetical protein SELMODRAFT_86023 [Selaginella moellendorffii]
Length=128

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  284  KKNRIQVSSTKKPLFFYVNLAK  349
            KKNRIQVS+TKKPLFFYVNLAK
Sbjct  15   KKNRIQVSNTKKPLFFYVNLAK  36



>emb|CDY41887.1| BnaC05g47170D [Brassica napus]
Length=152

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  275  DLQKKNRIQVSSTKKPLFFYVNLAK  349
            +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  28   ETHKKNRIQVSNTKKPLFFYVNLAK  52



>ref|XP_002978089.1| hypothetical protein SELMODRAFT_176795 [Selaginella moellendorffii]
 gb|EFJ20746.1| hypothetical protein SELMODRAFT_176795 [Selaginella moellendorffii]
Length=128

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  284  KKNRIQVSSTKKPLFFYVNLAK  349
            KKNRIQVS+TKKPLFFYVNLAK
Sbjct  15   KKNRIQVSNTKKPLFFYVNLAK  36



>emb|CBI26374.3| unnamed protein product [Vitis vinifera]
Length=131

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  269  AGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            A + QKKNRIQVS++KKPLFFY+NLAK
Sbjct  9    ATETQKKNRIQVSNSKKPLFFYINLAK  35



>emb|CDY21118.1| BnaA01g33490D [Brassica napus]
Length=156

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  275  DLQKKNRIQVSSTKKPLFFYVNLAK  349
            +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  32   ETHKKNRIQVSNTKKPLFFYVNLAK  56



>emb|CDY50744.1| BnaAnng10510D [Brassica napus]
Length=152

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  275  DLQKKNRIQVSSTKKPLFFYVNLAK  349
            +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  28   ETHKKNRIQVSNTKKPLFFYVNLAK  52



>ref|XP_010027179.1| PREDICTED: uncharacterized protein At2g34160 [Eucalyptus grandis]
 gb|KCW61578.1| hypothetical protein EUGRSUZ_H04315 [Eucalyptus grandis]
Length=149

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  284  KKNRIQVSSTKKPLFFYVNLAK  349
            KKNRIQVS+TKKPLFFYVNLAK
Sbjct  17   KKNRIQVSNTKKPLFFYVNLAK  38



>ref|XP_006408171.1| hypothetical protein EUTSA_v10021676mg [Eutrema salsugineum]
 gb|ESQ49624.1| hypothetical protein EUTSA_v10021676mg [Eutrema salsugineum]
Length=161

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +2

Query  272  GDLQKKNRIQVSSTKKPLFFYVNLAK  349
             +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  30   AETHKKNRIQVSNTKKPLFFYVNLAK  55



>ref|XP_009355722.1| PREDICTED: uncharacterized protein At2g34160-like [Pyrus x bretschneideri]
Length=134

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 31/43 (72%), Gaps = 2/43 (5%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQK--KNRIQVSSTKKPLFFYVNLAK  349
            ME + E V N+ I+     K  KNRIQVS+TKKP+FFYV+LAK
Sbjct  1    MEGLAEEVNNLQITDASYNKNNKNRIQVSNTKKPVFFYVSLAK  43



>gb|KFK37876.1| hypothetical protein AALP_AA3G040800 [Arabis alpina]
Length=164

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  275  DLQKKNRIQVSSTKKPLFFYVNLAK  349
            +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  29   ETHKKNRIQVSNTKKPLFFYVNLAK  53



>ref|XP_006423982.1| hypothetical protein CICLE_v10030008mg [Citrus clementina]
 gb|ESR37222.1| hypothetical protein CICLE_v10030008mg [Citrus clementina]
Length=95

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  281  QKKNRIQVSSTKKPLFFYVNLAK  349
             KKNRIQVS+TKKPLFFYVNLAK
Sbjct  30   HKKNRIQVSNTKKPLFFYVNLAK  52



