BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2745_g1_i1 len=469 path=[447:0-468]

Length=469
                                                                      Score     E

emb|CDP02602.1|  unnamed protein product                              87.0    1e-17   
ref|XP_006364411.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  84.3    6e-17   
ref|XP_004233459.1|  PREDICTED: adenylyl-sulfate kinase 3-like        84.7    1e-16   
ref|XP_006364412.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  84.3    1e-16   
sp|O49204.1|KAPS_CATRO  RecName: Full=Adenylyl-sulfate kinase, ch...  84.0    1e-16   Catharanthus roseus [chatas]
ref|XP_009609820.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  82.4    2e-16   
ref|XP_011073686.1|  PREDICTED: adenylyl-sulfate kinase 3-like is...  83.6    2e-16   
ref|XP_011073685.1|  PREDICTED: adenylyl-sulfate kinase 3-like is...  83.6    2e-16   
ref|XP_011099374.1|  PREDICTED: adenylyl-sulfate kinase 3-like        83.2    3e-16   
gb|EYU29625.1|  hypothetical protein MIMGU_mgv1a010612mg              82.8    5e-16   
ref|XP_008236312.1|  PREDICTED: adenylyl-sulfate kinase 3             82.0    6e-16   
ref|XP_009788046.1|  PREDICTED: adenylyl-sulfate kinase 3-like        82.4    1e-15   
ref|XP_002525273.1|  adenylsulfate kinase, putative                   81.3    1e-15   Ricinus communis
ref|XP_009587556.1|  PREDICTED: adenylyl-sulfate kinase 3-like        81.3    1e-15   
ref|XP_009786346.1|  PREDICTED: adenylyl-sulfate kinase 3-like        80.5    3e-15   
ref|XP_006363831.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  80.5    3e-15   
ref|XP_004231928.1|  PREDICTED: adenylyl-sulfate kinase 3             80.5    3e-15   
emb|CBI33692.3|  unnamed protein product                              82.8    3e-15   
ref|XP_002271740.2|  PREDICTED: adenylyl-sulfate kinase 3 isoform X1  79.7    5e-15   Vitis vinifera
ref|XP_010652705.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  79.3    5e-15   
ref|XP_010652709.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  79.0    6e-15   
ref|XP_002284476.2|  PREDICTED: adenylyl-sulfate kinase 3 isoform X1  79.3    6e-15   Vitis vinifera
ref|XP_008440390.1|  PREDICTED: adenylyl-sulfate kinase 3-like        79.0    7e-15   
ref|XP_008237969.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  78.2    1e-14   
ref|XP_008237953.1|  PREDICTED: adenylyl-sulfate kinase 3 isoform X3  78.2    1e-14   
ref|XP_008237945.1|  PREDICTED: adenylyl-sulfate kinase 3 isoform X2  78.2    1e-14   
ref|XP_008237961.1|  PREDICTED: adenylyl-sulfate kinase 3 isoform X4  77.8    2e-14   
gb|KDP32075.1|  hypothetical protein JCGZ_12536                       78.2    2e-14   
ref|XP_008237936.1|  PREDICTED: adenylyl-sulfate kinase 3 isoform X1  78.2    2e-14   
ref|XP_008341131.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  77.4    2e-14   
ref|XP_008341126.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  77.4    2e-14   
ref|XP_006841089.1|  hypothetical protein AMTR_s00086p00044060        77.4    2e-14   
ref|XP_008341113.1|  PREDICTED: adenylyl-sulfate kinase 3 isoform X1  77.4    3e-14   
ref|XP_008465313.1|  PREDICTED: adenylyl-sulfate kinase 3-like        76.6    3e-14   
ref|XP_004141137.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  76.6    3e-14   
ref|XP_004169743.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  77.4    3e-14   
ref|XP_004141865.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  77.0    3e-14   
ref|XP_008341121.1|  PREDICTED: adenylyl-sulfate kinase 3 isoform X3  77.0    3e-14   
ref|XP_009362565.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  76.6    4e-14   
ref|XP_009362564.1|  PREDICTED: adenylyl-sulfate kinase 3-like is...  76.6    4e-14   
ref|XP_009362563.1|  PREDICTED: adenylyl-sulfate kinase 3-like is...  76.6    4e-14   
ref|XP_008338443.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  76.3    4e-14   
ref|XP_009362561.1|  PREDICTED: adenylyl-sulfate kinase 3-like is...  76.6    5e-14   
ref|XP_007201292.1|  hypothetical protein PRUPE_ppa010961mg           76.3    5e-14   
ref|XP_004288250.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  77.0    5e-14   
ref|XP_008338439.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  75.9    5e-14   
ref|XP_011001988.1|  PREDICTED: adenylyl-sulfate kinase 3-like        76.6    6e-14   
ref|XP_007205681.1|  hypothetical protein PRUPE_ppa009621mg           76.3    7e-14   
ref|XP_002313178.2|  hypothetical protein POPTR_0009s09110g           75.9    8e-14   Populus trichocarpa [western balsam poplar]
ref|XP_007030739.1|  Adenosine-5'-phosphosulfate (APS) kinase 3       72.4    1e-13   
ref|XP_010679637.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  75.1    1e-13   
ref|XP_011078782.1|  PREDICTED: adenylyl-sulfate kinase 3             74.7    2e-13   
ref|XP_009375667.1|  PREDICTED: adenylyl-sulfate kinase 3             75.1    2e-13   
ref|XP_008355371.1|  PREDICTED: adenylyl-sulfate kinase 3-like        75.1    2e-13   
emb|CBI22451.3|  unnamed protein product                              74.3    2e-13   
ref|XP_002276818.1|  PREDICTED: adenylyl-sulfate kinase 3             74.3    2e-13   Vitis vinifera
ref|XP_002525424.1|  adenylsulfate kinase, putative                   74.3    2e-13   Ricinus communis
ref|XP_011030338.1|  PREDICTED: adenylyl-sulfate kinase 3-like        74.3    3e-13   
ref|XP_006426123.1|  hypothetical protein CICLE_v10026239mg           74.3    3e-13   
ref|XP_010647917.1|  PREDICTED: adenylyl-sulfate kinase 3-like is...  74.3    3e-13   
ref|XP_007030729.1|  Adenosine-5'-phosphosulfate (APS) kinase 3 i...  73.2    3e-13   
ref|XP_010054581.1|  PREDICTED: adenylyl-sulfate kinase 3-like        73.6    4e-13   
ref|XP_010679636.1|  PREDICTED: adenylyl-sulfate kinase 3 isoform X1  74.3    4e-13   
