BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27513_g1_i1 len=1043 path=[1:0-1042]

Length=1043
                                                                      Score     E

ref|XP_009793076.1|  PREDICTED: axial regulator YABBY 1                 392   2e-133   
ref|XP_009609785.1|  PREDICTED: axial regulator YABBY 1                 391   2e-133   
ref|XP_011090395.1|  PREDICTED: axial regulator YABBY 1                 386   1e-131   
emb|CDP19940.1|  unnamed protein product                                382   5e-130   
ref|XP_004229793.1|  PREDICTED: axial regulator YABBY 1                 378   1e-127   
gb|AAS10177.1|  YABBY-like transcription factor GRAMINIFOLIA            376   2e-127   Antirrhinum majus [garden snapdragon]
ref|XP_006347890.1|  PREDICTED: axial regulator YABBY 1-like            374   2e-126   
dbj|BAQ19377.1|  filamentous flower                                     367   8e-124   
ref|XP_002280334.1|  PREDICTED: axial regulator YABBY 1 isoform X2      366   1e-123   Vitis vinifera
emb|CAN70458.1|  hypothetical protein VITISV_031595                     366   2e-123   Vitis vinifera
gb|AGD94962.1|  transcription factor YABBY1                             362   6e-122   
ref|XP_010661657.1|  PREDICTED: axial regulator YABBY 1 isoform X1      362   9e-122   
gb|EYU31965.1|  hypothetical protein MIMGU_mgv1a013346mg                361   2e-121   
ref|XP_007052113.1|  Plant-specific transcription factor YABBY fa...    358   1e-120   
gb|ACA64096.1|  YABBY1                                                  357   1e-119   Petunia x hybrida [garden petunia]
gb|AAO22990.1|  YABBY transcription factor CDM51                        349   8e-117   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|EYU31966.1|  hypothetical protein MIMGU_mgv1a013346mg                348   3e-116   
ref|XP_002320712.1|  abnormal floral organs family protein              347   6e-116   Populus trichocarpa [western balsam poplar]
gb|KDP28784.1|  hypothetical protein JCGZ_14555                         342   6e-114   
gb|KCW73030.1|  hypothetical protein EUGRSUZ_E01474                     343   2e-113   
ref|XP_010056343.1|  PREDICTED: axial regulator YABBY 1-like            340   4e-113   
gb|KHG22928.1|  Axial regulator YABBY 1 -like protein                   337   3e-112   
ref|XP_011033940.1|  PREDICTED: axial regulator YABBY 1                 336   1e-111   
ref|XP_010053914.1|  PREDICTED: axial regulator YABBY 1                 335   3e-111   
ref|XP_011017468.1|  PREDICTED: axial regulator YABBY 1                 332   3e-110   
gb|ACL68660.1|  graminifolia protein                                    331   1e-109   Streptocarpus rexii
ref|XP_010264212.1|  PREDICTED: protein YABBY 4-like                    329   4e-109   
ref|XP_003517025.1|  PREDICTED: axial regulator YABBY 1-like            323   8e-107   
ref|XP_006445302.1|  hypothetical protein CICLE_v10022170mg             322   2e-106   
ref|XP_007039924.1|  Plant-specific transcription factor YABBY fa...    322   3e-106   
ref|XP_003521963.1|  PREDICTED: axial regulator YABBY 1-like            320   2e-105   
ref|XP_007134824.1|  hypothetical protein PHAVU_010G079200g             318   8e-105   
gb|KDO48375.1|  hypothetical protein CISIN_1g028144mg                   318   2e-104   
gb|ACU23522.1|  unknown                                                 317   2e-104   Glycine max [soybeans]
ref|XP_006440374.1|  hypothetical protein CICLE_v10021834mg             317   2e-104   
gb|AEK35321.1|  YABBY3-like protein                                     317   2e-104   
ref|XP_009375773.1|  PREDICTED: axial regulator YABBY 1 isoform X2      318   3e-104   
ref|XP_006477249.1|  PREDICTED: axial regulator YABBY 3-like isof...    317   4e-104   
ref|XP_002266233.1|  PREDICTED: protein YABBY 4                         316   7e-104   Vitis vinifera
ref|XP_008364378.1|  PREDICTED: axial regulator YABBY 1-like isof...    317   8e-104   
ref|XP_010259025.1|  PREDICTED: protein YABBY 4-like                    316   9e-104   
gb|KDO85746.1|  hypothetical protein CISIN_1g027215mg                   315   3e-103   
gb|KDP25628.1|  hypothetical protein JCGZ_20784                         313   7e-103   
ref|XP_002304427.1|  hypothetical protein POPTR_0003s11230g             313   8e-103   Populus trichocarpa [western balsam poplar]
ref|XP_002532573.1|  Axial regulator YABBY1, putative                   313   1e-102   Ricinus communis
gb|KHG29380.1|  Axial regulator YABBY 1 -like protein                   313   1e-102   
ref|XP_004306943.1|  PREDICTED: axial regulator YABBY 1-like            313   1e-102   
ref|XP_009375772.1|  PREDICTED: axial regulator YABBY 1 isoform X1      313   2e-102   
ref|XP_003549900.1|  PREDICTED: protein YABBY 4-like                    312   3e-102   
ref|XP_008364377.1|  PREDICTED: axial regulator YABBY 1-like isof...    312   4e-102   
ref|XP_011033925.1|  PREDICTED: protein YABBY 4-like                    311   4e-102   
ref|XP_008232595.1|  PREDICTED: axial regulator YABBY 1 isoform X2      311   7e-102   
ref|XP_007218311.1|  hypothetical protein PRUPE_ppa010905mg             311   8e-102   
ref|XP_003525801.1|  PREDICTED: protein YABBY 4-like isoform X1         309   5e-101   
ref|XP_008232594.1|  PREDICTED: axial regulator YABBY 1 isoform X1      308   2e-100   
ref|XP_008787013.1|  PREDICTED: protein YABBY 4-like                    306   6e-100   
ref|XP_008344381.1|  PREDICTED: axial regulator YABBY 1-like            306   7e-100   
gb|KHG19574.1|  Axial regulator YABBY 1 -like protein                   303   9e-99    
ref|XP_009346562.1|  PREDICTED: axial regulator YABBY 3-like            303   2e-98    
ref|XP_010088882.1|  hypothetical protein L484_020870                   302   3e-98    
ref|XP_007155627.1|  hypothetical protein PHAVU_003G217700g             301   7e-98    
gb|AFN26939.1|  FIL protein                                             300   2e-97    
ref|XP_010933715.1|  PREDICTED: protein YABBY 4-like                    299   5e-97    
ref|XP_004506104.1|  PREDICTED: axial regulator YABBY 1-like            299   5e-97    
ref|XP_008796843.1|  PREDICTED: protein YABBY 4-like                    296   7e-96    
ref|XP_007209583.1|  hypothetical protein PRUPE_ppa011209mg             295   1e-95    
ref|XP_008238617.1|  PREDICTED: protein YABBY 4-like                    295   2e-95    
ref|XP_010093672.1|  hypothetical protein L484_019011                   293   7e-95    
ref|XP_011018257.1|  PREDICTED: protein YABBY 4-like                    291   4e-94    
gb|AEK35320.1|  YABBY3-like protein                                     290   2e-93    
gb|KEH29133.1|  plant-specific transcription factor YABBY family ...    290   2e-93    
ref|XP_009781194.1|  PREDICTED: protein YABBY 4-like                    288   5e-93    
ref|XP_006368172.1|  hypothetical protein POPTR_0001s00240g             286   3e-92    
ref|XP_004515739.1|  PREDICTED: protein YABBY 4-like                    286   4e-92    
gb|ACN79518.1|  YABBY1 protein                                          285   8e-92    Lotus japonicus
ref|XP_009359375.1|  PREDICTED: axial regulator YABBY 1-like            285   1e-91    
ref|XP_008381158.1|  PREDICTED: axial regulator YABBY 1-like            285   1e-91    
ref|XP_009339707.1|  PREDICTED: axial regulator YABBY 1-like            284   3e-91    
ref|XP_009411506.1|  PREDICTED: protein YABBY 4-like                    283   2e-90    
ref|XP_008373809.1|  PREDICTED: axial regulator YABBY 1-like            282   2e-90    
ref|XP_010544625.1|  PREDICTED: axial regulator YABBY 1-like            282   2e-90    
ref|XP_010524377.1|  PREDICTED: axial regulator YABBY 1-like            280   9e-90    
ref|XP_006477248.1|  PREDICTED: axial regulator YABBY 3-like isof...    280   3e-89    
ref|XP_006440375.1|  hypothetical protein CICLE_v10021834mg             280   3e-89    
gb|AES90958.2|  plant-specific transcription factor YABBY family ...    278   9e-89    
ref|XP_009600360.1|  PREDICTED: axial regulator YABBY 1-like            275   6e-88    
ref|XP_006355492.1|  PREDICTED: protein YABBY 4                         275   6e-88    
ref|XP_006579624.1|  PREDICTED: protein YABBY 4-like isoform X2         274   8e-88    
gb|AFI44623.1|  putative male sterile protein                           273   9e-87    
ref|XP_009384089.1|  PREDICTED: protein YABBY 4-like                    273   2e-86    
gb|AID67130.1|  YAB1 protein                                            270   6e-86    
ref|XP_004298663.1|  PREDICTED: axial regulator YABBY 1-like            271   6e-86    
ref|XP_006840962.1|  hypothetical protein AMTR_s00085p00032940          268   3e-85    
ref|XP_009382346.1|  PREDICTED: axial regulator YABBY 1-like            268   9e-85    
dbj|BAD72170.1|  filamentous flower like protein                        266   9e-85    Amborella trichopoda
ref|XP_009104094.1|  PREDICTED: axial regulator YABBY 1 isoform X2      267   1e-84    
ref|XP_003608761.1|  Protein YABBY                                      266   2e-84    
emb|CDY56250.1|  BnaA07g38010D                                          266   2e-84    
ref|XP_006397699.1|  hypothetical protein EUTSA_v10001617mg             266   3e-84    
gb|AID67131.1|  YAB1 protein                                            265   9e-84    
ref|XP_002882000.1|  hypothetical protein ARALYDRAFT_903959             265   1e-83    
ref|XP_009142321.1|  PREDICTED: axial regulator YABBY 1-like isof...    265   1e-83    
gb|AID67127.1|  YAB1 protein                                            264   2e-83    
gb|AID67132.1|  YAB1 protein                                            264   3e-83    
gb|AID67128.1|  YAB1 protein                                            263   3e-83    
ref|XP_006294955.1|  hypothetical protein CARUB_v10024011mg             263   7e-83    
gb|KCW73031.1|  hypothetical protein EUGRSUZ_E01474                     264   9e-83    
ref|NP_566037.1|  axial regulator YABBY 1                               261   2e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007052114.1|  Plant-specific transcription factor YABBY fa...    258   3e-82    
ref|XP_010506457.1|  PREDICTED: axial regulator YABBY 1                 260   6e-82    
ref|XP_010508202.1|  PREDICTED: axial regulator YABBY 1-like            259   1e-81    
ref|XP_006386566.1|  hypothetical protein POPTR_0002s14600g             257   2e-81    
ref|XP_004147586.1|  PREDICTED: axial regulator YABBY 1-like            260   2e-81    
ref|XP_006375305.1|  hypothetical protein POPTR_0014s06210g             257   2e-81    
emb|CAG17551.1|  putative CRC transcription factor 1                    252   4e-80    Ipomoea nil [qian niu]
emb|CDP09914.1|  unnamed protein product                                254   4e-80    
emb|CDX98262.1|  BnaC06g16230D                                          256   4e-80    
ref|XP_009142322.1|  PREDICTED: axial regulator YABBY 1-like isof...    255   6e-80    
gb|ACO92387.1|  DBC43-3-2                                               255   7e-80    Brassica rapa subsp. pekinensis [bai cai]
ref|XP_010692186.1|  PREDICTED: axial regulator YABBY 1 isoform X1      256   8e-80    
ref|XP_011093320.1|  PREDICTED: axial regulator YABBY 1-like            252   1e-79    
emb|CDX95636.1|  BnaC03g25170D                                          254   3e-79    
gb|AFI44620.1|  putative male sterile protein                           253   3e-79    
ref|XP_009104095.1|  PREDICTED: axial regulator YABBY 1 isoform X3      253   4e-79    
gb|AFI44622.1|  putative male sterile protein                           253   4e-79    
ref|XP_010544370.1|  PREDICTED: axial regulator YABBY 3                 252   9e-79    
emb|CDY27390.1|  BnaC04g50150D                                          252   2e-78    
ref|XP_009104093.1|  PREDICTED: axial regulator YABBY 1 isoform X1      251   2e-78    
ref|XP_010692187.1|  PREDICTED: axial regulator YABBY 1 isoform X2      250   1e-77    
ref|XP_010676177.1|  PREDICTED: axial regulator YABBY 1-like isof...    249   2e-77    
ref|XP_009133711.1|  PREDICTED: axial regulator YABBY 1                 248   4e-77    
ref|XP_004245737.1|  PREDICTED: protein YABBY 4 isoform X1              248   5e-77    
ref|XP_002872965.1|  hypothetical protein ARALYDRAFT_490550             247   1e-76    
gb|AFI44619.1|  putative male sterile protein                           247   1e-76    
ref|XP_002452852.1|  hypothetical protein SORBIDRAFT_04g033590          245   1e-75    Sorghum bicolor [broomcorn]
dbj|BAJ83625.1|  FIL-like YABBY protein                                 241   1e-74    
ref|XP_006647599.1|  PREDICTED: protein YABBY 4-like                    241   3e-74    
dbj|BAJ83620.1|  FIL-like YABBY protein                                 239   7e-74    
ref|XP_004953265.1|  PREDICTED: protein YABBY 4-like                    241   7e-74    
ref|XP_009408705.1|  PREDICTED: protein YABBY 5-like                    237   4e-73    
gb|ACG32891.1|  yabby15 protein                                         238   8e-73    Zea mays [maize]
ref|XP_008645991.1|  PREDICTED: protein YABBY 4                         237   2e-72    
ref|NP_001047559.1|  Os02g0643200                                       237   2e-72    Oryza sativa Japonica Group [Japonica rice]
gb|AAP79885.1|  yabby15 protein                                         236   3e-72    Zea mays [maize]
ref|XP_010456314.1|  PREDICTED: axial regulator YABBY 3 isoform X2      235   4e-72    
ref|XP_009111513.1|  PREDICTED: axial regulator YABBY 3 isoform X2      235   6e-72    
ref|XP_010419551.1|  PREDICTED: axial regulator YABBY 3-like isof...    234   9e-72    
ref|XP_006288552.1|  hypothetical protein CARUB_v10001833mg             234   1e-71    
gb|KFK30595.1|  hypothetical protein AALP_AA6G002000                    234   2e-71    
ref|NP_567154.1|  axial regulator YABBY 3                               233   3e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010676179.1|  PREDICTED: protein YABBY 4-like isoform X2         232   4e-71    
ref|NP_001053423.1|  Os04g0536300                                       233   6e-71    Oryza sativa Japonica Group [Japonica rice]
emb|CAD41530.3|  OSJNBb0020O11.2                                        233   7e-71    
dbj|BAD83708.1|  filamentous flower like protein                        232   2e-70    Nuphar japonica
ref|XP_010456313.1|  PREDICTED: axial regulator YABBY 3 isoform X1      231   3e-70    
ref|XP_009111509.1|  PREDICTED: axial regulator YABBY 3 isoform X1      231   4e-70    
gb|EAZ31462.1|  hypothetical protein OsJ_15599                          231   4e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010419550.1|  PREDICTED: axial regulator YABBY 3-like isof...    230   6e-70    
ref|XP_003569970.1|  PREDICTED: protein YABBY 4-like                    230   1e-69    
gb|KFK37311.1|  male sterile protein                                    228   2e-69    
ref|XP_004982656.1|  PREDICTED: protein YABBY 3-like                    230   4e-69    
ref|XP_010546420.1|  PREDICTED: axial regulator YABBY 3-like            227   5e-69    
ref|XP_006652579.1|  PREDICTED: protein YABBY 5-like                    228   8e-69    
gb|EMT32371.1|  hypothetical protein F775_27799                         228   8e-69    
ref|XP_006579625.1|  PREDICTED: protein YABBY 4-like isoform X3         223   1e-68    
ref|XP_010240181.1|  PREDICTED: protein YABBY 5-like                    224   2e-67    
ref|XP_006396217.1|  hypothetical protein EUTSA_v10028925mg             222   6e-67    
gb|EMT07786.1|  hypothetical protein F775_25525                         223   7e-67    
ref|XP_004976365.1|  PREDICTED: protein YABBY 5-like isoform X1         222   2e-66    
gb|EEC73684.1|  hypothetical protein OsI_08248                          222   4e-66    Oryza sativa Indica Group [Indian rice]
ref|XP_008448889.1|  PREDICTED: protein YABBY 4-like                    216   3e-65    
ref|XP_010325468.1|  PREDICTED: axial regulator YABBY 1 isoform X2      216   7e-65    
ref|XP_004976366.1|  PREDICTED: protein YABBY 5-like isoform X2         217   1e-64    
ref|XP_004150647.1|  PREDICTED: protein YABBY 4-like                    214   2e-64    
ref|XP_010533768.1|  PREDICTED: axial regulator YABBY 5-like            212   2e-63    
ref|XP_002511672.1|  conserved hypothetical protein                     209   3e-63    Ricinus communis
ref|XP_002464399.1|  hypothetical protein SORBIDRAFT_01g017560          215   3e-63    Sorghum bicolor [broomcorn]
gb|AFK46270.1|  unknown                                                 209   5e-63    
gb|ACG43271.1|  axial regulator YABBY1                                  211   9e-62    Zea mays [maize]
gb|AFW68435.1|  yabby9                                                  211   1e-61    
ref|NP_001105231.1|  yabby9                                             210   2e-61    Zea mays [maize]
ref|NP_001078337.1|  axial regulator YABBY 3                            205   1e-60    Arabidopsis thaliana [mouse-ear cress]
gb|ACF85053.1|  unknown                                                 205   1e-60    Zea mays [maize]
ref|XP_010426672.1|  PREDICTED: axial regulator YABBY 3-like isof...    201   2e-59    
gb|AAQ93323.1|  YABBY protein                                           204   3e-59    Triticum aestivum [Canadian hard winter wheat]
ref|XP_006842053.1|  hypothetical protein AMTR_s00078p00029420          199   3e-58    
ref|XP_008667172.1|  PREDICTED: putative YABBY domain transcripti...    198   1e-57    
gb|AFK48204.1|  unknown                                                 195   1e-57    
ref|XP_010426665.1|  PREDICTED: axial regulator YABBY 3-like isof...    197   2e-57    
ref|NP_001065021.2|  Os10g0508300                                       201   3e-57    Oryza sativa Japonica Group [Japonica rice]
sp|Q8L556.1|YAB3_ORYSJ  RecName: Full=Protein YABBY 3; AltName: F...    199   5e-57    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006661936.1|  PREDICTED: protein YABBY 3-like                    198   8e-57    
ref|NP_001132033.1|  putative YABBY domain transcription factor f...    196   2e-56    Zea mays [maize]
gb|AFW68437.1|  yabby9                                                  197   4e-56    
gb|AAS10179.1|  YABBY2-like transcription factor YAB2                   191   1e-55    Antirrhinum majus [garden snapdragon]
dbj|BAJ83624.1|  YAB5-like YABBY protein                                190   2e-55    
ref|XP_010090516.1|  hypothetical protein L484_017140                   190   3e-55    
ref|NP_001105230.1|  yabby14                                            191   1e-54    Zea mays [maize]
dbj|BAD72169.1|  YABBY5 like protein                                    188   2e-54    Cabomba caroliniana
ref|XP_002448235.1|  hypothetical protein SORBIDRAFT_06g023770          191   2e-54    Sorghum bicolor [broomcorn]
ref|XP_002285328.1|  PREDICTED: axial regulator YABBY 5 isoform X1      188   2e-54    Vitis vinifera
gb|AID67113.1|  YAB5 protein                                            187   2e-54    
ref|XP_010533151.1|  PREDICTED: axial regulator YABBY 5                 187   3e-54    
ref|XP_009407727.1|  PREDICTED: protein YABBY 2-like                    187   3e-54    
gb|AID67112.1|  YAB5 protein                                            187   4e-54    
ref|XP_003574170.1|  PREDICTED: protein YABBY 3-like                    191   4e-54    
ref|XP_007015607.1|  Plant-specific transcription factor YABBY fa...    187   6e-54    
ref|XP_003609353.1|  YABBY protein                                      186   1e-53    
ref|XP_006487832.1|  PREDICTED: putative axial regulator YABBY 2-...    186   1e-53    
gb|EYU30547.1|  hypothetical protein MIMGU_mgv1a016431mg                184   1e-53    
ref|XP_009133935.1|  PREDICTED: axial regulator YABBY 5                 185   2e-53    
ref|XP_002277937.1|  PREDICTED: putative axial regulator YABBY 2 ...    185   2e-53    Vitis vinifera
ref|XP_011088989.1|  PREDICTED: putative axial regulator YABBY 2        185   2e-53    
gb|KDO48950.1|  hypothetical protein CISIN_1g029862mg                   185   3e-53    
emb|CDX83239.1|  BnaA03g22670D                                          184   4e-53    
ref|XP_004487438.1|  PREDICTED: putative axial regulator YABBY 2-...    184   4e-53    
gb|ACJ85113.1|  unknown                                                 185   4e-53    Medicago truncatula
gb|AHZ90132.1|  YABBY2                                                  184   6e-53    
ref|XP_009364015.1|  PREDICTED: axial regulator YABBY 5-like            184   6e-53    
ref|XP_010651638.1|  PREDICTED: putative axial regulator YABBY 2 ...    184   7e-53    
gb|AID67114.1|  YAB5 protein                                            184   7e-53    
ref|XP_006487833.1|  PREDICTED: putative axial regulator YABBY 2-...    184   7e-53    
gb|EYU34993.1|  hypothetical protein MIMGU_mgv1a014582mg                184   8e-53    
ref|XP_010250140.1|  PREDICTED: axial regulator YABBY 5-like isof...    184   9e-53    
ref|XP_008778120.1|  PREDICTED: protein YABBY 2-like isoform X1         183   1e-52    
ref|XP_007155017.1|  hypothetical protein PHAVU_003G166100g             184   1e-52    
ref|XP_007013479.1|  Plant-specific transcription factor YABBY fa...    183   1e-52    
gb|AFY26892.1|  YABBY2-like transcription factor YAB2                   183   1e-52    
gb|EEE51245.1|  hypothetical protein OsJ_32108                          186   1e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006450896.1|  hypothetical protein CICLE_v10009560mg             183   1e-52    
ref|XP_010105229.1|  hypothetical protein L484_012344                   184   1e-52    
ref|NP_001281031.1|  axial regulator YABBY 5                            183   1e-52    
ref|XP_006358281.1|  PREDICTED: axial regulator YABBY 5-like            183   2e-52    
gb|KDO48952.1|  hypothetical protein CISIN_1g029862mg                   183   2e-52    
ref|XP_004287301.1|  PREDICTED: axial regulator YABBY 5-like            183   2e-52    
emb|CDY38528.1|  BnaC03g26690D                                          182   2e-52    
ref|XP_004242778.1|  PREDICTED: axial regulator YABBY 5                 182   2e-52    
gb|KDO80208.1|  hypothetical protein CISIN_1g028980mg                   183   2e-52    
ref|XP_010254434.1|  PREDICTED: axial regulator YABBY 5-like            182   3e-52    
ref|XP_010651636.1|  PREDICTED: putative axial regulator YABBY 2 ...    182   3e-52    
gb|AAS10178.1|  YABBY-like transcription factor PROLONGATA              182   3e-52    Antirrhinum majus [garden snapdragon]
gb|AID67111.1|  YAB5 protein                                            182   3e-52    
ref|XP_004150030.1|  PREDICTED: axial regulator YABBY 5-like            182   3e-52    
ref|XP_002308074.1|  plant-specific transcription factor YABBY fa...    182   4e-52    Populus trichocarpa [western balsam poplar]
ref|NP_001236663.1|  uncharacterized protein LOC100500091               182   5e-52    
dbj|BAF56419.1|  YABBY2 like protein                                    182   5e-52    Ruscus aculeatus
ref|XP_006295133.1|  hypothetical protein CARUB_v10024208mg             181   5e-52    
ref|XP_010426681.1|  PREDICTED: axial regulator YABBY 3-like isof...    182   5e-52    
ref|XP_008810627.1|  PREDICTED: protein YABBY 2-like isoform X2         182   5e-52    
ref|XP_010263070.1|  PREDICTED: putative axial regulator YABBY 2 ...    181   6e-52    
ref|XP_008242786.1|  PREDICTED: axial regulator YABBY 5                 182   6e-52    
ref|XP_008230525.1|  PREDICTED: putative axial regulator YABBY 2 ...    182   6e-52    
ref|XP_004140176.1|  PREDICTED: putative axial regulator YABBY 2-...    181   6e-52    
ref|XP_004508482.1|  PREDICTED: axial regulator YABBY 5-like            182   7e-52    
gb|KDP32424.1|  hypothetical protein JCGZ_13349                         181   8e-52    
gb|EPS63061.1|  hypothetical protein M569_11726                         178   8e-52    
ref|XP_009148102.1|  PREDICTED: putative axial regulator YABBY 2 ...    181   9e-52    
ref|XP_010651637.1|  PREDICTED: putative axial regulator YABBY 2 ...    181   1e-51    
emb|CDX95059.1|  BnaC05g06120D                                          181   1e-51    
ref|XP_010685467.1|  PREDICTED: putative axial regulator YABBY 2 ...    181   1e-51    
ref|XP_010557599.1|  PREDICTED: axial regulator YABBY 5-like            180   1e-51    
ref|XP_006591839.1|  PREDICTED: uncharacterized protein LOC100500...    180   2e-51    
gb|AGT16533.1|  axial regulator                                         181   2e-51    
gb|ADE77754.1|  unknown                                                 180   2e-51    
ref|XP_008467059.1|  PREDICTED: axial regulator YABBY 1-like            179   2e-51    
ref|XP_009110892.1|  PREDICTED: putative axial regulator YABBY 2 ...    180   2e-51    
ref|XP_007202630.1|  hypothetical protein PRUPE_ppa012028mg             180   2e-51    
gb|ABK95415.1|  unknown                                                 180   2e-51    Populus trichocarpa [western balsam poplar]
ref|XP_008230517.1|  PREDICTED: putative axial regulator YABBY 2 ...    180   3e-51    
emb|CDP15572.1|  unnamed protein product                                180   3e-51    
ref|NP_001238347.1|  uncharacterized protein LOC100499942               180   3e-51    
gb|ADE75601.1|  unknown                                                 179   3e-51    
ref|XP_011044616.1|  PREDICTED: putative axial regulator YABBY 2 ...    180   3e-51    
gb|AEK35322.1|  YABBY2-like protein                                     180   3e-51    
gb|KHG14718.1|  Axial regulator YABBY 5 -like protein                   179   4e-51    
ref|XP_009612000.1|  PREDICTED: axial regulator YABBY 5-like isof...    179   4e-51    
ref|XP_009611999.1|  PREDICTED: putative axial regulator YABBY 2 ...    179   4e-51    
ref|XP_008449608.1|  PREDICTED: putative axial regulator YABBY 2        179   4e-51    
ref|XP_009611997.1|  PREDICTED: putative axial regulator YABBY 2 ...    179   5e-51    
ref|XP_009792036.1|  PREDICTED: axial regulator YABBY 5-like isof...    179   6e-51    
ref|XP_003596925.1|  YABBY protein                                      179   6e-51    
ref|XP_010685466.1|  PREDICTED: putative axial regulator YABBY 2 ...    179   6e-51    
ref|NP_850080.1|  axial regulator YABBY 5                               178   6e-51    
ref|XP_009148101.1|  PREDICTED: putative axial regulator YABBY 2 ...    179   7e-51    
ref|XP_010048072.1|  PREDICTED: axial regulator YABBY 5                 179   7e-51    
ref|XP_009785258.1|  PREDICTED: axial regulator YABBY 5                 179   7e-51    
ref|XP_006303358.1|  hypothetical protein CARUB_v10010384mg             179   8e-51    
ref|XP_003542627.1|  PREDICTED: axial regulator YABBY 5-like            179   8e-51    
ref|XP_010247851.1|  PREDICTED: putative axial regulator YABBY 2 ...    179   8e-51    
ref|XP_004173692.1|  PREDICTED: axial regulator YABBY 5-like            178   9e-51    
ref|XP_010247861.1|  PREDICTED: putative axial regulator YABBY 2 ...    178   1e-50    
ref|XP_009792035.1|  PREDICTED: axial regulator YABBY 5-like isof...    178   1e-50    
ref|XP_004139305.1|  PREDICTED: axial regulator YABBY 5-like            179   1e-50    
gb|ACU19358.1|  unknown                                                 178   1e-50    
ref|XP_010263069.1|  PREDICTED: putative axial regulator YABBY 2 ...    178   1e-50    
ref|XP_009607227.1|  PREDICTED: axial regulator YABBY 5-like isof...    178   1e-50    
ref|XP_009792034.1|  PREDICTED: axial regulator YABBY 5-like isof...    178   1e-50    
ref|XP_006409724.1|  hypothetical protein EUTSA_v10017320mg             177   1e-50    
ref|XP_009110891.1|  PREDICTED: putative axial regulator YABBY 2 ...    178   1e-50    
ref|XP_010263071.1|  PREDICTED: putative axial regulator YABBY 2 ...    178   1e-50    
gb|EEE53629.1|  hypothetical protein OsJ_36906                          179   2e-50    
ref|XP_006417684.1|  hypothetical protein EUTSA_v10008858mg             178   2e-50    
ref|XP_009622268.1|  PREDICTED: axial regulator YABBY 5-like isof...    178   2e-50    
ref|XP_008457474.1|  PREDICTED: axial regulator YABBY 5                 178   2e-50    
ref|XP_006361110.1|  PREDICTED: putative axial regulator YABBY 2-...    178   2e-50    
ref|XP_010653257.1|  PREDICTED: axial regulator YABBY 5 isoform X4      177   2e-50    
ref|XP_003540284.1|  PREDICTED: putative axial regulator YABBY 2-...    177   3e-50    
gb|ACJ86053.1|  unknown                                                 178   3e-50    
emb|CDX97491.1|  BnaC08g13560D                                          177   3e-50    
ref|XP_006594908.1|  PREDICTED: putative axial regulator YABBY 2-...    177   4e-50    
ref|XP_010510888.1|  PREDICTED: axial regulator YABBY 5                 176   5e-50    
ref|XP_010919475.1|  PREDICTED: axial regulator YABBY 1                 175   5e-50    
ref|XP_011044615.1|  PREDICTED: putative axial regulator YABBY 2 ...    177   5e-50    
ref|XP_006650352.1|  PREDICTED: protein YABBY 2-like                    177   5e-50    
ref|XP_009792033.1|  PREDICTED: axial regulator YABBY 5-like isof...    177   5e-50    
ref|XP_009368867.1|  PREDICTED: axial regulator YABBY 5-like            176   5e-50    
ref|XP_002263154.2|  PREDICTED: axial regulator YABBY 5 isoform X1      176   5e-50    
ref|XP_010031585.1|  PREDICTED: putative axial regulator YABBY 2 ...    177   5e-50    
gb|KDO80207.1|  hypothetical protein CISIN_1g028980mg                   176   6e-50    
ref|XP_006417685.1|  hypothetical protein EUTSA_v10008858mg             176   6e-50    
gb|AEK35324.1|  YABBY5-like protein                                     176   6e-50    
ref|XP_003561769.1|  PREDICTED: protein YABBY 2-like                    176   7e-50    
ref|XP_010917943.1|  PREDICTED: protein YABBY 2-like isoform X6         176   7e-50    
ref|XP_010917941.1|  PREDICTED: protein YABBY 2-like isoform X4         176   7e-50    
gb|KDO48951.1|  hypothetical protein CISIN_1g029862mg                   176   7e-50    
ref|XP_010905004.1|  PREDICTED: protein YABBY 2-like                    177   7e-50    
ref|XP_010687959.1|  PREDICTED: axial regulator YABBY 5                 177   7e-50    
ref|XP_006664216.1|  PREDICTED: protein YABBY 6-like                    177   8e-50    
ref|XP_002527201.1|  Axial regulator YABBY5, putative                   176   8e-50    
ref|XP_010031584.1|  PREDICTED: putative axial regulator YABBY 2 ...    176   8e-50    
ref|NP_001276158.1|  uncharacterized protein LOC100785458               176   9e-50    
ref|XP_007150002.1|  hypothetical protein PHAVU_005G117600g             176   9e-50    
ref|XP_004241356.1|  PREDICTED: putative axial regulator YABBY 2 ...    176   1e-49    
ref|XP_006594909.1|  PREDICTED: putative axial regulator YABBY 2-...    176   1e-49    
ref|XP_010475645.1|  PREDICTED: putative axial regulator YABBY 2        176   1e-49    
ref|XP_004963174.1|  PREDICTED: protein YABBY 6-like isoform X1         176   1e-49    
gb|KDP42970.1|  hypothetical protein JCGZ_23912                         176   1e-49    
gb|AID67134.1|  YAB2 protein                                            176   1e-49    
ref|XP_011017779.1|  PREDICTED: axial regulator YABBY 5-like            176   1e-49    
ref|XP_010488902.1|  PREDICTED: putative axial regulator YABBY 2        176   1e-49    
ref|XP_010031586.1|  PREDICTED: putative axial regulator YABBY 2 ...    176   1e-49    
ref|XP_010250138.1|  PREDICTED: axial regulator YABBY 5-like isof...    176   1e-49    
dbj|BAJ89435.1|  predicted protein                                      175   2e-49    
ref|XP_010473042.1|  PREDICTED: axial regulator YABBY 5-like            174   2e-49    
dbj|BAK08176.1|  predicted protein                                      176   2e-49    
ref|XP_009762052.1|  PREDICTED: axial regulator YABBY 5-like isof...    175   2e-49    
ref|XP_010653256.1|  PREDICTED: axial regulator YABBY 5 isoform X3      175   2e-49    
ref|XP_009762053.1|  PREDICTED: axial regulator YABBY 5-like isof...    175   3e-49    
ref|XP_004982272.1|  PREDICTED: protein YABBY 2-like                    175   3e-49    
ref|XP_011078402.1|  PREDICTED: axial regulator YABBY 5                 174   3e-49    
gb|EMT27813.1|  Protein YABBY 6                                         175   3e-49    
ref|XP_010653254.1|  PREDICTED: axial regulator YABBY 5 isoform X2      174   3e-49    
ref|XP_003577246.1|  PREDICTED: protein YABBY 6-like isoform X1         175   3e-49    
ref|XP_003543399.1|  PREDICTED: putative axial regulator YABBY 2-...    174   3e-49    
gb|KFK43154.1|  hypothetical protein AALP_AA1G086900                    174   3e-49    
ref|XP_008790352.1|  PREDICTED: protein YABBY 2-like isoform X1         174   3e-49    
ref|NP_001050783.1|  Os03g0650000                                       174   4e-49    
ref|XP_007132510.1|  hypothetical protein PHAVU_011G100300g             174   4e-49    
ref|XP_006450895.1|  hypothetical protein CICLE_v10009560mg             174   4e-49    
gb|ACG33156.1|  axial regulator YABBY2                                  174   5e-49    
ref|NP_001234390.1|  FAS protein                                        174   5e-49    
ref|NP_001280989.1|  putative axial regulator YABBY 2                   174   5e-49    
ref|XP_009406691.1|  PREDICTED: protein YABBY 2-like                    174   5e-49    
dbj|BAK07545.1|  predicted protein                                      176   5e-49    
ref|XP_002878987.1|  plant-specific transcription factor yabby fa...    173   6e-49    
emb|CDP10425.1|  unnamed protein product                                174   6e-49    
ref|XP_002324648.2|  hypothetical protein POPTR_0018s12990g             174   6e-49    
ref|XP_002889696.1|  hypothetical protein ARALYDRAFT_470907             174   7e-49    
ref|XP_008790367.1|  PREDICTED: protein YABBY 2-like isoform X3         173   7e-49    
ref|XP_006826429.1|  hypothetical protein AMTR_s00004p00165390          174   8e-49    
ref|XP_002515880.1|  Axial regulator YABBY2, putative                   174   8e-49    
ref|XP_010917942.1|  PREDICTED: protein YABBY 2-like isoform X5         172   9e-49    
ref|XP_009389764.1|  PREDICTED: protein YABBY 2-like                    173   9e-49    
ref|XP_010917944.1|  PREDICTED: protein YABBY 2-like isoform X7         172   9e-49    
ref|XP_010458084.1|  PREDICTED: putative axial regulator YABBY 2        173   1e-48    
gb|AFK33997.1|  unknown                                                 173   1e-48    
gb|AGD94963.1|  transcription factor YABBY2                             173   1e-48    
gb|AID67135.1|  YAB2 protein                                            173   1e-48    
ref|XP_009398350.1|  PREDICTED: axial regulator YABBY 5-like isof...    173   1e-48    
ref|XP_011020144.1|  PREDICTED: axial regulator YABBY 5-like            173   1e-48    
gb|AID67133.1|  YAB2 protein                                            173   1e-48    
gb|KHN41251.1|  Putative axial regulator YABBY 2                        172   2e-48    
dbj|BAD72168.1|  YABBY2 like protein                                    172   2e-48    
ref|NP_001141765.1|  uncharacterized protein LOC100273901               172   2e-48    
ref|XP_010322450.1|  PREDICTED: putative axial regulator YABBY 2 ...    173   2e-48    
ref|XP_007150001.1|  hypothetical protein PHAVU_005G117600g             172   2e-48    
ref|XP_009118373.1|  PREDICTED: putative axial regulator YABBY 2 ...    172   2e-48    
ref|XP_009378606.1|  PREDICTED: putative axial regulator YABBY 2 ...    172   2e-48    
ref|XP_004963175.1|  PREDICTED: protein YABBY 6-like isoform X2         172   3e-48    
emb|CDY22681.1|  BnaC08g43150D                                          172   3e-48    
ref|XP_009378607.1|  PREDICTED: putative axial regulator YABBY 2 ...    172   3e-48    
ref|NP_001067299.1|  Os12g0621100                                       172   3e-48    
ref|XP_009798278.1|  PREDICTED: axial regulator YABBY 5-like            172   3e-48    
ref|XP_009626437.1|  PREDICTED: axial regulator YABBY 5-like            172   3e-48    
ref|XP_009611998.1|  PREDICTED: putative axial regulator YABBY 2 ...    172   4e-48    
ref|NP_001077490.1|  transcription factor YABBY family protein          171   4e-48    
ref|XP_008382120.1|  PREDICTED: putative axial regulator YABBY 2 ...    172   4e-48    
ref|XP_008790360.1|  PREDICTED: protein YABBY 2-like isoform X2         171   5e-48    
ref|XP_003577247.1|  PREDICTED: protein YABBY 6-like isoform X2         171   5e-48    
ref|XP_009118372.1|  PREDICTED: putative axial regulator YABBY 2 ...    171   5e-48    
ref|XP_006840679.1|  hypothetical protein AMTR_s00096p00054100          171   6e-48    
ref|XP_008385588.1|  PREDICTED: putative axial regulator YABBY 2 ...    171   6e-48    
ref|XP_006409726.1|  hypothetical protein EUTSA_v10017320mg             171   6e-48    
ref|XP_009408517.1|  PREDICTED: axial regulator YABBY 5-like            171   7e-48    
ref|XP_010250139.1|  PREDICTED: axial regulator YABBY 5-like isof...    171   8e-48    
gb|ABK25610.1|  unknown                                                 171   9e-48    
ref|XP_009398349.1|  PREDICTED: axial regulator YABBY 5-like isof...    171   9e-48    
gb|ABW80974.1|  YABBY2                                                  171   1e-47    
ref|XP_008385589.1|  PREDICTED: putative axial regulator YABBY 2 ...    171   1e-47    
gb|AID67136.1|  YAB2 protein                                            171   1e-47    
ref|XP_008810626.1|  PREDICTED: protein YABBY 2-like isoform X1         171   1e-47    
gb|EPS57324.1|  hypothetical protein M569_17494                         167   1e-47    
ref|XP_004251722.1|  PREDICTED: axial regulator YABBY 5-like isof...    171   1e-47    
ref|XP_011090281.1|  PREDICTED: putative axial regulator YABBY 2 ...    171   1e-47    
ref|XP_010417805.1|  PREDICTED: axial regulator YABBY 5-like            169   1e-47    
ref|XP_006345225.1|  PREDICTED: axial regulator YABBY 5-like            169   4e-47    
ref|XP_002442565.1|  hypothetical protein SORBIDRAFT_08g022030          169   5e-47    
gb|KHG30510.1|  Putative axial regulator YABBY 2 -like protein          168   7e-47    
gb|AEK35323.1|  YABBY2-like protein                                     168   1e-46    
gb|KHG21757.1|  Putative axial regulator YABBY 2 -like protein          167   1e-46    
ref|XP_003605973.1|  YABBY protein                                      167   2e-46    
ref|XP_007021795.1|  Plant-specific transcription factor YABBY fa...    167   3e-46    
ref|XP_010248516.1|  PREDICTED: axial regulator YABBY 4                 167   4e-46    
ref|XP_008667127.1|  PREDICTED: uncharacterized protein LOC100272...    167   4e-46    
gb|KHG24875.1|  Axial regulator YABBY 5 -like protein                   166   5e-46    
ref|NP_001140845.1|  uncharacterized protein LOC100272921               167   6e-46    
dbj|BAF65256.1|  FILAMENTOUS FLOWER like protein                        164   6e-46    
ref|XP_008444049.1|  PREDICTED: axial regulator YABBY 5-like            165   1e-45    
ref|XP_006340315.1|  PREDICTED: putative axial regulator YABBY 2-...    164   4e-45    
ref|XP_008667122.1|  PREDICTED: uncharacterized protein LOC100272...    164   4e-45    
ref|XP_010557447.1|  PREDICTED: putative axial regulator YABBY 2        164   5e-45    
gb|ACN35306.1|  unknown                                                 164   1e-44    
gb|AID67137.1|  YAB2 protein                                            163   1e-44    
ref|XP_009397431.1|  PREDICTED: protein YABBY 2-like                    162   2e-44    
gb|AID67122.1|  FAS protein                                             162   2e-44    
ref|XP_010521623.1|  PREDICTED: putative axial regulator YABBY 2        161   3e-44    
ref|XP_011024888.1|  PREDICTED: putative axial regulator YABBY 2 ...    160   5e-44    
gb|ADY39185.1|  transcription factor INO                                160   6e-44    
gb|AAR87498.1|  YABBY1                                                  158   8e-44    
gb|ADY39186.1|  transcription factor INO                                160   8e-44    
gb|AID67123.1|  FAS protein                                             160   9e-44    
ref|XP_010656451.1|  PREDICTED: axial regulator YABBY 5 isoform X2      160   1e-43    
gb|AID67126.1|  FAS protein                                             159   2e-43    
ref|XP_008812180.1|  PREDICTED: protein YABBY 7                         160   2e-43    
gb|ACG32970.1|  axial regulator YABBY2                                  160   2e-43    
ref|XP_011024889.1|  PREDICTED: putative axial regulator YABBY 2 ...    159   2e-43    
emb|CAN74459.1|  hypothetical protein VITISV_012710                     158   2e-43    
gb|AID67125.1|  FAS protein                                             159   3e-43    
gb|AAP54543.2|  YABBY protein                                           161   5e-43    
ref|XP_002299655.2|  hypothetical protein POPTR_0001s22180g             158   1e-42    
ref|XP_007013480.1|  Plant-specific transcription factor YABBY fa...    156   2e-42    
ref|XP_011044614.1|  PREDICTED: axial regulator YABBY 5-like isof...    157   3e-42    
ref|XP_004171895.1|  PREDICTED: axial regulator YABBY 5-like            155   5e-42    
ref|XP_006424060.1|  hypothetical protein CICLE_v100293541mg            155   6e-42    
ref|XP_006487834.1|  PREDICTED: putative axial regulator YABBY 2-...    155   8e-42    
gb|KCW86700.1|  hypothetical protein EUGRSUZ_B03310                     155   1e-41    
dbj|BAJ83621.1|  INO-like YABBY protein                                 154   2e-41    
ref|XP_006424061.1|  hypothetical protein CICLE_v100293541mg            153   3e-41    
ref|XP_010046639.1|  PREDICTED: axial regulator YABBY 4                 154   3e-41    
gb|KDO48953.1|  hypothetical protein CISIN_1g029862mg                   153   3e-41    
dbj|BAC82106.1|  putative transcription factor                          154   4e-41    
dbj|BAC82107.1|  putative transcription factor                          154   4e-41    
ref|XP_006600135.1|  PREDICTED: uncharacterized protein LOC100499...    152   4e-41    
ref|XP_003613209.1|  Axial regulator YABBY                              154   4e-41    
ref|XP_011044613.1|  PREDICTED: axial regulator YABBY 5-like isof...    153   5e-41    
gb|KDP26614.1|  hypothetical protein JCGZ_17772                         153   8e-41    
ref|XP_004489825.1|  PREDICTED: axial regulator YABBY 4-like            153   1e-40    
gb|KHN08994.1|  Axial regulator YABBY 4                                 152   2e-40    
ref|XP_002323368.2|  hypothetical protein POPTR_0016s06760g             150   3e-40    
dbj|BAF65261.1|  FILAMENTOUS FLOWER like protein                        147   3e-40    
ref|XP_010247865.1|  PREDICTED: putative axial regulator YABBY 2 ...    150   4e-40    
ref|XP_003526547.1|  PREDICTED: axial regulator YABBY 4-like isof...    151   4e-40    
ref|XP_007157432.1|  hypothetical protein PHAVU_002G069700g             152   5e-40    
dbj|BAF65258.1|  FILAMENTOUS FLOWER like protein                        147   5e-40    
ref|XP_008389678.1|  PREDICTED: axial regulator YABBY 4                 151   6e-40    
gb|EYU36014.1|  hypothetical protein MIMGU_mgv1a025679mg                149   7e-40    
dbj|BAJ83626.1|  INO-like YABBY protein                                 150   8e-40    
ref|XP_010533193.1|  PREDICTED: axial regulator YABBY 4-like isof...    151   8e-40    
gb|AAV74414.1|  filamentous flower-like yabby protein                   146   9e-40    
ref|XP_010533185.1|  PREDICTED: axial regulator YABBY 4-like isof...    150   1e-39    
ref|XP_011042560.1|  PREDICTED: putative axial regulator YABBY 2        149   1e-39    
ref|XP_010651541.1|  PREDICTED: axial regulator YABBY 4 isoform X2      149   1e-39    
ref|XP_006417686.1|  hypothetical protein EUTSA_v10008858mg             148   1e-39    
emb|CBI28560.3|  unnamed protein product                                149   2e-39    
ref|XP_010940212.1|  PREDICTED: protein YABBY 7-like                    149   2e-39    
ref|XP_007153748.1|  hypothetical protein PHAVU_003G061800g             150   2e-39    
ref|XP_010100436.1|  hypothetical protein L484_027747                   151   2e-39    
ref|NP_001058937.1|  Os07g0160100                                       148   2e-39    
gb|AAC72847.1|  unknown                                                 148   2e-39    
ref|XP_006657460.1|  PREDICTED: protein YABBY 1-like                    148   3e-39    
ref|XP_006592796.1|  PREDICTED: putative axial regulator YABBY 2-...    148   4e-39    
ref|XP_010906354.1|  PREDICTED: protein YABBY 2-like                    147   5e-39    
ref|XP_006578278.1|  PREDICTED: axial regulator YABBY 4-like isof...    148   6e-39    
ref|XP_002525393.1|  Axial regulator YABBY4, putative                   149   6e-39    
gb|KCW50950.1|  hypothetical protein EUGRSUZ_J00587                     147   9e-39    
ref|XP_006592795.1|  PREDICTED: putative axial regulator YABBY 2-...    147   1e-38    
ref|XP_007207250.1|  hypothetical protein PRUPE_ppa011880m2g            146   1e-38    
ref|XP_003523786.2|  PREDICTED: axial regulator YABBY 4-like isof...    147   1e-38    
ref|XP_010917937.1|  PREDICTED: protein YABBY 2-like isoform X2         147   1e-38    
ref|XP_007207251.1|  hypothetical protein PRUPE_ppa011880m2g            145   2e-38    