>ref|XP_009124986.1| PREDICTED: uncharacterized protein At2g34160-like [Brassica rapa]
Length=161

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  275  DLQKKNRIQVSSTKKPLFFYVNLAK  349
            +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  32   ETHKKNRIQVSNTKKPLFFYVNLAK  56



>gb|KDP23684.1| hypothetical protein JCGZ_23517 [Jatropha curcas]
Length=146

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +2

Query  266  SAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            +A    KKNRIQVS+TKKPLFFYVNLAK
Sbjct  30   TAQGQHKKNRIQVSNTKKPLFFYVNLAK  57



>ref|XP_009124184.1| PREDICTED: uncharacterized protein At2g34160-like [Brassica rapa]
Length=157

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  275  DLQKKNRIQVSSTKKPLFFYVNLAK  349
            +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  28   ETHKKNRIQVSNTKKPLFFYVNLAK  52



>emb|CDY30010.1| BnaC01g39980D [Brassica napus]
Length=159

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  275  DLQKKNRIQVSSTKKPLFFYVNLAK  349
            +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  35   ETHKKNRIQVSNTKKPLFFYVNLAK  59



>ref|XP_010417092.1| PREDICTED: uncharacterized protein At2g34160-like [Camelina sativa]
Length=158

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  281  QKKNRIQVSSTKKPLFFYVNLAK  349
             KKNRIQVS+TKKPLFFYVNLAK
Sbjct  30   HKKNRIQVSNTKKPLFFYVNLAK  52



>ref|NP_187113.1| DUO1-activated nucleic acid binding protein [Arabidopsis thaliana]
 gb|AAF04892.1|AC011437_7 unknown protein [Arabidopsis thaliana]
 gb|AAR20712.1| At3g04620 [Arabidopsis thaliana]
 gb|AAR24749.1| At3g04620 [Arabidopsis thaliana]
 gb|AEE74107.1| DUO1-activated nucleic acid binding protein [Arabidopsis thaliana]
Length=164

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  275  DLQKKNRIQVSSTKKPLFFYVNLAK  349
            +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  33   ETHKKNRIQVSNTKKPLFFYVNLAK  57



>ref|XP_002884455.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60714.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
Length=164

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  275  DLQKKNRIQVSSTKKPLFFYVNLAK  349
            +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  33   ETHKKNRIQVSNTKKPLFFYVNLAK  57



>gb|KHG16323.1| hypothetical protein F383_08228 [Gossypium arboreum]
Length=122

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 4/37 (11%)
 Frame = +2

Query  239  TEGVTNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            TEGV     S+    KKNRIQVS+T+KPLFFYVNLAK
Sbjct  5    TEGVD----SSASNSKKNRIQVSNTQKPLFFYVNLAK  37



>ref|XP_009134767.1| PREDICTED: uncharacterized protein At2g34160-like [Brassica rapa]
Length=162

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +2

Query  266  SAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            +  +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  29   ATAESHKKNRIQVSNTKKPLFFYVNLAK  56



>ref|XP_010485843.1| PREDICTED: uncharacterized protein At2g34160-like [Camelina sativa]
Length=158

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  281  QKKNRIQVSSTKKPLFFYVNLAK  349
             KKNRIQVS+TKKPLFFYVNLAK
Sbjct  30   HKKNRIQVSNTKKPLFFYVNLAK  52



>emb|CDX74179.1| BnaA03g28680D [Brassica napus]
Length=164

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +2

Query  266  SAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            +  +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  29   ATAESHKKNRIQVSNTKKPLFFYVNLAK  56



>emb|CDY40664.1| BnaC03g33800D [Brassica napus]
Length=161

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +2

Query  266  SAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            +  +  KKNRIQVS+TKKPLFFYVNLAK
Sbjct  25   ATAESHKKNRIQVSNTKKPLFFYVNLAK  52