ref|XP_002265518.1|  PREDICTED: adenylyl-sulfate kinase 3-like is...  74.3    4e-13   Vitis vinifera
ref|XP_004289810.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  73.9    4e-13   
ref|XP_007030728.1|  Adenosine-5'-phosphosulfate (APS) kinase 3 i...  73.2    5e-13   
gb|KDP39700.1|  hypothetical protein JCGZ_02720                       73.2    6e-13   
ref|XP_009599487.1|  PREDICTED: adenylyl-sulfate kinase 3-like        72.8    8e-13   
gb|KCW89869.1|  hypothetical protein EUGRSUZ_A02099                   73.9    8e-13   
ref|XP_009797311.1|  PREDICTED: adenylyl-sulfate kinase 3-like        72.8    8e-13   
ref|XP_010934822.1|  PREDICTED: adenylyl-sulfate kinase 3             72.4    9e-13   
ref|XP_006600139.1|  PREDICTED: uncharacterized protein LOC100500...  72.8    9e-13   
ref|XP_006579946.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  72.8    9e-13   
ref|XP_002465684.1|  hypothetical protein SORBIDRAFT_01g043710        72.8    1e-12   Sorghum bicolor [broomcorn]
ref|XP_006579947.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  72.4    1e-12   
ref|XP_006600140.1|  PREDICTED: uncharacterized protein LOC100500...  72.0    1e-12   
ref|XP_007155832.1|  hypothetical protein PHAVU_003G235300g           72.8    1e-12   
ref|XP_010023311.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  72.0    1e-12   
ref|XP_008658407.1|  PREDICTED: adenylyl-sulfate kinase isoform X4    72.0    1e-12   
gb|ACF82149.1|  unknown                                               72.0    1e-12   Zea mays [maize]
gb|EPS62027.1|  adenylyl-sulfate kinase, chloroplastic                72.0    1e-12   
ref|XP_006579944.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  72.8    2e-12   
ref|XP_006600138.1|  PREDICTED: uncharacterized protein LOC100500...  72.8    2e-12   
ref|NP_001144141.1|  adenylyl-sulfate kinase                          72.0    2e-12   Zea mays [maize]
ref|XP_008658404.1|  PREDICTED: adenylyl-sulfate kinase isoform X3    72.0    2e-12   
ref|XP_010257674.1|  PREDICTED: adenylyl-sulfate kinase 3             71.6    2e-12   
gb|AFW89313.1|  hypothetical protein ZEAMMB73_907084                  71.6    2e-12   
ref|XP_006579943.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  72.4    2e-12   
ref|XP_010070656.1|  PREDICTED: adenylyl-sulfate kinase 3 isoform X1  72.4    2e-12   
ref|XP_008658402.1|  PREDICTED: adenylyl-sulfate kinase isoform X1    72.4    2e-12   
ref|XP_006590296.1|  PREDICTED: uncharacterized protein LOC100786...  71.6    2e-12   
gb|EMS45667.1|  Adenylyl-sulfate kinase 1, chloroplastic              70.9    2e-12   
ref|XP_009613594.1|  PREDICTED: adenylyl-sulfate kinase 3             71.2    3e-12   
ref|XP_006408245.1|  hypothetical protein EUTSA_v10021488mg           71.2    3e-12   
ref|XP_009354618.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  70.9    3e-12   
ref|XP_010111685.1|  Adenylyl-sulfate kinase 1                        72.0    3e-12   
gb|KHF97681.1|  Adenylyl-sulfate kinase, chloroplastic                72.0    3e-12   
ref|NP_187040.1|  adenosine-5'-phosphosulfate (APS) kinase 3          70.9    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009354615.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  70.9    3e-12   
ref|XP_006298545.1|  hypothetical protein CARUB_v10014638mg           70.9    3e-12   
ref|XP_010515733.1|  PREDICTED: adenylyl-sulfate kinase 3             70.9    3e-12   
ref|XP_009354617.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  70.9    3e-12   
ref|XP_008802703.1|  PREDICTED: adenylyl-sulfate kinase 3-like        70.9    4e-12   
gb|KDO78881.1|  hypothetical protein CISIN_1g023675mg                 71.2    4e-12   
ref|XP_006466435.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  71.2    4e-12   
gb|KHN12998.1|  Adenylyl-sulfate kinase, chloroplastic                71.6    4e-12   
ref|NP_001241077.1|  uncharacterized protein LOC100786331             71.6    4e-12   
gb|KHG08681.1|  Adenylyl-sulfate kinase 1, chloroplastic -like pr...  71.2    5e-12   
ref|XP_010236603.1|  PREDICTED: adenylyl-sulfate kinase 3             70.5    5e-12   
ref|XP_006443425.1|  hypothetical protein CICLE_v10022273mg           70.1    6e-12   
ref|XP_006657874.1|  PREDICTED: adenylyl-sulfate kinase 3-like        71.6    6e-12   
ref|XP_007156712.1|  hypothetical protein PHAVU_002G010900g           70.9    8e-12   
ref|XP_010276378.1|  PREDICTED: adenylyl-sulfate kinase 3-like        69.7    9e-12   
gb|AES94540.2|  sulfate adenylyltransferase subunit 1/adenylylsul...  70.5    1e-11   
ref|XP_002319692.2|  hypothetical protein POPTR_0013s05450g           69.7    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_002319694.1|  adenylylsulfate kinase family protein            69.3    1e-11   Populus trichocarpa [western balsam poplar]
dbj|BAJ96620.1|  predicted protein                                    69.7    1e-11   
ref|XP_003608523.1|  Adenylyl-sulfate kinase                          70.5    1e-11   
gb|ACU23241.1|  unknown                                               69.3    1e-11   Glycine max [soybeans]
ref|XP_003554016.1|  PREDICTED: adenylyl-sulfate kinase 3-like is...  69.3    1e-11   
ref|XP_006651143.1|  PREDICTED: adenylyl-sulfate kinase 3-like        69.3    1e-11   
ref|XP_009420648.1|  PREDICTED: adenylyl-sulfate kinase 3-like        68.9    1e-11   
ref|XP_010247330.1|  PREDICTED: adenylyl-sulfate kinase 3-like is...  70.1    2e-11   
ref|XP_010247329.1|  PREDICTED: adenylyl-sulfate kinase 3-like is...  69.7    2e-11   
ref|XP_004985300.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  68.9    2e-11   
ref|XP_007204742.1|  hypothetical protein PRUPE_ppa011498mg           68.6    2e-11   
ref|NP_001237036.1|  uncharacterized protein LOC100500116             68.6    2e-11   
dbj|BAJ92303.1|  predicted protein                                    69.3    2e-11   