>ref|XP_009793076.1| PREDICTED: axial regulator YABBY 1 [Nicotiana sylvestris]
Length=220

 Score =   392 bits (1006),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 208/221 (94%), Gaps = 3/221 (1%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSSSS AFAPDHH HH H   PSGEQLCYV CNFCDTVLAVSVPCSSLFKTVTVRCGHCT
Sbjct  1    MSSSSAAFAPDHHLHHHHLSPPSGEQLCYVQCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  60

Query  339  NLLSVN--MRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRG  512
            NLLSVN  MRGLLLP+A NQLHLPHSFFSPQNLL+EIRN+PPSLL+NQPNPNE LMP+RG
Sbjct  61   NLLSVNVNMRGLLLPSA-NQLHLPHSFFSPQNLLEEIRNSPPSLLINQPNPNELLMPVRG  119

Query  513  VDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH  692
            VDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH
Sbjct  120  VDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH  179

Query  693  IHFGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            IHFGLMPDQPVKKPNACQQEGED LMK+GFLAP N+GVSPY
Sbjct  180  IHFGLMPDQPVKKPNACQQEGEDVLMKEGFLAPANVGVSPY  220



>ref|XP_009609785.1| PREDICTED: axial regulator YABBY 1 [Nicotiana tomentosiformis]
Length=220

 Score =   391 bits (1005),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 208/221 (94%), Gaps = 3/221 (1%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSSSS AFAPDHH HH H   PSGEQLCYV CNFCDTVLAVSVPCSSLFKTVTVRCGHCT
Sbjct  1    MSSSSAAFAPDHHLHHHHLSPPSGEQLCYVQCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  60

Query  339  NLLSVN--MRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRG  512
            NLLSVN  MRGLLLP+A NQLHLPHSFFSPQNLLDEIRN+PPSLL+NQPNPNE LMP+RG
Sbjct  61   NLLSVNVNMRGLLLPSA-NQLHLPHSFFSPQNLLDEIRNSPPSLLINQPNPNEPLMPVRG  119

Query  513  VDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH  692
            VDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH
Sbjct  120  VDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH  179

Query  693  IHFGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            IHFGLMPDQPVKKPNACQQEGED L+K+GFLAP N+GVSPY
Sbjct  180  IHFGLMPDQPVKKPNACQQEGEDVLIKEGFLAPANVGVSPY  220



>ref|XP_011090395.1| PREDICTED: axial regulator YABBY 1 [Sesamum indicum]
Length=212

 Score =   386 bits (992),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 195/219 (89%), Positives = 205/219 (94%), Gaps = 7/219 (3%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSSSS AFAPDHHH     LSPS EQLCYVHCNFCDTVLAVSVPC+SLFKTVTVRCGHCT
Sbjct  1    MSSSSAAFAPDHHH-----LSPS-EQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCT  54

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVD  518
            NLLSVNMRGLLLP A NQLHL HSFFSPQNLL+EIRN+P +LL+NQP+PNESLMP+RG+D
Sbjct  55   NLLSVNMRGLLLPAA-NQLHLGHSFFSPQNLLEEIRNSPSNLLINQPSPNESLMPVRGID  113

Query  519  ELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIH  698
            ELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIH
Sbjct  114  ELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIH  173

Query  699  FGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            FGLMPDQPVKKPN CQQEG+D LMKDGFLAP N+GVSPY
Sbjct  174  FGLMPDQPVKKPNVCQQEGDDVLMKDGFLAPANVGVSPY  212



>emb|CDP19940.1| unnamed protein product [Coffea canephora]
Length=214

 Score =   382 bits (982),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 201/219 (92%), Gaps = 5/219 (2%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSSSS    PDHHH      +P  EQLCYVHCNFCDTVLAVSVPC+SLFKTVTVRCGHCT
Sbjct  1    MSSSSAFATPDHHHLA----APPTEQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCT  56

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVD  518
            NLLSVNMRGLLLP+A NQLHL HSFFSPQNLL+E+RNTPP+LL+NQPNPNESLMP+RGVD
Sbjct  57   NLLSVNMRGLLLPSA-NQLHLGHSFFSPQNLLEELRNTPPNLLINQPNPNESLMPVRGVD  115

Query  519  ELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIH  698
            ELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIH
Sbjct  116  ELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIH  175

Query  699  FGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            FGLMPDQPVKK N CQQEGED LMKDGFLAP N+GVSPY
Sbjct  176  FGLMPDQPVKKSNVCQQEGEDVLMKDGFLAPANVGVSPY  214



>ref|XP_004229793.1| PREDICTED: axial regulator YABBY 1 [Solanum lycopersicum]
Length=242

 Score =   378 bits (970),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/221 (88%), Positives = 201/221 (91%), Gaps = 5/221 (2%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSSSS AFAPDHH HH H   PSGEQLCYV CNFCDTVLAVSVPCSS FK VTVRCGHCT
Sbjct  25   MSSSSAAFAPDHHLHHHHLSPPSGEQLCYVQCNFCDTVLAVSVPCSSFFKNVTVRCGHCT  84

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQP-NPNESLMPIRG-  512
            NLLSVN   ++LPTA NQLHLPHSFFSP NLLDEIRN PPSLLMNQ  NPNESLMP+RG 
Sbjct  85   NLLSVN---IILPTAANQLHLPHSFFSPHNLLDEIRNNPPSLLMNQQINPNESLMPVRGG  141

Query  513  VDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH  692
            VDE+PKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH
Sbjct  142  VDEIPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH  201

Query  693  IHFGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            IHFGLMPDQPVKKPNACQQEGED LMK+GFLAP N+GVSPY
Sbjct  202  IHFGLMPDQPVKKPNACQQEGEDVLMKEGFLAPANIGVSPY  242



>gb|AAS10177.1| YABBY-like transcription factor GRAMINIFOLIA [Antirrhinum majus]
Length=211

 Score =   376 bits (965),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 188/217 (87%), Positives = 202/217 (93%), Gaps = 7/217 (3%)
 Frame = +3

Query  165  SSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL  344
            SSS+AFAPDHHH     ++PS EQLCYVHCNFCDTVLAVSVPC+SL KTVTVRCGHCTNL
Sbjct  2    SSSSAFAPDHHH-----ITPS-EQLCYVHCNFCDTVLAVSVPCTSLIKTVTVRCGHCTNL  55

Query  345  LSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDEL  524
            LSVNMRGLLLP A NQLHL HSFFSPQNLL+EIRN+P +LLMNQPNPN+S+MP+RG+DEL
Sbjct  56   LSVNMRGLLLPAA-NQLHLGHSFFSPQNLLEEIRNSPSNLLMNQPNPNDSMMPVRGLDEL  114

Query  525  PKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFG  704
            PKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFG
Sbjct  115  PKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFG  174

Query  705  LMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            LMPDQPVKKPN C+Q G+D LMKDGFLAP N+GVSPY
Sbjct  175  LMPDQPVKKPNVCRQHGDDVLMKDGFLAPANVGVSPY  211



>ref|XP_006347890.1| PREDICTED: axial regulator YABBY 1-like [Solanum tuberosum]
Length=218

 Score =   374 bits (959),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 194/221 (88%), Positives = 201/221 (91%), Gaps = 5/221 (2%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSSSS AFAPDHH HH H   PSGEQLCYV CNFCDTVLAVSVPCSS FK VTVRCGHCT
Sbjct  1    MSSSSAAFAPDHHLHHHHLSPPSGEQLCYVQCNFCDTVLAVSVPCSSFFKNVTVRCGHCT  60

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQP-NPNESLMPIRG-  512
            NLLSVN   ++LPTA NQLHLPHSFFSP NLLDEIRN PPSLLMNQ  NPNESLMP+RG 
Sbjct  61   NLLSVN---IILPTAANQLHLPHSFFSPHNLLDEIRNNPPSLLMNQQINPNESLMPVRGG  117

Query  513  VDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH  692
            VD++PKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH
Sbjct  118  VDDIPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH  177

Query  693  IHFGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            IHFGLMPDQPVKKPNACQQEGED LMK+GFLAP N+GVSPY
Sbjct  178  IHFGLMPDQPVKKPNACQQEGEDVLMKEGFLAPANIGVSPY  218



>dbj|BAQ19377.1| filamentous flower [Sarracenia purpurea]
Length=213

 Score =   367 bits (941),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 183/217 (84%), Positives = 195/217 (90%), Gaps = 5/217 (2%)
 Frame = +3

Query  165  SSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL  344
            SSS AF+PDHH H    LS S EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL
Sbjct  2    SSSNAFSPDHHQH----LSASSEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL  57

Query  345  LSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDEL  524
            LSVNMRGLLLP A NQLHL HSFFSPQNLL+EIR++  +LL+NQPNP ES+ P+RGVDEL
Sbjct  58   LSVNMRGLLLP-ATNQLHLGHSFFSPQNLLEEIRSSSSNLLINQPNPTESVTPVRGVDEL  116

Query  525  PKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFG  704
            PKPP ANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFG
Sbjct  117  PKPPAANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFG  176

Query  705  LMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            L+PDQPVKK N  QQEGE+ LMKDG+L P N+GVSPY
Sbjct  177  LLPDQPVKKANVRQQEGEEVLMKDGYLGPANVGVSPY  213



>ref|XP_002280334.1| PREDICTED: axial regulator YABBY 1 isoform X2 [Vitis vinifera]
 emb|CBI38884.3| unnamed protein product [Vitis vinifera]
Length=210

 Score =   366 bits (940),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 194/217 (89%), Gaps = 8/217 (4%)
 Frame = +3

Query  165  SSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL  344
            SSS+AF+PDH       LSP+ +QLCYVHCNFCDTVLAVSVPC+SLFKTVTVRCGHCTNL
Sbjct  2    SSSSAFSPDH-------LSPTSDQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNL  54

Query  345  LSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDEL  524
            LSVNMRGLLLP A NQLHL HS FSP N+L+EIR+ P S+L+NQPNPNE++MP+RGVDE+
Sbjct  55   LSVNMRGLLLPAA-NQLHLGHSLFSPHNILEEIRSPPSSMLINQPNPNEAVMPVRGVDEI  113

Query  525  PKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFG  704
            PKPPV NRPPEKRQRVPSAYNRFIKDEIQRIKAGNP ISHREAFSAAAKNWAHFPHIHFG
Sbjct  114  PKPPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPGISHREAFSAAAKNWAHFPHIHFG  173

Query  705  LMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            LMPDQPVKK N  QQEGED LMKDGF AP N+GVSPY
Sbjct  174  LMPDQPVKKANVRQQEGEDMLMKDGFFAPANVGVSPY  210



>emb|CAN70458.1| hypothetical protein VITISV_031595 [Vitis vinifera]
Length=210

 Score =   366 bits (939),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 192/217 (88%), Gaps = 8/217 (4%)
 Frame = +3

Query  165  SSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL  344
            SSS+AF+PDH       LSP+ +QLCYVHCNFCDTVLAVSVPC+SLFKTVTVRCGHCTNL
Sbjct  2    SSSSAFSPDH-------LSPTSDQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNL  54

Query  345  LSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDEL  524
            LSVNMRGLLLP A NQLHL HS FSP N L+EIR+ P S+L NQPNPNE++MP+RGVDE+
Sbjct  55   LSVNMRGLLLPAA-NQLHLGHSLFSPHNJLEEIRSPPSSMLTNQPNPNEAVMPVRGVDEI  113

Query  525  PKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFG  704
            PKPPV NRPPEKRQRVPSAYNRFIKDEIQRIKAGNP ISHREAFSAAAKNWAHFPHIHFG
Sbjct  114  PKPPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPGISHREAFSAAAKNWAHFPHIHFG  173

Query  705  LMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            LMPDQPVKK N  QQEGED LMKDGF AP N+GVSPY
Sbjct  174  LMPDQPVKKANVRQQEGEDMLMKDGFFAPANVGVSPY  210



>gb|AGD94962.1| transcription factor YABBY1 [Vitis pseudoreticulata]
Length=210

 Score =   362 bits (929),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 192/217 (88%), Gaps = 8/217 (4%)
 Frame = +3

Query  165  SSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL  344
            SSS+AF+PDH       LSP+ +QLCYVHCNFCDT LAVSVPC+SLFKTVTVRCGHCTNL
Sbjct  2    SSSSAFSPDH-------LSPTSDQLCYVHCNFCDTALAVSVPCTSLFKTVTVRCGHCTNL  54

Query  345  LSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDEL  524
            LSVNMRGLLLP A NQLHL HS FSP NLL+EIR+ P S+L NQPNPNE++MP+RGVDE+
Sbjct  55   LSVNMRGLLLPAA-NQLHLGHSPFSPHNLLEEIRSPPSSMLTNQPNPNEAVMPVRGVDEI  113

Query  525  PKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFG  704
            PKPPV NRPPEKRQRVPSAYNRFIKDEIQRIKAGNP ISHREAFSAAAKNWAHFPHIHFG
Sbjct  114  PKPPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPGISHREAFSAAAKNWAHFPHIHFG  173

Query  705  LMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            LMPDQPVKK N  QQEGED LMKDGF AP N+GVSPY
Sbjct  174  LMPDQPVKKANVRQQEGEDMLMKDGFFAPANVGVSPY  210



>ref|XP_010661657.1| PREDICTED: axial regulator YABBY 1 isoform X1 [Vitis vinifera]
Length=211

 Score =   362 bits (928),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 194/218 (89%), Gaps = 9/218 (4%)
 Frame = +3

Query  165  SSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL  344
            SSS+AF+PDH       LSP+ +QLCYVHCNFCDTVLAVSVPC+SLFKTVTVRCGHCTNL
Sbjct  2    SSSSAFSPDH-------LSPTSDQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNL  54

Query  345  LSVNMRGLLLPTAPNQLHLPHSFFSPQNLL-DEIRNTPPSLLMNQPNPNESLMPIRGVDE  521
            LSVNMRGLLLP A NQLHL HS FSP N+L +EIR+ P S+L+NQPNPNE++MP+RGVDE
Sbjct  55   LSVNMRGLLLPAA-NQLHLGHSLFSPHNILQEEIRSPPSSMLINQPNPNEAVMPVRGVDE  113

Query  522  LPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHF  701
            +PKPPV NRPPEKRQRVPSAYNRFIKDEIQRIKAGNP ISHREAFSAAAKNWAHFPHIHF
Sbjct  114  IPKPPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPGISHREAFSAAAKNWAHFPHIHF  173

Query  702  GLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            GLMPDQPVKK N  QQEGED LMKDGF AP N+GVSPY
Sbjct  174  GLMPDQPVKKANVRQQEGEDMLMKDGFFAPANVGVSPY  211



>gb|EYU31965.1| hypothetical protein MIMGU_mgv1a013346mg [Erythranthe guttata]
Length=223

 Score =   361 bits (926),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 193/223 (87%), Positives = 204/223 (91%), Gaps = 7/223 (3%)
 Frame = +3

Query  165  SSSTAFAP--DhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            SSS+AFAP   HHHHH HHLSPS EQLCYV CNFCDTVLAVSVPC+SLFKTVTVRCGHCT
Sbjct  2    SSSSAFAPADHHHHHHNHHLSPS-EQLCYVQCNFCDTVLAVSVPCTSLFKTVTVRCGHCT  60

Query  339  NLLSVNMRGLLLPTA-PNQLHLPHSFFSPQNLLDEIRNTPPS-LLMNQPNPNES-LMPIR  509
            NLLSVNMRGLLLP A PNQLHL HSFFSPQNLL+EIR++P S +LMNQ NPNES LM IR
Sbjct  61   NLLSVNMRGLLLPAAAPNQLHLGHSFFSPQNLLEEIRSSPSSNMLMNQANPNESSLMNIR  120

Query  510  GVDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFP  689
            G++ELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFP
Sbjct  121  GIEELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFP  180

Query  690  HIHFGLMPDQPVKKPNACQQEGEDGLMKDGFL-APPNLGVSPY  815
            HIHFGLMPDQPVKKPN CQQEG+D LMKDGFL A  N+G+SPY
Sbjct  181  HIHFGLMPDQPVKKPNVCQQEGDDVLMKDGFLAAAANVGISPY  223



>ref|XP_007052113.1| Plant-specific transcription factor YABBY family protein isoform 
1 [Theobroma cacao]
 gb|EOX96270.1| Plant-specific transcription factor YABBY family protein isoform 
1 [Theobroma cacao]
Length=212

 Score =   358 bits (920),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 198/221 (90%), Gaps = 11/221 (5%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSSSS AF+PDH       LSPS +QLCYVHCNFCDTVLAVSVPC+SLFKTVTVRCGHCT
Sbjct  1    MSSSSAAFSPDH-------LSPS-DQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCT  52

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMP-IRG-  512
            NLLSVNMRGLLLP A NQLHL HSFF+PQNLL+EIR+ PP++L+NQPNP++++MP IRG 
Sbjct  53   NLLSVNMRGLLLPAA-NQLHLGHSFFTPQNLLEEIRSAPPNMLINQPNPSDTVMPAIRGG  111

Query  513  VDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH  692
            V+E+PKPPV NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH
Sbjct  112  VEEIPKPPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH  171

Query  693  IHFGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            IHFGLMPDQPVKK N  QQEGED LMKDGF A  N+GV+PY
Sbjct  172  IHFGLMPDQPVKKTNVRQQEGEDVLMKDGFFASTNVGVTPY  212



>gb|ACA64096.1| YABBY1 [Petunia x hybrida]
Length=223

 Score =   357 bits (915),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 183/197 (93%), Gaps = 3/197 (2%)
 Frame = +3

Query  228  GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPH  407
            GE LCYVHC FCDTVLAVSVP SS FK VTVRCGHCTNLLSVN+  L+LPTA NQLHL H
Sbjct  29   GEHLCYVHCTFCDTVLAVSVPSSSWFKMVTVRCGHCTNLLSVNI-SLVLPTA-NQLHLGH  86

Query  408  SFFSPQNLLDEIRNTPPSLLMNQPNPNESLMP-IRGVDELPKPPVANRPPEKRQRVPSAY  584
            SFFSPQNLLDEIRNTPPSLL+NQPNPNESLM   RGVDELPKPPVANRPPEKRQRVPSAY
Sbjct  87   SFFSPQNLLDEIRNTPPSLLINQPNPNESLMQNFRGVDELPKPPVANRPPEKRQRVPSAY  146

Query  585  NRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDG  764
            NRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGED 
Sbjct  147  NRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDV  206

Query  765  LMKDGFLAPPNLGVSPY  815
            LMK+GFLAP N+GVSPY
Sbjct  207  LMKEGFLAPANVGVSPY  223



>gb|AAO22990.1| YABBY transcription factor CDM51 [Chrysanthemum x morifolium]
Length=220

 Score =   349 bits (896),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 192/223 (86%), Gaps = 10/223 (4%)
 Frame = +3

Query  165  SSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL  344
            SSS +F+PDHHHHH   LSP+ EQLCYV CNFCDTVLAVSVPC SLF TVTVRCGHCTNL
Sbjct  2    SSSASFSPDHHHHH---LSPTSEQLCYVQCNFCDTVLAVSVPCGSLFTTVTVRCGHCTNL  58

Query  345  LSVNMRGLLLPT------APNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPI  506
            LSVNMR LL P       A NQ HL H+FFS Q+L++E+RNTP +L +NQPNPN+   P+
Sbjct  59   LSVNMRALLFPASVTTTAAANQFHLGHNFFSAQSLMEEMRNTPANLFLNQPNPNDHFGPV  118

Query  507  RGVDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  686
            R VDELPKPPVANRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHF
Sbjct  119  R-VDELPKPPVANRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHF  177

Query  687  PHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            PHIHFGLMPDQPVKKPN CQQ+GED LMKDGFLA  N+GVSPY
Sbjct  178  PHIHFGLMPDQPVKKPNVCQQDGEDLLMKDGFLATANVGVSPY  220



>gb|EYU31966.1| hypothetical protein MIMGU_mgv1a013346mg [Erythranthe guttata]
Length=219

 Score =   348 bits (892),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 190/223 (85%), Positives = 201/223 (90%), Gaps = 11/223 (5%)
 Frame = +3

Query  165  SSSTAFAP--DhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            SSS+AFAP   HHHHH HHLSPS EQLCYV CNFCDTVLAVSVPC+SLFKTVTVRCGHCT
Sbjct  2    SSSSAFAPADHHHHHHNHHLSPS-EQLCYVQCNFCDTVLAVSVPCTSLFKTVTVRCGHCT  60

Query  339  NLLSVNMRGLLLPTA-PNQLHLPHSFFSPQNLLDEIRNTPPS-LLMNQPNPNES-LMPIR  509
            NLLSVNMRGLLLP A PNQLHL HSFFSPQNLL+EIR++P S +LMNQ NPNES LM IR
Sbjct  61   NLLSVNMRGLLLPAAAPNQLHLGHSFFSPQNLLEEIRSSPSSNMLMNQANPNESSLMNIR  120

Query  510  GVDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFP  689
            G++ELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFP
Sbjct  121  GIEELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFP  180

Query  690  HIHFGLMPDQPVKKPNACQQEGEDGLMKDGFL-APPNLGVSPY  815
            HIHFGLMPDQPVKKPN    EG+D LMKDGFL A  N+G+SPY
Sbjct  181  HIHFGLMPDQPVKKPN----EGDDVLMKDGFLAAAANVGISPY  219



>ref|XP_002320712.1| abnormal floral organs family protein [Populus trichocarpa]
 gb|EEE99027.1| abnormal floral organs family protein [Populus trichocarpa]
Length=212

 Score =   347 bits (889),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 174/222 (78%), Positives = 190/222 (86%), Gaps = 13/222 (6%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            M+SSS AF+PDH          S +QLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT
Sbjct  1    MASSSAAFSPDHLS--------SSDQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  52

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSPQ-NLLDEIRNT--PPSLLMNQPNPNESLMPIR  509
            NL SVNMR LL   A NQ +L H FF+PQ N+L+ +R+T  PPSL++NQPNPNES+MPIR
Sbjct  53   NLFSVNMRSLL--PAANQFYLGHGFFNPQINILEGMRSTGAPPSLMINQPNPNESVMPIR  110

Query  510  GVDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFP  689
            GV+E+PKPPV NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFP
Sbjct  111  GVEEIPKPPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFP  170

Query  690  HIHFGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            HIHFGLMPDQPVKK N  QQEGED LMKDGF AP N+GV+PY
Sbjct  171  HIHFGLMPDQPVKKTNVRQQEGEDVLMKDGFFAPANVGVTPY  212



>gb|KDP28784.1| hypothetical protein JCGZ_14555 [Jatropha curcas]
Length=212

 Score =   342 bits (876),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 176/221 (80%), Positives = 191/221 (86%), Gaps = 11/221 (5%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSSSS AF+PDH       LSPS E LCYVHC FCDT LAVSVPCSSLFKTVTVRCGHCT
Sbjct  1    MSSSSAAFSPDH-------LSPSDE-LCYVHCKFCDTFLAVSVPCSSLFKTVTVRCGHCT  52

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRN-TPPSLLMNQPNPNESLMPIRG-  512
            NLL+V+MR LLLP A NQLHL H FF+PQN+L+EIR+ TPP++L+NQP+PNE +MP+RG 
Sbjct  53   NLLTVDMRRLLLPAA-NQLHLGHPFFNPQNILEEIRSATPPNMLINQPSPNEPIMPVRGG  111

Query  513  VDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH  692
            V+ELPKPPV NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH
Sbjct  112  VEELPKPPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH  171

Query  693  IHFGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            IHFGLMPDQPVKK N  QQEGED LMKDGF    N+ VSPY
Sbjct  172  IHFGLMPDQPVKKTNVRQQEGEDVLMKDGFYCAANVDVSPY  212



>gb|KCW73030.1| hypothetical protein EUGRSUZ_E01474 [Eucalyptus grandis]
Length=290

 Score =   343 bits (880),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 192/225 (85%), Gaps = 12/225 (5%)
 Frame = +3

Query  153  KNMSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGH  332
            +N  SSS+AF+PD        LSP  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGH
Sbjct  74   RNNMSSSSAFSPDP-------LSP-NEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGH  125

Query  333  CTNLLSVNMRGLLLPTAP-NQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIR  509
            CTNLLSVNMR LLLP AP NQLHL HS+F+PQNLL+EIRN P ++LMNQ  PNE +M +R
Sbjct  126  CTNLLSVNMRSLLLPPAPANQLHLGHSYFTPQNLLEEIRNVPSNMLMNQTIPNEPMMQLR  185

Query  510  G-VDELPKPP-VANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAH  683
            G ++++PKPP V NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAH
Sbjct  186  GGIEDIPKPPPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAH  245

Query  684  FPHIHFGLMPD-QPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            FPHIHFGLMPD QPVKK N  QQEGED LMKDGF  P N+GVSPY
Sbjct  246  FPHIHFGLMPDHQPVKKANLRQQEGEDVLMKDGFFTPTNVGVSPY  290



>ref|XP_010056343.1| PREDICTED: axial regulator YABBY 1-like [Eucalyptus grandis]
Length=214

 Score =   340 bits (871),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 176/221 (80%), Positives = 191/221 (86%), Gaps = 12/221 (5%)
 Frame = +3

Query  165  SSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL  344
            SSS+AF+PD        LSP+ EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL
Sbjct  2    SSSSAFSPDP-------LSPN-EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL  53

Query  345  LSVNMRGLLLPTAP-NQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRG-VD  518
            LSVNMR LLLP AP NQLHL HS+F+PQNLL+EIRN P ++LMNQ  PNE +M +RG ++
Sbjct  54   LSVNMRSLLLPPAPANQLHLGHSYFTPQNLLEEIRNVPSNMLMNQTIPNEPMMQLRGGIE  113

Query  519  ELPKPP-VANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHI  695
            ++PKPP V NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHI
Sbjct  114  DIPKPPPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHI  173

Query  696  HFGLMPD-QPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            HFGLMPD QPVKK N  QQEGED LMKDGF  P N+GVSPY
Sbjct  174  HFGLMPDHQPVKKANLRQQEGEDVLMKDGFFTPTNVGVSPY  214



>gb|KHG22928.1| Axial regulator YABBY 1 -like protein [Gossypium arboreum]
Length=220

 Score =   337 bits (865),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 171/222 (77%), Positives = 191/222 (86%), Gaps = 12/222 (5%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSSSS AF+PDH       +SPS +QLCYVHCNFCDTVLAVSVPC+SLFKTVTVRCGHCT
Sbjct  1    MSSSSAAFSPDH-------VSPS-DQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCT  52

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPS-LLMNQPNPNESLMP--IR  509
            NLLSVNM GLLLPT  NQ H+ HSFF+P NLL+EIR++  + +++NQPNPN SLMP    
Sbjct  53   NLLSVNMLGLLLPTT-NQHHVGHSFFTPHNLLEEIRSSATTNMVINQPNPNNSLMPPIHG  111

Query  510  GVDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFP  689
            G +++PKPPV NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFP
Sbjct  112  GAEDIPKPPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFP  171

Query  690  HIHFGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            HIHFGLMPDQPVKK N  QQEGE+ +MKDGF AP N+GV+PY
Sbjct  172  HIHFGLMPDQPVKKTNVHQQEGEEMVMKDGFFAPKNVGVTPY  213



>ref|XP_011033940.1| PREDICTED: axial regulator YABBY 1 [Populus euphratica]
Length=212

 Score =   336 bits (861),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 178/200 (89%), Gaps = 5/200 (3%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLP  404
            S +QLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL SV MR LL   A NQ +L 
Sbjct  15   SSDQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLFSVTMRSLL--PAANQFYLG  72

Query  405  HSFFSPQ-NLLDEIRNT--PPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVP  575
            H FF+PQ N+L+ +R+T  PPSL++NQPNPNESLMPIRGV+E+PKPPV NRPPEKRQRVP
Sbjct  73   HGFFNPQINILEGMRSTGAPPSLMINQPNPNESLMPIRGVEEIPKPPVVNRPPEKRQRVP  132

Query  576  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEG  755
            SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKK +  QQEG
Sbjct  133  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKTDVRQQEG  192

Query  756  EDGLMKDGFLAPPNLGVSPY  815
            ED LMKDGF AP N+GV+PY
Sbjct  193  EDVLMKDGFFAPANVGVTPY  212



>ref|XP_010053914.1| PREDICTED: axial regulator YABBY 1 [Eucalyptus grandis]
 gb|KCW78296.1| hypothetical protein EUGRSUZ_D02474 [Eucalyptus grandis]
Length=222

 Score =   335 bits (859),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 189/215 (88%), Gaps = 7/215 (3%)
 Frame = +3

Query  177  AFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVN  356
             FAPDHHHH    LS   EQLCYVHCN+CDTVLAVSVPC+SLFKTVTVRCGHCTNLLSVN
Sbjct  13   GFAPDHHHH----LSSPTEQLCYVHCNYCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVN  68

Query  357  MRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRG-VDELPKP  533
            MRG+LLP+A NQL L H++F+PQNLL+EIRN PPSLL+NQ +P +S+M +RG  +++PKP
Sbjct  69   MRGMLLPSA-NQLQLGHNYFTPQNLLEEIRNAPPSLLINQLSPADSIMQLRGGAEQIPKP  127

Query  534  PVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMP  713
            PV NRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMP
Sbjct  128  PVVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMP  187

Query  714  DQPVKKPNACQQEGEDGLMKDGFL-APPNLGVSPY  815
            DQPVKK N CQQEGED L KDG L A  N+GVSPY
Sbjct  188  DQPVKKTNICQQEGEDVLRKDGGLFATANVGVSPY  222



>ref|XP_011017468.1| PREDICTED: axial regulator YABBY 1 [Populus euphratica]
 ref|XP_011017469.1| PREDICTED: axial regulator YABBY 1 [Populus euphratica]
Length=210

 Score =   332 bits (851),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 182/220 (83%), Gaps = 11/220 (5%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSSSS A  PDH          S EQLCYVHCNFCDTVLAVSVPC+SL  TV VRCGHCT
Sbjct  1    MSSSSAAIGPDHLS--------SSEQLCYVHCNFCDTVLAVSVPCNSLCNTVAVRCGHCT  52

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRN-TPPSLLMNQPNPNESLMPIRGV  515
            NLLSV+M GLL   A NQ +L H FF+PQN+L+EIRN  PP+LL+NQPNPNE L+PIRGV
Sbjct  53   NLLSVSMHGLL--PAANQFYLGHGFFNPQNILEEIRNGAPPNLLINQPNPNELLIPIRGV  110

Query  516  DELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHI  695
            +E+PKPP+ NRPPEKR RVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHI
Sbjct  111  EEIPKPPMVNRPPEKRHRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHI  170

Query  696  HFGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            HFGLMPD+PVKK N  QQEGED LMKD F A  N+GV+PY
Sbjct  171  HFGLMPDEPVKKANVRQQEGEDVLMKDEFFAASNVGVTPY  210



>gb|ACL68660.1| graminifolia protein [Streptocarpus rexii]
Length=213

 Score =   331 bits (848),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 180/219 (82%), Positives = 195/219 (89%), Gaps = 9/219 (4%)
 Frame = +3

Query  165  SSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL  344
            SSS+AFAPDHHH     LSPS EQLCYV C+FCDTVLAVSVPC+SLFKTVTVRCGHCTNL
Sbjct  2    SSSSAFAPDHHH-----LSPS-EQLCYVQCDFCDTVLAVSVPCTSLFKTVTVRCGHCTNL  55

Query  345  LSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNES-LMPIRGVDE  521
            LSVNMRGLLLP APNQL L HSFFSP NLL+EI N+P +++ NQPNPNE  ++P+RG+DE
Sbjct  56   LSVNMRGLLLP-APNQLQLGHSFFSPHNLLEEIHNSPSNMMNNQPNPNEIFIVPVRGIDE  114

Query  522  LPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHF  701
            LPKPPV NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHF
Sbjct  115  LPKPPVTNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHF  174

Query  702  GLMPDQPVKKPNACQQEGED-GLMKDGFLAPPNLGVSPY  815
            GLMPDQ VKK + CQQEG+D  L KDGFLAP N+GVSPY
Sbjct  175  GLMPDQLVKKQSVCQQEGDDVVLTKDGFLAPANVGVSPY  213



>ref|XP_010264212.1| PREDICTED: protein YABBY 4-like [Nelumbo nucifera]
Length=211

 Score =   329 bits (844),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 187/219 (85%), Gaps = 11/219 (5%)
 Frame = +3

Query  165  SSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL  344
            SSS+AF+ DH       LSPS EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL
Sbjct  2    SSSSAFSLDH-------LSPS-EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL  53

Query  345  LSVNMRGLLLPTAPNQLHLPHSFFSP-QNLLDEIRNTPPSLLMNQPNPNESLMPIRG-VD  518
            LSVNMRGLLLP A NQLHL ++FFSP  N L+EI +  P+LL++QPNPN+S++ +RG  D
Sbjct  54   LSVNMRGLLLPAA-NQLHLGNTFFSPSHNFLEEIPSPQPNLLIDQPNPNDSIVSVRGGSD  112

Query  519  ELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIH  698
            ELP+PP  NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDI+HREAFSAAAKNWAHFPHIH
Sbjct  113  ELPRPPAVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHFPHIH  172

Query  699  FGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            FGLMPDQ VKK N  QQEGE+ LMKDG  A  N+GVSPY
Sbjct  173  FGLMPDQTVKKSNVRQQEGEEVLMKDGIFASANVGVSPY  211



>ref|XP_003517025.1| PREDICTED: axial regulator YABBY 1-like [Glycine max]
 gb|KHN47898.1| Axial regulator YABBY 1 [Glycine soja]
Length=215

 Score =   323 bits (829),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 181/205 (88%), Gaps = 8/205 (4%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS +QLCYVHCNFCDTVLAVSVPC+SLFKTVTVRCGHCTNLLSVNMRGLLLP+A NQL
Sbjct  14   LSPS-DQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPSA-NQL  71

Query  396  HLPHSFFSPQNLLDEIRNTPPS-LLMNQ-PNPNESLMPIR--GVDELPKPPVANRPPEKR  563
            HL HSFF+PQNLL+EIRN P + ++MNQ PNPN+ +M     G +E PKPP ANRPPEKR
Sbjct  72   HLGHSFFTPQNLLEEIRNAPSTNMMMNQLPNPNDLVMSTMRGGPEETPKPPSANRPPEKR  131

Query  564  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKKPNA  740
            QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD QPVKK N 
Sbjct  132  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDNQPVKKANV  191

Query  741  CQQEGEDGLMKDGFLAPPNLGVSPY  815
             +QE ED LMKDGF AP N+GVSPY
Sbjct  192  -RQEAEDVLMKDGFFAPANVGVSPY  215



>ref|XP_006445302.1| hypothetical protein CICLE_v10022170mg [Citrus clementina]
 ref|XP_006490878.1| PREDICTED: axial regulator YABBY 1-like [Citrus sinensis]
 gb|ESR58542.1| hypothetical protein CICLE_v10022170mg [Citrus clementina]
 gb|KDO85745.1| hypothetical protein CISIN_1g027215mg [Citrus sinensis]
Length=218

 Score =   322 bits (826),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/225 (76%), Positives = 187/225 (83%), Gaps = 16/225 (7%)
 Frame = +3

Query  162  SSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTN  341
            SS+  A +PDH          S EQLCYVHC FCDTVLAVSVPC+SLFKTVTVRCGHCTN
Sbjct  3    SSTPAALSPDHLS--------SSEQLCYVHCTFCDTVLAVSVPCTSLFKTVTVRCGHCTN  54

Query  342  LLSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLM-NQPNP-NESLMPIRGV  515
            LLSVNMRGLLLP A NQLHL H FF+PQNLL+EIRN P ++LM N PNP ++S+MP+R V
Sbjct  55   LLSVNMRGLLLPAA-NQLHLGHPFFTPQNLLEEIRNVPANMLMINPPNPADQSVMPVRVV  113

Query  516  D--ELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFP  689
            D  E+PK PV NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFP
Sbjct  114  DHQEIPKSPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFP  173

Query  690  HIHFGLMP-DQPVKKPNA-CQQEGEDGLMKDGFLAP-PNLGVSPY  815
            HIHFGLMP DQPVKK +   QQEGED ++KDGF AP  N+GV+PY
Sbjct  174  HIHFGLMPSDQPVKKTSVRQQQEGEDAMIKDGFFAPAANVGVTPY  218



>ref|XP_007039924.1| Plant-specific transcription factor YABBY family protein [Theobroma 
cacao]
 gb|EOY24425.1| Plant-specific transcription factor YABBY family protein [Theobroma 
cacao]
Length=211

 Score =   322 bits (825),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 171/200 (86%), Gaps = 3/200 (2%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRGLLLP+A NQLHL
Sbjct  13   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSA-NQLHL  71

Query  402  PHSFFSP-QNLLDEIRNTPPSLLMNQPNPNESLMPIRGV-DELPKPPVANRPPEKRQRVP  575
             HSFFSP  NLL+EI N   + L+NQ N N+  +P RGV DELP+PPV NRPPEKRQRVP
Sbjct  72   AHSFFSPSHNLLEEISNPSQNFLLNQTNTNDFALPTRGVADELPRPPVINRPPEKRQRVP  131

Query  576  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEG  755
            SAYNRFIKDEIQRIKAGNPDI+HREAFSAAAKNWAHFPHIHFGLMPDQ  KK N  QQEG
Sbjct  132  SAYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHFPHIHFGLMPDQTPKKTNVRQQEG  191

Query  756  EDGLMKDGFLAPPNLGVSPY  815
            ED L+KDGF A  N+GVSPY
Sbjct  192  EDVLIKDGFFASANVGVSPY  211



>ref|XP_003521963.1| PREDICTED: axial regulator YABBY 1-like [Glycine max]
 gb|KHN35612.1| Axial regulator YABBY 1 [Glycine soja]
Length=216

 Score =   320 bits (820),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 180/205 (88%), Gaps = 8/205 (4%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS +QLCYVHCNFCDTVLAVSVPC+SLFK VTVRCGHCTNLLSVNMRGLLLP+A NQL
Sbjct  15   LSPS-DQLCYVHCNFCDTVLAVSVPCTSLFKNVTVRCGHCTNLLSVNMRGLLLPSA-NQL  72

Query  396  HLPHSFFSPQNLLDEIRNTPPS-LLMNQ-PNPNESLMPIR--GVDELPKPPVANRPPEKR  563
            HL H+FF+PQNL++EIRN P + ++MNQ PNPN+ +M     G +E PKPP ANRPPEKR
Sbjct  73   HLGHTFFTPQNLMEEIRNAPSTNIMMNQLPNPNDLVMSTMRGGPEETPKPPSANRPPEKR  132

Query  564  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKKPNA  740
            QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD QPVKK N 
Sbjct  133  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDNQPVKKANV  192

Query  741  CQQEGEDGLMKDGFLAPPNLGVSPY  815
             +QE ED LMKDGF AP N+GVSPY
Sbjct  193  -RQEAEDVLMKDGFFAPANVGVSPY  216



>ref|XP_007134824.1| hypothetical protein PHAVU_010G079200g [Phaseolus vulgaris]
 gb|ESW06818.1| hypothetical protein PHAVU_010G079200g [Phaseolus vulgaris]
Length=215

 Score =   318 bits (816),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 181/205 (88%), Gaps = 8/205 (4%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS +QLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLP+A NQ+
Sbjct  14   LSPS-DQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPSA-NQI  71

Query  396  HLPHSFFSPQNLLDEIRNTPPS-LLMNQ-PNPNESLMPIR--GVDELPKPPVANRPPEKR  563
            HL H+FF+PQNLL+EIRN P + ++MNQ PNPN+ +M     G +E PKPP ANRPPEKR
Sbjct  72   HLGHTFFTPQNLLEEIRNAPSTNMVMNQMPNPNDLVMRTMRGGPEETPKPPSANRPPEKR  131

Query  564  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKKPNA  740
            QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD QPVKK N 
Sbjct  132  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDHQPVKKANV  191

Query  741  CQQEGEDGLMKDGFLAPPNLGVSPY  815
             +QE ED L+KDGF AP N+GVSP+
Sbjct  192  -RQEAEDVLIKDGFFAPANVGVSPF  215



>gb|KDO48375.1| hypothetical protein CISIN_1g028144mg [Citrus sinensis]
Length=213

 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 173/201 (86%), Gaps = 4/201 (2%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P+ EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRGLLLP+A NQ HL
Sbjct  14   PTSEQLCYVHCNLCDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSA-NQFHL  72

Query  402  PHSFFSP-QNLLDEIRNTPPSLLMNQPNPNESLMPIRGV-DELPKPPVANRPPEKRQRVP  575
             H+FFSP  NL +EI N  P+ L+NQ N N+ ++P RGV DELP+PP  +RPPEKRQRVP
Sbjct  73   GHNFFSPSHNLREEIPNPSPNFLINQTNTNDFIVPTRGVVDELPRPPATSRPPEKRQRVP  132

Query  576  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKKPNACQQE  752
            SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL+PD QPVKK N  QQE
Sbjct  133  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLVPDHQPVKKANVRQQE  192

Query  753  GEDGLMKDGFLAPPNLGVSPY  815
            GED LMKDGF A  N+GVSPY
Sbjct  193  GEDVLMKDGFFASANVGVSPY  213



>gb|ACU23522.1| unknown [Glycine max]
Length=216

 Score =   317 bits (813),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 181/205 (88%), Gaps = 8/205 (4%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS +QLCYVHCNFCDTVLAVSVPC+SLFK VTVRCGHCTNLLSVNMRGLLLP+A NQL
Sbjct  15   LSPS-DQLCYVHCNFCDTVLAVSVPCTSLFKNVTVRCGHCTNLLSVNMRGLLLPSA-NQL  72

Query  396  HLPHSFFSPQNLLDEIRNTPPS-LLMNQ-PNPNESLM-PIRGV-DELPKPPVANRPPEKR  563
            HL H+FF+PQNL++EIRN P + ++MNQ PNPN+ +M  +RG  +E PKPP ANRPPEKR
Sbjct  73   HLGHTFFTPQNLMEEIRNAPSTNIMMNQLPNPNDLVMNTMRGGPEETPKPPSANRPPEKR  132

Query  564  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKKPNA  740
            QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD Q VKK N 
Sbjct  133  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDNQSVKKANV  192

Query  741  CQQEGEDGLMKDGFLAPPNLGVSPY  815
             +QE ED LMKDGF AP N+GVSPY
Sbjct  193  -RQEAEDVLMKDGFFAPANVGVSPY  216



>ref|XP_006440374.1| hypothetical protein CICLE_v10021834mg [Citrus clementina]
 gb|ESR53614.1| hypothetical protein CICLE_v10021834mg [Citrus clementina]
Length=215

 Score =   317 bits (813),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 173/201 (86%), Gaps = 4/201 (2%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P+ EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRGLLLP+A NQ HL
Sbjct  16   PTSEQLCYVHCNLCDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSA-NQFHL  74

Query  402  PHSFFSP-QNLLDEIRNTPPSLLMNQPNPNESLMPIRGV-DELPKPPVANRPPEKRQRVP  575
             H+FFSP  NL +EI N  P+ L+NQ N N+ ++P RGV DELP+PP  +RPPEKRQRVP
Sbjct  75   GHNFFSPSHNLREEIPNPSPNFLINQTNTNDFIVPTRGVVDELPRPPATSRPPEKRQRVP  134

Query  576  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKKPNACQQE  752
            SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL+PD QPVKK N  QQE
Sbjct  135  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLVPDHQPVKKANVRQQE  194

Query  753  GEDGLMKDGFLAPPNLGVSPY  815
            GED LMKDGF A  N+GVSPY
Sbjct  195  GEDVLMKDGFFASANVGVSPY  215



>gb|AEK35321.1| YABBY3-like protein [Eschscholzia californica subsp. californica]
Length=219

 Score =   317 bits (813),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/227 (73%), Positives = 183/227 (81%), Gaps = 16/227 (7%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSSS++AF+ DH       LS   EQLCYVHCN CDTVLAVSVPCSSLFKTVTVRCGHCT
Sbjct  1    MSSSNSAFSLDH-------LSLPSEQLCYVHCNLCDTVLAVSVPCSSLFKTVTVRCGHCT  53