>gb|ABR26175.1| unknown [Oryza sativa Indica Group]
Length=126

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  281  QKKNRIQVSSTKKPLFFYVNLAK  349
             KKNRIQVS+TKKPLFFYVNLAK
Sbjct  10   HKKNRIQVSNTKKPLFFYVNLAK  32



>gb|KDO48762.1| hypothetical protein CISIN_1g038360mg [Citrus sinensis]
Length=149

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  281  QKKNRIQVSSTKKPLFFYVNLAK  349
             KKNRIQVS+TKKPLFFYVNLAK
Sbjct  30   HKKNRIQVSNTKKPLFFYVNLAK  52



>ref|XP_010463944.1| PREDICTED: uncharacterized protein At2g34160-like [Camelina sativa]
Length=158

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  281  QKKNRIQVSSTKKPLFFYVNLAK  349
             KKNRIQVS+TKKPLFFYVNLAK
Sbjct  30   HKKNRIQVSNTKKPLFFYVNLAK  52



>dbj|BAK08244.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=189

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +2

Query  251  TNINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
             +I   AG   KKNRIQVS+ KKPL+FYVNLAK
Sbjct  68   ADIEAEAGVSAKKNRIQVSTNKKPLYFYVNLAK  100



>ref|XP_006487872.1| PREDICTED: uncharacterized protein At2g34160-like [Citrus sinensis]
Length=148

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  281  QKKNRIQVSSTKKPLFFYVNLAK  349
             KKNRIQVS+TKKPLFFYVNLAK
Sbjct  29   HKKNRIQVSNTKKPLFFYVNLAK  51



>ref|XP_009364477.1| PREDICTED: uncharacterized protein At2g34160-like [Pyrus x bretschneideri]
Length=134

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  284  KKNRIQVSSTKKPLFFYVNLAK  349
            KKNRIQVS+TKKPLFFYVNLAK
Sbjct  21   KKNRIQVSNTKKPLFFYVNLAK  42



>ref|XP_011091961.1| PREDICTED: uncharacterized protein At2g34160-like [Sesamum indicum]
 ref|XP_011091962.1| PREDICTED: uncharacterized protein At2g34160-like [Sesamum indicum]
Length=149

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  284  KKNRIQVSSTKKPLFFYVNLAK  349
            KKNRIQVS+TKKPLFFYVNLAK
Sbjct  17   KKNRIQVSNTKKPLFFYVNLAK  38



>ref|XP_008370716.1| PREDICTED: uncharacterized protein At2g34160-like [Malus domestica]
Length=135

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  284  KKNRIQVSSTKKPLFFYVNLAK  349
            KKNRIQVS+TKKPLFFYVNLAK
Sbjct  21   KKNRIQVSNTKKPLFFYVNLAK  42



>ref|XP_008350636.1| PREDICTED: uncharacterized protein At2g34160-like [Malus domestica]
Length=134

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  284  KKNRIQVSSTKKPLFFYVNLAK  349
            KKNRIQVS+TKKPLFFYVNLAK
Sbjct  21   KKNRIQVSNTKKPLFFYVNLAK  42



>ref|XP_009372174.1| PREDICTED: uncharacterized protein At2g34160 [Pyrus x bretschneideri]
Length=135

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  284  KKNRIQVSSTKKPLFFYVNLAK  349
            KKNRIQVS+TKKPLFFYVNLAK
Sbjct  21   KKNRIQVSNTKKPLFFYVNLAK  42



>ref|XP_008656129.1| PREDICTED: uncharacterized protein At2g34160-like [Zea mays]
 gb|AFW81392.1| hypothetical protein ZEAMMB73_168635 [Zea mays]
Length=174

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 3/31 (10%)
 Frame = +2

Query  266  SAGDLQK---KNRIQVSSTKKPLFFYVNLAK  349
            + GD Q+   +NRIQVSS+KKPLFFYVNLAK
Sbjct  11   AGGDAQQAVGRNRIQVSSSKKPLFFYVNLAK  41