ref|XP_010549674.1|  PREDICTED: adenylyl-sulfate kinase 3             68.6    2e-11   
ref|XP_010555367.1|  PREDICTED: adenylyl-sulfate kinase 2, chloro...  69.3    2e-11   
ref|NP_001060064.1|  Os07g0573100                                     70.1    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002460898.1|  hypothetical protein SORBIDRAFT_02g037100        69.7    2e-11   Sorghum bicolor [broomcorn]
ref|XP_004985299.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  68.9    3e-11   
gb|KHN46776.1|  Adenylyl-sulfate kinase 1, chloroplastic              68.2    3e-11   
ref|XP_003548742.1|  PREDICTED: adenylyl-sulfate kinase 3-like is...  68.2    3e-11   
ref|XP_002884417.1|  hypothetical protein ARALYDRAFT_896410           68.2    3e-11   
ref|XP_004493162.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  68.2    3e-11   
ref|XP_007030733.1|  Uncharacterized protein TCM_026474               65.9    3e-11   
tpg|DAA41181.1|  TPA: hypothetical protein ZEAMMB73_656997            67.8    3e-11   
ref|XP_008240467.1|  PREDICTED: adenylyl-sulfate kinase 3             68.2    3e-11   
emb|CDY63896.1|  BnaA01g34620D                                        68.9    3e-11   
ref|XP_009128991.1|  PREDICTED: adenylyl-sulfate kinase 2, chloro...  68.9    3e-11   
ref|NP_001136943.1|  adenylyl-sulfate kinase isoform 1                68.2    3e-11   Zea mays [maize]
ref|XP_004511836.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  69.3    4e-11   
gb|EAZ25960.1|  hypothetical protein OsJ_09815                        68.2    4e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009136250.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  68.6    4e-11   
gb|ACN25636.1|  unknown                                               67.8    4e-11   Zea mays [maize]
ref|XP_008667369.1|  PREDICTED: adenylyl-sulfate kinase isoform 1...  68.2    4e-11   
tpg|DAA41174.1|  TPA: adenylyl-sulfate kinase                         68.2    4e-11   
ref|XP_002532415.1|  adenylsulfate kinase, putative                   68.6    4e-11   Ricinus communis
gb|AFK37560.1|  unknown                                               67.4    5e-11   
emb|CDY37220.1|  BnaA09g08410D                                        68.2    5e-11   
ref|XP_007047526.1|  Adenylyl-sulfate kinase isoform 2                67.4    5e-11   
ref|XP_009123212.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  68.2    5e-11   
ref|XP_010488913.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  68.2    5e-11   
emb|CDX81460.1|  BnaC09g08710D                                        68.2    5e-11   
ref|XP_010517725.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  68.2    5e-11   
gb|EAY88937.1|  hypothetical protein OsI_10422                        68.2    5e-11   Oryza sativa Indica Group [Indian rice]
gb|AFK41167.1|  unknown                                               67.4    5e-11   
ref|XP_010467257.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  68.2    5e-11   
gb|KEH23530.1|  sulfate adenylyltransferase subunit 1/adenylylsul...  67.4    5e-11   
gb|AFK41675.1|  unknown                                               67.4    6e-11   
emb|CDY64897.1|  BnaC05g47640D                                        67.0    6e-11   
ref|XP_009353136.1|  PREDICTED: adenylyl-sulfate kinase 3-like is...  67.0    6e-11   
ref|XP_003558559.1|  PREDICTED: adenylyl-sulfate kinase 3-like        67.8    6e-11   
ref|XP_009763439.1|  PREDICTED: adenylyl-sulfate kinase 3-like        67.0    7e-11   
ref|XP_007047525.1|  Adenosine-5\'-phosphosulfate kinase 3 isoform 1  67.8    7e-11   
ref|XP_009353134.1|  PREDICTED: adenylyl-sulfate kinase 3-like is...  67.0    7e-11   
ref|XP_009109428.1|  PREDICTED: adenylyl-sulfate kinase 2, chloro...  67.4    8e-11   
emb|CDY50861.1|  BnaA05g37220D                                        67.0    8e-11   
emb|CDX90373.1|  BnaA08g16110D                                        67.4    9e-11   
ref|XP_010272582.1|  PREDICTED: adenylyl-sulfate kinase 3-like is...  68.2    9e-11   
ref|XP_008372758.1|  PREDICTED: adenylyl-sulfate kinase 3-like        68.2    9e-11   
ref|XP_003611582.1|  Adenylyl-sulfate kinase                          68.6    1e-10   
ref|XP_006298172.1|  hypothetical protein CARUB_v10014222mg           67.8    1e-10   
gb|KFK39980.1|  hypothetical protein AALP_AA3G314300                  67.0    1e-10   
ref|XP_008787194.1|  PREDICTED: adenylyl-sulfate kinase 3-like        66.6    1e-10   
ref|XP_010530704.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  67.0    1e-10   
emb|CDX69374.1|  BnaC01g00790D                                        67.4    1e-10   
emb|CDP14316.1|  unnamed protein product                              66.2    1e-10   
emb|CDY39470.1|  BnaC03g60800D                                        66.6    1e-10   
ref|XP_007030742.1|  Adenosine-5'-phosphosulfate (APS) kinase 3       66.6    1e-10   
ref|XP_006351363.1|  PREDICTED: adenylyl-sulfate kinase 3-like        66.2    1e-10   
emb|CDX93145.1|  BnaA03g38670D                                        66.6    2e-10   
ref|XP_009394753.1|  PREDICTED: adenylyl-sulfate kinase 3-like        67.0    2e-10   
dbj|BAJ96358.1|  predicted protein                                    66.6    2e-10   
ref|XP_006409637.1|  hypothetical protein EUTSA_v10022805mg           66.6    2e-10   
emb|CDY65440.1|  BnaCnng47170D                                        66.6    2e-10   
ref|XP_010938967.1|  PREDICTED: adenylyl-sulfate kinase 3 isoform X1  66.6    2e-10   
ref|XP_004249302.1|  PREDICTED: adenylyl-sulfate kinase 3-like        65.9    2e-10   
ref|XP_010938968.1|  PREDICTED: adenylyl-sulfate kinase 3 isoform X2  65.9    2e-10   
ref|XP_009362562.1|  PREDICTED: adenylyl-sulfate kinase 3-like is...  66.6    2e-10   
ref|XP_008341116.1|  PREDICTED: adenylyl-sulfate kinase 3 isoform X2  66.2    2e-10   
ref|XP_010942792.1|  PREDICTED: adenylyl-sulfate kinase 3-like is...  65.9    2e-10   