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSP-------QNLLDEIRNTPPSLLMNQPNPNESL  497
            NLLSVNMRGLLLP+  +QL L HSFFSP        NL +EI +  P++ ++Q + N S 
Sbjct  54   NLLSVNMRGLLLPST-DQLQLTHSFFSPTTTTTTTHNLREEIPSQAPNMFIDQQSQNNSR  112

Query  498  MPIRGVDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNW  677
            M IRG DEL KPPVANRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDI+HREAFSAAAKNW
Sbjct  113  MQIRGQDELHKPPVANRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDITHREAFSAAAKNW  172

Query  678  AHFPHIHFGLMPDQ-PVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            AHFPHIHFGLMPDQ P KKPN  QQEGE+ L+KDGF  P N+G+SPY
Sbjct  173  AHFPHIHFGLMPDQNPGKKPNLHQQEGEEVLLKDGFCTPANVGISPY  219



>ref|XP_009375773.1| PREDICTED: axial regulator YABBY 1 isoform X2 [Pyrus x bretschneideri]
Length=232

 Score =   318 bits (814),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 182/212 (86%), Gaps = 13/212 (6%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPN--  389
            LSP+ +QLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHC+NL+SVNMR LLLP A N  
Sbjct  22   LSPT-DQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCSNLISVNMRALLLPPANNNN  80

Query  390  QLHLPHSFFS-PQNLLDEIRNTPPSLLMN-QP-NPNESLMPIRG-----VDELPKPP-VA  542
            QLHLPH FFS P NLL+EIRNTP + +MN QP   NES+MPIRG     + E+PKPP V 
Sbjct  81   QLHLPHPFFSTPHNLLEEIRNTPSNTMMNHQPCYTNESIMPIRGEGFDHLQEIPKPPAVV  140

Query  543  NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQP  722
            NRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQP
Sbjct  141  NRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQP  200

Query  723  VKKPNACQQEGEDGLMKDGFLA-PPNLGVSPY  815
            VKK N  QQEG+D LMKDGF + P N+GVSPY
Sbjct  201  VKKTNMRQQEGDDMLMKDGFFSTPANVGVSPY  232



>ref|XP_006477249.1| PREDICTED: axial regulator YABBY 3-like isoform X2 [Citrus sinensis]
Length=215

 Score =   317 bits (811),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 173/201 (86%), Gaps = 4/201 (2%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P+ EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRGLLLP+A NQ HL
Sbjct  16   PTSEQLCYVHCNLCDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSA-NQFHL  74

Query  402  PHSFFSP-QNLLDEIRNTPPSLLMNQPNPNESLMPIRGV-DELPKPPVANRPPEKRQRVP  575
             H+FFSP  NL +EI N  P+ L+NQ N N+ ++P RGV DELP+PP  +RPPEKRQRVP
Sbjct  75   GHNFFSPSHNLREEIPNPSPNFLINQTNTNDFIVPTRGVVDELPRPPATSRPPEKRQRVP  134

Query  576  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKKPNACQQE  752
            SAYNRFIKDEIQRIKAGNPDI+HREAFSAAAKNWAHFPHIHFGL+PD QPVKK N  QQE
Sbjct  135  SAYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHFPHIHFGLVPDHQPVKKANVRQQE  194

Query  753  GEDGLMKDGFLAPPNLGVSPY  815
            GED LMKDGF A  N+GVSPY
Sbjct  195  GEDVLMKDGFFASANVGVSPY  215



>ref|XP_002266233.1| PREDICTED: protein YABBY 4 [Vitis vinifera]
 emb|CBI31883.3| unnamed protein product [Vitis vinifera]
Length=211

 Score =   316 bits (809),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 170/200 (85%), Gaps = 3/200 (2%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VN+RGLLLP+A NQLHL
Sbjct  13   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNLRGLLLPSA-NQLHL  71

Query  402  PHSFFSP-QNLLDEIRNTPPSLLMNQPNPNESLMPIRG-VDELPKPPVANRPPEKRQRVP  575
             H+FFSP  NLL+EI N  P+ L+NQ   N+  +  RG  DELP+PPV NRPPEKRQRVP
Sbjct  72   GHAFFSPSHNLLEEIPNPSPNFLINQTTANDFSVSARGGADELPRPPVINRPPEKRQRVP  131

Query  576  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEG  755
            SAYNRFIKDEIQRIKAGNPDI+HREAFSAAAKNWAHFPHIHFGLMPDQ +KK N  QQEG
Sbjct  132  SAYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHFPHIHFGLMPDQTMKKTNVRQQEG  191

Query  756  EDGLMKDGFLAPPNLGVSPY  815
            ED LMKDGF A  N+GVSPY
Sbjct  192  EDVLMKDGFFASANVGVSPY  211



>ref|XP_008364378.1| PREDICTED: axial regulator YABBY 1-like isoform X2 [Malus domestica]
Length=233

 Score =   317 bits (811),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 173/230 (75%), Positives = 190/230 (83%), Gaps = 13/230 (6%)
 Frame = +3

Query  162  SSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTN  341
            ++SST F      HH H LSP+ +QLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHC+N
Sbjct  5    AASSTVFNSQDQQHHHHLLSPT-DQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCSN  63

Query  342  LLSVNMRGLLLPTAPN--QLHLPHSFFS-PQNLLDEIRNTPPSLLMN-QP-NPNESLMPI  506
            L+SVNM  LLLP A N  QLHLPH FFS P NLL+EIRNTP + +MN QP   NES+MPI
Sbjct  64   LISVNMCALLLPPANNNNQLHLPHPFFSTPHNLLEEIRNTPSNTMMNHQPCYTNESIMPI  123

Query  507  RG-----VDELPKPP-VANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAA  668
            RG     + E+PKPP V NRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAA
Sbjct  124  RGEGFEHLQEIPKPPAVVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAA  183

Query  669  KNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFLA-PPNLGVSPY  815
            KNWAHFPHIHFGLMPDQPVKK N  QQEG+D L+KDGF + P N+GVSPY
Sbjct  184  KNWAHFPHIHFGLMPDQPVKKTNMRQQEGDDMLVKDGFFSTPANVGVSPY  233



>ref|XP_010259025.1| PREDICTED: protein YABBY 4-like [Nelumbo nucifera]
Length=211

 Score =   316 bits (809),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 173/219 (79%), Positives = 190/219 (87%), Gaps = 11/219 (5%)
 Frame = +3

Query  165  SSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL  344
            SSS+AF+ DH       LSPS EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL
Sbjct  2    SSSSAFSLDH-------LSPS-EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL  53

Query  345  LSVNMRGLLLPTAPNQLHLPHSFFSP-QNLLDEIRNTPPSLLMNQPNPNESLMPIRG-VD  518
            LSVNMRGLLLP A NQLHL ++FFSP +N L+EI +  P+LL++QPNP +S++ +RG  D
Sbjct  54   LSVNMRGLLLPAA-NQLHLGNTFFSPSRNFLEEIPSPQPNLLIDQPNPTDSIVSVRGGSD  112

Query  519  ELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIH  698
            ELP+PPV NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDI+HREAFSAAAKNWAHFPHIH
Sbjct  113  ELPRPPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHFPHIH  172

Query  699  FGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            FGLMPDQ VKKPN  QQEGED LMKDGF A  N+GVSPY
Sbjct  173  FGLMPDQTVKKPNVRQQEGEDVLMKDGFFASANVGVSPY  211



>gb|KDO85746.1| hypothetical protein CISIN_1g027215mg [Citrus sinensis]
Length=226

 Score =   315 bits (807),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 170/233 (73%), Positives = 187/233 (80%), Gaps = 24/233 (10%)
 Frame = +3

Query  162  SSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAV--------SVPCSSLFKTVT  317
            SS+  A +PDH          S EQLCYVHC FCDTVLAV        SVPC+SLFKTVT
Sbjct  3    SSTPAALSPDHLS--------SSEQLCYVHCTFCDTVLAVPYHFIFSVSVPCTSLFKTVT  54

Query  318  VRCGHCTNLLSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLM-NQPNP-NE  491
            VRCGHCTNLLSVNMRGLLLP A NQLHL H FF+PQNLL+EIRN P ++LM N PNP ++
Sbjct  55   VRCGHCTNLLSVNMRGLLLPAA-NQLHLGHPFFTPQNLLEEIRNVPANMLMINPPNPADQ  113

Query  492  SLMPIRGVD--ELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAA  665
            S+MP+R VD  E+PK PV NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAA
Sbjct  114  SVMPVRVVDHQEIPKSPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAA  173

Query  666  AKNWAHFPHIHFGLMP-DQPVKKPNA-CQQEGEDGLMKDGFLAP-PNLGVSPY  815
            AKNWAHFPHIHFGLMP DQPVKK +   QQEGED ++KDGF AP  N+GV+PY
Sbjct  174  AKNWAHFPHIHFGLMPSDQPVKKTSVRQQQEGEDAMIKDGFFAPAANVGVTPY  226



>gb|KDP25628.1| hypothetical protein JCGZ_20784 [Jatropha curcas]
Length=213

 Score =   313 bits (803),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 172/204 (84%), Gaps = 6/204 (3%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS EQLCYV CN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMR L+LP+A NQ 
Sbjct  12   LSPS-EQLCYVQCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRALILPSA-NQF  69

Query  396  HLPHSFFSP-QNLLDEIRNTPPSLLMNQPNPNESLMPIRGV--DELPKPPVANRPPEKRQ  566
            HL HSF+SP  NLLDEI N  P+ L+NQ N N   +P RGV  DELP+PPV NRPPEKRQ
Sbjct  70   HLGHSFYSPSHNLLDEIPNQTPNFLINQTNVNNFSVPSRGVTHDELPRPPVINRPPEKRQ  129

Query  567  RVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQ  746
            RVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQ VKK N  Q
Sbjct  130  RVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQTVKKTNMRQ  189

Query  747  QEG-EDGLMKDGFLAPPNLGVSPY  815
            QEG +D LMKDGF A  N+GVSPY
Sbjct  190  QEGSDDVLMKDGFFASANVGVSPY  213



>ref|XP_002304427.1| hypothetical protein POPTR_0003s11230g [Populus trichocarpa]
 gb|EEE79406.1| hypothetical protein POPTR_0003s11230g [Populus trichocarpa]
Length=213

 Score =   313 bits (803),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 170/199 (85%), Gaps = 5/199 (3%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPHS  410
            EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRGLLLP+A NQ HL HS
Sbjct  16   EQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSA-NQFHLGHS  74

Query  411  FFSP-QNLLDEIRNTPPSLLMNQPNPNESLMPIRGV--DELPKPPVANRPPEKRQRVPSA  581
            FFSP  NLLDEI N  P+ L+NQ N N+  +P+RG+   ELP+PPV NRPPEKRQRVPSA
Sbjct  75   FFSPSHNLLDEIPNPTPNFLINQTNVNDFSVPVRGMADHELPRPPVINRPPEKRQRVPSA  134

Query  582  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGED  761
            YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQ VKK N  QQEGED
Sbjct  135  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQMVKKTNVRQQEGED  194

Query  762  GLMKDGFLAPPNLGV-SPY  815
             LMKDGF +  N GV +PY
Sbjct  195  VLMKDGFFSSANAGVPTPY  213



>ref|XP_002532573.1| Axial regulator YABBY1, putative [Ricinus communis]
 gb|EEF29807.1| Axial regulator YABBY1, putative [Ricinus communis]
Length=214

 Score =   313 bits (802),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 172/203 (85%), Gaps = 6/203 (3%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P+ EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRGL+LP+A NQ HL
Sbjct  13   PTSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLILPSA-NQFHL  71

Query  402  PHSFFSPQ-NLLDEIRNTPPSLLMNQPNPNESLMPIRGV-DELPKPPVANRPPEKRQRVP  575
             HSFFSP  N+LDEI N  P+ L+NQ N N+  +P RG+ DELP+PPV NRPPEKRQRVP
Sbjct  72   GHSFFSPHHNILDEIPNPSPNFLINQTNVNDFSIPTRGMTDELPRPPVINRPPEKRQRVP  131

Query  576  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQ--Q  749
            SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQ VKK N  Q   
Sbjct  132  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQTVKKTNVRQVTY  191

Query  750  EGEDGLMKDGFLAPPNLGV-SPY  815
            EGED +MKDGF A  N+GV +PY
Sbjct  192  EGEDVMMKDGFFASANVGVTTPY  214



>gb|KHG29380.1| Axial regulator YABBY 1 -like protein [Gossypium arboreum]
Length=207

 Score =   313 bits (801),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 171/200 (86%), Gaps = 7/200 (4%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRGLL+P+A NQ HL
Sbjct  13   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLMPSA-NQFHL  71

Query  402  PHSFFSP-QNLLDEIRNTPPSLLMNQPNPNESLMPIRGV-DELPKPPVANRPPEKRQRVP  575
            PH+FF+P  NLL+EI N  P++L+NQ N ++  +P RGV DELP+PPV NRPPEKRQRVP
Sbjct  72   PHNFFTPSHNLLEEISNPSPNILLNQGNTSDITLPTRGVVDELPRPPVINRPPEKRQRVP  131

Query  576  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEG  755
            SAYNRFIKDEIQRIKAGNPDI+HREAFSAAAKNWAHFPHIHFGLMPDQP K+ N    E 
Sbjct  132  SAYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHFPHIHFGLMPDQPAKRTN----ES  187

Query  756  EDGLMKDGFLAPPNLGVSPY  815
            ED LMKDGF A  N+GV+PY
Sbjct  188  EDVLMKDGFFASANVGVTPY  207



>ref|XP_004306943.1| PREDICTED: axial regulator YABBY 1-like [Fragaria vesca subsp. 
vesca]
Length=218

 Score =   313 bits (802),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 188/225 (84%), Gaps = 18/225 (8%)
 Frame = +3

Query  162  SSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTN  341
            +SS+T F+P      P HLSPS +QLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHC+N
Sbjct  5    ASSNTVFSP------PDHLSPS-DQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCSN  57

Query  342  LLSVNMRGLLLPTAPNQLHLPHSFFSPQNLL-DEIRNTPPSLLMNQPNP--NESLMP-IR  509
            LLSVNMRGLLLP A N   L HSFF+PQNLL +EIRN P +   NQPN   NES MP IR
Sbjct  58   LLSVNMRGLLLPAAAN---LGHSFFTPQNLLQEEIRNAPSNTFTNQPNMMMNESFMPMIR  114

Query  510  GVDELPKPP-VANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  686
            GV+E+PKPP V NRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHF
Sbjct  115  GVEEIPKPPPVVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHF  174

Query  687  PHIHFGLMPDQPVKKPNACQQEGEDGLMKD-GFL-APPNLGVSPY  815
            PHIHFGLMPDQPVKK N  +Q+GED L+KD GF  A  NLGVSPY
Sbjct  175  PHIHFGLMPDQPVKKANM-RQDGEDMLIKDNGFFNAAANLGVSPY  218



>ref|XP_009375772.1| PREDICTED: axial regulator YABBY 1 isoform X1 [Pyrus x bretschneideri]
Length=233

 Score =   313 bits (801),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 182/213 (85%), Gaps = 14/213 (7%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPN--  389
            LSP+ +QLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHC+NL+SVNMR LLLP A N  
Sbjct  22   LSPT-DQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCSNLISVNMRALLLPPANNNN  80

Query  390  QLHLPHSFFS-PQNLL-DEIRNTPPSLLMN-QP-NPNESLMPIRG-----VDELPKPP-V  539
            QLHLPH FFS P NLL +EIRNTP + +MN QP   NES+MPIRG     + E+PKPP V
Sbjct  81   QLHLPHPFFSTPHNLLQEEIRNTPSNTMMNHQPCYTNESIMPIRGEGFDHLQEIPKPPAV  140

Query  540  ANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQ  719
             NRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQ
Sbjct  141  VNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQ  200

Query  720  PVKKPNACQQEGEDGLMKDGFLA-PPNLGVSPY  815
            PVKK N  QQEG+D LMKDGF + P N+GVSPY
Sbjct  201  PVKKTNMRQQEGDDMLMKDGFFSTPANVGVSPY  233



>ref|XP_003549900.1| PREDICTED: protein YABBY 4-like [Glycine max]
 gb|KHN09788.1| Protein YABBY 5 [Glycine soja]
Length=215

 Score =   312 bits (799),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 169/203 (83%), Gaps = 6/203 (3%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRGLL+P+ P Q HL
Sbjct  14   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLMPS-PTQFHL  72

Query  402  PHSFFSP-QNLLDEIRNTPPSLLMNQPN---PNESLMPIR-GVDELPKPPVANRPPEKRQ  566
             HSFFSP  NLL+EI N  P+ LMNQ N    +E  MP R   DELP+PP+ NRPPEKRQ
Sbjct  73   GHSFFSPSHNLLEEIPNPTPNFLMNQTNFSASHEFSMPARTAADELPRPPITNRPPEKRQ  132

Query  567  RVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQ  746
            RVPSAYNRFIKDEIQRIK+ NPDI+HREAFSAAAKNWAHFPHIHFGLMPDQ VKK N CQ
Sbjct  133  RVPSAYNRFIKDEIQRIKSVNPDITHREAFSAAAKNWAHFPHIHFGLMPDQTVKKTNVCQ  192

Query  747  QEGEDGLMKDGFLAPPNLGVSPY  815
            Q+GE+ LMKDGF A  N+GVSPY
Sbjct  193  QDGEEVLMKDGFYASANVGVSPY  215



>ref|XP_008364377.1| PREDICTED: axial regulator YABBY 1-like isoform X1 [Malus domestica]
 gb|ADL36867.1| YABBY domain class transcription factor [Malus domestica]
Length=234

 Score =   312 bits (800),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 190/231 (82%), Gaps = 14/231 (6%)
 Frame = +3

Query  162  SSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTN  341
            ++SST F      HH H LSP+ +QLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHC+N
Sbjct  5    AASSTVFNSQDQQHHHHLLSPT-DQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCSN  63

Query  342  LLSVNMRGLLLPTAPN--QLHLPHSFFS-PQNLL-DEIRNTPPSLLMN-QP-NPNESLMP  503
            L+SVNM  LLLP A N  QLHLPH FFS P NLL +EIRNTP + +MN QP   NES+MP
Sbjct  64   LISVNMCALLLPPANNNNQLHLPHPFFSTPHNLLQEEIRNTPSNTMMNHQPCYTNESIMP  123

Query  504  IRG-----VDELPKPP-VANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAA  665
            IRG     + E+PKPP V NRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAA
Sbjct  124  IRGEGFEHLQEIPKPPAVVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAA  183

Query  666  AKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFLA-PPNLGVSPY  815
            AKNWAHFPHIHFGLMPDQPVKK N  QQEG+D L+KDGF + P N+GVSPY
Sbjct  184  AKNWAHFPHIHFGLMPDQPVKKTNMRQQEGDDMLVKDGFFSTPANVGVSPY  234



>ref|XP_011033925.1| PREDICTED: protein YABBY 4-like [Populus euphratica]
Length=213

 Score =   311 bits (798),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 169/199 (85%), Gaps = 5/199 (3%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPHS  410
            EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHC+NLL VNMRGLLLP+A NQ HL HS
Sbjct  16   EQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCSNLLPVNMRGLLLPSA-NQFHLGHS  74

Query  411  FFSP-QNLLDEIRNTPPSLLMNQPNPNESLMPIRGV--DELPKPPVANRPPEKRQRVPSA  581
            FFSP  NLLDEI N  P+ L+NQ N N+  +P+RG+   ELP+PPV NRPPEKRQRVPSA
Sbjct  75   FFSPSHNLLDEIPNPTPNFLINQTNVNDFSVPVRGMADHELPRPPVINRPPEKRQRVPSA  134

Query  582  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGED  761
            YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQ VK+ N  QQEGED
Sbjct  135  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQTVKRTNVRQQEGED  194

Query  762  GLMKDGFLAPPNLGV-SPY  815
             LMKDGF    N GV +PY
Sbjct  195  VLMKDGFFTSANAGVPTPY  213



>ref|XP_008232595.1| PREDICTED: axial regulator YABBY 1 isoform X2 [Prunus mume]
Length=231

 Score =   311 bits (798),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 182/221 (82%), Gaps = 12/221 (5%)
 Frame = +3

Query  183  APDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMR  362
            +PD      H LSPS +QLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHC+NLLSVNMR
Sbjct  13   SPDQQQQQQHLLSPS-DQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCSNLLSVNMR  71

Query  363  GLLLPTAPNQLHLPHSFF-SPQNLLDEIRNTPPS--LLMNQPN-PNESLMPIRGV----D  518
             LLLP  PN  HLPH FF +P NLL+++RN P S  L+ +QPN  NES+M IRG      
Sbjct  72   ALLLP-PPNNQHLPHPFFNTPHNLLEDMRNAPSSNTLMNHQPNYTNESIMAIRGGGLDHQ  130

Query  519  ELPKPPVA-NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHI  695
            E+PKPP A NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHI
Sbjct  131  EIPKPPAAVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHI  190

Query  696  HFGLMPDQPVKKPNACQQEGEDGLMKDGFLA-PPNLGVSPY  815
            HFGLMPDQPVKK N  QQEGED LMKDGF + P N+GVSPY
Sbjct  191  HFGLMPDQPVKKTNMRQQEGEDMLMKDGFFSTPANVGVSPY  231



>ref|XP_007218311.1| hypothetical protein PRUPE_ppa010905mg [Prunus persica]
 gb|EMJ19510.1| hypothetical protein PRUPE_ppa010905mg [Prunus persica]
Length=231

 Score =   311 bits (797),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 181/221 (82%), Gaps = 12/221 (5%)
 Frame = +3

Query  183  APDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMR  362
            +PD      H LSPS +QLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHC+NLLSVNMR
Sbjct  13   SPDQQQQQQHLLSPS-DQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCSNLLSVNMR  71

Query  363  GLLLPTAPNQLHLPHSFF-SPQNLLDEIRNTPPS--LLMNQPN-PNESLMPIRGV----D  518
             LLLP  PN  HLPH FF +P NLL+++RN P S  L+  QPN  NES+M IRG      
Sbjct  72   ALLLP-PPNNQHLPHPFFNTPHNLLEDMRNAPSSNTLMNQQPNYTNESIMAIRGGGLDHQ  130

Query  519  ELPKPPVA-NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHI  695
            E+PKPP A NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHI
Sbjct  131  EIPKPPAAVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHI  190

Query  696  HFGLMPDQPVKKPNACQQEGEDGLMKDGFLA-PPNLGVSPY  815
            HFGLMPDQPVKK N  QQEGED LMKDGF + P N+GVSPY
Sbjct  191  HFGLMPDQPVKKTNMRQQEGEDMLMKDGFFSTPANVGVSPY  231



>ref|XP_003525801.1| PREDICTED: protein YABBY 4-like isoform X1 [Glycine max]
 gb|KHN04335.1| Protein YABBY 5 [Glycine soja]
Length=214

 Score =   309 bits (791),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 168/203 (83%), Gaps = 7/203 (3%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRGLL+P+ P Q HL
Sbjct  14   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLMPS-PTQFHL  72

Query  402  PHSFFSP-QNLLDEIRNTPPSLLMNQPN---PNESLMPIR-GVDELPKPPVANRPPEKRQ  566
             HSFFSP  NLL+EI N  P+ LMNQ N    NE  MP R   DELP+P + NRPPEKRQ
Sbjct  73   GHSFFSPSHNLLEEIPNPSPNFLMNQTNLSASNEFSMPARIAADELPRP-IMNRPPEKRQ  131

Query  567  RVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQ  746
            RVPSAYNRFIKDEIQRIK+ NPDI+HREAFSAAAKNWAHFPHIHFGLMPDQ VKK N CQ
Sbjct  132  RVPSAYNRFIKDEIQRIKSVNPDITHREAFSAAAKNWAHFPHIHFGLMPDQTVKKTNVCQ  191

Query  747  QEGEDGLMKDGFLAPPNLGVSPY  815
            QEGE+ LMKDGF A  N+GVSPY
Sbjct  192  QEGEEVLMKDGFYASANVGVSPY  214



>ref|XP_008232594.1| PREDICTED: axial regulator YABBY 1 isoform X1 [Prunus mume]
Length=232

 Score =   308 bits (788),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 170/222 (77%), Positives = 181/222 (82%), Gaps = 13/222 (6%)
 Frame = +3

Query  183  APDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMR  362
            +PD      H LSPS +QLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHC+NLLSVNMR
Sbjct  13   SPDQQQQQQHLLSPS-DQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCSNLLSVNMR  71

Query  363  GLLLPTAPNQLHLPHSFF-SPQNLLDE-IRNTPPS--LLMNQPN-PNESLMPIRGV----  515
             LLLP  PN  HLPH FF +P NLL E +RN P S  L+ +QPN  NES+M IRG     
Sbjct  72   ALLLP-PPNNQHLPHPFFNTPHNLLQEDMRNAPSSNTLMNHQPNYTNESIMAIRGGGLDH  130

Query  516  DELPKPPVA-NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH  692
             E+PKPP A NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH
Sbjct  131  QEIPKPPAAVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH  190

Query  693  IHFGLMPDQPVKKPNACQQEGEDGLMKDGFLA-PPNLGVSPY  815
            IHFGLMPDQPVKK N  QQEGED LMKDGF + P N+GVSPY
Sbjct  191  IHFGLMPDQPVKKTNMRQQEGEDMLMKDGFFSTPANVGVSPY  232



>ref|XP_008787013.1| PREDICTED: protein YABBY 4-like [Phoenix dactylifera]
Length=229

 Score =   306 bits (785),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 164/236 (69%), Positives = 183/236 (78%), Gaps = 24/236 (10%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSSSS AF+ DH        SP  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT
Sbjct  1    MSSSSAAFSLDHLS------SPPSEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  54

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSP--QNLLDEIRNTPPSLLMNQP-----------  479
            NLLSVNMRGLLLP A NQL L H F +P   N+LDEI   PPSLLM+QP           
Sbjct  55   NLLSVNMRGLLLPAA-NQLGLGHPFLAPSHHNILDEITCPPPSLLMDQPILHNNSSNGNH  113

Query  480  -NPNESLMPIRGVDE-LPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREA  653
             + + ++ P++G +E LP+ PV NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDI+HREA
Sbjct  114  NHNHNAMAPVKGTEEELPQTPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHREA  173

Query  654  FSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFL--APPNLGVSPY  815
            FSAAAKNWAHFPHIHFGLMPDQ +KK +  QQEGED L+KDGF   A  N+GV+P+
Sbjct  174  FSAAAKNWAHFPHIHFGLMPDQGLKKSSVRQQEGEDVLLKDGFYAAAAANMGVTPF  229



>ref|XP_008344381.1| PREDICTED: axial regulator YABBY 1-like [Malus domestica]
Length=231

 Score =   306 bits (785),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 174/231 (75%), Positives = 189/231 (82%), Gaps = 17/231 (7%)
 Frame = +3

Query  162  SSSSTAF-APDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            ++SST F +PD   H    LSP+ +QLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHC+
Sbjct  5    ATSSTVFNSPDQQQHL---LSPT-DQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCS  60

Query  339  NLLSVNMRGLLLPTAPN--QLHLPHSFFS-PQNLLDEIRNTPPSLLMN-QPN-PNESLMP  503
            NLLSVNMR LLLP   N  QLHLPH FFS P NLL+EIRNTP + + N QPN  NES MP
Sbjct  61   NLLSVNMRALLLPPPNNNNQLHLPHHFFSTPHNLLEEIRNTPSNTITNHQPNYTNESAMP  120

Query  504  IRGV-----DELPKPP-VANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAA  665
            IRG       E+PKPP V NRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAA
Sbjct  121  IRGGGFDHHQEIPKPPAVVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAA  180

Query  666  AKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFLA-PPNLGVSPY  815
            AKNWAHFPHIHFGL+PDQPVKK N  QQEG+D LMKDGF + P N+GVSPY
Sbjct  181  AKNWAHFPHIHFGLLPDQPVKKTNIRQQEGDDVLMKDGFFSTPANVGVSPY  231



>gb|KHG19574.1| Axial regulator YABBY 1 -like protein [Gossypium arboreum]
Length=216

 Score =   303 bits (776),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 178/208 (86%), Gaps = 12/208 (6%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFK-TVTVRCGHCTNLLSVNMRGLLLPTAPNQ  392
            LSP+ +QLCYVHCNFCDTVLAVSVPCSSLF  TV VRCGHCTNLLSV+MRGLLLPTA NQ
Sbjct  13   LSPA-DQLCYVHCNFCDTVLAVSVPCSSLFNNTVMVRCGHCTNLLSVDMRGLLLPTA-NQ  70

Query  393  LHLPHSFFSPQNLLDEIRN-TPPSLLM-NQPNPNESLMPIRG---VDELPKPPVANRPPE  557
            LHL HSFF+PQNLL+EIR+  PP+++M N PNPN+++  IRG   ++E+ KPPV NRPPE
Sbjct  71   LHLAHSFFTPQNLLEEIRSCAPPNMVMINHPNPNDTV--IRGAAELEEIAKPPVVNRPPE  128

Query  558  KRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPV--KK  731
            KRQRVPSAYNRFIK+EIQRIKAGNPDISHR+AFSAAAKNWAHFP IHFG MPDQ V   K
Sbjct  129  KRQRVPSAYNRFIKEEIQRIKAGNPDISHRDAFSAAAKNWAHFPRIHFGQMPDQAVMKMK  188

Query  732  PNACQQEGEDGLMKDGFLAPPNLGVSPY  815
             N  QQEGE+ ++KDGF  P N+GVSPY
Sbjct  189  NNVRQQEGEEAVVKDGFFVPTNVGVSPY  216



>ref|XP_009346562.1| PREDICTED: axial regulator YABBY 3-like [Pyrus x bretschneideri]
Length=231

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 188/231 (81%), Gaps = 17/231 (7%)
 Frame = +3

Query  162  SSSSTAF-APDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            ++SST F +PD   H    LSP+ +QLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHC+
Sbjct  5    ATSSTVFNSPDQQQHL---LSPT-DQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCS  60

Query  339  NLLSVNMRGLLLPTAPN--QLHLPHSFFS-PQNLLDEIRNTPPSLLMN-QPN-PNESLMP  503
            NLLSVNMR LLLP   N  QLHLPH FFS P NLL+EIRNTP + + N QPN  NES MP
Sbjct  61   NLLSVNMRALLLPPPNNNNQLHLPHPFFSTPHNLLEEIRNTPSNTITNHQPNYTNESAMP  120

Query  504  IRGV-----DELPKPP-VANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAA  665
            IRG       E+PKPP V NRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAA
Sbjct  121  IRGGRFDHHQEIPKPPAVVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAA  180

Query  666  AKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFLA-PPNLGVSPY  815
            AKNWAHFPHIHFGL+PDQPVKK N  QQEG+D LMKDGF + P N+GV PY
Sbjct  181  AKNWAHFPHIHFGLLPDQPVKKTNIRQQEGDDVLMKDGFFSTPANVGVFPY  231



>ref|XP_010088882.1| hypothetical protein L484_020870 [Morus notabilis]
 gb|EXB37079.1| hypothetical protein L484_020870 [Morus notabilis]
Length=225

 Score =   302 bits (773),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 165/233 (71%), Positives = 181/233 (78%), Gaps = 22/233 (9%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MS+SS AF+PDH       LSPS +QLCYVHCNFCDTVLAVSVP  SLFKTVTVRCGHCT
Sbjct  1    MSASSAAFSPDH-------LSPS-DQLCYVHCNFCDTVLAVSVPSGSLFKTVTVRCGHCT  52

Query  339  NLLSVNMRGLLLPTAPNQLH--LPHSFFSPQNLL--DEIRNTPPS---LLMNQPNPNESL  497
            NLLSVNMRGLLLP+A NQLH    HS FSPQ  L  D +  +PP+   ++ +QPNPN  L
Sbjct  53   NLLSVNMRGLLLPSASNQLHQYFGHSLFSPQQYLLEDMMMRSPPASNAMVNHQPNPNHDL  112

Query  498  -MPIR---GVDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAA  665
             +P R      E+PKPPV NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAA
Sbjct  113  VIPSRRRAAEQEIPKPPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAA  172

Query  666  AKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFLA---PPNLGVSPY  815
            AKNWAHFPHIH GLMPDQPVKK N  Q E ++ LMKDGF +     N+GVSPY
Sbjct  173  AKNWAHFPHIHLGLMPDQPVKKANLRQPEADNMLMKDGFFSTTPAANVGVSPY  225



>ref|XP_007155627.1| hypothetical protein PHAVU_003G217700g [Phaseolus vulgaris]
 gb|ESW27621.1| hypothetical protein PHAVU_003G217700g [Phaseolus vulgaris]
Length=215

 Score =   301 bits (770),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 166/224 (74%), Positives = 178/224 (79%), Gaps = 14/224 (6%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSSSST  + DH         P  EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCT
Sbjct  1    MSSSSTTISLDHL--------PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCT  52

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSP-QNLLDEIRNTPPSLLMNQPN---PNESLMPI  506
            NLL VNMRGLL+P +P Q HL HSFFSP  NLL+EI N  P+ LMNQ N    NE  MP 
Sbjct  53   NLLPVNMRGLLVP-SPTQFHLGHSFFSPSHNLLEEIPNPSPNFLMNQTNLSVSNEFSMPA  111

Query  507  R-GVDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAH  683
            R   DELP+PP+ NRPPEKRQRVPSAYNRFIKDEIQRIK+ NPDI+HREAFSAAAKNWAH
Sbjct  112  RTAADELPRPPIINRPPEKRQRVPSAYNRFIKDEIQRIKSVNPDITHREAFSAAAKNWAH  171

Query  684  FPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            FPHIHFGLMPDQ VKK N CQQEGE+ LMKDGF A  N+GVSPY
Sbjct  172  FPHIHFGLMPDQTVKKTNVCQQEGEEVLMKDGFYASANVGVSPY  215



>gb|AFN26939.1| FIL protein [Papaver somniferum]
Length=230

 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 165/237 (70%), Positives = 182/237 (77%), Gaps = 28/237 (12%)
 Frame = +3

Query  165  SSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNL  344
            SSS+AF+ DH       LSPS EQLCYVHCN CDTVLAVSVPCSSL+KTVTVRCGHCTNL
Sbjct  2    SSSSAFSLDH-------LSPS-EQLCYVHCNLCDTVLAVSVPCSSLYKTVTVRCGHCTNL  53

Query  345  LSVNMRGLLLPTAPNQLHLPHSFF--------SPQNLLDEIRN-TPPSLLMNQ----PNP  485
            LSVNMRGLLLP A NQLHL H+FF        +  NL++EI N  PP+LLM+Q    PN 
Sbjct  54   LSVNMRGLLLPAASNQLHLGHAFFPPPPPPPPTHHNLMEEISNLQPPNLLMDQQQHNPNY  113

Query  486  NESLMPIRGV--DELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFS  659
            NES +P  G+  D+LP+ PVA +PPEKRQRVPSAYNRFIKDEIQRIKAGNPDI+HR+AFS
Sbjct  114  NESTIPRGGIHQDDLPRQPVAYKPPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHRQAFS  173

Query  660  AAAKNWAHFPHIHFGLMPDQPV-KKPNACQQEGEDGLMKDGFLAPPN----LGVSPY  815
            AAAKNWAHFPHIHFGLMPDQ   KK N  QQ+GED   KDGF    N    LGVSPY
Sbjct  174  AAAKNWAHFPHIHFGLMPDQTAGKKNNVRQQDGEDVPFKDGFFTAANNNQQLGVSPY  230



>ref|XP_010933715.1| PREDICTED: protein YABBY 4-like [Elaeis guineensis]
Length=229

 Score =   299 bits (766),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 162/236 (69%), Positives = 179/236 (76%), Gaps = 24/236 (10%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSSSS AF+ D          P  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT
Sbjct  1    MSSSSAAFSLDQLSP------PPSEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  54

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFF--SPQNLLDEIRNTPPSLLMNQPN----------  482
            NLLSVNMRGLLLP A NQL L H F   SP NLLDEI   PPSLLM+QP+          
Sbjct  55   NLLSVNMRGLLLPAA-NQLGLGHPFLAPSPHNLLDEIPCPPPSLLMDQPSLNNNNSNGNH  113

Query  483  --PNESLMPIRGVDE-LPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREA  653
               + ++ P RG +E LP+  V NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDI+HREA
Sbjct  114  NHNHNTMAPARGTEEELPQNQVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHREA  173

Query  654  FSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFL--APPNLGVSPY  815
            FSAAAKNWAHFPHIHFGLMPDQ ++K +  QQEGED L+KDGF   A  N+G++P+
Sbjct  174  FSAAAKNWAHFPHIHFGLMPDQGLRKNSVRQQEGEDVLLKDGFYAAAAANMGITPF  229



>ref|XP_004506104.1| PREDICTED: axial regulator YABBY 1-like [Cicer arietinum]
Length=219

 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 183/205 (89%), Gaps = 8/205 (4%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS +QLCYVHCNFCDTVLAVSVPC+SLFKTVTVRCGHCTNLLSVNMRGLLLP+A NQL
Sbjct  18   LSPS-DQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPSA-NQL  75

Query  396  HLPHSFFSPQNLLDEIRNTPPS-LLMNQ-PNPNESLM-PIRGV-DELPKPPVANRPPEKR  563
            HL HSFF+PQNLL+EIRN+P + ++MNQ PNPN+ +M  +RG  +E+PKPP ANRPPEKR
Sbjct  76   HLGHSFFNPQNLLEEIRNSPSTNMMMNQLPNPNDLVMNTMRGGPEEIPKPPPANRPPEKR  135

Query  564  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKKPNA  740
            QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD QPVKK N 
Sbjct  136  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDHQPVKKANV  195

Query  741  CQQEGEDGLMKDGFLAPPNLGVSPY  815
             +QE ED L+KDGF    N+GVSPY
Sbjct  196  -RQESEDVLIKDGFFTQANVGVSPY  219



>ref|XP_008796843.1| PREDICTED: protein YABBY 4-like [Phoenix dactylifera]
Length=230

 Score =   296 bits (758),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 162/237 (68%), Positives = 180/237 (76%), Gaps = 25/237 (11%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSSSS AF+ D          P  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT
Sbjct  1    MSSSSAAFSLDQLSP------PPSEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  54

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSP--QNLLDEIRNTPPSLLMNQPNPNE-------  491
            NLLSVNMRGLLLP A NQL L H F +P   NLLDEI   PPSL M+QP+ N        
Sbjct  55   NLLSVNMRGLLLPAA-NQLGLGHPFLAPSHHNLLDEIPCPPPSLPMDQPSLNSNNSNGAN  113

Query  492  ------SLMPIRGVDE-LPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHRE  650
                  ++ P +G +E LP+ PVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDI+HRE
Sbjct  114  HNHNHNTMAPAKGTEEELPQNPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHRE  173

Query  651  AFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFL--APPNLGVSPY  815
            AFSAAAKNWAHFPHIHFGLMPDQ ++K +  QQEGED L+KDGF   A  N+G++P+
Sbjct  174  AFSAAAKNWAHFPHIHFGLMPDQGLRKNSVRQQEGEDVLLKDGFYAAAAANMGITPF  230



>ref|XP_007209583.1| hypothetical protein PRUPE_ppa011209mg [Prunus persica]
 gb|EMJ10782.1| hypothetical protein PRUPE_ppa011209mg [Prunus persica]
Length=219

 Score =   295 bits (756),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 166/205 (81%), Gaps = 8/205 (4%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLH-  398
            P  EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRGLLLP+ PNQ H 
Sbjct  16   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPS-PNQFHH  74

Query  399  LPHSFFSP----QNLLDEIRNTPPSLLMNQPNPNE-SLMPIRGVDELPKPPVANRPPEKR  563
            L HSFFS      NLL+EI N  P+ LMNQ + N+ ++ P  G DELP+PP   RPPEKR
Sbjct  75   LGHSFFSSPNNSHNLLEEIPNPAPNFLMNQTSVNDFAVRPRGGADELPRPPAITRPPEKR  134

Query  564  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNAC  743
            QRVPSAYNRFIKDEIQRIK+ NPDISHREAFSAAAKNWAHFPHIHFGLMPDQ VKK N  
Sbjct  135  QRVPSAYNRFIKDEIQRIKSVNPDISHREAFSAAAKNWAHFPHIHFGLMPDQTVKKTNVR  194

Query  744  QQEGEDGLMKDGFLAPP-NLGVSPY  815
            QQEGED LMKDGF A   N+ VSPY
Sbjct  195  QQEGEDVLMKDGFFASANNVRVSPY  219



>ref|XP_008238617.1| PREDICTED: protein YABBY 4-like [Prunus mume]
Length=219

 Score =   295 bits (755),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 165/205 (80%), Gaps = 8/205 (4%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLH-  398
            P  EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRGLLLP+ PNQ H 
Sbjct  16   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPS-PNQFHH  74

Query  399  LPHSFFSP----QNLLDEIRNTPPSLLMNQPNPNE-SLMPIRGVDELPKPPVANRPPEKR  563
            L HSFFS      NLL+EI N  P+ LMNQ   N+ ++ P  G DELP+PP   RPPEKR
Sbjct  75   LGHSFFSSPNNSHNLLEEIPNPAPNFLMNQTGVNDFAVRPRGGADELPRPPAITRPPEKR  134

Query  564  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNAC  743
            QRVPSAYNRFIKDEIQRIK+ NPDISHREAFSAAAKNWAHFPHIHFGLMPDQ VKK N  
Sbjct  135  QRVPSAYNRFIKDEIQRIKSVNPDISHREAFSAAAKNWAHFPHIHFGLMPDQTVKKTNVR  194

Query  744  QQEGEDGLMKDGFLAPP-NLGVSPY  815
            QQEGED LMKDGF A   N+ VSPY
Sbjct  195  QQEGEDVLMKDGFFASANNVRVSPY  219



>ref|XP_010093672.1| hypothetical protein L484_019011 [Morus notabilis]
 gb|EXB54452.1| hypothetical protein L484_019011 [Morus notabilis]
Length=218

 Score =   293 bits (750),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 165/205 (80%), Gaps = 8/205 (4%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRGLLLP+A NQ HL
Sbjct  15   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSA-NQFHL  73

Query  402  PHSFFSP--QNLLDEIRNTPPSLLMNQPNPNESLMPIRGV---DELPKPPVANRPPEKRQ  566
             HSFF+P   NLL+EI N  P+ LMNQ N  +  +P RGV    EL +PPV NRPPEKRQ
Sbjct  74   GHSFFTPSHHNLLEEIPNPTPNFLMNQTNMTDFAVPPRGVAHDHELSRPPVINRPPEKRQ  133

Query  567  RVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQ  746
            RVPSAYNRFIKDEIQRIK+ NPDISHREAFSAAAKNWAHFPHIHFGLMPDQ   K    +
Sbjct  134  RVPSAYNRFIKDEIQRIKSVNPDISHREAFSAAAKNWAHFPHIHFGLMPDQSANKKTNVR  193

Query  747  QEGEDGLMKD-GFLAPPN-LGVSPY  815
            QEGED LMKD GF A  N +GV+PY
Sbjct  194  QEGEDVLMKDAGFFASANHVGVAPY  218



>ref|XP_011018257.1| PREDICTED: protein YABBY 4-like [Populus euphratica]
Length=214

 Score =   291 bits (745),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 167/203 (82%), Gaps = 6/203 (3%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRGL LP+A +Q  L
Sbjct  13   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLYLPSA-SQFPL  71

Query  402  PHSFFSP-QNLLD-EIRNTPPSLLMNQPNPNESLMPIRGV--DELPKPPVANRPPEKRQR  569
             H+F+SP  NLLD +I N  PS LMNQ + N+  + +RG+   ELP+PPV NRPPEKRQR
Sbjct  72   GHNFYSPSHNLLDDQIPNPTPSFLMNQTHVNDFSVTVRGMADRELPRPPVINRPPEKRQR  131

Query  570  VPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQ  749
            VPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQ +KK N  QQ
Sbjct  132  VPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQTMKKNNVRQQ  191

Query  750  EGEDGLMKDGFLAPPNLGV-SPY  815
            EGED L+ D F A  N+GV +PY
Sbjct  192  EGEDVLINDAFFASSNVGVTTPY  214



>gb|AEK35320.1| YABBY3-like protein [Eschscholzia californica subsp. californica]
Length=228

 Score =   290 bits (742),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 174/215 (81%), Gaps = 17/215 (8%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS EQLCYVHCN CDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLP A NQL
Sbjct  16   LSPS-EQLCYVHCNLCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLP-ATNQL  73

Query  396  HLPHSFFS------------PQNLLD-EIRNTPPSLLMNQPNPNESLMPIRGVDELPKPP  536
            H  HS FS              NL++ +I   PP+LL++QPN N+SLM +RG  E+P+PP
Sbjct  74   HFGHSIFSPLPLPPPPPPTSTHNLMEGQIPCQPPNLLIDQPNLNDSLMSVRGAHEIPRPP  133

Query  537  VANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
            V NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDI+HREAFSAAAKNWAHFPHIHFGLMPD
Sbjct  134  VVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHFPHIHFGLMPD  193

Query  717  Q-PVKKPNACQQEGEDGLMKD-GFLAPPNLGVSPY  815
            Q   KK N  QQEGED LMKD G+  P N+GVSPY
Sbjct  194  QTAAKKSNIRQQEGEDMLMKDGGYFTPANVGVSPY  228



>gb|KEH29133.1| plant-specific transcription factor YABBY family protein [Medicago 
truncatula]
Length=221

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 174/199 (87%), Gaps = 8/199 (4%)
 Frame = +3

Query  237  LCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPHSFF  416
            LCYVHCNFCDTVLAVSVPC+SLFKTVTVRCGHCTNLLSVNMR LLLP APNQLHL H++F
Sbjct  25   LCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRALLLP-APNQLHLGHTYF  83

Query  417  SPQNLLDEIRNTPPS-LLMNQ-PNPNESLM-PIRGV--DELPKPPVANRPPEKRQRVPSA  581
            +PQ L++EIRN P + ++MNQ PNPN+ +M  +RG   +E+PKPP ANRPPEKRQRVPSA
Sbjct  84   NPQTLMEEIRNAPSTNMMMNQLPNPNDLMMNTMRGGHHEEIPKPPPANRPPEKRQRVPSA  143

Query  582  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKKPNACQQEGE  758
            YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD QPVKK N  +Q+ E
Sbjct  144  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDHQPVKKANV-RQDSE  202