>gb|EYU30530.1| hypothetical protein MIMGU_mgv1a015883mg [Erythranthe guttata]
Length=142

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  284  KKNRIQVSSTKKPLFFYVNLAK  349
            KKNRIQVS+TKKPLFFYVNLAK
Sbjct  17   KKNRIQVSNTKKPLFFYVNLAK  38



>ref|XP_006382820.1| hypothetical protein POPTR_0005s05780g [Populus trichocarpa]
 gb|ERP60617.1| hypothetical protein POPTR_0005s05780g [Populus trichocarpa]
Length=148

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  281  QKKNRIQVSSTKKPLFFYVNLAK  349
            QK NRIQVS+TKKPLFFYVNLAK
Sbjct  33   QKNNRIQVSNTKKPLFFYVNLAK  55



>ref|XP_009355687.1| PREDICTED: uncharacterized protein At2g34160-like [Pyrus x bretschneideri]
Length=89

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +2

Query  278  LQKKNRIQVSSTKKPLFFYVNLAK  349
            +Q KNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MQLKNRIQVSNTKKPLFFYVNLAK  24



>ref|XP_011087389.1| PREDICTED: uncharacterized protein At2g34160-like [Sesamum indicum]
Length=127

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  284  KKNRIQVSSTKKPLFFYVNLAK  349
            KKNRIQVS+TKKPLFFYVNLAK
Sbjct  21   KKNRIQVSNTKKPLFFYVNLAK  42



>gb|AFK44427.1| unknown [Lotus japonicus]
Length=128

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  284  KKNRIQVSSTKKPLFFYVNLAK  349
            KKNRIQVS+TKKPLFFYVNLAK
Sbjct  16   KKNRIQVSNTKKPLFFYVNLAK  37



>gb|AFW81391.1| hypothetical protein ZEAMMB73_168635 [Zea mays]
Length=184

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 3/31 (10%)
 Frame = +2

Query  266  SAGDLQK---KNRIQVSSTKKPLFFYVNLAK  349
            + GD Q+   +NRIQVSS+KKPLFFYVNLAK
Sbjct  11   AGGDAQQAVGRNRIQVSSSKKPLFFYVNLAK  41



>ref|XP_010675061.1| PREDICTED: uncharacterized protein At2g34160 [Beta vulgaris subsp. 
vulgaris]
Length=139

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  284  KKNRIQVSSTKKPLFFYVNLAK  349
            KKNRIQVS+TKKPLFFYVNLAK
Sbjct  16   KKNRIQVSNTKKPLFFYVNLAK  37



>gb|AGU71361.1| nucleic acid binding protein, partial [Lumnitzera racemosa]
Length=49

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  269  AGDLQKKNRIQVSSTKKPLFFYVNLAK  349
             GD QK+NR+QVS+TKKPL +YVNL+K
Sbjct  7    TGDSQKRNRVQVSNTKKPLCYYVNLSK  33



>emb|CDM85818.1| unnamed protein product [Triticum aestivum]
Length=189

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  254  NINISAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            +I   AG   KKNRIQVS+ KKPL+FYVNLAK
Sbjct  69   DIEAEAGVSAKKNRIQVSTNKKPLYFYVNLAK  100



>ref|XP_007144839.1| hypothetical protein PHAVU_007G1886001g, partial [Phaseolus vulgaris]
 gb|ESW16833.1| hypothetical protein PHAVU_007G1886001g, partial [Phaseolus vulgaris]
Length=37

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  284  KKNRIQVSSTKKPLFFYVNLAK  349
            KKNRIQVS+TKKPLFFYVNLAK
Sbjct  16   KKNRIQVSNTKKPLFFYVNLAK  37



>ref|XP_006664564.1| PREDICTED: uncharacterized protein At2g34160-like, partial [Oryza 
brachyantha]
Length=168