gb|EYU20667.1|  hypothetical protein MIMGU_mgv1a013619mg              65.5    3e-10   
gb|ABR17904.1|  unknown                                               67.0    3e-10   Picea sitchensis
ref|XP_009396045.1|  PREDICTED: adenylyl-sulfate kinase 3-like        66.2    3e-10   
ref|XP_009412960.1|  PREDICTED: adenylyl-sulfate kinase 3-like        65.1    3e-10   
ref|XP_010942790.1|  PREDICTED: adenylyl-sulfate kinase 3-like is...  65.9    4e-10   
gb|AGN12804.1|  adenylyl-sulfate kinase 2                             65.9    5e-10   
ref|XP_009130398.1|  PREDICTED: adenylyl-sulfate kinase 3             64.3    5e-10   
emb|CDY08724.1|  BnaA06g25000D                                        65.5    6e-10   
ref|XP_010431974.1|  PREDICTED: adenylyl-sulfate kinase 2, chloro...  65.5    6e-10   
ref|XP_002883855.1|  hypothetical protein ARALYDRAFT_480365           65.1    6e-10   
gb|AAF17236.1|AF178976_1  adenosine-5'-phosphosulfate kinase          65.5    6e-10   Zea mays [maize]
gb|AGN12786.1|  adenylyl-sulfate kinase 2                             65.1    8e-10   
pdb|3UIE|A  Chain A, Crystal Structure Of Adenosine 5'-Phosphosul...  63.5    1e-09   
ref|XP_008386819.1|  PREDICTED: adenylyl-sulfate kinase 3-like        63.5    1e-09   
ref|XP_009366451.1|  PREDICTED: adenylyl-sulfate kinase 3-like        63.5    1e-09   
gb|ACG47301.1|  adenylyl-sulfate kinase                               65.1    1e-09   Zea mays [maize]
tpg|DAA63253.1|  TPA: adenylyl-sulfate kinase                         65.1    1e-09   
ref|XP_010672046.1|  PREDICTED: adenylyl-sulfate kinase 3             63.5    1e-09   
ref|XP_006573663.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  62.4    1e-09   
ref|XP_008391689.1|  PREDICTED: adenylyl-sulfate kinase 3 isoform X2  63.2    1e-09   
ref|XP_008391688.1|  PREDICTED: adenylyl-sulfate kinase 3 isoform X1  63.2    2e-09   
ref|NP_179082.1|  Adenylyl-sulfate kinase 1                           63.9    2e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62496.1|  putative adenosine phosphosulfate kinase              63.9    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003575801.1|  PREDICTED: adenylyl-sulfate kinase 3-like        63.9    2e-09   
gb|AFW89308.1|  hypothetical protein ZEAMMB73_907084                  63.5    2e-09   
ref|XP_009150696.1|  PREDICTED: adenylyl-sulfate kinase 4, chloro...  63.5    2e-09   
ref|XP_006411795.1|  hypothetical protein EUTSA_v10025861mg           63.9    2e-09   
ref|XP_010547945.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  63.5    3e-09   
ref|XP_008454396.1|  PREDICTED: adenylyl-sulfate kinase 3             63.5    3e-09   
ref|XP_009138548.1|  PREDICTED: adenylyl-sulfate kinase 2, chloro...  63.2    4e-09   
emb|CDY31612.1|  BnaA03g54400D                                        63.2    4e-09   
ref|XP_006285007.1|  hypothetical protein CARUB_v10006314mg           63.2    4e-09   
ref|XP_007161945.1|  hypothetical protein PHAVU_001G111000g           62.0    4e-09   
emb|CDY63923.1|  BnaC07g51290D                                        63.2    4e-09   
ref|XP_004152280.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  63.2    4e-09   
ref|XP_007161946.1|  hypothetical protein PHAVU_001G111000g           62.0    5e-09   
ref|XP_004156864.1|  PREDICTED: LOW QUALITY PROTEIN: adenylyl-sul...  62.8    5e-09   
ref|XP_004979791.1|  PREDICTED: adenylyl-sulfate kinase, chloropl...  62.8    6e-09   
ref|NP_195704.1|  adenosine-5'-phosphosulfate-kinase 2                62.4    8e-09   Arabidopsis thaliana [mouse-ear cress]
gb|ACG40162.1|  adenylyl-sulfate kinase 1                             62.0    9e-09   Zea mays [maize]
gb|ABR16196.1|  unknown                                               62.4    1e-08   Picea sitchensis
ref|XP_002992810.1|  hypothetical protein SELMODRAFT_136031           60.8    1e-08   
ref|NP_001131924.1|  uncharacterized protein LOC100193315             61.6    1e-08   Zea mays [maize]
ref|XP_002449895.1|  hypothetical protein SORBIDRAFT_05g025240        62.0    1e-08   Sorghum bicolor [broomcorn]
gb|KFK30569.1|  hypothetical protein AALP_AA7G278900                  62.0    1e-08   
gb|AFW60291.1|  adenylyl-sulfate kinase                               61.6    1e-08   
ref|XP_002987503.1|  hypothetical protein SELMODRAFT_126226           60.8    1e-08   
ref|XP_004958103.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  62.0    1e-08   
emb|CDY36498.1|  BnaC03g48570D                                        60.8    2e-08   
ref|XP_006663615.1|  PREDICTED: adenylyl-sulfate kinase 3-like        61.2    2e-08   
gb|KHN36300.1|  BTB/POZ domain-containing protein                     61.6    3e-08   
ref|XP_008808841.1|  PREDICTED: adenylyl-sulfate kinase 3-like        60.5    3e-08   
ref|XP_010437119.1|  PREDICTED: adenylyl-sulfate kinase 2, chloro...  60.5    3e-08   
gb|EMS64302.1|  Adenylyl-sulfate kinase, chloroplastic                60.5    3e-08   
ref|XP_010550306.1|  PREDICTED: adenylyl-sulfate kinase 4, chloro...  60.1    4e-08   
ref|XP_010102764.1|  Adenylyl-sulfate kinase                          59.7    6e-08   
ref|XP_010550304.1|  PREDICTED: adenylyl-sulfate kinase 3 isoform X1  60.5    6e-08   
ref|XP_002866895.1|  aps-kinase 2                                     59.7    7e-08   
ref|XP_005842851.1|  hypothetical protein CHLNCDRAFT_33366            58.5    1e-07   
ref|WP_028457974.1|  adenylyltransferase                              59.7    1e-07   
ref|XP_001419808.1|  predicted protein                                57.8    1e-07   Ostreococcus lucimarinus CCE9901
ref|WP_015940311.1|  adenylylsulfate kinase                           59.3    2e-07   
gb|KFK28437.1|  hypothetical protein AALP_AA8G514500                  58.5    2e-07   
ref|WP_031458482.1|  adenylyltransferase                              59.3    2e-07   