Query  759  DGLMKDGFLAPPNLGVSPY  815
            D LMKDGF    N+GVSPY
Sbjct  203  DVLMKDGFFTQANVGVSPY  221



>ref|XP_009781194.1| PREDICTED: protein YABBY 4-like [Nicotiana sylvestris]
Length=209

 Score =   288 bits (737),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 160/200 (80%), Gaps = 8/200 (4%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL     GLLLP+A +  H 
Sbjct  16   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLP----GLLLPSANH--HF  69

Query  402  PHSFFSP-QNLLDEIRNTPPSLLMNQPNPNESLMPIR-GVDELPKPPVANRPPEKRQRVP  575
             H++FSP  NLL+EI N  P+ LMNQ N  + ++P R G D+LP+PPV NRPPEKRQRVP
Sbjct  70   GHTYFSPSHNLLEEITNATPTFLMNQSNSTDFVLPTRPGFDDLPRPPVINRPPEKRQRVP  129

Query  576  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEG  755
            SAYNRFIK+EIQRIKAGNPDISHREAFS AAKNWAHFPHI FGL+PDQ VK+ N  QQ+G
Sbjct  130  SAYNRFIKEEIQRIKAGNPDISHREAFSTAAKNWAHFPHIQFGLVPDQTVKRANVRQQDG  189

Query  756  EDGLMKDGFLAPPNLGVSPY  815
            ED LMKDG     N+ VSPY
Sbjct  190  EDVLMKDGLFTSTNVSVSPY  209



>ref|XP_006368172.1| hypothetical protein POPTR_0001s00240g [Populus trichocarpa]
 gb|ERP64741.1| hypothetical protein POPTR_0001s00240g [Populus trichocarpa]
Length=214

 Score =   286 bits (733),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 6/203 (3%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRGL LP+A +Q  L
Sbjct  13   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLFLPSA-SQFPL  71

Query  402  PHSFFSP-QNLLD-EIRNTPPSLLMNQPNPNESLMPIRGV--DELPKPPVANRPPEKRQR  569
             H+ +SP  NLLD +I N  P+ L+NQ + N+  + +RG+   ELP+PPV +RPPEKRQR
Sbjct  72   GHNLYSPSHNLLDDQIPNPTPNFLINQTHVNDFSVTVRGMADHELPRPPVIHRPPEKRQR  131

Query  570  VPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQ  749
            VPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQ +KK N  QQ
Sbjct  132  VPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQAMKKNNVRQQ  191

Query  750  EGEDGLMKDGFLAPPNLGV-SPY  815
            EGED L+ DGF A  N+GV +PY
Sbjct  192  EGEDVLINDGFFASSNVGVTTPY  214



>ref|XP_004515739.1| PREDICTED: protein YABBY 4-like [Cicer arietinum]
Length=218

 Score =   286 bits (732),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 169/204 (83%), Gaps = 7/204 (3%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  EQLCYVHCN CDT+LAVSVPC+SLFKTVTVRCGHCTNLL VNMR LLLP +PNQ HL
Sbjct  16   PPSEQLCYVHCNICDTILAVSVPCTSLFKTVTVRCGHCTNLLPVNMRALLLP-SPNQFHL  74

Query  402  PHSFFSP-QNLLDEIRNTPPSLLMNQ----PNPNESLMPIRGV-DELPKPPVANRPPEKR  563
             HS FSP  NLL+E+ N  P+ LMN     PN N+  MP R V DELP+PP+ NRPPEKR
Sbjct  75   GHSLFSPTHNLLEEMPNPTPNFLMNHTNITPNFNDFSMPPRTVADELPRPPIINRPPEKR  134

Query  564  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNAC  743
            QRVPSAYNRFIKDEIQRIK+ NPDI+HREAFSAAAKNWAHFPHIHFGLMPDQ +KK N C
Sbjct  135  QRVPSAYNRFIKDEIQRIKSVNPDITHREAFSAAAKNWAHFPHIHFGLMPDQTMKKTNVC  194

Query  744  QQEGEDGLMKDGFLAPPNLGVSPY  815
            QQEG++ LMKDGF A  N+GVSPY
Sbjct  195  QQEGDEVLMKDGFFASANVGVSPY  218



>gb|ACN79518.1| YABBY1 protein [Lotus japonicus]
Length=221

 Score =   285 bits (730),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 162/206 (79%), Gaps = 9/206 (4%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  EQLCYVHCN CDT+LAVSVP +SLFKTVTVRCGHCTNLL VNMR LLLP+ PNQ HL
Sbjct  17   PPSEQLCYVHCNICDTILAVSVPSTSLFKTVTVRCGHCTNLLPVNMRALLLPS-PNQFHL  75

Query  402  PHSFFSP-QNLLDEIRNTPPSLLMNQPNPNESL----MPIR-GVDELPKPPVANRPP-EK  560
             HSFFSP  NLL E+ N  P+ LMN  N   +     +P R   DELP+PP+ NRP  EK
Sbjct  76   GHSFFSPPHNLLGEMPNPSPNFLMNHTNATSNFSQFSVPARSAADELPRPPIINRPAQEK  135

Query  561  RQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNA  740
            RQRVPSAYNRFIKDEIQRIK+ NPDI+HREAF AAAKNWAHFPHIHFGLMPDQ +KK   
Sbjct  136  RQRVPSAYNRFIKDEIQRIKSVNPDITHREAFGAAAKNWAHFPHIHFGLMPDQTMKKTTV  195

Query  741  CQQEGEDGL-MKDGFLAPPNLGVSPY  815
            CQQEGE+ L MKDGF A  ++GVSPY
Sbjct  196  CQQEGEEVLMMKDGFYASADVGVSPY  221



>ref|XP_009359375.1| PREDICTED: axial regulator YABBY 1-like [Pyrus x bretschneideri]
 ref|XP_009359376.1| PREDICTED: axial regulator YABBY 1-like [Pyrus x bretschneideri]
Length=220

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 166/207 (80%), Gaps = 10/207 (5%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLH-  398
            P  EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRGLLLP +PNQ H 
Sbjct  15   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLP-SPNQFHH  73

Query  399  LPHSFFSP----QNLLDEIRNTP-PSLLMNQPNPNE-SLMPIRGVDEL-PKPPVANRPPE  557
            L HSFFS      NLL+EI N P P+ LMNQ + N+ +  P  G DEL P+PPV NRPPE
Sbjct  74   LGHSFFSSPNNSHNLLEEIPNVPTPNFLMNQTSVNDFAARPTGGPDELLPRPPVINRPPE  133

Query  558  KRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPN  737
            KRQRVPSAYNRFIKDEIQRIK+ NPDISHREAFSAAAKNWAHFPHIHFGLMPDQ VKK  
Sbjct  134  KRQRVPSAYNRFIKDEIQRIKSVNPDISHREAFSAAAKNWAHFPHIHFGLMPDQTVKKTT  193

Query  738  ACQQEGEDGLMKDGFLAPP-NLGVSPY  815
              QQEGED +MKDGF +   N+ V PY
Sbjct  194  VRQQEGEDVVMKDGFFSSANNVRVLPY  220



>ref|XP_008381158.1| PREDICTED: axial regulator YABBY 1-like [Malus domestica]
Length=218

 Score =   285 bits (728),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 163/206 (79%), Gaps = 8/206 (4%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  EQLCYVHCN CDT LAVSVPC+SLFKTVTVRCGHCTNLL+VNMRG LLP++    HL
Sbjct  13   PPSEQLCYVHCNICDTGLAVSVPCTSLFKTVTVRCGHCTNLLTVNMRGQLLPSSNQFHHL  72

Query  402  PHSFFSP----QNLLDEIRNTP-PSLLMNQPNPNE-SLMPIRGVDE-LPKPPVANRPPEK  560
             HSFFS      NLL+EI N P P+ L+N  N N+ +  P  G DE  P+PPV NRPPEK
Sbjct  73   GHSFFSSPNNSLNLLEEIPNVPTPNFLVNHTNVNDFAGTPRGGADEHFPRPPVINRPPEK  132

Query  561  RQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNA  740
            RQRVPSAYNRFIKDEIQRIK+ NPDISHREAFSAAAKNWAHFPHIHFGLMPDQ VKK   
Sbjct  133  RQRVPSAYNRFIKDEIQRIKSVNPDISHREAFSAAAKNWAHFPHIHFGLMPDQTVKKTTI  192

Query  741  CQQEGEDGLMKDGFLAPP-NLGVSPY  815
             QQEGED LMKDGFL+   N+ VSPY
Sbjct  193  RQQEGEDVLMKDGFLSSANNVRVSPY  218



>ref|XP_009339707.1| PREDICTED: axial regulator YABBY 1-like [Pyrus x bretschneideri]
Length=218

 Score =   284 bits (727),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 161/206 (78%), Gaps = 8/206 (4%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRG LLP++    HL
Sbjct  13   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGQLLPSSNQFHHL  72

Query  402  PHSFFSP----QNLLDEIRNTP-PSLLMNQPNPNE-SLMPIRGVDE-LPKPPVANRPPEK  560
             HSFFS      NLL+EI N P P+ L+NQ N N+ +  P  G DE  P P V NRPPEK
Sbjct  73   GHSFFSSPNNSLNLLEEIPNVPTPNFLVNQTNVNDFAATPRGGADEHFPTPAVINRPPEK  132

Query  561  RQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNA  740
            RQRVPSAYNRFIKDEIQRIK+ NPDISHREAFSAAAKNWAHFPHIHFGLMPDQ VKK   
Sbjct  133  RQRVPSAYNRFIKDEIQRIKSVNPDISHREAFSAAAKNWAHFPHIHFGLMPDQTVKKTTI  192

Query  741  CQQEGEDGLMKDGFLAPP-NLGVSPY  815
             QQEGED LMKDGF +   N+ VSPY
Sbjct  193  RQQEGEDVLMKDGFFSSANNVRVSPY  218



>ref|XP_009411506.1| PREDICTED: protein YABBY 4-like [Musa acuminata subsp. malaccensis]
Length=244

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 158/251 (63%), Positives = 180/251 (72%), Gaps = 39/251 (16%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSSSS AF+ DH         P  EQLCYVHCNFCDTVLAVSVP +SLFKTVTVRCGHCT
Sbjct  1    MSSSSAAFSLDHLSP------PPSEQLCYVHCNFCDTVLAVSVPYTSLFKTVTVRCGHCT  54

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSP--QNLLDEIRNTPPSLLMN-------------  473
            NLLSVNMRGLLLP A NQLHL H+  +P   NLLD+++  PPSLL++             
Sbjct  55   NLLSVNMRGLLLPAA-NQLHLSHACLTPAHHNLLDDLQCPPPSLLLDPSILCSGNANNNG  113

Query  474  -------QPNPNESL-------MPIRGVDE-LPKPPVANRPPEKRQRVPSAYNRFIKDEI  608
                     N N+S+        P++GV+E LP+ PV NRPPEKRQRVPSAYNRFIKDEI
Sbjct  114  NLVHSNATVNHNDSINSNCSTTAPVKGVEEVLPRSPVVNRPPEKRQRVPSAYNRFIKDEI  173

Query  609  QRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFL-  785
            QRIKAGNPDI+HREAFSAAAKNWAHFPHIHFGLMPDQ +KK +  Q  GED L K+GF  
Sbjct  174  QRIKAGNPDITHREAFSAAAKNWAHFPHIHFGLMPDQGLKKASVRQAPGEDVLPKEGFYA  233

Query  786  -APPNLGVSPY  815
             A  N+GV+P+
Sbjct  234  TAAANMGVTPF  244



>ref|XP_008373809.1| PREDICTED: axial regulator YABBY 1-like [Malus domestica]
Length=220

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 165/207 (80%), Gaps = 10/207 (5%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLH-  398
            P  EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRGLLLP+ PNQ H 
Sbjct  15   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPS-PNQFHH  73

Query  399  LPHSFFSP----QNLLDEIRNTP-PSLLMNQPNPNE-SLMPIRGVDEL-PKPPVANRPPE  557
            L HSFFS      NLL+EI N P P+ LMNQ + N+ +  P  G DEL P+ PV NRPPE
Sbjct  74   LGHSFFSSPSNSHNLLEEIPNVPTPNFLMNQTSVNDFAARPRGGPDELLPRXPVINRPPE  133

Query  558  KRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPN  737
            KRQRVPSAYNRFIKDEIQRIK+ NPDISHREAFSAAAKNWAHFPHIHFGLMPDQ VKK  
Sbjct  134  KRQRVPSAYNRFIKDEIQRIKSVNPDISHREAFSAAAKNWAHFPHIHFGLMPDQTVKKTT  193

Query  738  ACQQEGEDGLMKDGFLAPP-NLGVSPY  815
              QQEGED +MKDGF +   N+ V PY
Sbjct  194  VRQQEGEDVVMKDGFFSSANNVRVLPY  220



>ref|XP_010544625.1| PREDICTED: axial regulator YABBY 1-like [Tarenaya hassleriana]
Length=225

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 180/225 (80%), Gaps = 20/225 (9%)
 Frame = +3

Query  174  TAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSV  353
             AF+PDH       LSPS + LCYV C+FC+TVLAVSVP +S+FK VTVRCG+CTNLLSV
Sbjct  10   AAFSPDH-------LSPS-DHLCYVQCDFCNTVLAVSVPYTSMFKVVTVRCGYCTNLLSV  61

Query  354  NMRGLLLPTAPNQLHL-PHSFFSPQNLLDEIRNTPPS--LLMNQ-PNPNE--SLMPIRGV  515
            NMR LL+PTA NQL L PHSFF+PQN+L+E+R+ P +  +L+NQ P+PN+  S M IRG+
Sbjct  62   NMRSLLIPTA-NQLQLGPHSFFNPQNILEELRDAPSNVNMLVNQHPSPNDIPSFMDIRGL  120

Query  516  D---ELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  686
            D   E+PK P  NRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHF
Sbjct  121  DQQLEIPKAPPVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHF  180

Query  687  PHIHFGLMPD-QPVKKPNACQQEGEDGLMKDGFLAP-PNLGVSPY  815
            PHIHFGL PD QPVKK     QEGE  +MK+GF  P  N+GV+P+
Sbjct  181  PHIHFGLAPDNQPVKKAEITNQEGEGVVMKEGFYTPAANVGVAPF  225



>ref|XP_010524377.1| PREDICTED: axial regulator YABBY 1-like [Tarenaya hassleriana]
Length=225

 Score =   280 bits (717),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 178/225 (79%), Gaps = 20/225 (9%)
 Frame = +3

Query  174  TAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSV  353
             AF+PDH       LSPS + LCYV C+FC+TVLAVSVP +S+FK VTVRCG+CTNLLSV
Sbjct  10   AAFSPDH-------LSPS-DHLCYVQCDFCNTVLAVSVPYTSMFKIVTVRCGYCTNLLSV  61

Query  354  NMRGLLLPTAPNQLHL-PHSFFSPQNLLDEIRNTPPS--LLMNQ-PNPNE--SLMPIRGV  515
            NMR LLLP A NQL L PHSFF+PQN+L+ +R+ P +  +LMNQ P+ N+  S M IRG+
Sbjct  62   NMRSLLLPAA-NQLQLGPHSFFNPQNILEGLRDAPSNVNMLMNQHPSQNDMPSFMDIRGL  120

Query  516  D---ELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  686
            D   E PK P  NRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHF
Sbjct  121  DQQLETPKAPPVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHF  180

Query  687  PHIHFGLMPD-QPVKKPNACQQEGEDGLMKDGFLAP-PNLGVSPY  815
            PHIHFG+ PD +PVK      QEGEDG+MK+GF AP  N+GV+PY
Sbjct  181  PHIHFGIAPDNRPVKMAGMTNQEGEDGVMKEGFYAPAANVGVAPY  225



>ref|XP_006477248.1| PREDICTED: axial regulator YABBY 3-like isoform X1 [Citrus sinensis]
Length=243

 Score =   280 bits (716),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 155/179 (87%), Gaps = 4/179 (2%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P+ EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRGLLLP+A NQ HL
Sbjct  16   PTSEQLCYVHCNLCDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSA-NQFHL  74

Query  402  PHSFFSP-QNLLDEIRNTPPSLLMNQPNPNESLMPIRGV-DELPKPPVANRPPEKRQRVP  575
             H+FFSP  NL +EI N  P+ L+NQ N N+ ++P RGV DELP+PP  +RPPEKRQRVP
Sbjct  75   GHNFFSPSHNLREEIPNPSPNFLINQTNTNDFIVPTRGVVDELPRPPATSRPPEKRQRVP  134

Query  576  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKKPNACQQ  749
            SAYNRFIKDEIQRIKAGNPDI+HREAFSAAAKNWAHFPHIHFGL+PD QPVKK N  QQ
Sbjct  135  SAYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHFPHIHFGLVPDHQPVKKANVRQQ  193



>ref|XP_006440375.1| hypothetical protein CICLE_v10021834mg [Citrus clementina]
 gb|ESR53615.1| hypothetical protein CICLE_v10021834mg [Citrus clementina]
Length=252

 Score =   280 bits (716),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 155/179 (87%), Gaps = 4/179 (2%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P+ EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRGLLLP+A NQ HL
Sbjct  16   PTSEQLCYVHCNLCDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSA-NQFHL  74

Query  402  PHSFFSP-QNLLDEIRNTPPSLLMNQPNPNESLMPIRGV-DELPKPPVANRPPEKRQRVP  575
             H+FFSP  NL +EI N  P+ L+NQ N N+ ++P RGV DELP+PP  +RPPEKRQRVP
Sbjct  75   GHNFFSPSHNLREEIPNPSPNFLINQTNTNDFIVPTRGVVDELPRPPATSRPPEKRQRVP  134

Query  576  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKKPNACQQ  749
            SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL+PD QPVKK N  QQ
Sbjct  135  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLVPDHQPVKKANVRQQ  193



>gb|AES90958.2| plant-specific transcription factor YABBY family protein [Medicago 
truncatula]
Length=218

 Score =   278 bits (710),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 170/205 (83%), Gaps = 8/205 (4%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  EQLCYVHC  CDT+LAVSVPC+SLFKTVTVRCGHCTNLL VNMR LLLP+ PNQ HL
Sbjct  15   PPSEQLCYVHCTICDTILAVSVPCTSLFKTVTVRCGHCTNLLPVNMRALLLPS-PNQFHL  73

Query  402  PHSFFSP--QNLLDEIRNTPPSLLMNQPN-PNE-SLMPIRGV-DELPKPPVANRPPEKRQ  566
             HSFFSP   NLL+E+ N  P+ +MN  N PN+ S+ P R V DELP+PP+ NRPPEKRQ
Sbjct  74   GHSFFSPTHHNLLEEMPNPAPNFMMNHINAPNDFSMPPTRTVADELPRPPIINRPPEKRQ  133

Query  567  RVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQ  746
            RVPSAYNRFIKDEIQRIK+ NPDI+HREAFSAAAKNWAHFPHIHFGLMPDQ +KK N CQ
Sbjct  134  RVPSAYNRFIKDEIQRIKSVNPDITHREAFSAAAKNWAHFPHIHFGLMPDQTMKKTNVCQ  193

Query  747  QEGEDG-LMKD-GFLAPPNLGVSPY  815
            QEG+D  LMKD GF A  NLGVSPY
Sbjct  194  QEGDDQILMKDGGFYASANLGVSPY  218



>ref|XP_009600360.1| PREDICTED: axial regulator YABBY 1-like [Nicotiana tomentosiformis]
Length=209

 Score =   275 bits (704),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 155/200 (78%), Gaps = 8/200 (4%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL   +         +  H 
Sbjct  16   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPSLL------LPSDNHHF  69

Query  402  PHSFFSP-QNLLDEIRNTPPSLLMNQPNPNESLMPIR-GVDELPKPPVANRPPEKRQRVP  575
             H++FSP  N+L+EI N  P+ LMNQ N  + ++P R G D+LP+PPV NRPPEKRQRVP
Sbjct  70   GHTYFSPSHNILEEITNATPNFLMNQCNSTDFVLPARPGFDDLPRPPVINRPPEKRQRVP  129

Query  576  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEG  755
            SAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHI FGLMPDQ VK+ N  QQ+G
Sbjct  130  SAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIQFGLMPDQTVKRANVRQQDG  189

Query  756  EDGLMKDGFLAPPNLGVSPY  815
            ED LMKDG     N+ VSPY
Sbjct  190  EDVLMKDGLFTSANVSVSPY  209



>ref|XP_006355492.1| PREDICTED: protein YABBY 4 [Solanum tuberosum]
Length=219

 Score =   275 bits (704),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 157/202 (78%), Gaps = 10/202 (5%)
 Frame = +3

Query  228  GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPH  407
             EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL     G LLP+  +  H  H
Sbjct  22   SEQLCYVHCNVCDTVLAVSVPCTSLFKTVTVRCGHCTNLLP----GWLLPSTNHHHHFGH  77

Query  408  SFFSP-QNLLDEIRNTPPSLLMNQPNPNESL--MPIR-GVDELPKPP-VANRPPEKRQRV  572
            ++FSP  NLL+EI N  P+ LMNQ N       +P R G D+LP+PP V NRPPEKRQRV
Sbjct  78   TYFSPSHNLLEEISNATPNFLMNQSNSAHEFVQLPARPGFDDLPRPPPVINRPPEKRQRV  137

Query  573  PSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQE  752
            PSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHI FGLMPDQ VK+ N  QQ+
Sbjct  138  PSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIQFGLMPDQTVKRTNVRQQD  197

Query  753  GEDGLMKDG-FLAPPNLGVSPY  815
            GED LMKDG F    N+ VSPY
Sbjct  198  GEDVLMKDGLFNTSANVSVSPY  219



>ref|XP_006579624.1| PREDICTED: protein YABBY 4-like isoform X2 [Glycine max]
Length=187

 Score =   274 bits (701),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 152/184 (83%), Gaps = 7/184 (4%)
 Frame = +3

Query  279  VSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPHSFFSP-QNLLDEIRNTP  455
            VSVPC+SLFKTVTVRCGHCTNLL VNMRGLL+P+ P Q HL HSFFSP  NLL+EI N  
Sbjct  6    VSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLMPS-PTQFHLGHSFFSPSHNLLEEIPNPS  64

Query  456  PSLLMNQPN---PNESLMPIR-GVDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKA  623
            P+ LMNQ N    NE  MP R   DELP+P + NRPPEKRQRVPSAYNRFIKDEIQRIK+
Sbjct  65   PNFLMNQTNLSASNEFSMPARIAADELPRP-IMNRPPEKRQRVPSAYNRFIKDEIQRIKS  123

Query  624  GNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLG  803
             NPDI+HREAFSAAAKNWAHFPHIHFGLMPDQ VKK N CQQEGE+ LMKDGF A  N+G
Sbjct  124  VNPDITHREAFSAAAKNWAHFPHIHFGLMPDQTVKKTNVCQQEGEEVLMKDGFYASANVG  183

Query  804  VSPY  815
            VSPY
Sbjct  184  VSPY  187



>gb|AFI44623.1| putative male sterile protein [Brassica rapa subsp. pekinensis]
Length=233

 Score =   273 bits (698),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 171/212 (81%), Gaps = 14/212 (7%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS EQLCYV CN+C+T+LAVSVP +S+FKTVTVRCG CTNL+SVNMR L+LP A NQL
Sbjct  24   LSPS-EQLCYVQCNYCETILAVSVPYTSMFKTVTVRCGCCTNLISVNMRSLVLP-ASNQL  81

Query  396  HL---PHSFFSPQNLLDEIRNTPPSL---LMNQ-PNPNE--SLMPIRGVDELPKPPVANR  548
             L   PHS+F+PQN+L+E+R  P ++   ++NQ PN N+  SLM +    E+PK P  NR
Sbjct  82   QLQLGPHSYFTPQNILEELREAPSNMNMMMINQHPNMNDIPSLMDLHQKHEIPKAPPTNR  141

Query  549  PPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPV  725
            PPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL PD Q V
Sbjct  142  PPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLAPDNQHV  201

Query  726  KKPNACQQEGEDGL-MKDGFLAP-PNLGVSPY  815
            KK N  QQEGED + MK+GF AP  N+GV PY
Sbjct  202  KKTNMPQQEGEDNMGMKEGFYAPAANVGVIPY  233



>ref|XP_009384089.1| PREDICTED: protein YABBY 4-like [Musa acuminata subsp. malaccensis]
Length=249

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 155/255 (61%), Positives = 175/255 (69%), Gaps = 42/255 (16%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSSSS AF+ DH         P  EQLCYVHCN CDTVLAVSVP +SLFKTVTVRCGHCT
Sbjct  1    MSSSSAAFSLDHLSPP-----PPSEQLCYVHCNLCDTVLAVSVPFTSLFKTVTVRCGHCT  55

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSPQ--NLLDEIRNTPPSLLM--------------  470
            NLLSVNMRGL LP A NQ+HL H    P   +LLDE++  PPSLL+              
Sbjct  56   NLLSVNMRGLHLPPA-NQIHLTHPCLIPSHTSLLDELQCQPPSLLLDPSILCNGNNNNNS  114

Query  471  ----------------NQPNPNESLMPIRGV-DELPKPPVANRPPEKRQRVPSAYNRFIK  599
                            N  +   ++ P++GV +ELP+ PV NRPPEKRQRVPSAYNRFIK
Sbjct  115  SSSSRLINSITSTTNNNTISNCNTMAPVKGVGEELPRTPVVNRPPEKRQRVPSAYNRFIK  174

Query  600  DEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDG  779
            DEIQRIKAGNPDI+HREAFSAAAKNWAHFPHIHFGLMPDQ +KK +  Q EGED L KDG
Sbjct  175  DEIQRIKAGNPDITHREAFSAAAKNWAHFPHIHFGLMPDQGLKKASVRQPEGEDVLPKDG  234

Query  780  FL---APPNLGVSPY  815
            F    A  N+GV+P+
Sbjct  235  FYATAAAANMGVAPF  249



>gb|AID67130.1| YAB1 protein [Solanum virginianum]
Length=219

 Score =   270 bits (691),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 161/203 (79%), Gaps = 11/203 (5%)
 Frame = +3

Query  228  GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLP-TAPNQLH-L  401
             EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL     G LLP T  +QLH  
Sbjct  21   SEQLCYVHCNACDTVLAVSVPCTSLFKTVTVRCGHCTNLLP----GWLLPSTNHHQLHHF  76

Query  402  PHSFFSP-QNLLDEIRNTPPSLLMNQPNPNES-LMPIR-GVDELPKPP-VANRPPEKRQR  569
             H++FSP  NLL+EI N  P+ LMNQ N +   ++P R G D+LP+PP V NRPPEKRQR
Sbjct  77   GHNYFSPSHNLLEEISNATPNFLMNQSNSSHDFVLPARPGFDDLPRPPPVINRPPEKRQR  136

Query  570  VPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQ  749
            VPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHI FGLMPDQ VK+ N  QQ
Sbjct  137  VPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIQFGLMPDQTVKRTNVRQQ  196

Query  750  EGEDGLMKDG-FLAPPNLGVSPY  815
            +GED LMKDG F    N+ VSPY
Sbjct  197  DGEDVLMKDGLFNTSANVSVSPY  219



>ref|XP_004298663.1| PREDICTED: axial regulator YABBY 1-like [Fragaria vesca subsp. 
vesca]
Length=232

 Score =   271 bits (692),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 156/219 (71%), Positives = 168/219 (77%), Gaps = 21/219 (10%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            L+PS EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL VNMRGLLLP+ PNQ 
Sbjct  16   LAPS-EQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPS-PNQF  73

Query  396  H-LPHSFFS---PQNLLDE---IRNTPPSLLMNQPNPNESLMPIR---GV-DELPKPPVA  542
            H L HSFFS     NLLD+   + N  P+ LMN    + +   +R   GV DELP+PPV 
Sbjct  74   HHLGHSFFSQPNSHNLLDQEIPLMNPTPNFLMNNQTSSLNDFAVRPRGGVADELPRPPVI  133

Query  543  NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQ-  719
            NRPPEKRQRVPSAYNRFIKDEIQRIK+ NPDISHREAFSAAAKNWAHFPHIHFGLMPDQ 
Sbjct  134  NRPPEKRQRVPSAYNRFIKDEIQRIKSVNPDISHREAFSAAAKNWAHFPHIHFGLMPDQN  193

Query  720  --PVKKPNACQQE-GEDGLMKD--GFLAPP--NLGVSPY  815
               VKK N  QQE  ED LMKD  GF A    N+ VSPY
Sbjct  194  TSTVKKTNVRQQESAEDVLMKDHNGFFAAANNNVRVSPY  232



>ref|XP_006840962.1| hypothetical protein AMTR_s00085p00032940 [Amborella trichopoda]
 gb|ERN02637.1| hypothetical protein AMTR_s00085p00032940 [Amborella trichopoda]
Length=211

 Score =   268 bits (686),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 165/225 (73%), Gaps = 23/225 (10%)
 Frame = +3

Query  162  SSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTN  341
            SSSS AF P          +PS EQLCYVHCNFCDTVLAVSVPCSSLFK VTVRCGHCTN
Sbjct  3    SSSSFAFHP----------TPS-EQLCYVHCNFCDTVLAVSVPCSSLFKMVTVRCGHCTN  51

Query  342  LLSVNMRGLLLPTAPNQLHLPHSFFSP--QNLLDEIRNTPPSLLMNQP-----NPNESLM  500
            +LSV+ RGLL PTA  QLHL H+FFSP   NLLDE  + P SLL++ P     N   +  
Sbjct  52   VLSVDTRGLLHPTAATQLHLGHAFFSPTPHNLLDEC-SPPSSLLLDHPLMTPSNTGSAST  110

Query  501  PIRGVDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWA  680
             ++  + L  P   +RPPEKRQRVPSAYNRFIK+EIQRIKAGNPDI+HREAFS AAKNWA
Sbjct  111  RLQENEALHSP--VSRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDITHREAFSTAAKNWA  168

Query  681  HFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            HFPHIHFGLM DQ +KK N   Q+G+D L+ + F    N+GV+PY
Sbjct  169  HFPHIHFGLMADQSIKKTN--MQDGDDVLITESFFTAANMGVTPY  211



>ref|XP_009382346.1| PREDICTED: axial regulator YABBY 1-like [Musa acuminata subsp. 
malaccensis]
Length=244

 Score =   268 bits (686),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 153/250 (61%), Positives = 173/250 (69%), Gaps = 37/250 (15%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSSSS AF+ DH         P  E LCYVHCNFCDT LAVSVP +SLFKTVTVRCGHCT
Sbjct  1    MSSSSAAFSLDHLSP------PPSEHLCYVHCNFCDTDLAVSVPYTSLFKTVTVRCGHCT  54

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSP--QNLLDEIR----------------NTPPSL  464
            NLLSVNMR LLLP A   LHL H  F+P   NLLDE++                N     
Sbjct  55   NLLSVNMRALLLPAANQLLHLSHPCFTPPHHNLLDELQCPHPSLLLDPSLLCNGNNSNGS  114

Query  465  LMNQP---NPNESL-------MPIRGVDE-LPKPPVANRPPEKRQRVPSAYNRFIKDEIQ  611
            L+N P   N + S+        P++GV+E LP+ PV NRPPEKRQRVPSAYNRFIKDEIQ
Sbjct  115  LINSPTTVNHSNSINSSCNATAPVKGVEEELPRTPVVNRPPEKRQRVPSAYNRFIKDEIQ  174

Query  612  RIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFL--  785
            RIKAGNPDI+HREAFSAAAKNWAHFPHIHFGLMPDQ +KK +  Q EG+D L K+GF   
Sbjct  175  RIKAGNPDITHREAFSAAAKNWAHFPHIHFGLMPDQGLKKASVRQPEGDDVLPKEGFYAT  234

Query  786  APPNLGVSPY  815
            A  N+GV+P+
Sbjct  235  AAANMGVAPF  244



>dbj|BAD72170.1| filamentous flower like protein [Amborella trichopoda]
Length=201

 Score =   266 bits (681),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 156/204 (76%), Gaps = 12/204 (6%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLP  404
            + EQLCYVHCNFCDTVLAVSVPCSSLFK VTVRCGHCTN+LSV+ RGLL PTA  QLHL 
Sbjct  3    ASEQLCYVHCNFCDTVLAVSVPCSSLFKMVTVRCGHCTNVLSVDTRGLLHPTAATQLHLG  62

Query  405  HSFFSP--QNLLDEIRNTPPSLLMNQP-----NPNESLMPIRGVDELPKPPVANRPPEKR  563
            H+FFSP   NLLDE  + P SLL++ P     N   +   ++  + L  P   +RPPEKR
Sbjct  63   HAFFSPTPHNLLDEC-SPPSSLLLDHPLMTPSNTGSASTRLQENEALHSP--VSRPPEKR  119

Query  564  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNAC  743
            QRVPSAYNRFIK+EIQRIKAGNPDI+HREAFS AAKNWAHFPHIHFGLM DQ +KK N  
Sbjct  120  QRVPSAYNRFIKEEIQRIKAGNPDITHREAFSTAAKNWAHFPHIHFGLMADQSIKKTN--  177

Query  744  QQEGEDGLMKDGFLAPPNLGVSPY  815
             Q+G+D L+ + F    N+GV+PY
Sbjct  178  MQDGDDVLITESFFTAANMGVTPY  201



>ref|XP_009104094.1| PREDICTED: axial regulator YABBY 1 isoform X2 [Brassica rapa]
Length=220

 Score =   267 bits (682),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 164/203 (81%), Gaps = 13/203 (6%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS E LCYV CNFC+T+LAVSVP +SLFKTVTVRCG CTNLLSVNMR L+LP A NQL
Sbjct  19   LSPS-EHLCYVQCNFCETILAVSVPYTSLFKTVTVRCGCCTNLLSVNMRSLVLP-ASNQL  76

Query  396  HL---PHSFFSPQNLLDEIRNTPPSL---LMNQ-PNPNE--SLMPIRGVDELPKPPVANR  548
             L   P S+F+PQN+L+E+R  P ++   ++NQ PN N+  SLM +    E+PK P  NR
Sbjct  77   QLQLGPQSYFTPQNILEELREAPSNMNMMMINQHPNMNDIPSLMDLHQKHEIPKAPPTNR  136

Query  549  PPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPV  725
            PPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD QPV
Sbjct  137  PPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDNQPV  196

Query  726  KKPNACQQEGEDGL-MKDGFLAP  791
            KK N  QQEGE+ + MK+G  AP
Sbjct  197  KKTNMPQQEGEENMGMKEGLYAP  219



>ref|XP_003608761.1| Protein YABBY [Medicago truncatula]
Length=218

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 169/206 (82%), Gaps = 10/206 (5%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  EQLCYVHC  CDT+L VSVPC+SLFKTVTVRCGHCTNLL VNMR LLLP +PNQ HL
Sbjct  15   PPSEQLCYVHCTICDTIL-VSVPCTSLFKTVTVRCGHCTNLLPVNMRALLLP-SPNQFHL  72

Query  402  PHSFFSP--QNLL-DEIRNTPPSLLMNQPN-PNE-SLMPIRGV-DELPKPPVANRPPEKR  563
             HSFFSP   NLL +E+ N  P+ +MN  N PN+ S+ P R V DELP+PP+ NRPPEKR
Sbjct  73   GHSFFSPTHHNLLQEEMPNPAPNFMMNHINAPNDFSMPPTRTVADELPRPPIINRPPEKR  132

Query  564  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNAC  743
            QRVPSAYNRFIKDEIQRIK+ NPDI+HREAFSAAAKNWAHFPHIHFGLMPDQ +KK N C
Sbjct  133  QRVPSAYNRFIKDEIQRIKSVNPDITHREAFSAAAKNWAHFPHIHFGLMPDQTMKKTNVC  192

Query  744  QQEGEDG-LMKD-GFLAPPNLGVSPY  815
            QQEG+D  LMKD GF A  NLGVSPY
Sbjct  193  QQEGDDQILMKDGGFYASANLGVSPY  218



>emb|CDY56250.1| BnaA07g38010D [Brassica napus]
Length=218

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 163/201 (81%), Gaps = 11/201 (5%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS E LCYV CNFC+T+LAVSVP +SLFKTVTVRCG CTNLLSVNMR L+LP A NQL
Sbjct  19   LSPS-EHLCYVQCNFCETILAVSVPYTSLFKTVTVRCGCCTNLLSVNMRSLVLP-ASNQL  76

Query  396  HL-PHSFFSPQNLLDEIRNTPPSL---LMNQ-PNPNE--SLMPIRGVDELPKPPVANRPP  554
             L P S+F+PQN+L+E+R  P ++   ++NQ PN N+  S M +    E+PK P  NRPP
Sbjct  77   QLGPQSYFTPQNILEELREAPSNMNMMMINQHPNMNDIPSFMDLHQKHEIPKAPPTNRPP  136

Query  555  EKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKK  731
            EKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD Q VKK
Sbjct  137  EKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDNQSVKK  196

Query  732  PNACQQEGEDGL-MKDGFLAP  791
             N  QQEGE+ + MK+GF AP
Sbjct  197  TNMPQQEGEENMGMKEGFYAP  217



>ref|XP_006397699.1| hypothetical protein EUTSA_v10001617mg [Eutrema salsugineum]
 gb|ESQ39152.1| hypothetical protein EUTSA_v10001617mg [Eutrema salsugineum]
Length=229

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 154/236 (65%), Positives = 177/236 (75%), Gaps = 24/236 (10%)
 Frame = +3

Query  156  NMSS-SSTAFAPDhhhhhphhLSPSG---EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVR  323
            +MSS SS  F+P+H       LSPS    E LCYV C FC+T+LAVSVP +SLFKTVTVR
Sbjct  2    SMSSPSSAVFSPEH-------LSPSEHLCEHLCYVQCKFCETILAVSVPYTSLFKTVTVR  54

Query  324  CGHCTNLLSVNMRGLLLPTAPNQLHL---PHSFFSPQNLLDEIRNTPPSLLMNQPNPNE-  491
            CG CTNLLSVNMR ++LP A NQL L   PHS+ SPQNLL+E+R+ P ++ M   N +  
Sbjct  55   CGCCTNLLSVNMRPVVLP-ASNQLQLQLGPHSYMSPQNLLEELRDAPSNMNMMMMNQHPN  113

Query  492  -----SLMPIRGVDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAF  656
                 S M +    E+PK P  NRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAF
Sbjct  114  MNDIPSFMDLHQQHEMPKAPTVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAF  173

Query  657  SAAAKNWAHFPHIHFGLMPD-QPVKKPNACQQEGEDGL-MKDGFLAP-PNLGVSPY  815
            SAAAKNWAHFPHIHFGL+PD QPVKK N  QQEG+D + MK+GF AP  N+GVSPY
Sbjct  174  SAAAKNWAHFPHIHFGLVPDNQPVKKTNMPQQEGDDNMVMKEGFYAPAANVGVSPY  229



>gb|AID67131.1| YAB1 protein [Solanum mammosum]
Length=220

 Score =   265 bits (677),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 160/204 (78%), Gaps = 12/204 (6%)
 Frame = +3

Query  228  GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTA---PNQLH  398
             EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL     G LLP+        H
Sbjct  21   SEQLCYVHCNACDTVLAVSVPCTSLFKTVTVRCGHCTNLLP----GWLLPSTNHHHQLHH  76

Query  399  LPHSFFSP-QNLLDEIRNTPPSLLMNQPN-PNESLMPIR-GVDELPKPP-VANRPPEKRQ  566
              H++FSP  NLL+EI N  P+ LMNQ N  ++ ++P R G D+LP+PP V NRPPEKRQ
Sbjct  77   FGHTYFSPSHNLLEEISNATPNFLMNQSNSAHDFVLPARPGFDDLPRPPPVINRPPEKRQ  136

Query  567  RVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQ  746
            RVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHI FGLMPDQ VK+PN  Q
Sbjct  137  RVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIQFGLMPDQTVKRPNVRQ  196

Query  747  QEGEDGLMKDG-FLAPPNLGVSPY  815
            Q+GED LMKDG F    N+ VSPY
Sbjct  197  QDGEDVLMKDGLFNTSANVSVSPY  220



>ref|XP_002882000.1| hypothetical protein ARALYDRAFT_903959 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58259.1| hypothetical protein ARALYDRAFT_903959 [Arabidopsis lyrata subsp. 
lyrata]
Length=229

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 166/213 (78%), Gaps = 15/213 (7%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
             SPS E LCYV CNFC T+LAVSVP +SLFKTVTVRCG CTNLLSVNMR  +LP A NQL
Sbjct  19   FSPS-EHLCYVQCNFCQTILAVSVPYTSLFKTVTVRCGCCTNLLSVNMRSYVLP-ASNQL  76

Query  396  HL---PHSFFSPQNLLDEIRNTPPSLLM----NQPNPNE--SLMPIRGVDELPKPPVANR  548
             L   PHS+F+PQ++L+E+R+ P ++ M      P  N+  S M +    E+PK P  NR
Sbjct  77   QLQLGPHSYFNPQDILEELRDAPSNMNMMMMNQHPTMNDIPSFMDLHQQHEIPKAPPVNR  136

Query  549  PPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPV  725
            PPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL+PD QPV
Sbjct  137  PPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLVPDNQPV  196

Query  726  KKPNACQQEGEDGL-MKDGFLAP--PNLGVSPY  815
            KK N  QQEGED + MK+GF AP   N+GV+PY
Sbjct  197  KKTNMPQQEGEDNMVMKEGFYAPAAANVGVTPY  229



>ref|XP_009142321.1| PREDICTED: axial regulator YABBY 1-like isoform X1 [Brassica 
rapa]
 gb|AFI44621.1| putative male sterile protein [Brassica rapa subsp. pekinensis]
 gb|AFK10493.1| YABBY1 [Brassica rapa var. parachinensis]
Length=233

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 167/212 (79%), Gaps = 14/212 (7%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS EQLCYV CN+C+T+LAVSVP +S+FKTVTVRCG CTNL+SVNMR L+LP A NQL
Sbjct  24   LSPS-EQLCYVQCNYCETILAVSVPYTSMFKTVTVRCGCCTNLISVNMRSLVLP-ASNQL  81

Query  396  HL---PHSFFSPQNLLDEIRNTPPSLLMNQPNPNE------SLMPIRGVDELPKPPVANR  548
             L   PHS+F+PQN+L+E+++ P ++ M   N +       S M +    E+PK P  NR
Sbjct  82   QLQLGPHSYFTPQNILEELKDAPSNMNMMMMNQHPNMNDIPSFMDLHQQHEIPKAPPVNR  141

Query  549  PPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPV  725
            PPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL PD QPV
Sbjct  142  PPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLAPDNQPV  201

Query  726  KKPNACQQEGEDGL-MKDGFLAP-PNLGVSPY  815
            KK N  QQEGED + MK+GF AP  N+GV PY
Sbjct  202  KKTNMPQQEGEDNMGMKEGFYAPAANVGVIPY  233



>gb|AID67127.1| YAB1 protein [Solanum melongena]
Length=220

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 159/204 (78%), Gaps = 12/204 (6%)
 Frame = +3

Query  228  GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTA---PNQLH  398
             EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHC+NLL     G LLP+        H
Sbjct  21   SEQLCYVHCNVCDTVLAVSVPCTSLFKTVTVRCGHCSNLLP----GWLLPSTNHHHQLHH  76

Query  399  LPHSFFSP-QNLLDEIRNTPPSLLMNQPNP-NESLMPIR-GVDELPK-PPVANRPPEKRQ  566
              HS+FSP  NLL+EI N  P+ LMNQ N  ++ ++P R G D+LP+ PPV NRPPEKRQ
Sbjct  77   FGHSYFSPSHNLLEEISNATPNFLMNQSNSTHDFVLPARPGFDDLPRSPPVINRPPEKRQ  136

Query  567  RVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQ  746
            RVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHI FGLMPDQ VK+ N  Q
Sbjct  137  RVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIQFGLMPDQTVKRANVRQ  196

Query  747  QEGEDGLMKDG-FLAPPNLGVSPY  815
            Q+GED LMKDG F    N+ VSPY
Sbjct  197  QDGEDVLMKDGLFNTSANVSVSPY  220



>gb|AID67132.1| YAB1 protein [Solanum torvum]
Length=219

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 159/204 (78%), Gaps = 12/204 (6%)
 Frame = +3

Query  228  GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTA---PNQLH  398
             EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHC+NLL     G LLP+        H
Sbjct  20   SEQLCYVHCNVCDTVLAVSVPCTSLFKTVTVRCGHCSNLLP----GWLLPSTNHHHQLHH  75

Query  399  LPHSFFSP-QNLLDEIRNTPPSLLMNQPN-PNESLMPIR-GVDELPK-PPVANRPPEKRQ  566
              HS+FSP  NLL+EI N  P+ LMNQ N  ++ ++P R G D+LP+ PPV NRPPEKRQ
Sbjct  76   FGHSYFSPSHNLLEEISNATPNFLMNQSNLTHDFVLPARPGFDDLPRSPPVINRPPEKRQ  135

Query  567  RVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQ  746
            RVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHI FGLMPDQ VK+ N  Q
Sbjct  136  RVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIQFGLMPDQTVKRANVRQ  195

Query  747  QEGEDGLMKDG-FLAPPNLGVSPY  815
            Q+GED LMKDG F    N+ VSPY
Sbjct  196  QDGEDVLMKDGLFNTSANVSVSPY  219



>gb|AID67128.1| YAB1 protein [Solanum sisymbriifolium]
 gb|AID67129.1| YAB1 protein [Solanum aethiopicum]
Length=220

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 159/204 (78%), Gaps = 12/204 (6%)
 Frame = +3

Query  228  GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTA---PNQLH  398
             EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL     G LLP+        H
Sbjct  21   SEQLCYVHCNVCDTVLAVSVPCTSLFKTVTVRCGHCTNLLP----GWLLPSTNHHHQLHH  76

Query  399  LPHSFFSP-QNLLDEIRNTPPSLLMNQPN-PNESLMPIR-GVDELPKPP-VANRPPEKRQ  566
              H++FSP  NLL+EI N  P+ LMNQ N  ++ ++P R G D+LP+PP V NRPPEKRQ
Sbjct  77   FGHTYFSPSHNLLEEISNATPNFLMNQSNSAHDFVLPARPGFDDLPRPPPVINRPPEKRQ  136

Query  567  RVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQ  746
            RVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHI FGLMPDQ VK+ N  Q
Sbjct  137  RVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIQFGLMPDQTVKRANVRQ  196