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +2

Query  266  SAGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            +AG   KKNRIQVS+ KKPL+FYVNLAK
Sbjct  50   TAGASAKKNRIQVSTNKKPLYFYVNLAK  77



>ref|XP_010670649.1| PREDICTED: uncharacterized protein At2g34160-like [Beta vulgaris 
subsp. vulgaris]
Length=145

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 16/57 (28%)
 Frame = +2

Query  227  MEEITEGVTNINISAGD----------------LQKKNRIQVSSTKKPLFFYVNLAK  349
            ME++TEGV+N+ ++                     KKNRIQVS+TKKPLFFYVNLAK
Sbjct  1    MEQVTEGVSNLTVTDSSDNTNNTTNNNNNNNFNNNKKNRIQVSNTKKPLFFYVNLAK  57



>ref|XP_002455102.1| hypothetical protein SORBIDRAFT_03g004340 [Sorghum bicolor]
 gb|EES00222.1| hypothetical protein SORBIDRAFT_03g004340 [Sorghum bicolor]
Length=147

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 13/55 (24%)
 Frame = +2

Query  224  LMEEITEGVTNINISAGDLQKK-------------NRIQVSSTKKPLFFYVNLAK  349
            ++EEITEGV N+ ++                    NRIQVS+TKKPLFFYVNLAK
Sbjct  2    VVEEITEGVKNLAVAGDAAAASGGEGQRRGGGGSSNRIQVSNTKKPLFFYVNLAK  56



>ref|XP_003575507.1| PREDICTED: uncharacterized protein At2g34160-like [Brachypodium 
distachyon]
Length=190

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  269  AGDLQKKNRIQVSSTKKPLFFYVNLAK  349
            AG   KKNRIQVS+ KKPL+FYVNLAK
Sbjct  75   AGASAKKNRIQVSTNKKPLYFYVNLAK  101



>ref|XP_009396723.1| PREDICTED: uncharacterized protein At2g34160-like [Musa acuminata 
subsp. malaccensis]
Length=158

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +2

Query  281  QKKNRIQVSSTKKPLFFYVNLAK  349
             KKNRIQVS+ KKPLFFYVNLAK
Sbjct  46   HKKNRIQVSTNKKPLFFYVNLAK  68



>dbj|BAJ86084.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00418.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=153

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 32/63 (51%), Gaps = 22/63 (35%)
 Frame = +2

Query  227  MEEITEGVTNINISAGDLQ----------------------KKNRIQVSSTKKPLFFYVN  340
            +EEITEGV  + +  G+                          NRIQVS+TKKPLFFYVN
Sbjct  3    VEEITEGVRGLKVEDGEGAAAPPAAAAGGGGGDGPRRGANGSSNRIQVSNTKKPLFFYVN  62

Query  341  LAK  349
            LAK
Sbjct  63   LAK  65



>ref|NP_001236091.1| uncharacterized protein LOC100305998 [Glycine max]
 gb|ACU13957.1| unknown [Glycine max]
Length=129

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  284  KKNRIQVSSTKKPLFFYVNLAK  349
            KKN+IQVS+TKKPLFFYVNLAK
Sbjct  23   KKNKIQVSNTKKPLFFYVNLAK  44



>gb|EAY72729.1| hypothetical protein OsI_00594 [Oryza sativa Indica Group]
Length=124

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 34/62 (55%), Gaps = 23/62 (37%)
 Frame = +2

Query  227  MEEITEGVTNINI---------------------SAGDLQKKNRIQVSSTKKPLFFYVNL  343
            +EEITEGV N+ +                     +AG     NRIQVS+TKKPLFFYVNL
Sbjct  3    VEEITEGVRNLAVEGEPAAAAAAAGGGGEGAQRRAAGS--SSNRIQVSNTKKPLFFYVNL  60

Query  344  AK  349
            AK
Sbjct  61   AK  62



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508176617088