gb|ABA94897.1|  Adenylyl-sulfate kinase, chloroplast precursor, p...  58.2    2e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EMT14112.1|  Adenylyl-sulfate kinase, chloroplastic                57.8    4e-07   
ref|XP_001695959.1|  adenosine 5'-phosphosulfate kinase               56.6    6e-07   Chlamydomonas reinhardtii
ref|WP_012257979.1|  MULTISPECIES: adenylylsulfate kinase             57.8    6e-07   
ref|WP_013630895.1|  adenylylsulfate kinase                           55.5    7e-07   
ref|XP_006393959.1|  hypothetical protein EUTSA_v10004693mg           56.2    1e-06   
emb|CEF99122.1|  Adenylylsulphate kinase                              55.5    1e-06   
ref|XP_003081290.1|  putative adenosine-5'-phosphosulfate kinase ...  55.8    1e-06   
ref|XP_003054784.1|  predicted protein                                55.8    1e-06   
gb|EMS46047.1|  Adenylyl-sulfate kinase 2, chloroplastic              54.7    1e-06   
ref|XP_005650798.1|  hypothetical protein COCSUDRAFT_32119            55.5    1e-06   
dbj|BAF46286.1|  adenylylsulfate kinase, chloroplast                  55.1    2e-06   Chlamydomonas reinhardtii
ref|XP_006280894.1|  hypothetical protein CARUB_v10026887mg           55.1    3e-06   
ref|XP_001761563.1|  predicted protein                                53.9    3e-06   
gb|EEC82306.1|  hypothetical protein OsI_26565                        55.1    4e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_002507043.1|  adenylyl-sulfate kinase chloroplast precursor    54.3    5e-06   Micromonas commoda
ref|XP_010484486.1|  PREDICTED: adenylyl-sulfate kinase 4, chloro...  53.9    5e-06   
ref|XP_010444636.1|  PREDICTED: adenylyl-sulfate kinase 4, chloro...  53.9    7e-06   
ref|XP_010484485.1|  PREDICTED: adenylyl-sulfate kinase 4, chloro...  53.9    7e-06   
ref|XP_010463950.1|  PREDICTED: adenylyl-sulfate kinase 4, chloro...  53.9    7e-06   
ref|XP_002976147.1|  hypothetical protein SELMODRAFT_104624           52.8    8e-06   
ref|XP_001755205.1|  predicted protein                                52.8    1e-05   
gb|AGW24432.1|  adenylyl-sulfate kinase                               50.1    1e-05   
ref|XP_002866700.1|  hypothetical protein ARALYDRAFT_496843           53.1    1e-05   
ref|WP_024460052.1|  adenylyltransferase                              53.1    2e-05   
gb|EXJ14526.1|  Adenylylsulfate kinase                                51.6    2e-05   
gb|KDD76745.1|  adenylylsulfate kinase                                50.4    3e-05   
ref|WP_012514609.1|  adenylylsulfate kinase                           52.4    3e-05   
ref|WP_035619442.1|  adenylyltransferase                              52.4    3e-05   
ref|XP_007510755.1|  adenylylsulfate kinase                           51.6    4e-05   
ref|WP_009107601.1|  adenylylsulfate kinase                           52.4    4e-05   
emb|CEL17959.1|  Sulfate adenylyltransferase subunit 1                51.2    8e-05   
ref|XP_002968232.1|  hypothetical protein SELMODRAFT_89939            50.1    9e-05   
ref|WP_035539415.1|  adenylyltransferase                              51.2    1e-04   
ref|WP_007041985.1|  adenylylsulfate kinase                           50.1    1e-04   
ref|WP_031386088.1|  adenylyltransferase                              50.4    1e-04   
dbj|BAB08460.1|  adenylylsulfate kinase-like protein                  49.7    2e-04   
ref|WP_014433153.1|  adenylylsulfate kinase                           50.4    2e-04   
ref|WP_035984850.1|  adenylylsulfate kinase                           48.9    2e-04   
gb|KHK00653.1|  Sulfate adenylyltransferase                           50.1    2e-04   
ref|WP_029698777.1|  adenylylsulfate kinase                           46.2    2e-04   
ref|XP_005843476.1|  hypothetical protein CHLNCDRAFT_55206            49.7    2e-04   
ref|WP_026085943.1|  adenylylsulfate kinase                           48.5    2e-04   
ref|WP_011958040.1|  adenylylsulfate kinase                           49.7    2e-04   
ref|XP_002960265.1|  hypothetical protein SELMODRAFT_74623            48.9    3e-04   
emb|CDX81311.1|  BnaC09g07220D                                        48.5    3e-04   
ref|WP_027331210.1|  adenylyltransferase                              49.3    3e-04   
gb|AAC26856.1|  5'-adenylylsulfate kinase                             48.9    4e-04   
ref|WP_018085572.1|  hypothetical protein                             48.1    4e-04   
ref|WP_029520542.1|  adenylylsulfate kinase                           48.1    4e-04   
ref|WP_036784166.1|  adenylylsulfate kinase                           47.8    5e-04   
ref|XP_010490236.1|  PREDICTED: adenylyl-sulfate kinase 1, chloro...  47.0    5e-04   
ref|XP_005843477.1|  hypothetical protein CHLNCDRAFT_141154           48.5    5e-04   
ref|NP_569050.1|  adenosine-5'-phosphosulfate kinase 4                48.1    6e-04   
dbj|BAN39620.1|  sulfate adenylyltransferase, putative                48.5    6e-04   
ref|WP_009180705.1|  adenylylsulfate kinase                           48.5    6e-04   
ref|XP_656278.1|  sulfate adenylyltransferase                         48.5    6e-04   
ref|XP_008860638.1|  adenylylsulfate kinase domain containing pro...  48.5    7e-04   
gb|AAM61589.1|  adenylylsulfate kinase-like protein                   48.1    7e-04   
ref|XP_001736178.1|  adenylyl-sulfate kinase                          48.5    7e-04   
ref|WP_012122755.1|  adenylylsulfate kinase                           48.5    7e-04   
ref|XP_009156468.1|  adenylyl-sulfate kinase                          47.8    7e-04   
ref|XP_008721129.1|  adenylyl-sulfate kinase                          47.4    9e-04   
ref|WP_034790958.1|  adenylyltransferase                              48.1    0.001   
ref|WP_026940844.1|  adenylyltransferase                              48.1    0.001   
ref|WP_024823284.1|  adenylyltransferase                              47.8    0.001   