Query  747  QEGEDGLMKDG-FLAPPNLGVSPY  815
            Q+GED LMKDG F    N+ VSPY
Sbjct  197  QDGEDVLMKDGLFNTSANVSVSPY  220



>ref|XP_006294955.1| hypothetical protein CARUB_v10024011mg [Capsella rubella]
 gb|EOA27853.1| hypothetical protein CARUB_v10024011mg [Capsella rubella]
Length=224

 Score =   263 bits (671),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 153/230 (67%), Positives = 173/230 (75%), Gaps = 22/230 (10%)
 Frame = +3

Query  162  SSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTN  341
            S SS  F+PDH       LSPS + LCYV CNFCDT+LAVSVP +SLFKTVTVRCG CT 
Sbjct  5    SPSSAVFSPDH-------LSPS-DHLCYVQCNFCDTILAVSVPYTSLFKTVTVRCGCCTT  56

Query  342  LLSVNMRGLLLPTAPNQLHL---PHSFFSPQNLLDEIRNTPPSLLMNQPNPNE------S  494
            LLSVNMR L+LP A NQL L   PHS F+ QN+L+E+R+ P ++ M   N +       S
Sbjct  57   LLSVNMR-LVLP-ASNQLQLQLGPHSNFNSQNMLEELRDAPSNMNMMMMNQHPNMNDMPS  114

Query  495  LMPIRGVDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKN  674
             M +    E+PK P  NRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKN
Sbjct  115  FMDLHQQHEIPKAPPVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKN  174

Query  675  WAHFPHIHFGLMPD-QPVKKPNACQQEGEDGL-MKDGFLAP-PNLGVSPY  815
            WAHFPHIHFGL+PD QPVKK N  QQEGED + MKDGF AP  N+GV+PY
Sbjct  175  WAHFPHIHFGLVPDNQPVKKTNMPQQEGEDNMVMKDGFYAPAANVGVTPY  224



>gb|KCW73031.1| hypothetical protein EUGRSUZ_E01474 [Eucalyptus grandis]
Length=272

 Score =   264 bits (675),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 153/179 (85%), Gaps = 11/179 (6%)
 Frame = +3

Query  153  KNMSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGH  332
            +N  SSS+AF+PD        LSP  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGH
Sbjct  74   RNNMSSSSAFSPDP-------LSP-NEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGH  125

Query  333  CTNLLSVNMRGLLLPTAP-NQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIR  509
            CTNLLSVNMR LLLP AP NQLHL HS+F+PQNLL+EIRN P ++LMNQ  PNE +M +R
Sbjct  126  CTNLLSVNMRSLLLPPAPANQLHLGHSYFTPQNLLEEIRNVPSNMLMNQTIPNEPMMQLR  185

Query  510  -GVDELPK-PPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWA  680
             G++++PK PPV NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKN +
Sbjct  186  GGIEDIPKPPPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNVS  244



>ref|NP_566037.1| axial regulator YABBY 1 [Arabidopsis thaliana]
 sp|O22152.1|YAB1_ARATH RecName: Full=Axial regulator YABBY 1; AltName: Full=Fl-54; AltName: 
Full=Protein ABNORMAL FLORAL ORGANS; AltName: Full=Protein 
FILAMENTOUS FLOWER; AltName: Full=Protein antherless 
[Arabidopsis thaliana]
 gb|AAD33715.1|AF136538_1 YABBY1 [Arabidopsis thaliana]
 gb|AAB82644.1| expressed protein [Arabidopsis thaliana]
 gb|AAC69834.1| FIL [Arabidopsis thaliana]
 gb|AAD16053.1| abnormal floral organs protein [Arabidopsis thaliana]
 gb|ABH04516.1| At2g45190 [Arabidopsis thaliana]
 gb|AEC10523.1| axial regulator YABBY 1 [Arabidopsis thaliana]
Length=229

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 166/213 (78%), Gaps = 15/213 (7%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
             SPS + LCYV CNFC T+LAV+VP +SLFKTVTVRCG CTNLLSVNMR  +LP A NQL
Sbjct  19   FSPS-DHLCYVQCNFCQTILAVNVPYTSLFKTVTVRCGCCTNLLSVNMRSYVLP-ASNQL  76

Query  396  HL---PHSFFSPQNLLDEIRNTPPSLLM----NQPNPNE--SLMPIRGVDELPKPPVANR  548
             L   PHS+F+PQ++L+E+R+ P ++ M      P  N+  S M +    E+PK P  NR
Sbjct  77   QLQLGPHSYFNPQDILEELRDAPSNMNMMMMNQHPTMNDIPSFMDLHQQHEIPKAPPVNR  136

Query  549  PPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPV  725
            PPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL+PD QPV
Sbjct  137  PPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLVPDNQPV  196

Query  726  KKPNACQQEGEDGL-MKDGFLAP--PNLGVSPY  815
            KK N  QQEGED + MK+GF AP   N+GV+PY
Sbjct  197  KKTNMPQQEGEDNMVMKEGFYAPAAANVGVTPY  229



>ref|XP_007052114.1| Plant-specific transcription factor YABBY family protein isoform 
2 [Theobroma cacao]
 gb|EOX96271.1| Plant-specific transcription factor YABBY family protein isoform 
2 [Theobroma cacao]
Length=154

 Score =   258 bits (660),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 141/155 (91%), Gaps = 3/155 (2%)
 Frame = +3

Query  357  MRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMP-IRG-VDELPK  530
            MRGLLLP A NQLHL HSFF+PQNLL+EIR+ PP++L+NQPNP++++MP IRG V+E+PK
Sbjct  1    MRGLLLPAA-NQLHLGHSFFTPQNLLEEIRSAPPNMLINQPNPSDTVMPAIRGGVEEIPK  59

Query  531  PPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  710
            PPV NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM
Sbjct  60   PPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  119

Query  711  PDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            PDQPVKK N  QQEGED LMKDGF A  N+GV+PY
Sbjct  120  PDQPVKKTNVRQQEGEDVLMKDGFFASTNVGVTPY  154



>ref|XP_010506457.1| PREDICTED: axial regulator YABBY 1 [Camelina sativa]
 ref|XP_010518132.1| PREDICTED: axial regulator YABBY 1 [Camelina sativa]
Length=227

 Score =   260 bits (665),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 171/226 (76%), Gaps = 22/226 (10%)
 Frame = +3

Query  174  TAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSV  353
              F+PDH       LSPS + LCYV CNFCDT+LAVSVP +SLFKTVTVRCG CT LLSV
Sbjct  12   AVFSPDH-------LSPS-DHLCYVQCNFCDTILAVSVPYTSLFKTVTVRCGCCTTLLSV  63

Query  354  NMRGLLLPTAPNQLHL---PHSFFSPQNLLDEIRNTPPSLLMNQPNPNE------SLMPI  506
            NMR L+LP A NQL L   PHS+F+ QN+++E+R+ P ++ M   N +       S M +
Sbjct  64   NMR-LVLP-ASNQLQLQLGPHSYFNSQNIMEELRDAPSNMNMMMMNQHSNMNDIPSFMDL  121

Query  507  RGVDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  686
                E+PK P  NRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHF
Sbjct  122  HQQHEIPKAPPVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHF  181

Query  687  PHIHFGLMPD-QPVKKPNACQQEGEDGL-MKDGFLAP-PNLGVSPY  815
            PHIHFGL+PD QPVKK N  QQEGED + MKDGF AP  N+GV+PY
Sbjct  182  PHIHFGLVPDNQPVKKTNMPQQEGEDNMVMKDGFYAPAANVGVTPY  227



>ref|XP_010508202.1| PREDICTED: axial regulator YABBY 1-like [Camelina sativa]
Length=228

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 149/227 (66%), Positives = 171/227 (75%), Gaps = 23/227 (10%)
 Frame = +3

Query  174  TAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSV  353
              F+PDH       LSPS + LCYV CNFCDT+LAVSVP +SLFKTVTVRCG CT LLSV
Sbjct  12   AVFSPDH-------LSPS-DHLCYVQCNFCDTILAVSVPYTSLFKTVTVRCGCCTTLLSV  63

Query  354  NMRGLLLPTAPNQLHL---PHSFFSPQNLLDEIRNTPPSLLMNQPNPNE------SLMPI  506
            NMR L+LP A NQL L   PHS+F+ QN+++E+R+ P ++ M   N +       S M +
Sbjct  64   NMR-LVLP-ASNQLQLQLGPHSYFNSQNIMEELRDAPSNMNMMMMNQHSNMNDIPSFMDL  121

Query  507  RGVDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  686
                E+PK P  NRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHF
Sbjct  122  HQQHEIPKAPPVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHF  181

Query  687  PHIHFGLMPD-QPVKKPNACQQEGEDG--LMKDGFLAP-PNLGVSPY  815
            PHIHFGL+PD QPVKK N  QQEGED   +MKDGF AP  N+GV+PY
Sbjct  182  PHIHFGLVPDNQPVKKTNMPQQEGEDNNMVMKDGFYAPAANVGVTPY  228



>ref|XP_006386566.1| hypothetical protein POPTR_0002s14600g [Populus trichocarpa]
 gb|ERP64363.1| hypothetical protein POPTR_0002s14600g [Populus trichocarpa]
Length=167

 Score =   257 bits (657),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 145/219 (66%), Gaps = 52/219 (24%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSSSS AF PDH          S EQLCYVHCNFCDTVLAVSVPC+SL+KTV VRCGHCT
Sbjct  1    MSSSSAAFGPDHL--------SSSEQLCYVHCNFCDTVLAVSVPCTSLYKTVAVRCGHCT  52

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVD  518
            NLLSV+M GLL   A NQ +L H FF+PQN+L                            
Sbjct  53   NLLSVSMHGLL--PAANQFYLGHGFFNPQNIL----------------------------  82

Query  519  ELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIH  698
                          R RVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIH
Sbjct  83   --------------RHRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIH  128

Query  699  FGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            FGLMPDQPVKK N  QQEGED LM D F A  N+GV+PY
Sbjct  129  FGLMPDQPVKKANVRQQEGEDVLMTDEFFAAANVGVTPY  167



>ref|XP_004147586.1| PREDICTED: axial regulator YABBY 1-like [Cucumis sativus]
 ref|XP_004167326.1| PREDICTED: axial regulator YABBY 1-like [Cucumis sativus]
 gb|KGN50218.1| Axial regulator YABBY1 [Cucumis sativus]
Length=248

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 163/209 (78%), Gaps = 10/209 (5%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            L  S EQLCYVHCN CDTVLAVSVPC SLFKTVTVRCGHCTNLL VNMRGLLLP+ PNQ 
Sbjct  41   LPSSPEQLCYVHCNICDTVLAVSVPCCSLFKTVTVRCGHCTNLLPVNMRGLLLPS-PNQF  99

Query  396  H-LPHSFFSP-QNLLDEIRNTPPSLLMNQ--PNPNESLMPIRGV-DELPKPPVANRPPEK  560
            H L HSFFSP  N+L+ +     + L+NQ     N   MP RGV DELP+PPV NRPPEK
Sbjct  100  HQLGHSFFSPSHNILENMATPNSNYLINQFGATTNNFGMPSRGVTDELPRPPVVNRPPEK  159

Query  561  RQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNA  740
            RQRVPSAYNRFIKDEIQRIK+ NPDISHREAFSAAAKNWAHFPHIHFGLMPDQ VKK N 
Sbjct  160  RQRVPSAYNRFIKDEIQRIKSVNPDISHREAFSAAAKNWAHFPHIHFGLMPDQTVKKTNI  219

Query  741  CQQEGEDG---LMKD-GFLAPPNLGVSPY  815
             QQE  D    LMKD GF A  N+GVS +
Sbjct  220  RQQEQGDAQNVLMKDNGFYASANVGVSHF  248



>ref|XP_006375305.1| hypothetical protein POPTR_0014s06210g [Populus trichocarpa]
 gb|ERP53102.1| hypothetical protein POPTR_0014s06210g [Populus trichocarpa]
Length=165

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 151/221 (68%), Gaps = 58/221 (26%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            M+SSS AF+PDH          S +QLCYVHCNFCDTVLA+                   
Sbjct  1    MASSSAAFSPDHLS--------SSDQLCYVHCNFCDTVLAI-------------------  33

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNT--PPSLLMNQPNPNESLMPIRG  512
                                         N+L+ +R+T  PPSL++NQPNPNES+MPIRG
Sbjct  34   -----------------------------NILEGMRSTGAPPSLMINQPNPNESVMPIRG  64

Query  513  VDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH  692
            V+E+PKPPV NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH
Sbjct  65   VEEIPKPPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH  124

Query  693  IHFGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            IHFGLMPDQPVKK N  QQEGED LMKDGF AP N+GV+PY
Sbjct  125  IHFGLMPDQPVKKTNVRQQEGEDVLMKDGFFAPANVGVTPY  165



>emb|CAG17551.1| putative CRC transcription factor 1 [Ipomoea nil]
Length=123

 Score =   252 bits (644),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +3

Query  312  VTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNE  491
            VTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNE
Sbjct  1    VTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNE  60

Query  492  SLMPIRGVDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAK  671
            SLMPIRGVDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAK
Sbjct  61   SLMPIRGVDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAK  120

Query  672  NWA  680
            NWA
Sbjct  121  NWA  123



>emb|CDP09914.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   254 bits (650),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 143/171 (84%), Gaps = 5/171 (3%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLH--  398
            S EQLCYVHCN CDTVLAVSVPC+SLF+TVTVRCGHCTNLL VNMRGLLLP+A NQLH  
Sbjct  20   SSEQLCYVHCNICDTVLAVSVPCTSLFQTVTVRCGHCTNLLPVNMRGLLLPSA-NQLHNH  78

Query  399  LPHSFFSPQ-NLLDEIRNTPPSLLMNQPNPNE-SLMPIRGVDELPKPPVANRPPEKRQRV  572
              H+FFSP  N LD+I +  P+ LMNQ   ++ +L P  G  +LP+PPV NRPPE+RQR+
Sbjct  79   FGHTFFSPSPNFLDQISSPTPNFLMNQTTASDFTLPPQTGFSDLPRPPVMNRPPERRQRI  138

Query  573  PSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPV  725
            PSAYNRFIK+EIQRIKA NPDISHREAFSAAAKNWAHFPHI FGLMPDQ V
Sbjct  139  PSAYNRFIKEEIQRIKATNPDISHREAFSAAAKNWAHFPHIQFGLMPDQTV  189



>emb|CDX98262.1| BnaC06g16230D [Brassica napus]
Length=244

 Score =   256 bits (654),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 168/228 (74%), Gaps = 30/228 (13%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS E LCYV CNFC+T+LAVSVP +SLFKTVTVRCG C NLLSVNMR L+LP A NQ+
Sbjct  19   LSPS-EHLCYVQCNFCETILAVSVPYTSLFKTVTVRCGCCANLLSVNMRSLVLP-ASNQI  76

Query  396  HL---PHSFFSPQNLLDEIRNTPPSL---LMNQ-PNPNE--SLMPIRGVDELPKPPVANR  548
             L   P S+F+PQN+L+E+R  P ++   ++NQ PN N+  S M +    E+PK P  NR
Sbjct  77   QLQLGPQSYFTPQNILEELREAPSNMNMMMINQHPNMNDIPSFMDLHQKHEIPKAPPINR  136

Query  549  ----------------PPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWA  680
                             PEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWA
Sbjct  137  HIKRWPYPKKNDEVMMAPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWA  196

Query  681  HFPHIHFGLMPD-QPVKKPNACQQEGEDGL-MKDGFLAP-PNLGVSPY  815
            HFPHIHFGLMPD QPVKK N  QQ GE+ + MK+GF AP  N+G++PY
Sbjct  197  HFPHIHFGLMPDNQPVKKTNMPQQAGEENMGMKEGFYAPAANVGMTPY  244



>ref|XP_009142322.1| PREDICTED: axial regulator YABBY 1-like isoform X2 [Brassica 
rapa]
Length=231

 Score =   255 bits (652),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 165/212 (78%), Gaps = 16/212 (8%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS EQLCYV CN+C+T+LAVSVP +S+FKTVTVRCG CTNL+SVNMR L+LP A NQL
Sbjct  24   LSPS-EQLCYVQCNYCETILAVSVPYTSMFKTVTVRCGCCTNLISVNMRSLVLP-ASNQL  81

Query  396  HL---PHSFFSPQNLLDEIRNTPPSLLMNQPNPNE------SLMPIRGVDELPKPPVANR  548
             L   PHS+F+PQN+L+E+++ P ++ M   N +       S M +    E+PK P  NR
Sbjct  82   QLQLGPHSYFTPQNILEELKDAPSNMNMMMMNQHPNMNDIPSFMDLHQQHEIPKAPPVNR  141

Query  549  PPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPV  725
              +KRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL PD QPV
Sbjct  142  --QKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLAPDNQPV  199

Query  726  KKPNACQQEGEDGL-MKDGFLAP-PNLGVSPY  815
            KK N  QQEGED + MK+GF AP  N+GV PY
Sbjct  200  KKTNMPQQEGEDNMGMKEGFYAPAANVGVIPY  231



>gb|ACO92387.1| DBC43-3-2 [Brassica rapa subsp. pekinensis]
Length=231

 Score =   255 bits (652),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 165/212 (78%), Gaps = 16/212 (8%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS EQLCYV CN+C+T+LAVSVP +S+FKTVTVRCG CTNL+SVNMR L+LP A NQL
Sbjct  24   LSPS-EQLCYVQCNYCETILAVSVPYTSMFKTVTVRCGCCTNLISVNMRSLVLP-ASNQL  81

Query  396  HL---PHSFFSPQNLLDEIRNTPPSLLMNQPNPNE------SLMPIRGVDELPKPPVANR  548
             L   PHS+F+PQN+L+E+++ P ++ M   N +       S M +    E+PK P  NR
Sbjct  82   QLQLGPHSYFTPQNILEELKDAPSNMNMMMMNQHPNMNDIPSFMDLHQQHEIPKAPPVNR  141

Query  549  PPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPV  725
              +KRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL PD QPV
Sbjct  142  --QKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLAPDNQPV  199

Query  726  KKPNACQQEGEDGL-MKDGFLAP-PNLGVSPY  815
            KK N  QQEGED + MK+GF AP  N+GV PY
Sbjct  200  KKTNMPQQEGEDNIGMKEGFYAPAANVGVIPY  231



>ref|XP_010692186.1| PREDICTED: axial regulator YABBY 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=256

 Score =   256 bits (654),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 159/222 (72%), Positives = 171/222 (77%), Gaps = 23/222 (10%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNM---RGLLLPTAP  386
            LSPS +QLCYVHCNFCDTVLAVSVP SSLFKTVTVRCGHCTNLLSV M        P   
Sbjct  36   LSPS-DQLCYVHCNFCDTVLAVSVPSSSLFKTVTVRCGHCTNLLSVQMWTPSTPPPPLPT  94

Query  387  NQLHL---PHSFF-SPQNLLDEIRNTPPSLLMN--QPNPNESLMPIRGVD-----ELPKP  533
            NQLH    P SFF SP NLL+EIR++ P+ + N  Q   NE +MP+RG+D     ELPKP
Sbjct  95   NQLHHHLPPPSFFTSPHNLLEEIRSSTPNFINNHHQSVFNEPMMPVRGIDHHHHQELPKP  154

Query  534  PVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMP  713
            P  NRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMP
Sbjct  155  PPVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMP  214

Query  714  D-QPVKKPNA-CQQEGE-DGLMKDGFLAPP-----NLGVSPY  815
            D QPVKK N   QQEGE D LMK+GFLAP      N+GV PY
Sbjct  215  DHQPVKKANVRQQQEGEHDVLMKEGFLAPQANCNVNVGVGPY  256



>ref|XP_011093320.1| PREDICTED: axial regulator YABBY 1-like [Sesamum indicum]
Length=155

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 142/157 (90%), Gaps = 6/157 (4%)
 Frame = +3

Query  357  MRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPS-LLMNQPNPNESLMPIRGVDELPKP  533
            MRGLLLP+A NQLHL HSFF PQN+L+EI N+ PS LL+NQ NPNESLMP+RG+DELPKP
Sbjct  1    MRGLLLPSA-NQLHLGHSFFPPQNILEEITNSSPSNLLINQQNPNESLMPVRGIDELPKP  59

Query  534  PVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMP  713
            PVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMP
Sbjct  60   PVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMP  119

Query  714  D-QPVKKPNACQQEGEDG-LMKDGFLA-PPNLGVSPY  815
            D QPVKK N CQQEG+D  +MKDGFLA   NLGV+PY
Sbjct  120  DHQPVKK-NVCQQEGDDHVMMKDGFLATAANLGVTPY  155



>emb|CDX95636.1| BnaC03g25170D [Brassica napus]
Length=226

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 162/210 (77%), Gaps = 12/210 (6%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS + LCYV CNFC+T+LAVSVP +S+FKTVTVRCG CTNLLSVNMR   LP A NQL
Sbjct  19   LSPS-DHLCYVQCNFCETILAVSVPYTSMFKTVTVRCGCCTNLLSVNMRSAALP-ASNQL  76

Query  396  HL-PHSFFSPQNLLDEIRNTPPSLLMNQPNPNE------SLMPIRGVDELPKPPVANRPP  554
             L PHS+F+ QN+L+E+R+ P ++ M   N +       S M I    E+ K P  NRPP
Sbjct  77   QLGPHSYFNTQNILEELRDAPSNMNMMMMNQHPNMNDIPSFMNIHRQHEITKAPPVNRPP  136

Query  555  EKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKK  731
            EKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL PD QPVKK
Sbjct  137  EKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLAPDNQPVKK  196

Query  732  PNACQQEGEDGL-MKDGFLAP-PNLGVSPY  815
             N  QQ+GED + MK+G  AP  ++GV+PY
Sbjct  197  TNMPQQDGEDNMGMKEGLYAPAAHVGVAPY  226



>gb|AFI44620.1| putative male sterile protein [Brassica rapa subsp. pekinensis]
Length=231

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 165/212 (78%), Gaps = 16/212 (8%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS EQLCYV CN+C+T+LAVSVP +S+FKTVTVRCG CTNL+SVNMR L+LP A NQL
Sbjct  24   LSPS-EQLCYVQCNYCETILAVSVPYTSMFKTVTVRCGCCTNLISVNMRSLVLP-ASNQL  81

Query  396  HL---PHSFFSPQNLLDEIRNTPPSLLMNQPNPNE------SLMPIRGVDELPKPPVANR  548
             L   PHS+F+PQN+L+E+++ P ++ M   N +       S M +    E+PK P  NR
Sbjct  82   QLQLGPHSYFTPQNILEELKDAPSNMNMMMMNQHPNMNDIPSFMDLHQQHEIPKVPPVNR  141

Query  549  PPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPV  725
              +KRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL PD QPV
Sbjct  142  --QKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLAPDNQPV  199

Query  726  KKPNACQQEGEDGL-MKDGFLAP-PNLGVSPY  815
            KK N  QQEGED + M++GF AP  N+GV PY
Sbjct  200  KKTNMPQQEGEDNMGMREGFYAPAANVGVIPY  231



>ref|XP_009104095.1| PREDICTED: axial regulator YABBY 1 isoform X3 [Brassica rapa]
Length=219

 Score =   253 bits (645),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 153/188 (81%), Gaps = 12/188 (6%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS E LCYV CNFC+T+LAVSVP +SLFKTVTVRCG CTNLLSVNMR L+LP A NQL
Sbjct  19   LSPS-EHLCYVQCNFCETILAVSVPYTSLFKTVTVRCGCCTNLLSVNMRSLVLP-ASNQL  76

Query  396  HL---PHSFFSPQNLLDEIRNTPPSL---LMNQ-PNPNE--SLMPIRGVDELPKPPVANR  548
             L   P S+F+PQN+L+E+R  P ++   ++NQ PN N+  SLM +    E+PK P  NR
Sbjct  77   QLQLGPQSYFTPQNILEELREAPSNMNMMMINQHPNMNDIPSLMDLHQKHEIPKAPPTNR  136

Query  549  PPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPV  725
            PPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD QPV
Sbjct  137  PPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDNQPV  196

Query  726  KKPNACQQ  749
            KK N  QQ
Sbjct  197  KKTNMPQQ  204



>gb|AFI44622.1| putative male sterile protein [Brassica rapa subsp. pekinensis]
Length=231

 Score =   253 bits (647),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 164/212 (77%), Gaps = 16/212 (8%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS EQLCYV CN+C+T+LAV VP +S+FKTVTVRCG CTNL+SVNMR L+LP A NQL
Sbjct  24   LSPS-EQLCYVQCNYCETILAVGVPYTSMFKTVTVRCGCCTNLISVNMRSLVLP-ASNQL  81

Query  396  HL---PHSFFSPQNLLDEIRNTPPSLLMNQPNPNE------SLMPIRGVDELPKPPVANR  548
             L   PHS+F+PQN+L+E+++ P ++ M   N +       S M +    E+PK P  NR
Sbjct  82   QLQLGPHSYFTPQNILEELKDAPSNMNMMMMNQHPNMNDIPSFMDLHQQHEIPKAPPVNR  141

Query  549  PPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPV  725
              +KRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL PD QPV
Sbjct  142  --QKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLAPDNQPV  199

Query  726  KKPNACQQEGEDGL-MKDGFLAP-PNLGVSPY  815
            KK N  QQEGED + MK+GF AP  N+GV PY
Sbjct  200  KKTNMPQQEGEDNMGMKEGFYAPAANVGVIPY  231



>ref|XP_010544370.1| PREDICTED: axial regulator YABBY 3 [Tarenaya hassleriana]
Length=219

 Score =   252 bits (643),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 151/199 (76%), Gaps = 11/199 (6%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLP  404
            S +QLCYVHC+FCDT LAVSVP SSL KTV VRCGHC NLLSVNMR L LP   NQLHLP
Sbjct  21   SSDQLCYVHCHFCDTFLAVSVPSSSLLKTVMVRCGHCANLLSVNMRALFLPPVSNQLHLP  80

Query  405  HSFFSPQ--NLLDEIRN-TPPSLLMNQPNPNESL-----MPIRGVDELPKPPVANRPPEK  560
            HSFF+P   +LL+E+RN TP S ++   +PNESL     M      E+PKPP  NR PEK
Sbjct  81   HSFFTPPPPHLLEEMRNGTPNSSVVMAHDPNESLVVPNRMGRLDFQEIPKPPPVNRLPEK  140

Query  561  RQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFP--HIHFGLMPDQPVKKP  734
            R RVPSAYNRF+K+EIQRIKAGNPDISHREAFSAAAKNWAHFP  HIH GLMPD P  K 
Sbjct  141  RPRVPSAYNRFMKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHIHLGLMPDHPPMKA  200

Query  735  NACQQEGEDGLM-KDGFLA  788
            N  QQEGE+ ++ ++GF  
Sbjct  201  NVRQQEGENAVVRREGFYG  219



>emb|CDY27390.1| BnaC04g50150D [Brassica napus]
Length=247

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 166/226 (73%), Gaps = 28/226 (12%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS EQLCYV CN+C+T+LAVSVP +S+FKTVTVRCG CTNL+SVNMR L+LP A NQL
Sbjct  24   LSPS-EQLCYVQCNYCETILAVSVPYTSMFKTVTVRCGCCTNLISVNMRSLVLP-ASNQL  81

Query  396  HL---PHSFFSPQNLLDEIRNTPPSLLMNQPNPNE------SLMPIRGVDELPKPPVANR  548
             L   PHS+F+PQN+L+E+++ P ++ M   N +       S M +    E+PK P  NR
Sbjct  82   QLQLGPHSYFTPQNILEELKDAPSNMNMMMMNQHPNMNDIPSFMDLHQQHEIPKAPPVNR  141

Query  549  --------------PPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  686
                           PEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHF
Sbjct  142  QRERKKDNESSLNESPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHF  201

Query  687  PHIHFGLMPD-QPVKKPNACQQEGEDGL-MKDGFLAP-PNLGVSPY  815
            PHIHFGL PD QPVKK +  QQEGED + MK+GF AP  N+GV PY
Sbjct  202  PHIHFGLAPDNQPVKKTSMPQQEGEDNMGMKEGFYAPAANVGVIPY  247



>ref|XP_009104093.1| PREDICTED: axial regulator YABBY 1 isoform X1 [Brassica rapa]
Length=233

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 153/188 (81%), Gaps = 12/188 (6%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS E LCYV CNFC+T+LAVSVP +SLFKTVTVRCG CTNLLSVNMR L+LP A NQL
Sbjct  19   LSPS-EHLCYVQCNFCETILAVSVPYTSLFKTVTVRCGCCTNLLSVNMRSLVLP-ASNQL  76

Query  396  HL---PHSFFSPQNLLDEIRNTPPSL---LMNQ-PNPNE--SLMPIRGVDELPKPPVANR  548
             L   P S+F+PQN+L+E+R  P ++   ++NQ PN N+  SLM +    E+PK P  NR
Sbjct  77   QLQLGPQSYFTPQNILEELREAPSNMNMMMINQHPNMNDIPSLMDLHQKHEIPKAPPTNR  136

Query  549  PPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPV  725
            PPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD QPV
Sbjct  137  PPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDNQPV  196

Query  726  KKPNACQQ  749
            KK N  QQ
Sbjct  197  KKTNMPQQ  204



>ref|XP_010692187.1| PREDICTED: axial regulator YABBY 1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=255

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 159/222 (72%), Positives = 170/222 (77%), Gaps = 24/222 (11%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNM---RGLLLPTAP  386
            LSPS +QLCYVHCNFCDTVLAVSVP SSLFKTVTVRCGHCTNLLSV M        P   
Sbjct  36   LSPS-DQLCYVHCNFCDTVLAVSVPSSSLFKTVTVRCGHCTNLLSVQMWTPSTPPPPLPT  94

Query  387  NQLHL---PHSFF-SPQNLLDEIRNTPPSLLMN--QPNPNESLMPIRGVD-----ELPKP  533
            NQLH    P SFF SP NLL EIR++ P+ + N  Q   NE +MP+RG+D     ELPKP
Sbjct  95   NQLHHHLPPPSFFTSPHNLL-EIRSSTPNFINNHHQSVFNEPMMPVRGIDHHHHQELPKP  153

Query  534  PVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMP  713
            P  NRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMP
Sbjct  154  PPVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMP  213

Query  714  D-QPVKKPNA-CQQEGE-DGLMKDGFLAPP-----NLGVSPY  815
            D QPVKK N   QQEGE D LMK+GFLAP      N+GV PY
Sbjct  214  DHQPVKKANVRQQQEGEHDVLMKEGFLAPQANCNVNVGVGPY  255



>ref|XP_010676177.1| PREDICTED: axial regulator YABBY 1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=227

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 150/212 (71%), Gaps = 14/212 (7%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  EQLCY+ C  C+TVLAVSVP  SLFKTVTVRCGHCT+L   N R LL+   PNQ HL
Sbjct  16   PPSEQLCYLQCTRCETVLAVSVPSCSLFKTVTVRCGHCTHLQPANTRSLLVQPPPNQFHL  75

Query  402  PHSFFSP---QNLLDEIRNTPPSLLMNQPNPNESLM----PIRGVDELPKPPVANRPPEK  560
             H+++SP      L E+ N  P+  + QPN   S M       G +ELPKPP  NRPPEK
Sbjct  76   AHNYYSPPTSHYRLGEMANPSPTYSVTQPNATSSYMTPTLSRGGSNELPKPPTTNRPPEK  135

Query  561  RQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVK----  728
            RQRVPSAYNRFIK+EIQRIKA NPDISHREAFSAAAKNWAHFPHIHFGLMPDQ  K    
Sbjct  136  RQRVPSAYNRFIKEEIQRIKAENPDISHREAFSAAAKNWAHFPHIHFGLMPDQTAKRTST  195

Query  729  -KPNACQQEGEDGL-MKDGFL-APPNLGVSPY  815
             +P+  Q+ GED + M+ GF  A  N+G+SPY
Sbjct  196  MRPHHPQEAGEDNVRMRSGFYSAQTNVGISPY  227



>ref|XP_009133711.1| PREDICTED: axial regulator YABBY 1 [Brassica rapa]
 emb|CDX83395.1| BnaA03g21110D [Brassica napus]
Length=225

 Score =   248 bits (633),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 162/210 (77%), Gaps = 13/210 (6%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS + LCYV CNFC+T+LAVSVP +S+FKTVTVRCG CTNLLSVNMR   LP A NQL
Sbjct  19   LSPS-DHLCYVQCNFCETILAVSVPYTSMFKTVTVRCGCCTNLLSVNMRSAALP-ASNQL  76

Query  396  HL-PHSFFSPQNLLDEIRNTPPSLLMNQPNPNE------SLMPIRGVDELPKPPVANRPP  554
             L PHS+F+ QN+L+E+R+ P ++ M   N +       S M I    E+ K P  NRPP
Sbjct  77   QLGPHSYFNTQNILEELRDAPSNMNMMMMNQHPNMNDIPSFMNIHQ-HEITKAPPVNRPP  135

Query  555  EKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKK  731
            EKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL PD QPVKK
Sbjct  136  EKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLAPDNQPVKK  195

Query  732  PNACQQEGEDGL-MKDGFLAP-PNLGVSPY  815
             N  QQ+GE+ + MK+G  AP  ++GV+PY
Sbjct  196  TNMPQQDGENNMGMKEGLYAPAAHVGVAPY  225



>ref|XP_004245737.1| PREDICTED: protein YABBY 4 isoform X1 [Solanum lycopersicum]
Length=216

 Score =   248 bits (632),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 153/205 (75%), Gaps = 11/205 (5%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLP-TAPNQLH  398
            P  EQLCYVHCN CDTVLAVSVPC+SLFKTVTVRCGHCTNLL     G LLP T  +  H
Sbjct  16   PPSEQLCYVHCNVCDTVLAVSVPCTSLFKTVTVRCGHCTNLLP----GWLLPSTNHHHHH  71

Query  399  LPHSFFSP-QNLLDEIRNTPPSLLMNQPNPNESL--MPIR-GVDELPKPPVANRPP-EKR  563
              H++FSP  NLLDEI N  P+ LMNQ N       +P R G D+LP+PP     P EKR
Sbjct  72   FGHTYFSPSHNLLDEISNATPNFLMNQSNSAHEFVQLPARPGFDDLPRPPPVVNRPPEKR  131

Query  564  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNAC  743
            QRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHI FGLMPDQ VK+ N  
Sbjct  132  QRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIQFGLMPDQTVKRTNVR  191

Query  744  QQEGEDGLMKDG-FLAPPNLGVSPY  815
            QQ+GED L KDG F    N+ VSPY
Sbjct  192  QQDGEDVLTKDGLFNTSANVSVSPY  216



>ref|XP_002872965.1| hypothetical protein ARALYDRAFT_490550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49224.1| hypothetical protein ARALYDRAFT_490550 [Arabidopsis lyrata subsp. 
lyrata]
Length=240

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 163/222 (73%), Gaps = 31/222 (14%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSV--NMRGLLLPTAPNQLH  398
            S EQLCYVHC+FCDTVLAVSVP SSLFKTVTVRCGHC+NLLSV  +MR LLLP+  N   
Sbjct  21   SSEQLCYVHCSFCDTVLAVSVPPSSLFKTVTVRCGHCSNLLSVTVSMRALLLPSVSN---  77

Query  399  LPHSFFSPQ------NLLDEIRNTPPSLLMNQ--------PNPNESL-MPIRG-----VD  518
            L HSF  P       NLL+E+R+   ++ MN          +P+ESL MP R      + 
Sbjct  78   LGHSFLPPPPPPSPPNLLEEMRSGGQNINMNMMMSHHGAAHHPDESLVMPTRNGRVDHLQ  137

Query  519  ELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIH  698
            E+P+PP ANRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIH
Sbjct  138  EMPRPP-ANRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIH  196

Query  699  FGLMPDQ-PVKKPNACQQEGEDGLM---KDGFL-APPNLGVS  809
            FGLM D  P KK N  QQEGED +M   ++GF  +  N+GV+
Sbjct  197  FGLMADHPPTKKANVRQQEGEDSMMGRDREGFYGSTANVGVT  238



>gb|AFI44619.1| putative male sterile protein [Brassica rapa subsp. pekinensis]
Length=230

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 164/212 (77%), Gaps = 17/212 (8%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSPS EQLCYV CN+C+T+LAVSVP +S+FKTVTVRCG CTNL+SVNMR L+LP A NQL
Sbjct  24   LSPS-EQLCYVQCNYCETILAVSVPYTSMFKTVTVRCGCCTNLISVNMRSLVLP-ASNQL  81

Query  396  HL---PHSFFSPQNLLDEIRNTPPSLLMNQPNPNE------SLMPIRGVDELPKPPVANR  548
             L   PHS+F+PQN+L+E+++ P ++ M   N +       S + +    E+PK P  NR
Sbjct  82   QLQLGPHSYFTPQNILEELKDAPSNMNMMMMNQHPNMNDIPSFIDLHQQHEIPKAPPVNR  141

Query  549  PPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPV  725
              +KRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL PD QPV
Sbjct  142  --QKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLAPDNQPV  199

Query  726  KKPNACQQEGEDGL-MKDGFLAP-PNLGVSPY  815
            KK N  QQ GED + MK+GF AP  N+GV PY
Sbjct  200  KKTNMPQQ-GEDNMGMKEGFYAPAANVGVIPY  230



>ref|XP_002452852.1| hypothetical protein SORBIDRAFT_04g033590 [Sorghum bicolor]
 gb|EES05828.1| hypothetical protein SORBIDRAFT_04g033590 [Sorghum bicolor]
Length=254

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 143/238 (60%), Positives = 158/238 (66%), Gaps = 38/238 (16%)
 Frame = +3

Query  216  LSPS-GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAP--  386
            L+PS  EQLCYVHCN CDT+LAV VPCSSLFKTVTVRCGHC NLLSVN+RGLLLP A   
Sbjct  17   LAPSPTEQLCYVHCNCCDTILAVGVPCSSLFKTVTVRCGHCANLLSVNLRGLLLPPAAPP  76

Query  387  -NQLHLPHSFFSP---QNLLDEIRNTPPSLLMNQPNPNES--------------------  494
             N L+  HS  SP     LLDE+    PSLLM Q + N S                    
Sbjct  77   ANHLNFGHSLLSPTSPHGLLDELALQAPSLLMEQASANLSSSTMTGGSNSSCASNLPAGP  136

Query  495  ---LMPIRGVDELPK--PPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFS  659
                 P++   ELPK   P  NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDI+HREAFS
Sbjct  137  MPAAKPVQQEPELPKTTAPSVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHREAFS  196

Query  660  AAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFL------APPNLGVSPY  815
            AAAKNWAHFPHIHFGLMPDQ +KK    Q   ED L+KDG        A  N+G++P+
Sbjct  197  AAAKNWAHFPHIHFGLMPDQGLKKTFKTQDGAEDMLLKDGLYAAAAAAAAANMGITPF  254



>dbj|BAJ83625.1| FIL-like YABBY protein [Cabomba caroliniana]
Length=209

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 142/206 (69%), Gaps = 16/206 (8%)
 Frame = +3

Query  228  GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPH  407
             EQLCYVHCNFC+TVLAVSVPCSSLFK VTVRCGHCTNLLSVNMR L  PT        H
Sbjct  10   AEQLCYVHCNFCNTVLAVSVPCSSLFKVVTVRCGHCTNLLSVNMRALHQPTPTPTPPSNH  69

Query  408  SFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPP----------VANRPPE  557
            +FF P NL ++ +     LL      + S+M   G   + + P            N+P E
Sbjct  70   NFFPPHNLSNQSQAAVSMLL------DSSMMKECGAPSVGRVPSHTTMTTRSTTINKPTE  123

Query  558  KRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPN  737
            KRQRVPSAYNRFIKDEIQRIKAGNPDI+HREAFSAAAKNWAHFPHIHFGLM DQ VKK N
Sbjct  124  KRQRVPSAYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHFPHIHFGLMGDQNVKKTN  183

Query  738  ACQQEGEDGLMKDGFLAPPNLGVSPY  815
              QQEG+D ++ +      N+ V+PY
Sbjct  184  LHQQEGDDLILSEELFKAANMEVTPY  209



>ref|XP_006647599.1| PREDICTED: protein YABBY 4-like [Oryza brachyantha]
Length=254

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 143/240 (60%), Positives = 153/240 (64%), Gaps = 41/240 (17%)
 Frame = +3

Query  216  LSPS-GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLL---LPTA  383
            L+PS  EQLCYVHCN CDT+LAV VPCSSLFKTVTVRCGHC NLLSVN+RGLL       
Sbjct  16   LAPSPTEQLCYVHCNCCDTILAVGVPCSSLFKTVTVRCGHCANLLSVNLRGLLHPPPAPP  75

Query  384  PNQLHLPHSFFSP---QNLLDEIRNTPPSLLMNQPNPNESLMPIRGVD------------  518
             NQLH   S  SP     LLDE+    PSLLM Q + + SL  I G              
Sbjct  76   ANQLHFGPSLLSPTSPHGLLDEMAFQAPSLLMEQASAS-SLSGITGHSSSSCASNVPAMQ  134

Query  519  -----------ELPK--PPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFS  659
                       ELPK  P   NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFS
Sbjct  135  TPPAKPVQQEPELPKNAPTSVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFS  194

Query  660  AAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFL--------APPNLGVSPY  815
            AAAKNWAHFPHIHFGLMPDQ  KK    Q   ED L+KD           A  N+GV+P+
Sbjct  195  AAAKNWAHFPHIHFGLMPDQGFKKTFKPQDGSEDILLKDSLYAAAAAAAAAAANMGVTPF  254



>dbj|BAJ83620.1| FIL-like YABBY protein [Cabomba caroliniana]
Length=213

 Score =   239 bits (610),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 141/206 (68%), Gaps = 16/206 (8%)
 Frame = +3

Query  228  GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPH  407
             EQLCYVHCNFC+TVLAVSVPCSSLFK VTVRCGHCTNLLSVNMR L  PT        H
Sbjct  14   AEQLCYVHCNFCNTVLAVSVPCSSLFKVVTVRCGHCTNLLSVNMRALHQPTPTPTPPSNH  73

Query  408  SFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPP----------VANRPPE  557
            +FF P NL ++ +     LL      + S+M   G   + + P            N+P E
Sbjct  74   NFFPPHNLSNQSQAAVSMLL------DSSMMKECGAPSVGRVPSHTTMTTRSTTINKPTE  127

Query  558  KRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPN  737
            KRQRVPSAYNRFIKDEIQRIKAGNPDI+HRE FSAAAKNWAHFPHIHFGLM DQ +KK N
Sbjct  128  KRQRVPSAYNRFIKDEIQRIKAGNPDITHRETFSAAAKNWAHFPHIHFGLMGDQNIKKTN  187

Query  738  ACQQEGEDGLMKDGFLAPPNLGVSPY  815
              QQEG+D ++ +      N+ V+PY
Sbjct  188  LHQQEGDDLILSEELFKAANMEVTPY  213



>ref|XP_004953265.1| PREDICTED: protein YABBY 4-like [Setaria italica]
Length=256

 Score =   241 bits (614),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 140/239 (59%), Positives = 156/239 (65%), Gaps = 39/239 (16%)
 Frame = +3

Query  216  LSPS-GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAP--  386
            L+PS  EQLCYVHCN CDT+LAV VPCSSLFKTVTVRCGHC NLLSVN+RGLLLP A   
Sbjct  18   LAPSPTEQLCYVHCNCCDTILAVGVPCSSLFKTVTVRCGHCANLLSVNLRGLLLPPAAPP  77

Query  387  --NQLHLPHSFFSP---QNLLDEIRNTPPSLLMNQPNPNES-------------------  494
              +QL   HS  SP     LLDE     PS+LM+Q + N S                   
Sbjct  78   AASQLSFGHSLLSPTSPHGLLDEFALQAPSILMDQASANLSSATTGRSNSSCGSNLPAAP  137

Query  495  -----LMPIRGVDELPK-PPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAF  656
                    ++   EL K  P  NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDI+HREAF
Sbjct  138  MPAAKPPAVQQEPELAKSAPSVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHREAF  197

Query  657  SAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFL------APPNLGVSPY  815
            SAAAKNWAHFPHIHFGLMPDQ +KK    Q   ED L+KDG        A  N+G++P+
Sbjct  198  SAAAKNWAHFPHIHFGLMPDQGLKKTFKAQDGAEDMLLKDGLYAAAAAAAAANMGITPF  256



>ref|XP_009408705.1| PREDICTED: protein YABBY 5-like [Musa acuminata subsp. malaccensis]
Length=213

 Score =   237 bits (605),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 145/200 (73%), Gaps = 14/200 (7%)
 Frame = +3

Query  219  SPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLH  398
            SPS EQLCY +CNFCDT+LAVSVP SSLF TVTV+CG CTNLLSVN RGLL P   NQ  
Sbjct  16   SPS-EQLCYAYCNFCDTILAVSVPRSSLFMTVTVKCGKCTNLLSVNARGLLFPEV-NQFR  73

Query  399  LPHSFFS--PQNLLDEIRNTPPSLLMNQPNPNESLMPI---------RGVDE-LPKPPVA  542
            L HSF +     L DEI  +P SLLM+    N +             RG D+ L + PV 
Sbjct  74   LGHSFLTLPHHKLSDEIPCSPTSLLMDPTTMNTTTTTTTNTLVASVNRGTDDKLRRTPVL  133

Query  543  NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQP  722
            N+P EKRQR+PSAYNRFIKDEIQRIKA NPDI+HREAFSAAAKNWAHFPHIHFGLMPDQ 
Sbjct  134  NKPLEKRQRIPSAYNRFIKDEIQRIKAVNPDITHREAFSAAAKNWAHFPHIHFGLMPDQL  193

Query  723  VKKPNACQQEGEDGLMKDGF  782
            +KK +   QEGED L+KD F
Sbjct  194  MKKASFRLQEGEDVLLKDSF  213



>gb|ACG32891.1| yabby15 protein [Zea mays]
Length=258

 Score =   238 bits (607),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 156/240 (65%), Gaps = 40/240 (17%)
 Frame = +3

Query  216  LSPS-GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAP--  386
            L+PS  EQLCYVHCN CDT+LAV VPCSSLFKTVTVRCGHC NLLSVN+RGLLLP A   
Sbjct  19   LAPSPTEQLCYVHCNCCDTILAVGVPCSSLFKTVTVRCGHCANLLSVNLRGLLLPPAAPA  78