>emb|CDP02602.1| unnamed protein product [Coffea canephora]
Length=319

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPPLNSEIVLHQ  G C SP DLA+ VISYLE+KGYLE
Sbjct  270  IKGFTGIDDPYEPPLNSEIVLHQKVGLCDSPHDLAETVISYLEEKGYLE  318



>ref|XP_006364411.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic-like isoform 
X1 [Solanum tuberosum]
Length=207

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPL SEIVL Q++G C SP DLA IVISYL+ KGYL+A
Sbjct  158  IKGFTGVDDPYEPPLTSEIVLRQNQGICDSPNDLADIVISYLDKKGYLKA  207



>ref|XP_004233459.1| PREDICTED: adenylyl-sulfate kinase 3-like [Solanum lycopersicum]
Length=319

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPL SEIVL Q++G C SP DLA IVISYL+ KGYL+A
Sbjct  270  IKGFTGVDDPYEPPLTSEIVLRQNQGLCDSPNDLADIVISYLDKKGYLKA  319



>ref|XP_006364412.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic-like isoform 
X2 [Solanum tuberosum]
Length=314

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPL SEIVL Q++G C SP DLA IVISYL+ KGYL+A
Sbjct  265  IKGFTGVDDPYEPPLTSEIVLRQNQGICDSPNDLADIVISYLDKKGYLKA  314



>sp|O49204.1|KAPS_CATRO RecName: Full=Adenylyl-sulfate kinase, chloroplastic; AltName: 
Full=ATP adenosine-5'-phosphosulfate 3'-phosphotransferase; 
AltName: Full=Adenosine-5'-phosphosulfate kinase; Short=APS 
kinase; Flags: Precursor [Catharanthus roseus]
 gb|AAC31145.1| adenosine-5'-phosphosulfate-kinase [Catharanthus roseus]
Length=312

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPL SEIVLHQ  G C SP DLA IVISYLE+ GYL+A
Sbjct  263  IKGFTGIDDPYEPPLKSEIVLHQKLGMCDSPCDLADIVISYLEENGYLKA  312



>ref|XP_009609820.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic [Nicotiana 
tomentosiformis]
Length=169

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPL SEIVL Q++G C SP DLA +VISYL+  GYL+A
Sbjct  120  IKGFTGIDDPYEPPLKSEIVLRQNQGLCDSPNDLADVVISYLDKNGYLKA  169



>ref|XP_011073686.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X2 [Sesamum 
indicum]
Length=301

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPLN EIVLHQ EG C SP  LA+ VISYLE  GYLEA
Sbjct  252  IKGFTGVDDPYEPPLNCEIVLHQREGVCDSPTVLAEKVISYLERNGYLEA  301



>ref|XP_011073685.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X1 [Sesamum 
indicum]
Length=316

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPLN EIVLHQ EG C SP  LA+ VISYLE  GYLEA
Sbjct  267  IKGFTGVDDPYEPPLNCEIVLHQREGVCDSPTVLAEKVISYLERNGYLEA  316



>ref|XP_011099374.1| PREDICTED: adenylyl-sulfate kinase 3-like [Sesamum indicum]
Length=290

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPLNSEIVL Q E  C SP  LA+IVISYLE KGYLEA
Sbjct  241  IKGFTGVDDPYEPPLNSEIVLCQREKTCDSPNALAEIVISYLERKGYLEA  290



>gb|EYU29625.1| hypothetical protein MIMGU_mgv1a010612mg [Erythranthe guttata]
Length=307

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPLN EIVLHQSE  C SP  LA+ V+SYL+ KGYLEA
Sbjct  258  IKGFTGVDDPYEPPLNCEIVLHQSEETCDSPAVLAEKVVSYLQKKGYLEA  307



>ref|XP_008236312.1| PREDICTED: adenylyl-sulfate kinase 3 [Prunus mume]
Length=290

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EIVL   EG C+SP ++A+ VISYLEDKG+LEA
Sbjct  241  IKGFTGIDDPYEPPLNCEIVLTHEEGVCASPCEMAEEVISYLEDKGFLEA  290



>ref|XP_009788046.1| PREDICTED: adenylyl-sulfate kinase 3-like [Nicotiana sylvestris]
Length=364

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPL SEIVL Q++G C SP DLA +VISYL+  GYL+A
Sbjct  315  IKGFTGIDDPYEPPLKSEIVLRQNQGLCDSPNDLADVVISYLDKNGYLKA  364



>ref|XP_002525273.1| adenylsulfate kinase, putative [Ricinus communis]
 gb|EEF37101.1| adenylsulfate kinase, putative [Ricinus communis]
Length=281

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EIVL Q   +C+SP D+A+ VISYLE+KGYL A
Sbjct  232  IKGFTGIDDPYEPPLNCEIVLEQKGDYCASPCDMAETVISYLEEKGYLRA  281



>ref|XP_009587556.1| PREDICTED: adenylyl-sulfate kinase 3-like [Nicotiana tomentosiformis]
Length=316

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPL SEIVLHQ+ G   SP DLA  VISYL++KGYL+A
Sbjct  267  IKGFTGIDDPYEPPLKSEIVLHQNRGLFDSPNDLADTVISYLDEKGYLKA  316



>ref|XP_009786346.1| PREDICTED: adenylyl-sulfate kinase 3-like [Nicotiana sylvestris]
Length=319

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPL SEIVLHQ+ G   SP DLA  VISY+++KGYL+A
Sbjct  270  IKGFTGIDDPYEPPLKSEIVLHQNRGLFDSPNDLADTVISYMDEKGYLKA  319



>ref|XP_006363831.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic-like [Solanum 
tuberosum]
Length=308

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPL SEIVL Q++G C SP D A +VISYL+  GYL+A
Sbjct  259  IKGFTGIDDPYEPPLKSEIVLRQNQGLCDSPDDFADVVISYLDKNGYLKA  308



>ref|XP_004231928.1| PREDICTED: adenylyl-sulfate kinase 3 [Solanum lycopersicum]
Length=308

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPL +EIVL Q++G C SP D A +VISYL+  GYL+A
Sbjct  259  IKGFTGIDDPYEPPLKAEIVLRQNQGLCDSPNDFADVVISYLDRNGYLKA  308



>emb|CBI33692.3| unnamed protein product [Vitis vinifera]
Length=684

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            I+GFTGIDDPYEPPLN E+VL Q+ G  +SP D+AK VISYLE+KGYL+A
Sbjct  635  IRGFTGIDDPYEPPLNCEVVLQQTGGDYNSPSDMAKTVISYLEEKGYLKA  684



>ref|XP_002271740.2| PREDICTED: adenylyl-sulfate kinase 3 isoform X1 [Vitis vinifera]
 emb|CBI33684.3| unnamed protein product [Vitis vinifera]
Length=274