Query  387  --NQLHLPHSFFSP---QNLLDEIR-NTPPSLLMNQPNPN-ESLMPIRGVD---------  518
              N L+  HS  SP     LLDE+     PS LM Q + N  S M  R  +         
Sbjct  79   PPNHLNFAHSLLSPTSPHGLLDELALQQAPSFLMEQASANLSSTMTGRSSNSSCASNLPP  138

Query  519  --------------ELPK-PPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREA  653
                          ELPK  P  NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDI+HREA
Sbjct  139  PAPMPAAQPVQQEAELPKTAPSVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHREA  198

Query  654  FSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFL------APPNLGVSPY  815
            FSAAAKNWAHFPHIHFGLMPDQ +KK    Q   ED L+KD         A  N+G++P+
Sbjct  199  FSAAAKNWAHFPHIHFGLMPDQGLKKTFKTQDGAEDMLLKDDLYAAAAAAAAANMGITPF  258



>ref|XP_008645991.1| PREDICTED: protein YABBY 4 [Zea mays]
 gb|ACF81128.1| unknown [Zea mays]
 gb|ACG32835.1| yabby15 protein [Zea mays]
 gb|ACR36720.1| unknown [Zea mays]
Length=261

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 143/241 (59%), Positives = 158/241 (66%), Gaps = 41/241 (17%)
 Frame = +3

Query  216  LSPS-GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAP--  386
            L+PS  EQLCYVHCN CDT+LAV VPCSSLFKTVTVRCGHC NLLSVN+RGLLLP A   
Sbjct  21   LAPSPTEQLCYVHCNCCDTILAVGVPCSSLFKTVTVRCGHCANLLSVNLRGLLLPPAAPA  80

Query  387  --NQLHLPHSFFSP---QNLLDEIR-NTPPSLLMNQPNPN-ESLMPIRGVD---------  518
              N L+  HS  SP     LLDE+     PS LM Q + N  S M  R  +         
Sbjct  81   PPNHLNFAHSLLSPTSPHGLLDELALQQAPSFLMEQASANLSSTMTGRSSNSSCASNLPP  140

Query  519  --------------ELPK-PPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREA  653
                          ELPK  P  NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDI+HREA
Sbjct  141  PAPMPAAQPVQQEAELPKTAPSVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHREA  200

Query  654  FSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEG-EDGLMKDGFL------APPNLGVSP  812
            FSAAAKNWAHFPHIHFGLMPDQ +KK     Q+G ED L+KD         A  N+G++P
Sbjct  201  FSAAAKNWAHFPHIHFGLMPDQGLKKTFKTHQDGAEDMLLKDDLYAAAAAAAAANMGITP  260

Query  813  Y  815
            +
Sbjct  261  F  261



>ref|NP_001047559.1| Os02g0643200 [Oryza sativa Japonica Group]
 sp|Q6H668.1|YAB4_ORYSJ RecName: Full=Protein YABBY 4; AltName: Full=OsYAB7; AltName: 
Full=OsYABBY4 [Oryza sativa Japonica Group]
 sp|A2X7Q3.1|YAB4_ORYSI RecName: Full=Protein YABBY 4; AltName: Full=OsYAB7; AltName: 
Full=OsYABBY4 [Oryza sativa Indica Group]
 dbj|BAD25781.1| putative YABBY transcription factor CDM51 [Oryza sativa Japonica 
Group]
 dbj|BAF09473.1| Os02g0643200 [Oryza sativa Japonica Group]
 dbj|BAF45805.1| OsYABBY4 protein [Oryza sativa Japonica Group]
 dbj|BAG97834.1| unnamed protein product [Oryza sativa Japonica Group]
Length=256

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 142/234 (61%), Positives = 151/234 (65%), Gaps = 39/234 (17%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAP----NQLH  398
            EQLCYVHCN CDT+LAV VPCSSLFKTVTVRCGHC NLLSVN+RGLLLP       NQLH
Sbjct  23   EQLCYVHCNCCDTILAVGVPCSSLFKTVTVRCGHCANLLSVNLRGLLLPAPAPAPANQLH  82

Query  399  LPHSFFSP---QNLLDEIRNTPPSLLMNQPNP----------------NESLM------P  503
               S  SP     LLDE+    PSLLM Q                   N   M      P
Sbjct  83   FGPSLLSPTSPHGLLDEVAFQTPSLLMEQAASASLSSITGRSSSSCASNAPAMQMPPAKP  142

Query  504  IRGVDELPK--PPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNW  677
            ++   ELPK  P  ANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNW
Sbjct  143  VQQEPELPKNAPASANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNW  202

Query  678  AHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFL--------APPNLGVSPY  815
            AHFPHIHFGLMPDQ  KK    Q   ED L+KD           A  N+GV+P+
Sbjct  203  AHFPHIHFGLMPDQGFKKTFKPQDGSEDILLKDSLYAAAAAAAAAAANMGVTPF  256



>gb|AAP79885.1| yabby15 protein [Zea mays]
Length=250

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 143/241 (59%), Positives = 158/241 (66%), Gaps = 41/241 (17%)
 Frame = +3

Query  216  LSPS-GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAP--  386
            L+PS  EQLCYVHCN CDT+LAV VPCSSLFKTVTVRCGHC NLLSVN+RGLLLP A   
Sbjct  10   LAPSPTEQLCYVHCNCCDTILAVGVPCSSLFKTVTVRCGHCANLLSVNLRGLLLPPAAPA  69

Query  387  --NQLHLPHSFFSP---QNLLDEIR-NTPPSLLMNQPNPN-ESLMPIRGVD---------  518
              N L+  HS  SP     LLDE+     PS LM Q + N  S M  R  +         
Sbjct  70   PPNHLNFAHSLLSPTSPHGLLDELALQQAPSFLMEQASANLSSTMTGRSSNSSCASNLPP  129

Query  519  --------------ELPK-PPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREA  653
                          ELPK  P  NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDI+HREA
Sbjct  130  PAPMPAAQPVQQEAELPKTAPSVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHREA  189

Query  654  FSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEG-EDGLMKDGFL------APPNLGVSP  812
            FSAAAKNWAHFPHIHFGLMPDQ +KK     Q+G ED L+KD         A  N+G++P
Sbjct  190  FSAAAKNWAHFPHIHFGLMPDQGLKKTFKTHQDGAEDMLLKDDLYAAAAAAAAANMGITP  249

Query  813  Y  815
            +
Sbjct  250  F  250



>ref|XP_010456314.1| PREDICTED: axial regulator YABBY 3 isoform X2 [Camelina sativa]
Length=235

 Score =   235 bits (600),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 164/216 (76%), Gaps = 24/216 (11%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSV--NMRGLLLPTAPNQLH  398
            S +QLCYVHC+FCDTVLAVSVP SSLFKTVTVRCGHC+NLLSV  NMR LLLP+  N   
Sbjct  21   STDQLCYVHCSFCDTVLAVSVPPSSLFKTVTVRCGHCSNLLSVTVNMRTLLLPSVSN---  77

Query  399  LPHSFFSPQ----NLLDEIRNTPPSLLMNQ--------PNPNESL-MPIR-GVDELPKPP  536
            + HSF  P     NLL+E+R+   ++ MN          +PNESL M  R G+ E+P+PP
Sbjct  78   IGHSFIPPPPPPPNLLEEMRSGGQNINMNMMMSHHGAAHHPNESLAMAARNGLQEMPRPP  137

Query  537  VANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
             ANRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM D
Sbjct  138  PANRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMAD  197

Query  717  Q-PVKKPNA-CQQEGEDGLM--KDGFL-APPNLGVS  809
              P KK N   QQEGEDG+M  ++GF  +  N+GV+
Sbjct  198  HPPTKKANVRQQQEGEDGMMGSREGFYGSAANVGVT  233



>ref|XP_009111513.1| PREDICTED: axial regulator YABBY 3 isoform X2 [Brassica rapa]
 emb|CDY63059.1| BnaAnng18530D [Brassica napus]
Length=238

 Score =   235 bits (600),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 162/219 (74%), Gaps = 27/219 (12%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSV--NMRGLLLPTAPNQLH  398
            S +QLCYVHC+FCDTVLAVSVP SSLFKTVTVRCGHC+NLLSV  NMR LLLP+  N   
Sbjct  21   SSDQLCYVHCSFCDTVLAVSVPPSSLFKTVTVRCGHCSNLLSVTVNMRALLLPSVSN---  77

Query  399  LPHSFFSPQ------NLLDEIRNTPPSLLMNQ--------PNPNESLM---PIRGVD--E  521
            + HSF          NLL+E+RN   ++ MN          + NES +    +R VD  E
Sbjct  78   IGHSFLPSPPPPPPPNLLEEMRNGGQNINMNMMMSHHAAAHHSNESFVMATRVRSVDLQE  137

Query  522  LPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHF  701
            +P+PP ANRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHF
Sbjct  138  MPRPPPANRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHF  197

Query  702  GLMPDQ-PVKKPNACQQEGEDGLM-KDGFL-APPNLGVS  809
            GLMPD  P KK N  QQEGE+ +M ++GF  +  N+GV+
Sbjct  198  GLMPDHPPTKKANVRQQEGEEVMMGREGFYGSAANVGVT  236



>ref|XP_010419551.1| PREDICTED: axial regulator YABBY 3-like isoform X2 [Camelina 
sativa]
Length=236

 Score =   234 bits (598),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 163/217 (75%), Gaps = 25/217 (12%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSV--NMRGLLLPTAPNQLH  398
            S +QLCYVHC+FCDTVLAVSVP SSLFKTVTVRCGHC+NLLSV  NMR LLLP+  N   
Sbjct  21   STDQLCYVHCSFCDTVLAVSVPPSSLFKTVTVRCGHCSNLLSVTVNMRTLLLPSVSN---  77

Query  399  LPHSFFSPQ----NLLDEIRNTPPSLLMNQ--------PNPNESL-MPIR-GVDELPKPP  536
            + HSF  P     NLL+E+R+    + MN          +PNESL M  R G+ E+P+PP
Sbjct  78   IGHSFIPPPPPPPNLLEEMRSGGQYINMNMMMSHHGAAHHPNESLAMAARNGLQEMPRPP  137

Query  537  VANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
             ANRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM D
Sbjct  138  PANRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMAD  197

Query  717  Q-PVKKPNA--CQQEGEDGLM--KDGFL-APPNLGVS  809
              P KK N    QQEGEDG+M  ++GF  +  N+GV+
Sbjct  198  HPPTKKANVRQQQQEGEDGMMGSREGFYGSAANVGVT  234



>ref|XP_006288552.1| hypothetical protein CARUB_v10001833mg [Capsella rubella]
 gb|EOA21450.1| hypothetical protein CARUB_v10001833mg [Capsella rubella]
Length=242

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 163/223 (73%), Gaps = 31/223 (14%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSV--NMRGLLLPTAPNQLH  398
            S +QLCYVHCNFCDTVLAVSVP SSLFKTVTVRCGHC+NLLSV  NMR LLLP+  N   
Sbjct  21   SSDQLCYVHCNFCDTVLAVSVPPSSLFKTVTVRCGHCSNLLSVAVNMRALLLPSVSN---  77

Query  399  LPHSFFSPQ-----NLLDEIRNTPPSLLMNQ---------PNPNESL-MPIRG------V  515
            + HSF SP      NLL+E+R+   ++ MN           +PNESL M  R       +
Sbjct  78   IGHSFISPTPPPPPNLLEEMRSGGQNINMNMIMSHHHGGAHHPNESLAMGTRNGRVDHHL  137

Query  516  DELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHI  695
             E+P+PP ANRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHI
Sbjct  138  QEMPRPPPANRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHI  197

Query  696  HFGLMPDQ-PVKKPNACQQEGEDGLM---KDGFL-APPNLGVS  809
            HFGLM D  P KK N  QQEGED +M   ++GF  +  N+GV+
Sbjct  198  HFGLMADHPPTKKANVRQQEGEDVMMGSSREGFYGSAANVGVT  240



>gb|KFK30595.1| hypothetical protein AALP_AA6G002000 [Arabis alpina]
Length=233

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 160/214 (75%), Gaps = 22/214 (10%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSV--NMRGLLLPTAPNQLH  398
            + +Q+CYVHC+FCDTVLAVSVP SSLFKTVTVRCGHC+NLLSV  +MR LLLP+  N   
Sbjct  21   ASDQICYVHCSFCDTVLAVSVPPSSLFKTVTVRCGHCSNLLSVTVSMRALLLPSVSN---  77

Query  399  LPHSFFSPQ----NLLDEIRNTPPSLLMN----QPNPNESL-MPIRG----VDELPKPPV  539
            L HSF  P     NLL+E+RN   ++ MN       PNESL M  R     + E+P+PP 
Sbjct  78   LGHSFLPPPPPTPNLLEEMRNGGQNMNMNMMVSHQGPNESLVMAARNGRVDLQEMPRPPP  137

Query  540  ANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQ  719
             NRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD 
Sbjct  138  PNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDH  197

Query  720  -PVKKPNACQQEGEDGLM--KDGFL-APPNLGVS  809
             P KK N  QQEGED ++   +GF  A  N+GV+
Sbjct  198  PPTKKANVRQQEGEDVMLGRSEGFYGAAANVGVT  231



>ref|NP_567154.1| axial regulator YABBY 3 [Arabidopsis thaliana]
 sp|Q9XFB1.1|YAB3_ARATH RecName: Full=Axial regulator YABBY 3 [Arabidopsis thaliana]
 gb|AAD33717.1|AF136540_1 YABBY3 [Arabidopsis thaliana]
 gb|AAK59771.1| AT4g00180/F6N15_22 [Arabidopsis thaliana]
 gb|AAO11578.1| At4g00180/F6N15_22 [Arabidopsis thaliana]
 gb|AEE81834.1| axial regulator YABBY 3 [Arabidopsis thaliana]
Length=240

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 163/221 (74%), Gaps = 29/221 (13%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSV--NMRGLLLPTAPNQLH  398
            S +QLCYVHC+FCDTVLAVSVP SSLFKTVTVRCGHC+NLLSV  +MR LLLP+  N   
Sbjct  21   STDQLCYVHCSFCDTVLAVSVPPSSLFKTVTVRCGHCSNLLSVTVSMRALLLPSVSN---  77

Query  399  LPHSFFSPQ------NLLDEIRNTPPSLLMNQ--------PNPNESLMPI----RGVD--  518
            L HSF  P       NLL+E+R+   ++ MN          +PNE L+      R VD  
Sbjct  78   LGHSFLPPPPPPPPPNLLEEMRSGGQNINMNMMMSHHASAHHPNEHLVMATRNGRSVDHL  137

Query  519  -ELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHI  695
             E+P+PP ANRPPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHI
Sbjct  138  QEMPRPPPANRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHI  197

Query  696  HFGLMPDQ-PVKKPNACQQEGEDGLM-KDGFL-APPNLGVS  809
            HFGLM D  P KK N  QQEGEDG+M ++GF  +  N+GV+
Sbjct  198  HFGLMADHPPTKKANVRQQEGEDGMMGREGFYGSAANVGVA  238



>ref|XP_010676179.1| PREDICTED: protein YABBY 4-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=202

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 130/177 (73%), Gaps = 7/177 (4%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  EQLCY+ C  C+TVLAVSVP  SLFKTVTVRCGHCT+L   N R LL+   PNQ HL
Sbjct  16   PPSEQLCYLQCTRCETVLAVSVPSCSLFKTVTVRCGHCTHLQPANTRSLLVQPPPNQFHL  75

Query  402  PHSFFSP---QNLLDEIRNTPPSLLMNQPNPNESLM----PIRGVDELPKPPVANRPPEK  560
             H+++SP      L E+ N  P+  + QPN   S M       G +ELPKPP  NRPPEK
Sbjct  76   AHNYYSPPTSHYRLGEMANPSPTYSVTQPNATSSYMTPTLSRGGSNELPKPPTTNRPPEK  135

Query  561  RQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKK  731
            RQRVPSAYNRFIK+EIQRIKA NPDISHREAFSAAAKNWAHFPHIHFGLMPDQ  K+
Sbjct  136  RQRVPSAYNRFIKEEIQRIKAENPDISHREAFSAAAKNWAHFPHIHFGLMPDQTAKR  192



>ref|NP_001053423.1| Os04g0536300 [Oryza sativa Japonica Group]
 sp|Q0JBF0.1|YAB5_ORYSJ RecName: Full=Protein YABBY 5; AltName: Full=OsYAB3; AltName: 
Full=OsYABBY5 [Oryza sativa Japonica Group]
 sp|Q01JG2.2|YAB5_ORYSI RecName: Full=Protein YABBY 5; AltName: Full=OsYAB3; AltName: 
Full=OsYABBY5 [Oryza sativa Indica Group]
 dbj|BAF15337.1| Os04g0536300 [Oryza sativa Japonica Group]
 dbj|BAF45806.1| OsYABBY5 protein [Oryza sativa Japonica Group]
 dbj|BAG91829.1| unnamed protein product [Oryza sativa Japonica Group]
Length=266

 Score =   233 bits (595),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 149/238 (63%), Gaps = 43/238 (18%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAP---NQLHL  401
            EQLCYVHCNFCDT+LAV VPCSSLFKTVTVRCGHC NLLSVN+RGLLLP A    NQL  
Sbjct  29   EQLCYVHCNFCDTILAVGVPCSSLFKTVTVRCGHCANLLSVNLRGLLLPAAASTANQLPF  88

Query  402  PHSFFSP---QNLLDEI--RNTPPSLLMNQPNPNESLMPI-------------------R  509
              +  SP     LLDE+     P SL+  Q +PN S +                     +
Sbjct  89   GQALLSPTSPHGLLDEVPSFQAPASLMTEQASPNVSSITSSNSSCANNAPATSMASAANK  148

Query  510  GVDELPK----PPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNW  677
                 P+     P ANR  EKRQRVPSAYNRFIKDEIQRIKA NPDI+HREAFSAAAKNW
Sbjct  149  ATQREPQQPKNAPSANRTSEKRQRVPSAYNRFIKDEIQRIKASNPDITHREAFSAAAKNW  208

Query  678  AHFPHIHFGLMPDQPVKKPNACQQE--GEDGLMKDGFL----------APPNLGVSPY  815
            AHFPHIHFGLMPDQ +KK     Q+  GE  L KDG            A  ++GV+P+
Sbjct  209  AHFPHIHFGLMPDQGLKKTGIQSQDGAGECMLFKDGLYAAAAAAAAATAASSMGVTPF  266



>emb|CAD41530.3| OSJNBb0020O11.2 [Oryza sativa Japonica Group]
 emb|CAH67113.1| H0502G05.4 [Oryza sativa Indica Group]
 gb|EAY94977.1| hypothetical protein OsI_16784 [Oryza sativa Indica Group]
Length=265

 Score =   233 bits (595),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 149/238 (63%), Gaps = 43/238 (18%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAP---NQLHL  401
            EQLCYVHCNFCDT+LAV VPCSSLFKTVTVRCGHC NLLSVN+RGLLLP A    NQL  
Sbjct  28   EQLCYVHCNFCDTILAVGVPCSSLFKTVTVRCGHCANLLSVNLRGLLLPAAASTANQLPF  87

Query  402  PHSFFSP---QNLLDEI--RNTPPSLLMNQPNPNESLMPI-------------------R  509
              +  SP     LLDE+     P SL+  Q +PN S +                     +
Sbjct  88   GQALLSPTSPHGLLDEVPSFQAPASLMTEQASPNVSSITSSNSSCANNAPATSMASAANK  147

Query  510  GVDELPK----PPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNW  677
                 P+     P ANR  EKRQRVPSAYNRFIKDEIQRIKA NPDI+HREAFSAAAKNW
Sbjct  148  ATQREPQQPKNAPSANRTSEKRQRVPSAYNRFIKDEIQRIKASNPDITHREAFSAAAKNW  207

Query  678  AHFPHIHFGLMPDQPVKKPNACQQE--GEDGLMKDGFL----------APPNLGVSPY  815
            AHFPHIHFGLMPDQ +KK     Q+  GE  L KDG            A  ++GV+P+
Sbjct  208  AHFPHIHFGLMPDQGLKKTGIQSQDGAGECMLFKDGLYAAAAAAAAATAASSMGVTPF  265



>dbj|BAD83708.1| filamentous flower like protein [Nuphar japonica]
Length=246

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 139/213 (65%), Gaps = 31/213 (15%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLL-------------  371
            EQLCYVHCNFC+TVLAVSVPCSSLFK VTVRCGHCTNLLSVNMR LL             
Sbjct  14   EQLCYVHCNFCNTVLAVSVPCSSLFKMVTVRCGHCTNLLSVNMRALLQPPPPPPQNHHFF  73

Query  372  -----LPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPP  536
                 LPT  NQ+     F +P +++ +   +P S   N          +          
Sbjct  74   PPSDNLPTDENQVAAAAMFLNP-SIIKDSGASPVSCAANHTTTTARTTTV----------  122

Query  537  VANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
              N+PPEKRQRVPSAYNRFIKDEIQRIKAGNPDI+HREAFS AAKNWAHFPHIHFGLM D
Sbjct  123  --NKPPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHREAFSTAAKNWAHFPHIHFGLMAD  180

Query  717  QPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            Q ++K N  QQEG D ++ +GF     +G +PY
Sbjct  181  QNMEKSNLQQQEGNDLIISNGFFTTAIMGFTPY  213



>ref|XP_010456313.1| PREDICTED: axial regulator YABBY 3 isoform X1 [Camelina sativa]
Length=236

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 163/217 (75%), Gaps = 25/217 (12%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSV--NMRGLLLPTAPNQLH  398
            S +QLCYVHC+FCDTVLAVSVP SSLFKTVTVRCGHC+NLLSV  NMR LLLP+  N   
Sbjct  21   STDQLCYVHCSFCDTVLAVSVPPSSLFKTVTVRCGHCSNLLSVTVNMRTLLLPSVSN---  77

Query  399  LPHSFFSPQ----NLLDEIRNTPPSLLMNQ--------PNPNESL-MPIR-GVDELPKPP  536
            + HSF  P     NLL+E+R+   ++ MN          +PNESL M  R G+ E+P+PP
Sbjct  78   IGHSFIPPPPPPPNLLEEMRSGGQNINMNMMMSHHGAAHHPNESLAMAARNGLQEMPRPP  137

Query  537  VANRPP-EKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMP  713
             ANRP  EKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM 
Sbjct  138  PANRPAPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMA  197

Query  714  DQ-PVKKPNA-CQQEGEDGLM--KDGFL-APPNLGVS  809
            D  P KK N   QQEGEDG+M  ++GF  +  N+GV+
Sbjct  198  DHPPTKKANVRQQQEGEDGMMGSREGFYGSAANVGVT  234



>ref|XP_009111509.1| PREDICTED: axial regulator YABBY 3 isoform X1 [Brassica rapa]
 ref|XP_009111510.1| PREDICTED: axial regulator YABBY 3 isoform X1 [Brassica rapa]
 ref|XP_009111511.1| PREDICTED: axial regulator YABBY 3 isoform X1 [Brassica rapa]
 ref|XP_009111512.1| PREDICTED: axial regulator YABBY 3 isoform X1 [Brassica rapa]
Length=239

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 154/220 (70%), Gaps = 28/220 (13%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSV--NMRGLLLPTAPNQLH  398
            S +QLCYVHC+FCDTVLAVSVP SSLFKTVTVRCGHC+NLLSV  NMR LLLP+  N   
Sbjct  21   SSDQLCYVHCSFCDTVLAVSVPPSSLFKTVTVRCGHCSNLLSVTVNMRALLLPSVSN---  77

Query  399  LPHSFFSPQ------NLLDEIRNTPPSLLMNQ--------PNPNESLM---PIRGVD---  518
            + HSF          NLL+E+RN   ++ MN          + NES +    +R VD   
Sbjct  78   IGHSFLPSPPPPPPPNLLEEMRNGGQNINMNMMMSHHAAAHHSNESFVMATRVRSVDLQE  137

Query  519  ELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIH  698
                PP     PEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIH
Sbjct  138  MPRPPPANRPAPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIH  197

Query  699  FGLMPDQ-PVKKPNACQQEGEDGLM-KDGFL-APPNLGVS  809
            FGLMPD  P KK N  QQEGE+ +M ++GF  +  N+GV+
Sbjct  198  FGLMPDHPPTKKANVRQQEGEEVMMGREGFYGSAANVGVT  237



>gb|EAZ31462.1| hypothetical protein OsJ_15599 [Oryza sativa Japonica Group]
Length=265

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 148/238 (62%), Gaps = 43/238 (18%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAP---NQLHL  401
            EQLCYVHCNFCDT+LAV VPCSSLFKTVTVRCGHC  LLSVN+RGLLLP A    NQL  
Sbjct  28   EQLCYVHCNFCDTILAVGVPCSSLFKTVTVRCGHCAKLLSVNLRGLLLPAAASTANQLPF  87

Query  402  PHSFFSP---QNLLDEI--RNTPPSLLMNQPNPNESLMPI-------------------R  509
              +  SP     LLDE+     P SL+  Q +PN S +                     +
Sbjct  88   GQALLSPTSPHGLLDEVPSFQAPASLMTEQASPNVSSITSSNSSCANNAPATSMASAANK  147

Query  510  GVDELPK----PPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNW  677
                 P+     P ANR  EKRQRVPSAYNRFIKDEIQRIKA NPDI+HREAFSAAAKNW
Sbjct  148  ATQREPQQPKNAPSANRTSEKRQRVPSAYNRFIKDEIQRIKASNPDITHREAFSAAAKNW  207

Query  678  AHFPHIHFGLMPDQPVKKPNACQQE--GEDGLMKDGFL----------APPNLGVSPY  815
            AHFPHIHFGLMPDQ +KK     Q+  GE  L KDG            A  ++GV+P+
Sbjct  208  AHFPHIHFGLMPDQGLKKTGIQSQDGAGECMLFKDGLYAAAAAAAAATAASSMGVTPF  265



>ref|XP_010419550.1| PREDICTED: axial regulator YABBY 3-like isoform X1 [Camelina 
sativa]
Length=237

 Score =   230 bits (586),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 162/218 (74%), Gaps = 26/218 (12%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSV--NMRGLLLPTAPNQLH  398
            S +QLCYVHC+FCDTVLAVSVP SSLFKTVTVRCGHC+NLLSV  NMR LLLP+  N   
Sbjct  21   STDQLCYVHCSFCDTVLAVSVPPSSLFKTVTVRCGHCSNLLSVTVNMRTLLLPSVSN---  77

Query  399  LPHSFFSPQ----NLLDEIRNTPPSLLMNQ--------PNPNESL-MPIR-GVDELPKPP  536
            + HSF  P     NLL+E+R+    + MN          +PNESL M  R G+ E+P+PP
Sbjct  78   IGHSFIPPPPPPPNLLEEMRSGGQYINMNMMMSHHGAAHHPNESLAMAARNGLQEMPRPP  137

Query  537  VANRPP-EKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMP  713
             ANRP  EKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM 
Sbjct  138  PANRPAPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMA  197

Query  714  DQ-PVKKPNA--CQQEGEDGLM--KDGFL-APPNLGVS  809
            D  P KK N    QQEGEDG+M  ++GF  +  N+GV+
Sbjct  198  DHPPTKKANVRQQQQEGEDGMMGSREGFYGSAANVGVT  235



>ref|XP_003569970.1| PREDICTED: protein YABBY 4-like [Brachypodium distachyon]
Length=257

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/240 (57%), Positives = 156/240 (65%), Gaps = 40/240 (17%)
 Frame = +3

Query  216  LSPS-GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAP--  386
            L+PS  EQLCYVHCN CDT+LAV VPCSSL+KTV VRCGHC NLLSVN+RGLLLP A   
Sbjct  18   LAPSPTEQLCYVHCNCCDTILAVGVPCSSLYKTVAVRCGHCANLLSVNLRGLLLPPAAPP  77

Query  387  -NQLHLPHSFFSP---QNLLDEIRNTPPSLLMNQPNPNE---------------SLMPIR  509
             NQ  L HS  SP     LLD++     SLLM+Q + N                S MP+ 
Sbjct  78   ANQPQLSHSLLSPTSPHGLLDDVAFQTTSLLMDQASGNNLSSGGFTGRSNSSCASNMPVM  137

Query  510  GVDELPKP------------PVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREA  653
             +    KP            P  N+PPEKRQRVPSAYNRFIKDEIQRIKAGNPDI+HREA
Sbjct  138  PMPAATKPAQQETEQTTKSAPSTNKPPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHREA  197

Query  654  FSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEG-EDGLMKDGFL-----APPNLGVSPY  815
            FSAAAKNWAHFPHIHFGL+PDQ  K+     Q+G ED L+KD        A  N+GV+P+
Sbjct  198  FSAAAKNWAHFPHIHFGLIPDQGFKRSFVKAQDGAEDMLLKDSLYAAAAAAAANMGVTPF  257



>gb|KFK37311.1| male sterile protein [Arabis alpina]
Length=216

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 152/207 (73%), Gaps = 25/207 (12%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPHS  410
            E LCYV           SVP +SLFKTVTVRCG CTNLLSVNMR  +LP A NQL  PHS
Sbjct  23   EHLCYV-----------SVPYTSLFKTVTVRCGCCTNLLSVNMRSAILP-ASNQLG-PHS  69

Query  411  F-FSPQNLLDEIRNTPPSLLMNQPNPNE--------SLMPIRGVDELPKPPVANRPPEKR  563
            + F+ QN+L+E+R+TP ++ M   N +         S M +    E+PK P  NRPPEKR
Sbjct  70   YNFNTQNILEELRDTPSNMNMMMMNQHPNMNGHDIPSFMDLHQQHEIPKAPPVNRPPEKR  129

Query  564  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKKPNA  740
            QRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL+PD QPVKK N 
Sbjct  130  QRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLVPDNQPVKKTNM  189

Query  741  CQQEGEDGL-MKDGFLAP-PNLGVSPY  815
             QQEGED + MK+GF AP  N+GV+PY
Sbjct  190  PQQEGEDNMVMKEGFYAPAANVGVTPY  216



>ref|XP_004982656.1| PREDICTED: protein YABBY 3-like [Setaria italica]
Length=303

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 138/260 (53%), Positives = 161/260 (62%), Gaps = 62/260 (24%)
 Frame = +3

Query  219  SPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPN---  389
            +P+ EQLCYVHC+FCDTVL VSVP SSLFKTVTVRCGHC++LL+VNMRGLL    P    
Sbjct  45   APASEQLCYVHCHFCDTVLVVSVPTSSLFKTVTVRCGHCSSLLTVNMRGLLFQGTPTNTA  104

Query  390  ----------------------------QLHLPHSF-FSP---QNLLDEIRNTP-PSLLM  470
                                        Q H  HS   +P   Q+LLDEI ++  PSL +
Sbjct  105  APPADVTSTTTTITTEPPAAADASVNNGQFHFHHSLNLNPPHQQSLLDEISSSANPSLQL  164

Query  471  NQPNPNESLMP-----------------IRGVDELPKP---PVANRPPEKRQRVPSAYNR  590
             + +    L+P                  +G  E P P   PV NRPPEKRQRVPSAYNR
Sbjct  165  LEQHGLGGLIPSGRNAAAPPPPHPPAAAAKGTKE-PSPRTNPVVNRPPEKRQRVPSAYNR  223

Query  591  FIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKKPNAC---QQEGE  758
            FIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD Q +KK +       + +
Sbjct  224  FIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDHQGLKKTSLLPHQDHQRK  283

Query  759  DGLMKDG-FLAPPNLGVSPY  815
            DGL+KDG + A  N+GV+PY
Sbjct  284  DGLLKDGLYAAAANMGVAPY  303



>ref|XP_010546420.1| PREDICTED: axial regulator YABBY 3-like [Tarenaya hassleriana]
Length=219

 Score =   227 bits (578),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 143/203 (70%), Gaps = 6/203 (3%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  EQLCYVHCN CDTVLAVSVP +SL KTVTVRCGHCT LL VNM   L PT       
Sbjct  13   PLHEQLCYVHCNVCDTVLAVSVPSTSLSKTVTVRCGHCTTLLPVNMPSSLFPTLNQFQGF  72

Query  402  PHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPI----RGV-DELPKP-PVANRPPEKR  563
             H+    +NL+ +I+N   + ++++ N            RGV  ELP+P  V  +P EKR
Sbjct  73   GHNLLPHKNLVGDIQNPNMNHMISEANGKHVFAASPPCPRGVAKELPRPHQVIKKPQEKR  132

Query  564  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNAC  743
            QRVPSAYNRFIK+EIQRIKA NP+I+HREAFSAAAKNWAHFPHI FGL+PDQ  ++ N  
Sbjct  133  QRVPSAYNRFIKEEIQRIKAENPNITHREAFSAAAKNWAHFPHIQFGLLPDQSARRSNMR  192

Query  744  QQEGEDGLMKDGFLAPPNLGVSP  812
            QQEGED +MKD F+A  N+G+ P
Sbjct  193  QQEGEDPVMKDVFVASANVGMHP  215



>ref|XP_006652579.1| PREDICTED: protein YABBY 5-like [Oryza brachyantha]
Length=270

 Score =   228 bits (582),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 142/217 (65%), Gaps = 33/217 (15%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAP---NQLHL  401
            EQLCYVHCNFCDT+LAV VPCSSLFKTVTVRCGHC NLLSVN+RGLLLP A    NQL  
Sbjct  30   EQLCYVHCNFCDTILAVGVPCSSLFKTVTVRCGHCANLLSVNLRGLLLPAAATAANQLPF  89

Query  402  PHSFFSP---QNLLDEI--RNTPPSLLMNQPNPNESLM------------------PIRG  512
              +  SP     LLDE+     PPSL+  Q +PN S +                    + 
Sbjct  90   GQALLSPTSPHGLLDEVPSFQAPPSLMTEQASPNVSSITSSNSSCANNAPATSMASATKA  149

Query  513  VDELPKPP----VANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWA  680
                P+ P     ANR  EKRQRVPSAYNRFIKDEIQRIKA NPDI+HREAFSAAAKNWA
Sbjct  150  TQREPQQPKNASSANRTSEKRQRVPSAYNRFIKDEIQRIKASNPDITHREAFSAAAKNWA  209

Query  681  HFPHIHFGLMPDQPVKKPNACQQEGEDG---LMKDGF  782
            HFPHIHFGLMPDQ +KK     QEG  G   L KDG 
Sbjct  210  HFPHIHFGLMPDQGLKKTGIQSQEGAAGECMLFKDGL  246



>gb|EMT32371.1| hypothetical protein F775_27799 [Aegilops tauschii]
Length=258

 Score =   228 bits (580),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 143/227 (63%), Gaps = 38/227 (17%)
 Frame = +3

Query  216  LSPS-GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQ  392
            L+PS  EQLCYVHCN CDT+LAV VPCSSLFKTVTVRCGHC NLLSVN+R LLLP     
Sbjct  16   LAPSPTEQLCYVHCNCCDTILAVGVPCSSLFKTVTVRCGHCANLLSVNLRALLLPPTAPP  75

Query  393  LHLPH------SFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRG-------VDELPKP  533
               P       S  SP  LLDE+    PSLLM+Q + N S    R        +  +P P
Sbjct  76   ATQPPLRPSLLSPTSPHGLLDEVAFQTPSLLMDQASTNLSGFTGRSNSSCASNLPAMPMP  135

Query  534  ----------------PVANR--------PPEKRQRVPSAYNRFIKDEIQRIKAGNPDIS  641
                            P ANR         PEKRQRVPSAYNRFIKDEIQRIKAGNPDI+
Sbjct  136  AAKPAQQETEQSAKSAPSANRRKDQLFLSAPEKRQRVPSAYNRFIKDEIQRIKAGNPDIT  195

Query  642  HREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGF  782
            HREAFSAAAKNWAHFPHIHFGLMPDQ  K+    Q   ED L+KDG 
Sbjct  196  HREAFSAAAKNWAHFPHIHFGLMPDQGFKRTFKAQDGAEDMLLKDGL  242



>ref|XP_006579625.1| PREDICTED: protein YABBY 4-like isoform X3 [Glycine max]
Length=156

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 127/158 (80%), Gaps = 7/158 (4%)
 Frame = +3

Query  357  MRGLLLPTAPNQLHLPHSFFSP-QNLLDEIRNTPPSLLMNQPN---PNESLMPIR-GVDE  521
            MRGLL+P+ P Q HL HSFFSP  NLL+EI N  P+ LMNQ N    NE  MP R   DE
Sbjct  1    MRGLLMPS-PTQFHLGHSFFSPSHNLLEEIPNPSPNFLMNQTNLSASNEFSMPARIAADE  59

Query  522  LPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHF  701
            LP+P + NRPPEKRQRVPSAYNRFIKDEIQRIK+ NPDI+HREAFSAAAKNWAHFPHIHF
Sbjct  60   LPRP-IMNRPPEKRQRVPSAYNRFIKDEIQRIKSVNPDITHREAFSAAAKNWAHFPHIHF  118

Query  702  GLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            GLMPDQ VKK N CQQEGE+ LMKDGF A  N+GVSPY
Sbjct  119  GLMPDQTVKKTNVCQQEGEEVLMKDGFYASANVGVSPY  156



>ref|XP_010240181.1| PREDICTED: protein YABBY 5-like [Brachypodium distachyon]
Length=265

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 149/236 (63%), Gaps = 41/236 (17%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTA-PNQLHLPH  407
            EQLCYVHCNFCDT+LAV VPCSSLFKTV VRCGHC NLLSVN+R LLLP A PNQL    
Sbjct  30   EQLCYVHCNFCDTILAVGVPCSSLFKTVAVRCGHCANLLSVNLRSLLLPAAAPNQLPFGQ  89

Query  408  SFFSP------QNLLDEIRN--TPPSLLMNQPNPNE------------------SLMPIR  509
            S  SP        LLDE+ +   P SLL  Q +PN                   S+ P +
Sbjct  90   SLISPTSPASPHGLLDEMSSFQAPSSLLTEQSSPNVSSITSSNNSSAINTPATMSMPPEK  149

Query  510  GVDELPK-----PPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKN  674
                 P+        + + PEKRQRVPSAYNRFIKDEIQRIKA NPDI+HREAFSAAAKN
Sbjct  150  AAQREPQTRKNASSGSTKHPEKRQRVPSAYNRFIKDEIQRIKANNPDITHREAFSAAAKN  209

Query  675  WAHFPHIHFGLMPDQPVKKPNACQQE--GEDGLMKDGFL-------APPNLGVSPY  815
            WAHFPHIHFGLMPDQ ++K +   Q+  G+  L KD          A  ++GV+P+
Sbjct  210  WAHFPHIHFGLMPDQALRKTSIQSQDAAGDCMLFKDSLYAAAAAAAAASSMGVTPF  265



>ref|XP_006396217.1| hypothetical protein EUTSA_v10028925mg [Eutrema salsugineum]
 gb|ESQ37670.1| hypothetical protein EUTSA_v10028925mg [Eutrema salsugineum]
Length=237

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 153/218 (70%), Gaps = 26/218 (12%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSV--NMRGLLLPTAPNQLH  398
            S +QL YVHC+FCDTVLAVSVP SSLFKTVTVRCGHC+NLLSV  NMR LLLP   N   
Sbjct  21   SLDQLGYVHCSFCDTVLAVSVPPSSLFKTVTVRCGHCSNLLSVTVNMRALLLPPVSN---  77

Query  399  LPHSFFSPQ---NLLDEIRNTPPSLLMNQ--------PNPNESL-MPIRGVDELPKPPVA  542
            L HSF  P    NLL+E+RN   ++ MN          + NESL M  R     P+  + 
Sbjct  78   LGHSFLPPPPPCNLLEEMRNGGQNINMNMMMSHQAAAHHSNESLVMATRNGRVDPQELMP  137

Query  543  NRPP-----EKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL  707
              PP     EKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL
Sbjct  138  RPPPANRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL  197

Query  708  MPDQ-PVKKPNACQQEGEDGLM-KDGFL--APPNLGVS  809
            MPD  P KK N  QQEGED ++ ++GF   +  N+GV+
Sbjct  198  MPDHPPTKKANVRQQEGEDVMLGREGFYGSSAANVGVT  235



>gb|EMT07786.1| hypothetical protein F775_25525 [Aegilops tauschii]
Length=273

 Score =   223 bits (569),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 149/246 (61%), Gaps = 39/246 (16%)
 Frame = +3

Query  162  SSSSTAFAPDhhhhhphhLSP---SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGH  332
            + S T+F PDH         P     EQLCYVHCNFCDT+LAV VPCSSLFKTV VRCGH
Sbjct  6    AESETSFFPDHLAEQQQQQQPPFGEQEQLCYVHCNFCDTILAVGVPCSSLFKTVAVRCGH  65

Query  333  CTNLLSVNMRGLLLPTAPNQLHL------PHSFFSPQNLLDEIRN--TPPSLLMNQPNPN  488
            C NLLSVN+R LLLP + NQL        P S  SP  LLDE+ +   P SLL +Q +PN
Sbjct  66   CANLLSVNLRNLLLPASANQLPFSPSLLSPTSPASPHGLLDEMSSFQAPSSLLTDQASPN  125

Query  489  -----------------ESLMP-------IRGVDELPKPPVANRPPEKRQRVPSAYNRFI  596
                              S+MP        R   +        + PEKRQRVPSAYNRFI
Sbjct  126  VSSITSSSNSCAINTPAMSMMPPPEKTPARREPGQRKGAASGTKHPEKRQRVPSAYNRFI  185

Query  597  KDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQE----GEDG  764
            KDEIQRIKA NPDI+HREAFSAAAKNWAHFPHIHFGLMPDQ + +  + Q +    G+  
Sbjct  186  KDEIQRIKANNPDITHREAFSAAAKNWAHFPHIHFGLMPDQGLMRKTSIQSQLDGAGDCM  245

Query  765  LMKDGF  782
            L KD  
Sbjct  246  LFKDSL  251



>ref|XP_004976365.1| PREDICTED: protein YABBY 5-like isoform X1 [Setaria italica]
Length=264

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 146/237 (62%), Gaps = 42/237 (18%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPH-  407
            EQLCYVHC  CDT+LAV VPCSSLFKTVTVRCGHC NLLSVN+RGLLLPTA     LP  
Sbjct  28   EQLCYVHCKCCDTILAVGVPCSSLFKTVTVRCGHCANLLSVNLRGLLLPTAAANNQLPFG  87

Query  408  -------SFFSPQNLLDEIR--NTPPSLLMNQPNP-----------------NESLM---  500
                   S  SP  LLDE+      PSL   +P                   N S M   
Sbjct  88   GQQQALLSPTSPHGLLDEMMPFQQAPSLTSAEPASACVSTITSINNSCGGRNNASAMSMA  147

Query  501  --PIRGVDELPKPP----VANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSA  662
              P++   + P+ P      NR  EKRQRVPSAYNRFIKDEIQRIKA NPDI+HREAFSA
Sbjct  148  PPPLKPAPQEPQLPKSAASGNRTAEKRQRVPSAYNRFIKDEIQRIKASNPDITHREAFSA  207

Query  663  AAKNWAHFPHIHFGLMPDQPVKKPNACQQEG------EDGLMKDGFLAPPNLGVSPY  815
            AAKNWAHFPHIHFGLMPDQ +KK +    EG      +DGL      A  ++G++P+
Sbjct  208  AAKNWAHFPHIHFGLMPDQGLKKASMQNHEGGECMLFKDGLYAAAAAAASSMGIAPF  264



>gb|EEC73684.1| hypothetical protein OsI_08248 [Oryza sativa Indica Group]
 gb|EEE57463.1| hypothetical protein OsJ_07698 [Oryza sativa Japonica Group]
Length=286

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 139/264 (53%), Positives = 148/264 (56%), Gaps = 69/264 (26%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRG----LLLPTAPNQLH  398
            EQLCYVHCN CDT+LAV VPCSSLFKTVTVRCGHC NLLSVN+RG       P   NQLH
Sbjct  23   EQLCYVHCNCCDTILAVGVPCSSLFKTVTVRCGHCANLLSVNLRGLLLPAPAPAPANQLH  82

Query  399  LPHSFF---SPQNLLDEIRNTPPSLLMNQP-------------------NPNESLMPIRG  512
               S     SP  LLDE+    PSLLM Q                     P   + P + 
Sbjct  83   FGPSLLSPTSPHGLLDEVAFQTPSLLMEQAASASLSSITGRSSSSCASNAPAMQMPPAKP  142

Query  513  VD---ELPK--PPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKN-  674
            V    ELPK  P  ANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKN 
Sbjct  143  VQQEPELPKNAPASANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNR  202

Query  675  -----------------------------WAHFPHIHFGLMPDQPVKKPNACQQEGEDGL  767
                                         WAHFPHIHFGLMPDQ  KK    Q   ED L
Sbjct  203  QLVPGRLRDAESKRLWFLGAFSPTAAIARWAHFPHIHFGLMPDQGFKKTFKPQDGSEDIL  262

Query  768  MKDGFL--------APPNLGVSPY  815
            +KD           A  N+GV+P+
Sbjct  263  LKDSLYAAAAAAAAAAANMGVTPF  286



>ref|XP_008448889.1| PREDICTED: protein YABBY 4-like [Cucumis melo]
Length=184

 Score =   216 bits (550),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 128/169 (76%), Gaps = 6/169 (4%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            L P  +QLCYVHCN CDTVLAVSVP +SLFK VTVRCG+C NLL V+M G +L  +P+Q 
Sbjct  13   LPPPSDQLCYVHCNICDTVLAVSVPSTSLFKRVTVRCGYCANLLPVSMCGGMLLPSPSQF  72

Query  396  H-LPHS--FFSP--QNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPK-PPVANRPPE  557
            H   HS  FFSP   N L+EI N  P+ LMNQ    +  M  R  +++P+ PP  NRPPE
Sbjct  73   HGFTHSTTFFSPNTHNFLEEISNPNPNFLMNQTEGIDLTMATRVPNDVPRQPPTINRPPE  132

Query  558  KRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFG  704
            KRQRVPSAYNRFIKDEIQRIKA NPDISHREAFSAAAKNWAHFPHI FG
Sbjct  133  KRQRVPSAYNRFIKDEIQRIKAANPDISHREAFSAAAKNWAHFPHIRFG  181



>ref|XP_010325468.1| PREDICTED: axial regulator YABBY 1 isoform X2 [Solanum lycopersicum]
Length=210

 Score =   216 bits (550),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 137/186 (74%), Gaps = 11/186 (6%)
 Frame = +3

Query  279  VSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLP-TAPNQLHLPHSFFSP-QNLLDEIRNT  452
            VSVPC+SLFKTVTVRCGHCTNLL     G LLP T  +  H  H++FSP  NLLDEI N 
Sbjct  29   VSVPCTSLFKTVTVRCGHCTNLLP----GWLLPSTNHHHHHFGHTYFSPSHNLLDEISNA  84

Query  453  PPSLLMNQPNPNESL--MPIR-GVDELPKPPVANRPP-EKRQRVPSAYNRFIKDEIQRIK  620
             P+ LMNQ N       +P R G D+LP+PP     P EKRQRVPSAYNRFIK+EIQRIK
Sbjct  85   TPNFLMNQSNSAHEFVQLPARPGFDDLPRPPPVVNRPPEKRQRVPSAYNRFIKEEIQRIK  144

Query  621  AGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDG-FLAPPN  797
            AGNPDISHREAFSAAAKNWAHFPHI FGLMPDQ VK+ N  QQ+GED L KDG F    N
Sbjct  145  AGNPDISHREAFSAAAKNWAHFPHIQFGLMPDQTVKRTNVRQQDGEDVLTKDGLFNTSAN  204

Query  798  LGVSPY  815
            + VSPY
Sbjct  205  VSVSPY  210



>ref|XP_004976366.1| PREDICTED: protein YABBY 5-like isoform X2 [Setaria italica]
Length=262

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 146/235 (62%), Gaps = 40/235 (17%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPH-  407
            EQLCYVHC  CDT+LAV VPCSSLFKTVTVRCGHC NLLSVN+RGLLLPTA     LP  
Sbjct  28   EQLCYVHCKCCDTILAVGVPCSSLFKTVTVRCGHCANLLSVNLRGLLLPTAAANNQLPFG  87

Query  408  -------SFFSPQNLLDEIR--NTPPSLLMNQPNP-----------------NESLM---  500
                   S  SP  LLDE+      PSL   +P                   N S M   
Sbjct  88   GQQQALLSPTSPHGLLDEMMPFQQAPSLTSAEPASACVSTITSINNSCGGRNNASAMSMA  147

Query  501  --PIRGVDELPKPP--VANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAA  668
              P++   + P+ P   A+   +KRQRVPSAYNRFIKDEIQRIKA NPDI+HREAFSAAA
Sbjct  148  PPPLKPAPQEPQLPKSAASGNRKKRQRVPSAYNRFIKDEIQRIKASNPDITHREAFSAAA  207

Query  669  KNWAHFPHIHFGLMPDQPVKKPNACQQEG------EDGLMKDGFLAPPNLGVSPY  815
            KNWAHFPHIHFGLMPDQ +KK +    EG      +DGL      A  ++G++P+
Sbjct  208  KNWAHFPHIHFGLMPDQGLKKASMQNHEGGECMLFKDGLYAAAAAAASSMGIAPF  262



>ref|XP_004150647.1| PREDICTED: protein YABBY 4-like [Cucumis sativus]
 gb|KGN55900.1| hypothetical protein Csa_3G033810 [Cucumis sativus]
Length=185

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 126/167 (75%), Gaps = 6/167 (4%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLH-  398
            P  +QLCYVHCN CDTVLAVSVP +SLFK VTVRCG+C NLL VNM G +L  +P+Q H 
Sbjct  16   PPSDQLCYVHCNICDTVLAVSVPSTSLFKRVTVRCGYCANLLPVNMCGGMLLPSPSQFHG  75

Query  399  LPHS--FFSP--QNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPK-PPVANRPPEKR  563
              HS  F SP   N L+EI N  P+ LMNQ    +  M  R  +++P+ PP  NRPPEKR
Sbjct  76   FTHSTTFLSPNTHNFLEEISNPNPNFLMNQTEGIDLTMATRVPNDVPRQPPTINRPPEKR  135

Query  564  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFG  704
            QRVPSAYNRFIKDEIQRIKA NPDISHREAFSAAAKNWAHFPHI FG
Sbjct  136  QRVPSAYNRFIKDEIQRIKAANPDISHREAFSAAAKNWAHFPHIRFG  182



>ref|XP_010533768.1| PREDICTED: axial regulator YABBY 5-like [Tarenaya hassleriana]
Length=220

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 137/203 (67%), Gaps = 11/203 (5%)
 Frame = +3

Query  222  PSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHL  401
            P  E LCYVHCN CDTVLAVSVP +SL KTVTVRCGHCT LL V+M  LL P+    L  
Sbjct  14   PLHEHLCYVHCNICDTVLAVSVPSTSLSKTVTVRCGHCTTLLPVHM-PLLFPS----LGQ  68

Query  402  PHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLM-----PIRGVDELPKP-PVANRPPEKR  563
             HSF   QN   EI+N   +  +N+ + N         P     ELP+   V  RP  KR
Sbjct  69   FHSFVHNQNPTGEIQNPSTNHTINESSGNHLFATSPPCPRGMTKELPRSHQVIKRPQAKR  128

Query  564  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNAC  743
            QRVPSAYNRFIK+EIQRIKA NP+I+HREAFSAAAKNWAHFPHI FGL PDQ  ++ +  
Sbjct  129  QRVPSAYNRFIKEEIQRIKAENPNITHREAFSAAAKNWAHFPHIQFGLAPDQLARRSSIR  188

Query  744  QQEGEDGLMKDGFLAPPNLGVSP  812
             QEGED +MKD  LA  N+G++P
Sbjct  189  HQEGEDPVMKDVLLASANVGMAP  211



>ref|XP_002511672.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50341.1| conserved hypothetical protein [Ricinus communis]
Length=120

 Score =   209 bits (531),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 108/120 (90%), Gaps = 2/120 (2%)
 Frame = +3

Query  462  LLMNQPNPNESLMPIRGV--DELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPD  635
            +L+NQPNPNE +MP+RG   ++LPKPPV NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPD
Sbjct  1    MLINQPNPNEPVMPVRGGIHEDLPKPPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPD  60

Query  636  ISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLMKDGFLAPPNLGVSPY  815
            ISHREAFSAAAKNWAHFPHIHFGLMPDQPVKK N  QQEGED LMKDGF  P N+GVSPY
Sbjct  61   ISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKANVRQQEGEDVLMKDGFFPPANVGVSPY  120



>ref|XP_002464399.1| hypothetical protein SORBIDRAFT_01g017560 [Sorghum bicolor]
 gb|EER91397.1| hypothetical protein SORBIDRAFT_01g017560 [Sorghum bicolor]
Length=320

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 136/269 (51%), Positives = 154/269 (57%), Gaps = 75/269 (28%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAP--------  386
            EQLCYVHC+FCDTVL VSVP SSLFKTVTVRCGHC++LL+VNMRGLL P  P        
Sbjct  53   EQLCYVHCHFCDTVLVVSVPTSSLFKTVTVRCGHCSSLLTVNMRGLLFPGTPTNTAAAAA  112

Query  387  -----------------------------NQLHLPHSFFSPQN------LLDEIRNTPPS  461
                                          Q H P S     N      LLDEI +  P 
Sbjct  113  PPAAVTASTTTTTTTTITTAPPPATSVNNGQFHFPQSVDLAPNPHHQSLLLDEISSANPR  172

Query  462  LLMNQPNPNESLMPI-----------------RGVDELPKP---PVANRPPEKRQRVPSA  581
            L + + +    L+P                  +G  E P P   PV NRPPEKRQRVPSA
Sbjct  173  LQLLEQHGLGGLIPSGRNAAAPAPPPPPAAAGKGAKE-PSPRTNPVINRPPEKRQRVPSA  231

Query  582  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKKPNACQQ--E  752
            YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD Q +KK +   Q  +
Sbjct  232  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDHQGLKKTSLLPQDLQ  291

Query  753  GEDGLMKDGFL--------APPNLGVSPY  815
             +DGL+K+G          A  N+GV+PY
Sbjct  292  RKDGLLKEGLYAAAAAAAAAAANMGVAPY  320



>gb|AFK46270.1| unknown [Lotus japonicus]
Length=160

 Score =   209 bits (533),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 124/161 (77%), Gaps = 9/161 (6%)
 Frame = +3

Query  357  MRGLLLPTAPNQLHLPHSFFSP-QNLLDEIRNTPPSLLMNQPNPNESL----MPIR-GVD  518
            MR LLLP+ PNQ HL HSFFSP  NLL E+ N  P+ LMN  N   +     +P R   D
Sbjct  1    MRALLLPS-PNQFHLGHSFFSPPHNLLGEMPNPSPNFLMNHTNATSNFSQFSVPARSAAD  59

Query  519  ELPKPPVANRP-PEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHI  695
            ELP+PP+ NRP PEKRQRVPSAYNRFIKDEIQRIK+ NPDI+HREAFSAAAKNWAHFPHI
Sbjct  60   ELPRPPIINRPAPEKRQRVPSAYNRFIKDEIQRIKSVNPDITHREAFSAAAKNWAHFPHI  119

Query  696  HFGLMPDQPVKKPNACQQEGEDGL-MKDGFLAPPNLGVSPY  815
            HFGLMPDQ +KK   CQQEGE+ L MKDGF A  N+GVSPY
Sbjct  120  HFGLMPDQTMKKTTVCQQEGEEVLMMKDGFYASANVGVSPY  160



>gb|ACG43271.1| axial regulator YABBY1 [Zea mays]
Length=318

 Score =   211 bits (538),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 134/273 (49%), Positives = 151/273 (55%), Gaps = 79/273 (29%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAP--------  386
            EQLCYVHC+FCDTVL VSVP SSLFKTVTVRCGHC++LL+VNMRGLL P  P        
Sbjct  47   EQLCYVHCHFCDTVLVVSVPTSSLFKTVTVRCGHCSSLLTVNMRGLLFPGTPANTAAAAA  106

Query  387  --------------------------------NQLH-LPHSF-----FSPQN--LLDEIR  446
                                             Q H +PHS        P    LLDEI 
Sbjct  107  AAPPPPPAAVTSTTATITTAPPPPPATSVNNNGQFHFIPHSLDLALPIPPHQSLLLDEIS  166

Query  447  NTP-PSLLMNQPNPNESLMPI--------------------RGVDELPKP---PVANRPP  554
            +   PSL + Q +    ++P                     +G  E P P      NRPP
Sbjct  167  SAANPSLQLLQQHGLGGMIPSGRNGAAPHPPPPQPQPPAAGKGAKE-PSPRANSAINRPP  225

Query  555  EKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKK-  731
            EKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD    K 
Sbjct  226  EKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDHQGPKK  285

Query  732  ----PNACQQEGEDGLMKDG-FLAPPNLGVSPY  815
                P   Q+    GL+K+G + A  N+GV+PY
Sbjct  286  TSLLPQDHQRSDGGGLLKEGLYAAAANMGVAPY  318



>gb|AFW68435.1| yabby9 [Zea mays]
 gb|AIB05482.1| C2C2-YABBY transcription factor, partial [Zea mays]
Length=314

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/267 (49%), Positives = 151/267 (57%), Gaps = 73/267 (27%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPN-------  389
            EQLCYVHC FCDTVL VSVP SSLFKTVTVRCGHC++LL+V+MRGLL P  P        
Sbjct  49   EQLCYVHCYFCDTVLVVSVPTSSLFKTVTVRCGHCSSLLTVDMRGLLFPGTPTDTVAGAA  108

Query  390  ---------------------------QLHLPHSFFSPQN---LLDEIRNTP-PSLLMNQ  476
                                       Q HLPHS   P +   L+DEI +   PSL +  
Sbjct  109  PPPAADTSTTTTTITTAPPPANSVNNGQFHLPHSLNHPHHQSLLVDEISSAANPSLQLQL  168

Query  477  PNPNESLMPI-------------------RGVDELPKP---PVANRPPEKRQRVPSAYNR  590
                     I                   +G  E P P   P  NRPPEKRQRVPSAYNR
Sbjct  169  EQHGGLGGLILGGSRNTAAPPPPQPPAAGKGAKE-PSPRANPAVNRPPEKRQRVPSAYNR  227

Query  591  FIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKKPNACQQEGE--D  761
            FIKDEIQRIKAGNP+ISHREAFSAAAKNWAHFPHIHFGLMPD Q +K  +   Q+ +  D
Sbjct  228  FIKDEIQRIKAGNPNISHREAFSAAAKNWAHFPHIHFGLMPDHQGLKTTSLLPQDHQRKD  287

Query  762  GLMKDGFL---------APPNLGVSPY  815
            GL+K+G           A  N+G++PY
Sbjct  288  GLLKEGLYAAAAAAAAHAAANMGIAPY  314



>ref|NP_001105231.1| yabby9 [Zea mays]
 gb|AAP79886.1| yabby9 protein [Zea mays]
Length=314

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 132/267 (49%), Positives = 151/267 (57%), Gaps = 73/267 (27%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPN-------  389
            EQLCYVHC FCDTVL VSVP SSLFKTVTVRCGHC++LL+V+MRGLL P  P        
Sbjct  49   EQLCYVHCYFCDTVLVVSVPTSSLFKTVTVRCGHCSSLLTVDMRGLLFPGTPTDTVAGAA  108

Query  390  ---------------------------QLHLPHSFFSPQN---LLDEIRNTP-PSLLMNQ  476
                                       Q HLPHS   P +   L+DEI +   PSL +  
Sbjct  109  PPPAADTSTTTTTITTAPPPANSVNNGQFHLPHSLNHPYHQSLLVDEISSAANPSLQLQL  168

Query  477  PNPNESLMPI-------------------RGVDELPKP---PVANRPPEKRQRVPSAYNR  590
                     I                   +G  E P P   P  NRPPEKRQRVPSAYNR
Sbjct  169  EQHGGLGGLILGGSRNTAAPPPPQPPAAGKGAKE-PSPRVNPAVNRPPEKRQRVPSAYNR  227

Query  591  FIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKKPNACQQEGE--D  761
            FIKDEIQRIKAGNP+ISHREAFSAAAKNWAHFPHIHFGLMPD Q +K  +   Q+ +  D
Sbjct  228  FIKDEIQRIKAGNPNISHREAFSAAAKNWAHFPHIHFGLMPDHQGLKTTSLLPQDHQRKD  287

Query  762  GLMKDGFL---------APPNLGVSPY  815
            GL+K+G           A  N+G++PY
Sbjct  288  GLLKEGLYAAAAAAAAHAAANMGIAPY  314



>ref|NP_001078337.1| axial regulator YABBY 3 [Arabidopsis thaliana]
 dbj|BAH19423.1| AT4G00180 [Arabidopsis thaliana]
 gb|AEE81835.1| axial regulator YABBY 3 [Arabidopsis thaliana]
Length=209

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 148/210 (70%), Gaps = 29/210 (14%)
 Frame = +3

Query  258  FCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSV--NMRGLLLPTAPNQLHLPHSFFSPQ--  425
             CD    VSVP SSLFKTVTVRCGHC+NLLSV  +MR LLLP+  N   L HSF  P   
Sbjct  1    MCDINWQVSVPPSSLFKTVTVRCGHCSNLLSVTVSMRALLLPSVSN---LGHSFLPPPPP  57

Query  426  ----NLLDEIRNTPPSLLMNQ--------PNPNESLMPI----RGVD---ELPKPPVANR  548
                NLL+E+R+   ++ MN          +PNE L+      R VD   E+P+PP ANR
Sbjct  58   PPPPNLLEEMRSGGQNINMNMMMSHHASAHHPNEHLVMATRNGRSVDHLQEMPRPPPANR  117

Query  549  PPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQ-PV  725
            PPEKRQRVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM D  P 
Sbjct  118  PPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMADHPPT  177

Query  726  KKPNACQQEGEDGLM-KDGFL-APPNLGVS  809
            KK N  QQEGEDG+M ++GF  +  N+GV+
Sbjct  178  KKANVRQQEGEDGMMGREGFYGSAANVGVA  207



>gb|ACF85053.1| unknown [Zea mays]
 gb|AFW72533.1| yabby15 [Zea mays]
 gb|AIB04341.1| C2C2-YABBY transcription factor, partial [Zea mays]
Length=223

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 139/219 (63%), Gaps = 40/219 (18%)
 Frame = +3

Query  279  VSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAP----NQLHLPHSFFSP---QNLLD  437
            V VPCSSLFKTVTVRCGHC NLLSVN+RGLLLP A     N L+  HS  SP     LLD
Sbjct  5    VGVPCSSLFKTVTVRCGHCANLLSVNLRGLLLPPAAPAPPNHLNFAHSLLSPTSPHGLLD  64

Query  438  EIR-NTPPSLLMNQPNPN-ESLMPIRGVD-----------------------ELPK-PPV  539
            E+     PS LM Q + N  S M  R  +                       ELPK  P 
Sbjct  65   ELALQQAPSFLMEQASANLSSTMTGRSSNSSCASNLPPPAPMPAAQPVQQEAELPKTAPS  124

Query  540  ANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQ  719
             NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDI+HREAFSAAAKNWAHFPHIHFGLMPDQ
Sbjct  125  VNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHFPHIHFGLMPDQ  184

Query  720  PVKKPNACQQEG-EDGLMKDGFL------APPNLGVSPY  815
             +KK     Q+G ED L+KD         A  N+G++P+
Sbjct  185  GLKKTFKTHQDGAEDMLLKDDLYAAAAAAAAANMGITPF  223



>ref|XP_010426672.1| PREDICTED: axial regulator YABBY 3-like isoform X2 [Camelina 
sativa]
Length=203

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 149/205 (73%), Gaps = 25/205 (12%)
 Frame = +3

Query  258  FCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSV--NMRGLLLPTAPNQLHLPHSFFSPQ--  425
             CD    VSVP SSLFKTVTVRCGHC+NLLSV  NMR LLLP+  N   + HSF  P   
Sbjct  1    MCD-CRQVSVPPSSLFKTVTVRCGHCSNLLSVTVNMRTLLLPSVSN---IGHSFIPPPPP  56

Query  426  --NLLDEIRNTPPSLLMNQ--------PNPNESL-MPIR-GVDELPKPPVANRPPEKRQR  569
              NLL+E+R+   ++ MN          +PNESL M  R G+ E+P+PP ANRPPEKRQR
Sbjct  57   PPNLLEEMRSGGQNINMNMMMSHHGAAHHPNESLAMAARNGLQEMPRPPPANRPPEKRQR  116

Query  570  VPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQ-PVKKPNA-C  743
            VPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM D  P KK N   
Sbjct  117  VPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMADHPPTKKANVRQ  176

Query  744  QQEGEDGLM--KDGFL-APPNLGVS  809
            QQEGEDG+M  ++GF  +  N+GV+
Sbjct  177  QQEGEDGMMGSREGFYGSAANVGVT  201



>gb|AAQ93323.1| YABBY protein [Triticum aestivum]
Length=297

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 155/255 (61%), Gaps = 62/255 (24%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAP--------  386
            EQLCYVHC+FCDTVL VSVP SSLFKTVTVRCGHC++LL+V+MRGLL PT          
Sbjct  45   EQLCYVHCHFCDTVLVVSVPSSSLFKTVTVRCGHCSSLLTVDMRGLLFPTTTTTVAAESA  104

Query  387  ------------------NQLHLPHSF-FSPQN-----LLDEIRNTPPSLLMNQPNPNES  494
                               Q H P S   +P N     LLDEI +  PSL + + +    
Sbjct  105  ASAVTTTTSPPPAAAAHHGQFHYPSSLNLAPGNPPRHSLLDEISSANPSLQLLEQHGLGG  164

Query  495  LMPI--------------------RGVDELPKP---PVANRPPEKRQRVPSAYNRFIKDE  605
            L+                      +G  E P P   PV NRPPEKRQRVPSAYNRFIKDE
Sbjct  165  LIAAAGGRNAAAPAPLPPPPVAGGKGGKE-PSPRTNPVVNRPPEKRQRVPSAYNRFIKDE  223

Query  606  IQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKK----PNACQQEGEDGLM  770
            IQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD Q ++K    P   Q++   GL+
Sbjct  224  IQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDHQGLRKTSLLPQDHQRKDGHGLL  283

Query  771  KDGFLAPPNLGVSPY  815
            K+G  A  N+G++PY
Sbjct  284  KEGLYA-ANMGIAPY  297



>ref|XP_006842053.1| hypothetical protein AMTR_s00078p00029420 [Amborella trichopoda]
 gb|ERN03728.1| hypothetical protein AMTR_s00078p00029420 [Amborella trichopoda]
Length=221

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 125/196 (64%), Gaps = 16/196 (8%)
 Frame = +3

Query  219  SPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLL----LPTAP  386
            SPS E +CY+ CNFC+T+LAVSVPCSSLFK VTVRCGHCTNLLSVNM  +L    L  AP
Sbjct  15   SPSSEHVCYLPCNFCNTILAVSVPCSSLFKVVTVRCGHCTNLLSVNMAAVLHAPSLTPAP  74

Query  387  -----NQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNP-------NESLMPIRGVDELPK  530
                 +QL    S          +         +  N        N+ L+P   + E  +
Sbjct  75   ANLQHDQLLRNQSLTGSHGYNRMMMMMTTMDSSSTSNNFNHDDINNKVLIPNESIAEKEE  134

Query  531  PPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  710
              V NRPPEKRQRVPSAYNRFIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM
Sbjct  135  RTVVNRPPEKRQRVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGLM  194

Query  711  PDQPVKKPNACQQEGE  758
             D   K+P   Q  G+
Sbjct  195  LDTTKKQPKLDQGSGK  210



>ref|XP_008667172.1| PREDICTED: putative YABBY domain transcription factor family 
protein isoform X1 [Zea mays]
 gb|ACN26940.1| unknown [Zea mays]
 gb|ADX60142.1| C2C2-YABBY transcription factor [Zea mays]
 tpg|DAA36679.1| TPA: putative YABBY domain transcription factor family protein 
[Zea mays]
Length=246

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 141/225 (63%), Gaps = 32/225 (14%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNM-----------------  359
            EQ+CYVHC++CDT+LAV VPCSSLF+TVTVRCGHC+NLL VN+                 
Sbjct  24   EQICYVHCSYCDTILAVGVPCSSLFQTVTVRCGHCSNLLYVNLRALLLPAAAANNQLPPF  83

Query  360  -RGLLLPTAPNQLHLPH--SFFSPQNLLDEIR--------NTPPSLLMNQPNPNESLMPI  506
             + LL PT+P+ L  P       P   +  +         NT  S  M+   P  +   +
Sbjct  84   GQPLLSPTSPHGLLAPSLPGAEPPSACVSGVTSINNTCGGNTTTSSAMSSMAPPPAKHAL  143

Query  507  RGVDELPKPPVA-NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAH  683
            +   +LP+   + NR  EKRQRVPSAYNRFIKDEIQRIKA NPDI+HREAFSAAAKNWAH
Sbjct  144  QEAQQLPRTAASVNRTSEKRQRVPSAYNRFIKDEIQRIKASNPDITHREAFSAAAKNWAH  203

Query  684  FPHIHFGLMPDQPVKKPNACQQEG-EDGLMKDGFLAPPNLGVSPY  815
            FPHIHFGLMPDQ +KK     QEG E  L  DG  A  ++G SP+
Sbjct  204  FPHIHFGLMPDQGLKKNPMQNQEGAECMLFMDGLYA--SMGFSPF  246



>gb|AFK48204.1| unknown [Lotus japonicus]
Length=159

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 124/160 (78%), Gaps = 8/160 (5%)
 Frame = +3

Query  357  MRGLLLPTAPNQLHLPHSFFSP-QNLLDEIRNTPPSLLMNQPNPNESL----MPIR-GVD  518
            MR LLLP+ PNQ HL HSFFSP  NLL E+ N  P+ LMN  N   +     +P R   D
Sbjct  1    MRALLLPS-PNQFHLGHSFFSPPHNLLGEMPNPSPNFLMNHTNATSNFSQFSVPARSAAD  59

Query  519  ELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIH  698
            ELP+PP+ NRPPEKRQRVPSAYNRFIKDEIQRIK+ NPDI+HREAFSAAAKNWAHFPHIH
Sbjct  60   ELPRPPIINRPPEKRQRVPSAYNRFIKDEIQRIKSVNPDITHREAFSAAAKNWAHFPHIH  119

Query  699  FGLMPDQPVKKPNACQQEGEDGL-MKDGFLAPPNLGVSPY  815
            FGLMPDQ +KK   CQQEGE+ L MKDGF A  N+GVSPY
Sbjct  120  FGLMPDQTMKKTTVCQQEGEEVLMMKDGFYASANVGVSPY  159



>ref|XP_010426665.1| PREDICTED: axial regulator YABBY 3-like isoform X1 [Camelina 
sativa]
Length=204

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 148/206 (72%), Gaps = 26/206 (13%)
 Frame = +3

Query  258  FCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSV--NMRGLLLPTAPNQLHLPHSFFSPQ--  425
             CD    VSVP SSLFKTVTVRCGHC+NLLSV  NMR LLLP+  N   + HSF  P   
Sbjct  1    MCD-CRQVSVPPSSLFKTVTVRCGHCSNLLSVTVNMRTLLLPSVSN---IGHSFIPPPPP  56

Query  426  --NLLDEIRNTPPSLLMNQ--------PNPNESL-MPIR-GVDELPKPPVANRPP-EKRQ  566
              NLL+E+R+   ++ MN          +PNESL M  R G+ E+P+PP ANRP  EKRQ
Sbjct  57   PPNLLEEMRSGGQNINMNMMMSHHGAAHHPNESLAMAARNGLQEMPRPPPANRPAPEKRQ  116

Query  567  RVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQ-PVKKPNA-  740
            RVPSAYNRFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM D  P KK N  
Sbjct  117  RVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMADHPPTKKANVR  176

Query  741  CQQEGEDGLM--KDGFL-APPNLGVS  809
             QQEGEDG+M  ++GF  +  N+GV+
Sbjct  177  QQQEGEDGMMGSREGFYGSAANVGVT  202



>ref|NP_001065021.2| Os10g0508300 [Oryza sativa Japonica Group]
 dbj|BAF26935.2| Os10g0508300 [Oryza sativa Japonica Group]
Length=348

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 136/291 (47%), Positives = 155/291 (53%), Gaps = 96/291 (33%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVS-----------------------------------VPCSSLF  305
            EQLCYVHC++CDTVL VS                                   VP SSLF
Sbjct  58   EQLCYVHCHYCDTVLVVSDLRSNHAHFLSICVHLALDSRAFLVHPWRRVLQVSVPSSSLF  117

Query  306  KTVTVRCGHCTNLLSVNMRGLLLPTAPNQL----------------HLPHSF-FSPQN--  428
            +TVTVRCGHC++LL+VNMRGLLLPT                     H PHS   +P N  
Sbjct  118  ETVTVRCGHCSSLLTVNMRGLLLPTTAAAAPPPPPPPPPPPPPPAAHFPHSLNLAPANPP  177

Query  429  ----LLDEIR--NTPPSLLMNQ-------------PNPNESLMPI---------RGVDEL  524
                LLDEI   N+P  LL+ Q              N N               +   + 
Sbjct  178  HHHSLLDEISTANSPTQLLLEQHGLGGLMASAASCRNNNSPAAAAAPPPPTSQGKAAAKE  237

Query  525  PKP----PVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH  692
            P P     V NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH
Sbjct  238  PSPRTNTAVINRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPH  297

Query  693  IHFGLMPD-QPVKKPNACQQEGE--DGLMKDGFL-------APPNLGVSPY  815
            IHFGLMPD Q +KK +   Q+ +  DGL+K+G         A  N+GV+PY
Sbjct  298  IHFGLMPDHQGLKKTSLLPQDHQRKDGLLKEGLYAAAAAAAAAANMGVAPY  348



>sp|Q8L556.1|YAB3_ORYSJ RecName: Full=Protein YABBY 3; AltName: Full=OsYAB4; AltName: 
Full=OsYABBY3 [Oryza sativa Japonica Group]
 gb|AAM94935.1| putative transcription factor [Oryza sativa Japonica Group]
 gb|AAM95687.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF45804.1| OsYABBY3 protein [Oryza sativa Japonica Group]
Length=313

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 155/256 (61%), Gaps = 61/256 (24%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL-----  395
            EQLCYVHC++CDTVL VSVP SSLF+TVTVRCGHC++LL+VNMRGLLLPT          
Sbjct  58   EQLCYVHCHYCDTVLVVSVPSSSLFETVTVRCGHCSSLLTVNMRGLLLPTTAAAAPPPPP  117

Query  396  -----------HLPHSF-FSPQN------LLDEIR--NTPPSLLMNQ-------------  476
                       H PHS   +P N      LLDEI   N+P  LL+ Q             
Sbjct  118  PPPPPPPPPAAHFPHSLNLAPANPPHHHSLLDEISTANSPTQLLLEQHGLGGLMASAASC  177

Query  477  PNPNESLMPI---------RGVDELPKP----PVANRPPEKRQRVPSAYNRFIKDEIQRI  617
             N N               +   + P P     V NRPPEKRQRVPSAYNRFIKDEIQRI
Sbjct  178  RNNNSPAAAAAPPPPTSQGKAAAKEPSPRTNTAVINRPPEKRQRVPSAYNRFIKDEIQRI  237

Query  618  KAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKKPNACQQEGE--DGLMKDGFL-  785
            KAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD Q +KK +   Q+ +  DGL+K+G   
Sbjct  238  KAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDHQGLKKTSLLPQDHQRKDGLLKEGLYA  297

Query  786  ------APPNLGVSPY  815
                  A  N+GV+PY
Sbjct  298  AAAAAAAAANMGVAPY  313



>ref|XP_006661936.1| PREDICTED: protein YABBY 3-like [Oryza brachyantha]
Length=311

 Score =   198 bits (504),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 137/263 (52%), Positives = 156/263 (59%), Gaps = 69/263 (26%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL-----  395
            EQLCYVHC++CDTVL VSVP SSLFKTVTVRCGHC++LL+VNMRGLLLPT P        
Sbjct  50   EQLCYVHCHYCDTVLVVSVPSSSLFKTVTVRCGHCSSLLTVNMRGLLLPTTPTSAAATVA  109

Query  396  -----------------HLPHSF-FSP----QNLLDEIR--NTPPSLLMNQPNPNESLMP  503
                             H PHS   +P     +LLDEI   N   S L+ + +    LM 
Sbjct  110  AATAPPPPPPPPAASAKHFPHSLNLAPTGNHHSLLDEISSANATSSQLLLEQHGLGCLMA  169

Query  504  --------------------------------IRGVDELPKP---PVANRPPEKRQRVPS  578
                                             +G  E P P      NRPPEKRQRVPS
Sbjct  170  SAAAGCRNNNAPALRPAPPPPPPPPQPVPAPATKGAKE-PSPRTNTAVNRPPEKRQRVPS  228

Query  579  AYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKKPNACQQEG  755
            AYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD Q +KK +   Q+ 
Sbjct  229  AYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDHQGLKKASLLPQDH  288

Query  756  E--DGLMKDG-FLAPPNLGVSPY  815
            +  DGL+KDG + A  N+GV+PY
Sbjct  289  QRKDGLLKDGLYAAAANMGVAPY  311



>ref|NP_001132033.1| putative YABBY domain transcription factor family protein [Zea 
mays]
 gb|ACF80711.1| unknown [Zea mays]
 tpg|DAA36678.1| TPA: putative YABBY domain transcription factor family protein 
[Zea mays]
Length=254

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 144/233 (62%), Gaps = 40/233 (17%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNM-----------------  359
            EQ+CYVHC++CDT+LAV VPCSSLF+TVTVRCGHC+NLL VN+                 
Sbjct  24   EQICYVHCSYCDTILAVGVPCSSLFQTVTVRCGHCSNLLYVNLRALLLPAAAANNQLPPF  83

Query  360  -RGLLLPTAPNQL--HLPHSFFSPQ-----------NLLDEIR-----NTPPSLLMNQPN  482
             + LL PT+P+ L      SF +P            + +  I      NT  S  M+   
Sbjct  84   GQPLLSPTSPHGLLDAEAMSFQAPSLPGAEPPSACVSGVTSINNTCGGNTTTSSAMSSMA  143

Query  483  PNESLMPIRGVDELPKPPVA-NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFS  659
            P  +   ++   +LP+   + NR  EKRQRVPSAYNRFIKDEIQRIKA NPDI+HREAFS
Sbjct  144  PPPAKHALQEAQQLPRTAASVNRTSEKRQRVPSAYNRFIKDEIQRIKASNPDITHREAFS  203

Query  660  AAAKNWAHFPHIHFGLMPDQPVKKPNACQQEG-EDGLMKDGFLAPPNLGVSPY  815
            AAAKNWAHFPHIHFGLMPDQ +KK     QEG E  L  DG  A  ++G SP+
Sbjct  204  AAAKNWAHFPHIHFGLMPDQGLKKNPMQNQEGAECMLFMDGLYA--SMGFSPF  254



>gb|AFW68437.1| yabby9 [Zea mays]
Length=337

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 132/290 (46%), Positives = 151/290 (52%), Gaps = 96/290 (33%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAV-----------------------SVPCSSLFKTVTVRCGHCTN  341
            EQLCYVHC FCDTVL V                       SVP SSLFKTVTVRCGHC++
Sbjct  49   EQLCYVHCYFCDTVLVVPLSCLNLKDFHKLEGVPGTWVQVSVPTSSLFKTVTVRCGHCSS  108

Query  342  LLSVNMRGLLLPTAPN----------------------------------QLHLPHSFFS  419
            LL+V+MRGLL P  P                                   Q HLPHS   
Sbjct  109  LLTVDMRGLLFPGTPTDTVAGAAPPPAADTSTTTTTITTAPPPANSVNNGQFHLPHSLNH  168

Query  420  PQN---LLDEIRNTP-PSLLMNQPNPNESLMPI-------------------RGVDELPK  530
            P +   L+DEI +   PSL +           I                   +G  E P 
Sbjct  169  PHHQSLLVDEISSAANPSLQLQLEQHGGLGGLILGGSRNTAAPPPPQPPAAGKGAKE-PS  227

Query  531  P---PVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHF  701
            P   P  NRPPEKRQRVPSAYNRFIKDEIQRIKAGNP+ISHREAFSAAAKNWAHFPHIHF
Sbjct  228  PRANPAVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPNISHREAFSAAAKNWAHFPHIHF  287

Query  702  GLMPD-QPVKKPNACQQEGE--DGLMKDGFL---------APPNLGVSPY  815
            GLMPD Q +K  +   Q+ +  DGL+K+G           A  N+G++PY
Sbjct  288  GLMPDHQGLKTTSLLPQDHQRKDGLLKEGLYAAAAAAAAHAAANMGIAPY  337



>gb|AAS10179.1| YABBY2-like transcription factor YAB2 [Antirrhinum majus]
Length=186

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 117/168 (70%), Gaps = 15/168 (9%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            L  + E +CYVHCNFC+T+LAVSVPCS++F  VTVRCGHC NLLSVNM  LL       +
Sbjct  3    LDMTSECVCYVHCNFCNTILAVSVPCSNMFTIVTVRCGHCANLLSVNMGALL-----QSV  57

Query  396  HLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPK-PPVANRPPEKRQRV  572
            HL   F   Q+     ++   S   N+        P++   E PK PP+  RPPEKRQRV
Sbjct  58   HL-QDFQKQQHAEAAAKDNGSSSKSNR------YAPLQAEHEQPKMPPI--RPPEKRQRV  108

Query  573  PSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
            PSAYNRFIK+EIQRIKAGNP+ISHREAFS AAKNWAHFPHIHFGL  D
Sbjct  109  PSAYNRFIKEEIQRIKAGNPEISHREAFSTAAKNWAHFPHIHFGLKLD  156



>dbj|BAJ83624.1| YAB5-like YABBY protein [Cabomba caroliniana]
Length=174

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 118/169 (70%), Gaps = 21/169 (12%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLP  404
            + EQ+CYVHCNFC+T+LAVSVPC+SLF  VTVRCGHCTNLL VNM  +L P    Q  +P
Sbjct  8    ASEQVCYVHCNFCNTILAVSVPCTSLFNIVTVRCGHCTNLLPVNMAAMLQP----QTFVP  63

Query  405  HSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVPSAY  584
            + +      LD   ++  + +     PNE+ + I            NRPPEKRQRVPSAY
Sbjct  64   YDY-----PLDLSSSSKSNKISQMVKPNEASIAI------------NRPPEKRQRVPSAY  106

Query  585  NRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKK  731
            N+FIK+EIQRIKA NP+ISHREAFS AAKNWAHFPHIHFGLM +   K+
Sbjct  107  NQFIKEEIQRIKASNPEISHREAFSTAAKNWAHFPHIHFGLMLENSRKE  155



>ref|XP_010090516.1| hypothetical protein L484_017140 [Morus notabilis]
 gb|EXB39665.1| hypothetical protein L484_017140 [Morus notabilis]
Length=190

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 111/165 (67%), Gaps = 10/165 (6%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLP  404
            + E++CYVHCNFC+T+LAVSVPCSSLF  VTVRCGHC NLLSVNM    L T P Q    
Sbjct  7    ASERVCYVHCNFCNTILAVSVPCSSLFTIVTVRCGHCGNLLSVNMEAASLQTVPPQ----  62

Query  405  HSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVD-ELPKPPVANRPPEKRQRVPSA  581
                 PQ  +    N P     +    N+    +  VD E P      RPPEKRQRVPSA
Sbjct  63   ----DPQKQISSSEN-PVKEYGSSSKCNKHANLLESVDHEQPARSSPIRPPEKRQRVPSA  117

Query  582  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
            YNRFIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGL  D
Sbjct  118  YNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGLKLD  162



>ref|NP_001105230.1| yabby14 [Zea mays]
 gb|AAP79884.1| yabby14 protein [Zea mays]
 gb|ACG41975.1| yabby14 protein [Zea mays]
 gb|AFW58993.1| yabby14 [Zea mays]
 gb|AIB05936.1| C2C2-YABBY transcription factor, partial [Zea mays]
Length=268

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 143/242 (59%), Gaps = 49/242 (20%)
 Frame = +3

Query  237  LCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL---HLP-  404
            +CYVHC++CDT+LAV VPCSSLF+TVTVRCGHC NLL VN+R LLLP A       HLP 
Sbjct  27   ICYVHCSYCDTILAVGVPCSSLFQTVTVRCGHCANLLYVNLRALLLPPATAPAAANHLPP  86

Query  405  -----HSFFSPQNLLDEIRNT-----PPSLLMNQPNPNESLMPIRGVD------------  518
                  S  SP  LLD    +      PSL   +P     +  I  ++            
Sbjct  87   FGQALLSPTSPHGLLDAETMSSSSFQAPSLPSAEPPSAACVSGITSINNTACGGNNAASA  146

Query  519  --------------ELPKPPV-ANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREA  653
                          +LP+    AN+  EKRQRVPSAYNRFIKDEIQRIKA NPDI+HREA
Sbjct  147  MAPPPAKPALHEPPQLPRSAASANKTSEKRQRVPSAYNRFIKDEIQRIKASNPDITHREA  206

Query  654  FSAAAKNWAHFPHIHFGLMPDQPVKK-PNACQQEGEDGLMKDGFL-------APPNLGVS  809
            FSAAAKNWAHFPHIHFGLMPDQ +KK P   Q+  E  L KDG         A  ++G+S
Sbjct  207  FSAAAKNWAHFPHIHFGLMPDQGLKKHPMQTQEGAECMLFKDGLYAAAAAATAASSMGIS  266

Query  810  PY  815
            P+
Sbjct  267  PF  268



>dbj|BAD72169.1| YABBY5 like protein [Cabomba caroliniana]
Length=170

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 116/169 (69%), Gaps = 23/169 (14%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLP  404
            + EQ+CYVHCNFC+T+LAVSVPC+SLF  VTVRCGHCTNLL VNM  +L P         
Sbjct  4    ASEQVCYVHCNFCNTILAVSVPCTSLFNIVTVRCGHCTNLLPVNMAAMLQPQT-------  56

Query  405  HSFFSPQNL-LDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVPSA  581
               F+P +  LD   ++  + +     PNE+ + I            NRPPEKRQRVPSA
Sbjct  57   ---FAPYDYPLDLSSSSKSNKISQMVKPNEASIAI------------NRPPEKRQRVPSA  101

Query  582  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVK  728
            YN+FIK+EIQRIKA NP+I+HREAFS AAKNWAHFPHIHFGLM +   K
Sbjct  102  YNQFIKEEIQRIKASNPEINHREAFSTAAKNWAHFPHIHFGLMLENSRK  150



>ref|XP_002448235.1| hypothetical protein SORBIDRAFT_06g023770 [Sorghum bicolor]
 gb|EES12563.1| hypothetical protein SORBIDRAFT_06g023770 [Sorghum bicolor]
Length=276

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 136/223 (61%), Gaps = 43/223 (19%)
 Frame = +3

Query  237  LCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNM-----------------RG  365
            +CYVHC++CDT+LAV VPCSSLF+TVTVRCGHC+NLL VN+                 + 
Sbjct  31   ICYVHCSYCDTILAVGVPCSSLFQTVTVRCGHCSNLLYVNLRALLLPAAANQLPPFGGQA  90

Query  366  LLLPTAPNQL---HLPHSFFSPQNLLDEIRNTPPSLLM-------NQPNPNESLMPIRGV  515
            LL PT+P+ L       SF +P++L  +    PPS  +       N      S   +  +
Sbjct  91   LLSPTSPHGLLDAETMSSFQAPRSL--QPSTDPPSACVSTITSINNTCGGGNSASAMSSM  148

Query  516  D------------ELPKPPVA-NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAF  656
                         +LPK   + N+  EKRQRVPSAYNRFIKDEIQRIKA NPDI+HREAF
Sbjct  149  APPPPAKPALLEPQLPKSAASGNKTSEKRQRVPSAYNRFIKDEIQRIKASNPDITHREAF  208

Query  657  SAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEG-EDGLMKDGF  782
            SAAAKNWAHFPHIHFGLMPDQ +KK     QEG E  L KDG 
Sbjct  209  SAAAKNWAHFPHIHFGLMPDQGLKKNPMQNQEGAECMLFKDGL  251



>ref|XP_002285328.1| PREDICTED: axial regulator YABBY 5 isoform X1 [Vitis vinifera]
 emb|CBI28225.3| unnamed protein product [Vitis vinifera]
Length=185

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 112/166 (67%), Gaps = 12/166 (7%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            +  + EQLCY+ CNFC+ VLAVSVPCSSLF  VTVRCGHCTNL SVNM       +   +
Sbjct  5    IDVASEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFQSLSWQDV  64

Query  396  HLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRG-VDELPKPPVANRPPEKRQRV  572
              P+ + SP   +D          +   +   + M +R     + +  + NRPPEKRQRV
Sbjct  65   QAPN-YTSPDYRID----------LGSSSKCNTKMAMRAPASNISEERIVNRPPEKRQRV  113

Query  573  PSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  710
            PSAYN+FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM
Sbjct  114  PSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLM  159



>gb|AID67113.1| YAB5 protein [Solanum aethiopicum]
Length=183

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 119/182 (65%), Gaps = 14/182 (8%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            +  + EQLCYV CNFC+ VLAVSVPCSSLF  VTVRCGHCTNL SVNM         +  
Sbjct  5    IDVASEQLCYVPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNM--------ASAF  56

Query  396  HLPHSFFSPQNLLDEIRN-TPPSLLMN-----QPNPNESLMPIRGVDELPKPPVANRPPE  557
            H   S  S QN   ++ N T P   M+     + N N   M     + + +  + NRPPE
Sbjct  57   HQSSSSTSWQNHHVQVPNYTAPEYRMDFGSSTKCNMNRMSMRTPITNNVHEERIVNRPPE  116

Query  558  KRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPN  737
            KRQRVPSAYN+FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM +   +   
Sbjct  117  KRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLESNNQAKL  176

Query  738  AC  743
            AC
Sbjct  177  AC  178



>ref|XP_010533151.1| PREDICTED: axial regulator YABBY 5 [Tarenaya hassleriana]
Length=174

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 112/164 (68%), Gaps = 9/164 (5%)
 Frame = +3

Query  219  SPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLH  398
            + + EQLCY+ CNFC+ VLAVSVPCSSLF  VTVRCGHCTNL SVNM   L       L 
Sbjct  10   ATASEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAL-----QSLS  64

Query  399  LPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVPS  578
             P +F +P   + E RN   S          S +  R V E     + NRPPEKRQRVPS
Sbjct  65   RP-NFQAPNYGIPEYRNEYGSSSRCHNKVPSSRVSTRNVGE---QRIVNRPPEKRQRVPS  120

Query  579  AYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  710
            AYN+FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM
Sbjct  121  AYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLM  164



>ref|XP_009407727.1| PREDICTED: protein YABBY 2-like [Musa acuminata subsp. malaccensis]
Length=181

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 114/162 (70%), Gaps = 12/162 (7%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPHS  410
            E +CY+HCNFC+T+LAVSVP +S+F  VTVRCGHC NLLSVNM G LL   P Q    H+
Sbjct  8    EHVCYIHCNFCNTILAVSVPGNSMFNVVTVRCGHCANLLSVNM-GALLQAFPIQDFQAHN  66

Query  411  FFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVPSAYNR  590
            F S  N L+         + +    N S   +  + +  +  VA RPPEKRQRVPSAYNR
Sbjct  67   FGSQSNRLE---------IGSSSRCNRS--SLYSMKDEQQQIVALRPPEKRQRVPSAYNR  115

Query  591  FIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
            FI++EIQRIKA NPDISH+EAFSAAAKNWAHFPHIHFGL  D
Sbjct  116  FIREEIQRIKANNPDISHKEAFSAAAKNWAHFPHIHFGLTLD  157



>gb|AID67112.1| YAB5 protein [Solanum sisymbriifolium]
Length=183

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 119/182 (65%), Gaps = 14/182 (8%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            +  + EQLCY+ CNFC+ VLAVSVPCSSLF  VTVRCGHCTNL SVNM         +  
Sbjct  5    IDVASEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNM--------ASAF  56