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            I+GFTGIDDPYEPPLN E+VL Q+ G  +SP D+AK VISYLE+KGYL+A
Sbjct  225  IRGFTGIDDPYEPPLNCEVVLQQTGGDYASPSDMAKTVISYLEEKGYLKA  274



>ref|XP_010652705.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic isoform X2 
[Vitis vinifera]
Length=224

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            I+GFTGIDDPYEPPLN E+VL Q+ G  +SP D+AK VISYLE+KGYL+A
Sbjct  175  IRGFTGIDDPYEPPLNCEVVLQQTGGDYASPSDMAKTVISYLEEKGYLKA  224



>ref|XP_010652709.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic isoform X3 
[Vitis vinifera]
Length=224

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            I+GFTGIDDPYEPPLN E+VL Q+ G  +SP D+AK VISYLE+KGYL+A
Sbjct  175  IRGFTGIDDPYEPPLNCEVVLQQTGGDYNSPSDMAKTVISYLEEKGYLKA  224



>ref|XP_002284476.2| PREDICTED: adenylyl-sulfate kinase 3 isoform X1 [Vitis vinifera]
Length=274

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            I+GFTGIDDPYEPPLN E+VL Q+ G  +SP D+AK VISYLE+KGYL+A
Sbjct  225  IRGFTGIDDPYEPPLNCEVVLQQTGGDYNSPSDMAKTVISYLEEKGYLKA  274



>ref|XP_008440390.1| PREDICTED: adenylyl-sulfate kinase 3-like [Cucumis melo]
Length=286

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            I+GFTGIDDPYE PLNSEIVL   EG CSSP D+A+ VISYLE++G+L+A
Sbjct  237  IQGFTGIDDPYEEPLNSEIVLQYKEGICSSPNDMAERVISYLEERGHLQA  286



>ref|XP_008237969.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic isoform X5 
[Prunus mume]
 ref|XP_008237977.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic isoform X5 
[Prunus mume]
Length=207

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPLN EIVL Q    C+ PG++A+ VISYLE+KGYL+A
Sbjct  158  IKGFTGVDDPYEPPLNCEIVLQQKGRDCAPPGEMAETVISYLEEKGYLQA  207



>ref|XP_008237953.1| PREDICTED: adenylyl-sulfate kinase 3 isoform X3 [Prunus mume]
Length=258

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPLN EIVL Q    C+ PG++A+ VISYLE+KGYL+A
Sbjct  209  IKGFTGVDDPYEPPLNCEIVLQQKGRDCAPPGEMAETVISYLEEKGYLQA  258



>ref|XP_008237945.1| PREDICTED: adenylyl-sulfate kinase 3 isoform X2 [Prunus mume]
Length=284

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPLN EIVL Q    C+ PG++A+ VISYLE+KGYL+A
Sbjct  235  IKGFTGVDDPYEPPLNCEIVLQQKGRDCAPPGEMAETVISYLEEKGYLQA  284



>ref|XP_008237961.1| PREDICTED: adenylyl-sulfate kinase 3 isoform X4 [Prunus mume]
Length=252

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPLN EIVL Q    C+ PG++A+ VISYLE+KGYL+A
Sbjct  203  IKGFTGVDDPYEPPLNCEIVLQQKGRDCAPPGEMAETVISYLEEKGYLQA  252



>gb|KDP32075.1| hypothetical protein JCGZ_12536 [Jatropha curcas]
Length=294

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN E+ L Q    C SP ++A+ VISYLEDKGYLEA
Sbjct  245  IKGFTGIDDPYEPPLNCEVTLTQKGNNCVSPCEMAETVISYLEDKGYLEA  294



>ref|XP_008237936.1| PREDICTED: adenylyl-sulfate kinase 3 isoform X1 [Prunus mume]
Length=286

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPLN EIVL Q    C+ PG++A+ VISYLE+KGYL+A
Sbjct  237  IKGFTGVDDPYEPPLNCEIVLQQKGRDCAPPGEMAETVISYLEEKGYLQA  286



>ref|XP_008341131.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic isoform X5 
[Malus domestica]
 ref|XP_008341137.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic isoform X5 
[Malus domestica]
 ref|XP_008341144.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic isoform X5 
[Malus domestica]
 ref|XP_008341151.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic isoform X5 
[Malus domestica]
 ref|XP_008341157.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic isoform X5 
[Malus domestica]
 ref|XP_008341161.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic isoform X5 
[Malus domestica]
 ref|XP_008341167.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic isoform X5 
[Malus domestica]
Length=207

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IK FTG+DDPYEPPL  EIVL Q  G C SPG++A+ VISYLE+KGYL+A
Sbjct  158  IKSFTGVDDPYEPPLKCEIVLQQKGGDCVSPGEMAETVISYLEEKGYLQA  207



>ref|XP_008341126.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic isoform X4 
[Malus domestica]
Length=214

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IK FTG+DDPYEPPL  EIVL Q  G C SPG++A+ VISYLE+KGYL+A
Sbjct  165  IKSFTGVDDPYEPPLKCEIVLQQKGGDCVSPGEMAETVISYLEEKGYLQA  214



>ref|XP_006841089.1| hypothetical protein AMTR_s00086p00044060 [Amborella trichopoda]
 gb|ERN02764.1| hypothetical protein AMTR_s00086p00044060 [Amborella trichopoda]
Length=238

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP+N EIV+ Q +G CSSP  +A+ V++YLED G+L+A
Sbjct  189  IKGFTGIDDPYEPPVNCEIVVEQKDGVCSSPTAMAEQVVAYLEDNGFLQA  238



>ref|XP_008341113.1| PREDICTED: adenylyl-sulfate kinase 3 isoform X1 [Malus domestica]
Length=286

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IK FTG+DDPYEPPL  EIVL Q  G C SPG++A+ VISYLE+KGYL+A
Sbjct  237  IKSFTGVDDPYEPPLKCEIVLQQKGGDCVSPGEMAETVISYLEEKGYLQA  286



>ref|XP_008465313.1| PREDICTED: adenylyl-sulfate kinase 3-like [Cucumis melo]
 ref|XP_008465314.1| PREDICTED: adenylyl-sulfate kinase 3-like [Cucumis melo]
 ref|XP_008465315.1| PREDICTED: adenylyl-sulfate kinase 3-like [Cucumis melo]
 ref|XP_008465316.1| PREDICTED: adenylyl-sulfate kinase 3-like [Cucumis melo]
 ref|XP_008465317.1| PREDICTED: adenylyl-sulfate kinase 3-like [Cucumis melo]
Length=207