Query  396  HLPHSFFSPQNLLDEIRN-TPPSLLMN-----QPNPNESLMPIRGVDELPKPPVANRPPE  557
            H   S  S QN   ++ N T P   M+     + N N   M     + + +  + NRPPE
Sbjct  57   HQSSSSTSWQNHHVQVPNYTAPEYRMDFGSSTKCNMNRMSMRTPITNNVHEERIVNRPPE  116

Query  558  KRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPN  737
            KRQRVPSAYN+FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM +   +   
Sbjct  117  KRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLESNNQAKL  176

Query  738  AC  743
            AC
Sbjct  177  AC  178



>ref|XP_003574170.1| PREDICTED: protein YABBY 3-like [Brachypodium distachyon]
Length=315

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 149/265 (56%), Gaps = 71/265 (27%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLL------------  374
            EQLCYVHC+FCDTVL VSVP SSL KTVTVRCGHC++LL+VNMRGLL             
Sbjct  52   EQLCYVHCHFCDTVLVVSVPSSSLLKTVTVRCGHCSSLLTVNMRGLLFPTTTATPAASAV  111

Query  375  ----------PTAPNQLHLPHSF--FSPQN---------------------LLDEIRNTP  455
                      PT     H    F   SP +                     LLDEI +T 
Sbjct  112  TTLTDISSPPPTTAGGSHHGQQFQYSSPAHSLNLAPGPGGNIHNPPRHSLSLLDEISSTN  171

Query  456  PSLLMNQPNPNESLMPI-----------------RGVDELPKP---PVANRPPEKRQRVP  575
            P+ L         ++                   +G  E P P   P+ NRPPEKRQRVP
Sbjct  172  PASLQLLEQHGGGMVAAARNAAAPAAAAAPPAAGKGGKE-PSPRTNPIVNRPPEKRQRVP  230

Query  576  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD-QPVKK----PNA  740
            SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD Q ++K    P  
Sbjct  231  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDHQGLRKTSLLPLP  290

Query  741  CQQEGEDGLMKDGFLAPPNLGVSPY  815
               + +D L+KDG  A  N+GV+PY
Sbjct  291  QDHQRKDVLLKDGLYAAANMGVAPY  315



>ref|XP_007015607.1| Plant-specific transcription factor YABBY family protein isoform 
1 [Theobroma cacao]
 gb|EOY33226.1| Plant-specific transcription factor YABBY family protein isoform 
1 [Theobroma cacao]
Length=182

 Score =   187 bits (474),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 113/172 (66%), Gaps = 19/172 (11%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            L  S E++CYVHCNFC+T+LAVSVPC+SLF  VTVRCGHC NLLSVNM G  L T P   
Sbjct  3    LDLSSERVCYVHCNFCNTILAVSVPCTSLFNIVTVRCGHCANLLSVNM-GTSLQTVP---  58

Query  396  HLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVD----ELPK-PPVANRPPEK  560
                     Q+   E  NT       +   +         D    E P+ PP+  RPPEK
Sbjct  59   --------IQDAQKEQINTDQDHSNKECGSSSKCNKFSAFDSAEHEAPRMPPI--RPPEK  108

Query  561  RQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
            RQRVPSAYNRFIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGL  D
Sbjct  109  RQRVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGLKLD  160



>ref|XP_003609353.1| YABBY protein [Medicago truncatula]
 gb|AES91550.1| plant-specific transcription factor YABBY family protein [Medicago 
truncatula]
Length=191

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 117/185 (63%), Gaps = 21/185 (11%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSS S   AP            + EQLCY+ CNFC+ VLAVSVPCSSLF  VTVRCGHCT
Sbjct  1    MSSCSIDVAP-----------AAAEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCT  49

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESL-MPIRGV  515
            NL SVNM       +   +  P    +P+     IR +      + P  N+ + M     
Sbjct  50   NLWSVNMAAAFQSLSWQDVQAPSHCMNPEY---RIRTS------STPKCNDRIAMRSAPT  100

Query  516  DELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHI  695
              + +  V NRPPEKRQRVPSAYN+FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHI
Sbjct  101  THVTEERVVNRPPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHI  160

Query  696  HFGLM  710
            HFGLM
Sbjct  161  HFGLM  165



>ref|XP_006487832.1| PREDICTED: putative axial regulator YABBY 2-like isoform X1 [Citrus 
sinensis]
Length=186

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 114/169 (67%), Gaps = 11/169 (7%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLL--LPTAPN  389
            L  S E++CYVHCN+C+T+LAVSVPCSSLF  VTVRCGHC NLL+VNM   L  +P    
Sbjct  3    LDLSSERVCYVHCNYCNTILAVSVPCSSLFNIVTVRCGHCANLLNVNMVSALQAVPLQDP  62

Query  390  QLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQR  569
            QL   H      NL D I     S   ++ N   S       +    PP+  RPPEKRQR
Sbjct  63   QLQKQHI-----NLEDSITKDCGS--SSKCNKFSSAFETAEHETPRMPPI--RPPEKRQR  113

Query  570  VPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
            VPSAYNRFIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGL  D
Sbjct  114  VPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGLKLD  162



>gb|EYU30547.1| hypothetical protein MIMGU_mgv1a016431mg [Erythranthe guttata]
Length=122

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 108/122 (89%), Gaps = 5/122 (4%)
 Frame = +3

Query  465  LMNQPN---PNESLMPIRGVDELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPD  635
            +MNQ     PNES++P+R +DELPKPP A RPPEKRQRVPSAYNRFIKDEIQRIKAGNPD
Sbjct  1    MMNQQMMNIPNESMLPVRDIDELPKPPAAKRPPEKRQRVPSAYNRFIKDEIQRIKAGNPD  60

Query  636  ISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDG-LMKDGFL-APPNLGVS  809
            ISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPN CQQEG+D  +MKDGFL A  N+GVS
Sbjct  61   ISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNVCQQEGDDHVMMKDGFLGAAANVGVS  120

Query  810  PY  815
            PY
Sbjct  121  PY  122



>ref|XP_009133935.1| PREDICTED: axial regulator YABBY 5 [Brassica rapa]
 ref|XP_009133936.1| PREDICTED: axial regulator YABBY 5 [Brassica rapa]
Length=164

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 112/165 (68%), Gaps = 16/165 (10%)
 Frame = +3

Query  219  SPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLP-TAPNQL  395
            + + EQLCY+ CNFC+ VLAVSVPCSSLF  VTVRCGHCTNL SVNM   L   + PN  
Sbjct  5    ATAAEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAALQSLSRPNFQ  64

Query  396  HLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVP  575
              P++   P+       NT  S          S +  R + E     + NRPPEKRQRVP
Sbjct  65   VTPYAM--PEYGSSSRGNTKIS----------SRISARTISE---QRIVNRPPEKRQRVP  109

Query  576  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  710
            SAYN+FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM
Sbjct  110  SAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLM  154



>ref|XP_002277937.1| PREDICTED: putative axial regulator YABBY 2 isoform X2 [Vitis 
vinifera]
 emb|CBI24407.3| unnamed protein product [Vitis vinifera]
Length=183

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 113/164 (69%), Gaps = 13/164 (8%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPHS  410
            E++CYVHCNFC+T+LAVSVPC+SLF  VTVRCGHC NLLSVNM G LL T P Q      
Sbjct  8    ERVCYVHCNFCNTILAVSVPCTSLFTIVTVRCGHCANLLSVNM-GALLQTVPTQ------  60

Query  411  FFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVD-ELPK-PPVANRPPEKRQRVPSAY  584
                Q+   ++    PS      +           + E P+ PP+  RPPEKRQRVPSAY
Sbjct  61   --DLQSQKQQLSCGDPSEDCGSSSKCNKFSAFESAEHEQPRMPPI--RPPEKRQRVPSAY  116

Query  585  NRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
            NRFIK+EIQRIKA NPDI+HREAFS AAKNWAHFPHIHFGL  D
Sbjct  117  NRFIKEEIQRIKASNPDITHREAFSTAAKNWAHFPHIHFGLKLD  160



>ref|XP_011088989.1| PREDICTED: putative axial regulator YABBY 2 [Sesamum indicum]
 ref|XP_011088990.1| PREDICTED: putative axial regulator YABBY 2 [Sesamum indicum]
Length=185

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 111/166 (67%), Gaps = 12/166 (7%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            +  + E++CYVHCNFC+T+LAVSVPC S+F  VTVRCGHC NLLSVNM  LL        
Sbjct  3    MEMTSERVCYVHCNFCNTILAVSVPCGSMFTIVTVRCGHCANLLSVNMGALLQSVHLQDF  62

Query  396  HLPHSFFSPQNLLDE--IRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQR  569
             L       Q+++ E  IR+   S      +      P+  VD+        RPPEKRQR
Sbjct  63   QLQ----KQQSVVGEATIRDIGSS------SKCSRFGPVPQVDQEQPKAAPIRPPEKRQR  112

Query  570  VPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL  707
            VPSAYNRFIK+EIQRIKA NP+ISHREAFS AAKNWAHFPHIHFGL
Sbjct  113  VPSAYNRFIKEEIQRIKASNPEISHREAFSTAAKNWAHFPHIHFGL  158



>gb|KDO48950.1| hypothetical protein CISIN_1g029862mg [Citrus sinensis]
Length=186

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 114/169 (67%), Gaps = 11/169 (7%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLL--LPTAPN  389
            L  + E++CYVHCN+C+T+LAVSVPCSSLF  VTVRCGHC NLL+VNM   L  +P    
Sbjct  3    LDLASERVCYVHCNYCNTILAVSVPCSSLFNIVTVRCGHCANLLNVNMVSALQAVPLQDP  62

Query  390  QLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQR  569
            QL   H      NL D I     S   ++ N   S       +    PP+  RPPEKRQR
Sbjct  63   QLQKQHI-----NLEDSITKDCGS--SSKCNKFSSAFETAEHETPRMPPI--RPPEKRQR  113

Query  570  VPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
            VPSAYNRFIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGL  D
Sbjct  114  VPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGLKLD  162



>emb|CDX83239.1| BnaA03g22670D [Brassica napus]
Length=164

 Score =   184 bits (467),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 111/163 (68%), Gaps = 16/163 (10%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLP-TAPNQLHL  401
            + EQLCY+ CNFC+ VLAVSVPCSSLF  VTVRCGHCTNL SVNM   L   + PN    
Sbjct  7    AAEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAALQSLSRPNFQVT  66

Query  402  PHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVPSA  581
            P++   P+       NT  S          S +  R + E     + NRPPEKRQRVPSA
Sbjct  67   PYAM--PEYGSSSRGNTKIS----------SRISARTISE---QRIVNRPPEKRQRVPSA  111

Query  582  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  710
            YN+FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM
Sbjct  112  YNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLM  154



>ref|XP_004487438.1| PREDICTED: putative axial regulator YABBY 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004487439.1| PREDICTED: putative axial regulator YABBY 2-like isoform X2 [Cicer 
arietinum]
Length=184

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 113/165 (68%), Gaps = 10/165 (6%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLP  404
            + E++CYVHCNFC+T LAVSVPCSSL   VTVRCGHC NLLSVNM   L    P Q H  
Sbjct  7    ANERVCYVHCNFCNTTLAVSVPCSSLLTIVTVRCGHCANLLSVNMGASLQSFPPQQDHP-  65

Query  405  HSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPK-PPVANRPPEKRQRVPSA  581
                  Q LL   + T    + +  +  ++   +    E P+ PP+  RPPEKRQRVPSA
Sbjct  66   ----QKQQLLSCHQETSRREVGSSSSKCKAFETV--AHEQPRTPPI--RPPEKRQRVPSA  117

Query  582  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
            YNRFIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGL  D
Sbjct  118  YNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGLKLD  162



>gb|ACJ85113.1| unknown [Medicago truncatula]
 gb|AFK33376.1| unknown [Medicago truncatula]
Length=191

 Score =   185 bits (469),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 116/185 (63%), Gaps = 21/185 (11%)
 Frame = +3

Query  159  MSSSSTAFAPDhhhhhphhLSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCT  338
            MSS S   AP            + EQLCY+ CNFC+ VLAVSVPCSSLF  VTVRCGHCT
Sbjct  1    MSSCSIDVAP-----------AAAEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCT  49

Query  339  NLLSVNMRGLLLPTAPNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESL-MPIRGV  515
            NL SVNM       +   +  P    +P+     IR +      + P  N+ + M     
Sbjct  50   NLWSVNMAAAFQSLSWQDVQAPSHCMNPEY---RIRTS------STPKCNDRIAMRSAPT  100

Query  516  DELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHI  695
              + +  V NRPPEKRQRVPSAYN+FIK+EIQRIK  NPDISHREAFS AAKNWAHFPHI
Sbjct  101  THVTEERVVNRPPEKRQRVPSAYNQFIKEEIQRIKVNNPDISHREAFSTAAKNWAHFPHI  160

Query  696  HFGLM  710
            HFGLM
Sbjct  161  HFGLM  165



>gb|AHZ90132.1| YABBY2 [Incarvillea arguta]
Length=172

 Score =   184 bits (466),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 119/165 (72%), Gaps = 23/165 (14%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLP  404
            + E++CY+HCNFC+T+L V+VPC+S+   VTVRCGHC+NLLSVNM  LL     + LHL 
Sbjct  6    NSERVCYLHCNFCNTILVVNVPCNSMLSLVTVRCGHCSNLLSVNMGALL----HHSLHLQ  61

Query  405  HSFFSPQNLLD---EIRNTPPSLLMNQPNPNESLMPIRGVDELPKP-PVANRPPEKRQRV  572
              F   Q+L D    I+++  S   ++P            DELPKP P+  RPPEKRQRV
Sbjct  62   DHFQRQQSLTDVHAAIKDSGSS--SSKPE-----------DELPKPTPI--RPPEKRQRV  106

Query  573  PSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL  707
            PSAYNRFIK+EIQRIKA NP+I+HREAFSAAAKNWAH PHIHFG+
Sbjct  107  PSAYNRFIKEEIQRIKASNPEITHREAFSAAAKNWAHLPHIHFGM  151



>ref|XP_009364015.1| PREDICTED: axial regulator YABBY 5-like [Pyrus x bretschneideri]
Length=188

 Score =   184 bits (467),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 109/162 (67%), Gaps = 7/162 (4%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLP  404
            + EQLCY+ CNFC  VLAVSVPCSSLF  VTVRCGHCTNL SVNM       +   +   
Sbjct  8    ATEQLCYIPCNFCSIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFQSLSWQDVQAQ  67

Query  405  HSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVPSAY  584
            +  ++ QN   +   +  S   N+ N  +        D + +    NRPPEKRQRVPSAY
Sbjct  68   NYNYNSQNYRID---SGSSSKCNKKNATKDPTS----DHVTEERGVNRPPEKRQRVPSAY  120

Query  585  NRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  710
            N+FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM
Sbjct  121  NQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLM  162



>ref|XP_010651638.1| PREDICTED: putative axial regulator YABBY 2 isoform X4 [Vitis 
vinifera]
Length=181

 Score =   184 bits (466),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 115/165 (70%), Gaps = 17/165 (10%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPHS  410
            E++CYVHCNFC+T+LAVSVPC+SLF  VTVRCGHC NLLSVNM G LL T P Q      
Sbjct  8    ERVCYVHCNFCNTILAVSVPCTSLFTIVTVRCGHCANLLSVNM-GALLQTVPTQD-----  61

Query  411  FFSPQNLL--DEIRNTPPSLLMNQPNPNESLMPIRGVDELPK-PPVANRPPEKRQRVPSA  581
                Q L   D   +   S   N+ +  ES        E P+ PP+  RPPEKRQRVPSA
Sbjct  62   -LQKQQLSCGDPSEDCGSSSKCNKFSAFES-----AEHEQPRMPPI--RPPEKRQRVPSA  113

Query  582  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
            YNRFIK+EIQRIKA NPDI+HREAFS AAKNWAHFPHIHFGL  D
Sbjct  114  YNRFIKEEIQRIKASNPDITHREAFSTAAKNWAHFPHIHFGLKLD  158



>gb|AID67114.1| YAB5 protein [Solanum virginianum]
Length=182

 Score =   184 bits (466),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 121/181 (67%), Gaps = 13/181 (7%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLP----TA  383
            +  + EQLCY+ CN C+ VLAVSVPCSSLF  VTVRCGHCTNL SVNM          + 
Sbjct  5    IDVASEQLCYIPCNLCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFQSPSSTSW  64

Query  384  PN-QLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEK  560
            PN Q+ +P+ + +P+  +D   +T       + N N   M     + + +  + NRPPEK
Sbjct  65   PNHQVQVPN-YTAPEYRMDFGSST-------KCNMNRMSMRTPITNNVHEERIVNRPPEK  116

Query  561  RQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNA  740
            RQRVPSAYN+FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM +   +   A
Sbjct  117  RQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLESNNQAKLA  176

Query  741  C  743
            C
Sbjct  177  C  177



>ref|XP_006487833.1| PREDICTED: putative axial regulator YABBY 2-like isoform X2 [Citrus 
sinensis]
Length=184

 Score =   184 bits (467),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 113/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPT---AP  386
            L  S E++CYVHCN+C+T+LAVSVPCSSLF  VTVRCGHC NLL+VNM   L       P
Sbjct  3    LDLSSERVCYVHCNYCNTILAVSVPCSSLFNIVTVRCGHCANLLNVNMVSALQAVPLQDP  62

Query  387  NQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQ  566
             + H+        NL D I     S   ++ N   S       +    PP+  RPPEKRQ
Sbjct  63   QKQHI--------NLEDSITKDCGS--SSKCNKFSSAFETAEHETPRMPPI--RPPEKRQ  110

Query  567  RVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
            RVPSAYNRFIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGL  D
Sbjct  111  RVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGLKLD  160



>gb|EYU34993.1| hypothetical protein MIMGU_mgv1a014582mg [Erythranthe guttata]
Length=185

 Score =   184 bits (466),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 111/163 (68%), Gaps = 8/163 (5%)
 Frame = +3

Query  228  GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQ--LHL  401
             EQLCY+ CNFC  VLAVSVPC+SLF  VTVRCGHCTNL SVNM     P  P+   LH 
Sbjct  2    AEQLCYIPCNFCSIVLAVSVPCNSLFDVVTVRCGHCTNLWSVNMASTFHPFWPDHHLLHQ  61

Query  402  PHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVPSA  581
              ++ S      ++  +   L     N   S+ P     +LP+    NRPPEKRQRVPSA
Sbjct  62   APNYNSSSEYKVDLGGSSSKL-----NNKMSIQPSIPT-KLPEQRTVNRPPEKRQRVPSA  115

Query  582  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  710
            YN+FIK+EIQRIKA NP+ISHREAFS AAKNWAHFPHIHFGLM
Sbjct  116  YNQFIKEEIQRIKANNPEISHREAFSTAAKNWAHFPHIHFGLM  158



>ref|XP_010250140.1| PREDICTED: axial regulator YABBY 5-like isoform X3 [Nelumbo nucifera]
Length=187

 Score =   184 bits (466),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 117/178 (66%), Gaps = 14/178 (8%)
 Frame = +3

Query  228  GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPH  407
             EQ+CY+ CNFC+ +LAVSVPCSSLF  VTVRCGHCTNL SVNM   L   +   L  P 
Sbjct  11   SEQVCYIPCNFCNIILAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAALQSLSWQDLQTP-  69

Query  408  SFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVPSAYN  587
            SF SP   +D   ++  + +  +P P  +           +  + NRP EKRQRVPSAYN
Sbjct  70   SFTSPDYRIDLGSSSKCNKVAMRPPPPAN----------SEQRIVNRPAEKRQRVPSAYN  119

Query  588  RFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGED  761
            +FIK+EIQRIKA NP+ISHREAFS AAKNWAHFPHIHFGLM +    K  A   EG D
Sbjct  120  QFIKEEIQRIKANNPEISHREAFSTAAKNWAHFPHIHFGLMLE---NKNQAKLDEGSD  174



>ref|XP_008778120.1| PREDICTED: protein YABBY 2-like isoform X1 [Phoenix dactylifera]
Length=181

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 113/164 (69%), Gaps = 17/164 (10%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLP  404
            + E +CYVHCNFC+T+LAVSVP ++L   VTVRCGHCTNLL VNM GLL  T P Q    
Sbjct  6    TTEHVCYVHCNFCNTILAVSVPGNNLLNVVTVRCGHCTNLLYVNMSGLL-QTVPLQEIQA  64

Query  405  HSFFSPQNLLD---EIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVP  575
            H+  S  + ++     + +  SL+ +  N  +  +PIR             PPEKRQRVP
Sbjct  65   HNVGSEDHRVECGSSSKCSRTSLMYSMLNDQQQTLPIR-------------PPEKRQRVP  111

Query  576  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL  707
            SAYNRFIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGL
Sbjct  112  SAYNRFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGL  155



>ref|XP_007155017.1| hypothetical protein PHAVU_003G166100g [Phaseolus vulgaris]
 gb|ESW27011.1| hypothetical protein PHAVU_003G166100g [Phaseolus vulgaris]
Length=186

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 110/164 (67%), Gaps = 14/164 (9%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPHS  410
            EQLCY+ CNFC+ VLAVSVPCSSLF  VTVRCGHCTNL SVNM       +   +  P  
Sbjct  11   EQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFQSLSWQDVQGP-G  69

Query  411  FFSPQNLLDEIRNTPPS--LLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVPSAY  584
              +P+  +D    +  +  + M  P  N S           +  V NRPPEKRQRVPSAY
Sbjct  70   HCNPEYRIDTGSTSKCNNRIAMRAPTTNVS-----------EERVVNRPPEKRQRVPSAY  118

Query  585  NRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
            N+FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM D
Sbjct  119  NQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLD  162



>ref|XP_007013479.1| Plant-specific transcription factor YABBY family protein isoform 
1 [Theobroma cacao]
 gb|EOY31098.1| Plant-specific transcription factor YABBY family protein isoform 
1 [Theobroma cacao]
Length=184

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 116/185 (63%), Gaps = 13/185 (7%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPHS  410
            EQLCY+ CNFC+ VLAVSVPCSSLF  VTVRCGHCTNL SVNM       +   +  P+ 
Sbjct  10   EQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFQSLSWQDVQAPN-  68

Query  411  FFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVPSAYNR  590
             ++ Q+   E+ ++     ++   P  ++   R         V NRPPEKR RVPSAYN+
Sbjct  69   -YATQDYRTELGSSSKCNKLSMRTPANNVTEER---------VVNRPPEKRPRVPSAYNQ  118

Query  591  FIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEGEDGLM  770
            FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM +      N      E  LM
Sbjct  119  FIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLE--TNNQNKLDDASEKHLM  176

Query  771  KDGFL  785
                L
Sbjct  177  SRTAL  181



>gb|AFY26892.1| YABBY2-like transcription factor YAB2 [Morella rubra]
Length=181

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 115/165 (70%), Gaps = 17/165 (10%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLP  404
            + E++CYVHCNFC+T+LAVSVPCSSLF  VTVRCGHC NLLSVNM   L    P      
Sbjct  8    ASERVCYVHCNFCNTILAVSVPCSSLFTIVTVRCGHCANLLSVNMGASLQAVPPQDSQ--  65

Query  405  HSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPK-PPVANRPPEKRQRVPSA  581
                  Q+++ E  +   S   N+ +  E++       E P+ PP+  RPPEKRQRVPSA
Sbjct  66   -----KQHVISE--DCGSSSKCNKFSAFETVE-----HEQPRMPPI--RPPEKRQRVPSA  111

Query  582  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
            YNRFIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGL  D
Sbjct  112  YNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGLKLD  156



>gb|EEE51245.1| hypothetical protein OsJ_32108 [Oryza sativa Japonica Group]
Length=267

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 123/240 (51%), Positives = 140/240 (58%), Gaps = 61/240 (25%)
 Frame = +3

Query  279  VSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL----------------HLPHS  410
            VSVP SSLF+TVTVRCGHC++LL+VNMRGLLLPT                     H PHS
Sbjct  28   VSVPSSSLFETVTVRCGHCSSLLTVNMRGLLLPTTAAAAPPPPPPPPPPPPPPAAHFPHS  87

Query  411  F-FSPQN------LLDEIR--NTPPSLLMNQ-------------PNPNESLMPI------  506
               +P N      LLDEI   N+P  LL+ Q              N N            
Sbjct  88   LNLAPANPPHHHSLLDEISTANSPTQLLLEQHGLGGLMASAASCRNNNSPAAAAAPPPQT  147

Query  507  ---RGVDELPKP----PVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAA  665
               +   + P P     V NRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAA
Sbjct  148  SQGKAAAKEPSPRTNTAVINRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAA  207

Query  666  AKNWAHFPHIHFGLMPD-QPVKKPNACQQEGE--DGLMKDGFL-------APPNLGVSPY  815
            AKNWAHFPHIHFGLMPD Q +KK +   Q+ +  DGL+K+G         A  N+GV+PY
Sbjct  208  AKNWAHFPHIHFGLMPDHQGLKKTSLLPQDHQRKDGLLKEGLYAAAAAAAAAANMGVAPY  267



>ref|XP_006450896.1| hypothetical protein CICLE_v10009560mg [Citrus clementina]
 ref|XP_006475869.1| PREDICTED: axial regulator YABBY 5-like isoform X2 [Citrus sinensis]
 gb|ESR64136.1| hypothetical protein CICLE_v10009560mg [Citrus clementina]
 gb|KDO80206.1| hypothetical protein CISIN_1g028980mg [Citrus sinensis]
Length=190

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 111/163 (68%), Gaps = 12/163 (7%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPH-  407
            EQLCY+ CNFC+ VLAVSVPCSSL   VTVRCGHC+NL SVNM       +   +H    
Sbjct  11   EQLCYIPCNFCNIVLAVSVPCSSLLDIVTVRCGHCSNLWSVNMAAAFQSLSWQDVHHHQA  70

Query  408  -SFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRG-VDELPKPPVANRPPEKRQRVPSA  581
             S+ SP+  +D         L +    N  +  +R   ++  +  V NRPPEKRQRVPSA
Sbjct  71   PSYASPECRID---------LGSSSKCNNKISAMRTPTNKATEERVVNRPPEKRQRVPSA  121

Query  582  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  710
            YN+FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM
Sbjct  122  YNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLM  164



>ref|XP_010105229.1| hypothetical protein L484_012344 [Morus notabilis]
 gb|EXC04107.1| hypothetical protein L484_012344 [Morus notabilis]
Length=195

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 110/161 (68%), Gaps = 3/161 (2%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPHS  410
            EQLCY+ CNFC+ VLAVSVPCSSL   VTVRCGHCTNL SVNM       +  Q H  H 
Sbjct  10   EQLCYIPCNFCNIVLAVSVPCSSLLDIVTVRCGHCTNLWSVNMAAAFQSLSWQQDH--HH  67

Query  411  FFSPQNLLDEIRNTP-PSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVPSAYN  587
                QN    + +    S   ++ N N+  M     + + +  V NRPPEKRQRVPSAYN
Sbjct  68   HLQAQNYNYNVPDYRIDSGSSSRCNVNKLAMRAPNANNVSEERVVNRPPEKRQRVPSAYN  127

Query  588  RFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  710
            +FIK+EIQRIKA NP+ISHREAFS AAKNWAHFPHIHFGLM
Sbjct  128  QFIKEEIQRIKANNPEISHREAFSTAAKNWAHFPHIHFGLM  168



>ref|NP_001281031.1| axial regulator YABBY 5 [Malus domestica]
 gb|ADL36869.1| YABBY domain class transcription factor [Malus domestica]
Length=188

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 108/162 (67%), Gaps = 7/162 (4%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLP  404
            + EQLCY+ CNFC  VLAVSVPCSSLF  VTVRCGHCTNL SVNM       +   +   
Sbjct  8    ATEQLCYIPCNFCSIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFQSPSWQDVQAQ  67

Query  405  HSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVPSAY  584
            +  ++ QN   ++ ++      N      S       D + +    NRPPEKRQRVPSAY
Sbjct  68   NYNYNSQNYRIDLGSSSKCNKKNATRDPTS-------DHVTEERGVNRPPEKRQRVPSAY  120

Query  585  NRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  710
            N+FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM
Sbjct  121  NQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLM  162



>ref|XP_006358281.1| PREDICTED: axial regulator YABBY 5-like [Solanum tuberosum]
Length=179

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 118/176 (67%), Gaps = 12/176 (7%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLP  404
            + +QLCY+ CNFC+ VLAVSVPCSSL   VTVRCGHCTNL SVNM      ++    H+ 
Sbjct  8    ASDQLCYIPCNFCNIVLAVSVPCSSLLDIVTVRCGHCTNLWSVNMAAAFQSSSSQNHHVQ  67

Query  405  H-SFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRG--VDELPKPPVANRPPEKRQRVP  575
              ++ +P+  +D   +T           N + M +R    + + +  + NRPPEKRQRVP
Sbjct  68   VPNYTAPEYKMDFGSSTKC---------NMNRMSLRTPITNNVHEERIVNRPPEKRQRVP  118

Query  576  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNAC  743
            SAYN+FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM +   +   AC
Sbjct  119  SAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLESNNQAKLAC  174



>gb|KDO48952.1| hypothetical protein CISIN_1g029862mg [Citrus sinensis]
Length=184

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 113/170 (66%), Gaps = 15/170 (9%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPT---AP  386
            L  + E++CYVHCN+C+T+LAVSVPCSSLF  VTVRCGHC NLL+VNM   L       P
Sbjct  3    LDLASERVCYVHCNYCNTILAVSVPCSSLFNIVTVRCGHCANLLNVNMVSALQAVPLQDP  62

Query  387  NQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQ  566
             + H+        NL D I     S   ++ N   S       +    PP+  RPPEKRQ
Sbjct  63   QKQHI--------NLEDSITKDCGS--SSKCNKFSSAFETAEHETPRMPPI--RPPEKRQ  110

Query  567  RVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
            RVPSAYNRFIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGL  D
Sbjct  111  RVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGLKLD  160



>ref|XP_004287301.1| PREDICTED: axial regulator YABBY 5-like [Fragaria vesca subsp. 
vesca]
Length=186

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 108/160 (68%), Gaps = 8/160 (5%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPHS  410
            EQLCY+ CNFC+ VLAVSVPCSSL   VTVRCGHCTNL SVNM       +   +   H+
Sbjct  10   EQLCYIPCNFCNIVLAVSVPCSSLLDIVTVRCGHCTNLWSVNMAAAFQSLSWQDVQAQHN  69

Query  411  FFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVPSAYNR  590
              + QN    I +   S    +    +S+   R  +E       NRPPEKRQRVPSAYN+
Sbjct  70   H-NAQNY--RIDSGSSSKGNKKIATRDSIADHRATEER-----VNRPPEKRQRVPSAYNQ  121

Query  591  FIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  710
            FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM
Sbjct  122  FIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLM  161



>emb|CDY38528.1| BnaC03g26690D [Brassica napus]
Length=164

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 112/163 (69%), Gaps = 16/163 (10%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLP-TAPNQLHL  401
            + EQLCY+ CNFC+ VLAVSVPCSSLF  VTVRCGHCTNL SVNM   L   + PN    
Sbjct  7    AAEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAALQSLSRPNFQVT  66

Query  402  PHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVPSA  581
            P++  +P+       +T  S          S +  R + E     + NRPPEKRQRVPSA
Sbjct  67   PYA--TPEYGSSSRGHTKIS----------SRISARTISE---QRIVNRPPEKRQRVPSA  111

Query  582  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  710
            YN+FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM
Sbjct  112  YNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLM  154



>ref|XP_004242778.1| PREDICTED: axial regulator YABBY 5 [Solanum lycopersicum]
Length=180

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 119/178 (67%), Gaps = 9/178 (5%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPN--  389
            +  + +QLCY+ CNFC+ VLAVSVPCSSLF  VTVRCGHCTNL SVNM      ++    
Sbjct  5    IDVASDQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFQSSSSASW  64

Query  390  QLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQR  569
            Q H   ++ +P+  +D   +T       + N N   M     + + +  + NRPPEKRQR
Sbjct  65   QNHQVPNYTAPEYRMDFGSST-------KCNMNRMSMRTPITNNVHEERIVNRPPEKRQR  117

Query  570  VPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNAC  743
            VPSAYN+FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM +   +   AC
Sbjct  118  VPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLESNNQAKLAC  175



>gb|KDO80208.1| hypothetical protein CISIN_1g028980mg [Citrus sinensis]
Length=201

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 111/163 (68%), Gaps = 12/163 (7%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPH-  407
            EQLCY+ CNFC+ VLAVSVPCSSL   VTVRCGHC+NL SVNM       +   +H    
Sbjct  11   EQLCYIPCNFCNIVLAVSVPCSSLLDIVTVRCGHCSNLWSVNMAAAFQSLSWQDVHHHQA  70

Query  408  -SFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRG-VDELPKPPVANRPPEKRQRVPSA  581
             S+ SP+  +D         L +    N  +  +R   ++  +  V NRPPEKRQRVPSA
Sbjct  71   PSYASPECRID---------LGSSSKCNNKISAMRTPTNKATEERVVNRPPEKRQRVPSA  121

Query  582  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  710
            YN+FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM
Sbjct  122  YNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLM  164



>ref|XP_010254434.1| PREDICTED: axial regulator YABBY 5-like [Nelumbo nucifera]
Length=184

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 112/161 (70%), Gaps = 11/161 (7%)
 Frame = +3

Query  228  GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPH  407
             EQ+CY+ CNFC+ +LAVSVPCSSLF  VTVRCGHCTNL SVNM   L   +   L  P+
Sbjct  9    SEQVCYIPCNFCNIILAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAALQSLSWQDLQAPN  68

Query  408  SFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVPSAYN  587
             F SP+  ++          +   +   + + +R    + +  + NRPPEKRQRVPSAYN
Sbjct  69   -FTSPEYRIE----------LGSSSSKCNKIAMRPPPAINEERIVNRPPEKRQRVPSAYN  117

Query  588  RFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  710
            +FIK+EIQRIKA NP+ISHREAFS AAKNWAHFPHIHFGLM
Sbjct  118  QFIKEEIQRIKANNPEISHREAFSTAAKNWAHFPHIHFGLM  158



>ref|XP_010651636.1| PREDICTED: putative axial regulator YABBY 2 isoform X1 [Vitis 
vinifera]
Length=184

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 109/163 (67%), Gaps = 10/163 (6%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPHS  410
            E++CYVHCNFC+T+LAVSVPC+SLF  VTVRCGHC NLLSVNM G LL T P Q      
Sbjct  8    ERVCYVHCNFCNTILAVSVPCTSLFTIVTVRCGHCANLLSVNM-GALLQTVPTQ------  60

Query  411  FFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVD-ELPKPPVANRPPEKRQRVPSAYN  587
                Q+   ++    PS      +           + E P+ P     PEKRQRVPSAYN
Sbjct  61   --DLQSQKQQLSCGDPSEDCGSSSKCNKFSAFESAEHEQPRMPPIRPAPEKRQRVPSAYN  118

Query  588  RFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
            RFIK+EIQRIKA NPDI+HREAFS AAKNWAHFPHIHFGL  D
Sbjct  119  RFIKEEIQRIKASNPDITHREAFSTAAKNWAHFPHIHFGLKLD  161



>gb|AAS10178.1| YABBY-like transcription factor PROLONGATA [Antirrhinum majus]
Length=186

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 110/160 (69%), Gaps = 4/160 (3%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPHS  410
            EQLCY+ CNFC  VLAVSVPCSSLF  VTVRCGHCTNL SVNM       A  Q   PH 
Sbjct  5    EQLCYISCNFCSIVLAVSVPCSSLFDVVTVRCGHCTNLWSVNMAA----AATFQSLQPHW  60

Query  411  FFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVPSAYNR  590
              +  +      +T  ++ +   +   + M ++     P+  + NRPPEKRQRVPSAYN+
Sbjct  61   QDAVVHQAPNHASTEYNVDLGSSSRWNNKMAVQPSITKPEQRIVNRPPEKRQRVPSAYNQ  120

Query  591  FIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  710
            FIK+EIQRIKA NP+ISHREAFS AAKNWAHFPHIHFGLM
Sbjct  121  FIKEEIQRIKANNPEISHREAFSTAAKNWAHFPHIHFGLM  160



>gb|AID67111.1| YAB5 protein [Solanum melongena]
 gb|AID67115.1| YAB5 protein [Solanum torvum]
Length=182

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 118/180 (66%), Gaps = 11/180 (6%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLL----LPTA  383
            +  + EQLCY+ CNFC+ VLAVSVPCSSL+  VTVRCGHCTNL SVNM          + 
Sbjct  5    IDVASEQLCYIPCNFCNIVLAVSVPCSSLYDIVTVRCGHCTNLWSVNMASAFQSSSSSSW  64

Query  384  PNQLHLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKR  563
            PN      ++ +P+  +D   +T       + N N   M     + + +  + NRPPEKR
Sbjct  65   PNHHVQVPNYTAPEYRMDFGSST-------KCNMNRMSMRTPITNNVHEERIVNRPPEKR  117

Query  564  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNAC  743
            QRVPSAYN+FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM +   +   AC
Sbjct  118  QRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLESNNQAKLAC  177



>ref|XP_004150030.1| PREDICTED: axial regulator YABBY 5-like [Cucumis sativus]
Length=193

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 111/161 (69%), Gaps = 4/161 (2%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPHS  410
            EQLCY+ CNFC+ VLAVSVPCSSLF  VTVRCGHCTNL SVNM       +   + +P  
Sbjct  11   EQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFHSLSWQDVQVPSY  70

Query  411  FFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELP-KPPVANRPPEKRQRVPSAYN  587
                 N  D   +   S   ++ N N + M IR    +P +  V NRPPEKRQRVPSAYN
Sbjct  71   NLYGCNGADFQGDFGSS---SKCNNNVNKMEIRVPTTIPAEERVVNRPPEKRQRVPSAYN  127

Query  588  RFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  710
            +FIK+EIQRIKA NP+ISHREAFS AAKNWAHFP IHFGLM
Sbjct  128  QFIKEEIQRIKASNPEISHREAFSTAAKNWAHFPRIHFGLM  168



>ref|XP_002308074.1| plant-specific transcription factor YABBY family protein [Populus 
trichocarpa]
 gb|EEE91597.1| plant-specific transcription factor YABBY family protein [Populus 
trichocarpa]
Length=188

 Score =   182 bits (462),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 107/161 (66%), Gaps = 8/161 (5%)
 Frame = +3

Query  228  GEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLPH  407
             EQLCY+ CNFC+ VLAVSVPCSSLF  VTVRCGHCTN+ SVNM       +        
Sbjct  10   NEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNIWSVNMAAAFQSLSWQDQVQAS  69

Query  408  SFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVPSAYN  587
            ++ S    +D        L  +    N+  M     + + +  V NRPPEKRQRVPSAYN
Sbjct  70   NYNSHDYRID--------LGSSSKCNNKISMRTPAANIVTQERVVNRPPEKRQRVPSAYN  121

Query  588  RFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  710
            +FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM
Sbjct  122  QFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLM  162



>ref|NP_001236663.1| uncharacterized protein LOC100500091 [Glycine max]
 gb|ACU14881.1| unknown [Glycine max]
 gb|KHN21205.1| Putative axial regulator YABBY 2 [Glycine soja]
Length=183

 Score =   182 bits (461),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 119/189 (63%), Gaps = 20/189 (11%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLL---PTAPNQLHL  401
            E++CYVHCNFC+T+LAVSVP SSL   VTVRCGHC NLLSVNM   L    P  P + HL
Sbjct  9    ERVCYVHCNFCNTILAVSVPYSSLLTIVTVRCGHCANLLSVNMGASLQAFPPQDPQKQHL  68

Query  402  PHSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVD-ELPK-PPVANRPPEKRQRVP  575
              SF             P S  +   +    + P   V+ ELP+ PP+  RP EKR RVP
Sbjct  69   --SF-----------QEPSSKELGSSSKCSKIAPFEAVEHELPRIPPI--RPTEKRHRVP  113

Query  576  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNACQQEG  755
            SAYNRFIK+EIQRIKA NPDISHREAFS+AAKNWAHFPHIHFGL   +          +G
Sbjct  114  SAYNRFIKEEIQRIKASNPDISHREAFSSAAKNWAHFPHIHFGLKNLKLDGNKQEKLDQG  173

Query  756  EDGLMKDGF  782
            E     +GF
Sbjct  174  EGAEKSNGF  182



>dbj|BAF56419.1| YABBY2 like protein [Ruscus aculeatus]
Length=183

 Score =   182 bits (461),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 114/168 (68%), Gaps = 15/168 (9%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            LSP  E +CYVHCNFC+T+L V+VP ++LF  VT+RCGHC NLLSVNM G LL   P Q 
Sbjct  5    LSP--EHVCYVHCNFCNTILVVNVPGNNLFNIVTIRCGHCANLLSVNM-GALLQALPLQD  61

Query  396  HLPHSFFSPQNLLDEIRNTPPSLLMNQPNPNES-LMPIRGVDELPKPPVANRPPEKRQRV  572
               H   S  N  D           +  N N + LM  +  D+  + P+  R PEKRQRV
Sbjct  62   FQNHQVASQDNRGD---------CSSSSNCNRTALMFTQEHDQQQRLPI--RSPEKRQRV  110

Query  573  PSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
            PSAYNRFIK+EIQRIKA NPDISHREAFSAAAKNWAHFPHIHFGL  D
Sbjct  111  PSAYNRFIKEEIQRIKANNPDISHREAFSAAAKNWAHFPHIHFGLTLD  158



>ref|XP_006295133.1| hypothetical protein CARUB_v10024208mg [Capsella rubella]
 ref|XP_006295134.1| hypothetical protein CARUB_v10024208mg [Capsella rubella]
 gb|EOA28031.1| hypothetical protein CARUB_v10024208mg [Capsella rubella]
 gb|EOA28032.1| hypothetical protein CARUB_v10024208mg [Capsella rubella]
Length=164

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 107/162 (66%), Gaps = 14/162 (9%)
 Frame = +3

Query  225  SGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQLHLP  404
            S EQLCY+ CNFC+ VLAVSVPCSSLF  VTVRCGHCTNL SVNM   L       L  P
Sbjct  7    SSEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAL-----QSLSRP  61

Query  405  HSFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVPSAY  584
            +  F   N       +        P    S +  R + E     + NRPPEKRQRVPSAY
Sbjct  62   N--FQATNYAVPDYGSTSRGHTKTP----SRISTRTITE---QRIVNRPPEKRQRVPSAY  112

Query  585  NRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM  710
            N+FIK+EIQRIKA NPDISHREAFS AAKNWAHFPHIHFGLM
Sbjct  113  NQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLM  154



>ref|XP_010426681.1| PREDICTED: axial regulator YABBY 3-like isoform X3 [Camelina 
sativa]
Length=184

 Score =   182 bits (461),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 130/176 (74%), Gaps = 21/176 (12%)
 Frame = +3

Query  279  VSVPCSSLFKTVTVRCGHCTNLLSV--NMRGLLLPTAPNQLHLPHSFFSPQ----NLLDE  440
            VSVP SSLFKTVTVRCGHC+NLLSV  NMR LLLP+  N   + HSF  P     NLL+E
Sbjct  7    VSVPPSSLFKTVTVRCGHCSNLLSVTVNMRTLLLPSVSN---IGHSFIPPPPPPPNLLEE  63

Query  441  IRNTPPSLLMNQ--------PNPNESL-MPIR-GVDELPKPPVANRPP-EKRQRVPSAYN  587
            +R+   ++ MN          +PNESL M  R G+ E+P+PP ANRP  EKRQRVPSAYN
Sbjct  64   MRSGGQNINMNMMMSHHGAAHHPNESLAMAARNGLQEMPRPPPANRPAPEKRQRVPSAYN  123

Query  588  RFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQ-PVKKPNACQQE  752
            RFIK+EIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLM D  P KK N  QQ+
Sbjct  124  RFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMADHPPTKKANVRQQQ  179



>ref|XP_008810627.1| PREDICTED: protein YABBY 2-like isoform X2 [Phoenix dactylifera]
Length=185

 Score =   182 bits (461),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 111/163 (68%), Gaps = 15/163 (9%)
 Frame = +3

Query  231  EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQ-LHLPH  407
            E +CYVHC FC+T+LAVSVP ++L  TVTVRCGHCTNLLSVNM GLL  TAP Q L +  
Sbjct  9    EHVCYVHCTFCNTILAVSVPGNNLLNTVTVRCGHCTNLLSVNMGGLL-ETAPIQDLQVVG  67

Query  408  SFFSPQNLLDEIRNTPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKRQRVPSAYN  587
            S    +      +    S++ +  N  +  +P+R             PPEKRQRVPSAYN
Sbjct  68   SQDYRKERGSSSKCNKTSVMCSMQNDQQQTLPMR-------------PPEKRQRVPSAYN  114

Query  588  RFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD  716
            RFI++EIQRIK  NPDISHREAFS AAKNWAHFPHIHFGL  D
Sbjct  115  RFIREEIQRIKTNNPDISHREAFSTAAKNWAHFPHIHFGLNMD  157



>ref|XP_010263070.1| PREDICTED: putative axial regulator YABBY 2 isoform X2 [Nelumbo 
nucifera]
Length=183

 Score =   181 bits (460),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 117/186 (63%), Gaps = 19/186 (10%)
 Frame = +3

Query  216  LSPSGEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPTAPNQL  395
            L  + E +CYVHCNFC+T+LAVSVP +SL+  VTVRCGHC NLLSVNM  LL P     +
Sbjct  3    LDVASEHVCYVHCNFCNTILAVSVPSTSLYNVVTVRCGHCANLLSVNMGALLQPLPLQDI  62

Query  396  HLPHSFFSPQNLLDEIRN----TPPSLLMNQPNPNESLMPIRGVDELPKPPVANRPPEKR  563
             L +   S ++      +       S+L    N    ++P+R             PPEKR
Sbjct  63   QLQNHNSSSEDSTKGSGSSSKCNKVSMLDTAENDQPRMLPMR-------------PPEKR  109

Query  564  QRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPD--QPVKKPN  737
            QRVPSAYNRFIK+EIQRIKA NP+ISHREAFS AAKNWAHFPHIHFGL  D  + VK   
Sbjct  110  QRVPSAYNRFIKEEIQRIKASNPEISHREAFSTAAKNWAHFPHIHFGLTLDGNKHVKLDE  169

Query  738  ACQQEG  755
            A   EG
Sbjct  170  AIVGEG  175



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2376282946848