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L Q++G C +P D+AK ++++LE+KG+L+A
Sbjct  158  IKGFTGIDDPYEPPLNCEIELRQNDGVCPTPCDMAKQIVTFLEEKGFLQA  207



>ref|XP_004141137.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004164837.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like [Cucumis 
sativus]
 gb|KGN59756.1| hypothetical protein Csa_3G843750 [Cucumis sativus]
Length=207

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L Q++G C +P D+AK ++++LE+KG+L+A
Sbjct  158  IKGFTGIDDPYEPPLNCEIELRQNDGVCPTPCDMAKQIVTFLEEKGFLQA  207



>ref|XP_004169743.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic-like [Cucumis 
sativus]
Length=286

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            I+GFTGIDDPYE PLNSEIVL   EG CSSP D+A+ VISYLE++G+L+ 
Sbjct  237  IQGFTGIDDPYEEPLNSEIVLQYKEGICSSPNDMAERVISYLEERGHLQT  286



>ref|XP_004141865.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN48610.1| hypothetical protein Csa_6G495640 [Cucumis sativus]
Length=286

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            I+GFTGIDDPYE PLNSEIVL   EG CSSP D+A+ VISYLE++G+L+ 
Sbjct  237  IQGFTGIDDPYEEPLNSEIVLQYKEGICSSPNDMAERVISYLEERGHLQT  286



>ref|XP_008341121.1| PREDICTED: adenylyl-sulfate kinase 3 isoform X3 [Malus domestica]
Length=271

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IK FTG+DDPYEPPL  EIVL Q  G C SPG++A+ VISYLE+KGYL+A
Sbjct  222  IKSFTGVDDPYEPPLKCEIVLQQKGGDCVSPGEMAETVISYLEEKGYLQA  271



>ref|XP_009362565.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like isoform 
X5 [Pyrus x bretschneideri]
 ref|XP_009362566.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like isoform 
X5 [Pyrus x bretschneideri]
 ref|XP_009362567.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like isoform 
X5 [Pyrus x bretschneideri]
 ref|XP_009362568.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like isoform 
X5 [Pyrus x bretschneideri]
 ref|XP_009362569.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like isoform 
X5 [Pyrus x bretschneideri]
 ref|XP_009362570.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like isoform 
X5 [Pyrus x bretschneideri]
 ref|XP_009362572.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like isoform 
X5 [Pyrus x bretschneideri]
Length=207

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IK FTG+DDPYEPPL  E+VL Q  G C SPG++A+ VISYLE+KGYL+A
Sbjct  158  IKSFTGVDDPYEPPLKCEMVLQQKGGDCVSPGEMAETVISYLEEKGYLQA  207



>ref|XP_009362564.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X4 [Pyrus x 
bretschneideri]
Length=237

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IK FTG+DDPYEPPL  E+VL Q  G C SPG++A+ VISYLE+KGYL+A
Sbjct  188  IKSFTGVDDPYEPPLKCEMVLQQKGGDCVSPGEMAETVISYLEEKGYLQA  237



>ref|XP_009362563.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X3 [Pyrus x 
bretschneideri]
Length=241

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IK FTG+DDPYEPPL  E+VL Q  G C SPG++A+ VISYLE+KGYL+A
Sbjct  192  IKSFTGVDDPYEPPLKCEMVLQQKGGDCVSPGEMAETVISYLEEKGYLQA  241



>ref|XP_008338443.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic-like isoform 
X2 [Malus domestica]
 ref|XP_008338444.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic-like isoform 
X2 [Malus domestica]
Length=192

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPL  EIVL Q    C +PG++A+ VISYLE+KGYL+A
Sbjct  143  IKGFTGVDDPYEPPLKCEIVLQQKGTDCVTPGEMAETVISYLEEKGYLQA  192



>ref|XP_009362561.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X1 [Pyrus x 
bretschneideri]
Length=286

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IK FTG+DDPYEPPL  E+VL Q  G C SPG++A+ VISYLE+KGYL+A
Sbjct  237  IKSFTGVDDPYEPPLKCEMVLQQKGGDCVSPGEMAETVISYLEEKGYLQA  286



>ref|XP_007201292.1| hypothetical protein PRUPE_ppa010961mg [Prunus persica]
 gb|EMJ02491.1| hypothetical protein PRUPE_ppa010961mg [Prunus persica]
Length=229

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EIVL      C+SP ++A+ VISYLEDKG+LEA
Sbjct  180  IKGFTGIDDPYEPPLNCEIVLTHEGEVCASPCEMAEEVISYLEDKGFLEA  229



>ref|XP_004288250.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=319

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPLN EIVL Q    C SP  +A+ VISYLE+KGYL+A
Sbjct  270  IKGFTGVDDPYEPPLNCEIVLQQKGRDCVSPSSMAETVISYLEEKGYLQA  319



>ref|XP_008338439.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like isoform 
X1 [Malus domestica]
 ref|XP_008338440.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like isoform 
X1 [Malus domestica]
 ref|XP_008338441.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like isoform 
X1 [Malus domestica]
Length=207

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPL  EIVL Q    C +PG++A+ VISYLE+KGYL+A
Sbjct  158  IKGFTGVDDPYEPPLKCEIVLQQKGTDCVTPGEMAETVISYLEEKGYLQA  207



>ref|XP_011001988.1| PREDICTED: adenylyl-sulfate kinase 3-like [Populus euphratica]
 ref|XP_011013783.1| PREDICTED: adenylyl-sulfate kinase 3-like [Populus euphratica]
Length=281

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPL++EIVL  + G CS+P D+A+ VISYLE KGYL+A
Sbjct  232  IKGFTGIDDPYEPPLDAEIVLQCNTGDCSTPCDMAEKVISYLEVKGYLQA  281



>ref|XP_007205681.1| hypothetical protein PRUPE_ppa009621mg [Prunus persica]
 gb|EMJ06880.1| hypothetical protein PRUPE_ppa009621mg [Prunus persica]
Length=284

 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPLN EIVL Q    C  PG++A+ VI+YLE+KGYL+A
Sbjct  235  IKGFTGVDDPYEPPLNCEIVLQQKGRDCVPPGEMAETVIAYLEEKGYLQA  284



>ref|XP_002313178.2| hypothetical protein POPTR_0009s09110g [Populus trichocarpa]
 gb|EEE87133.2| hypothetical protein POPTR_0009s09110g [Populus trichocarpa]
Length=281

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPL++EIVL  + G CS+P D+A+ VISYLE KGYL+A
Sbjct  232  IKGFTGVDDPYEPPLDAEIVLQCNTGDCSTPCDMAEKVISYLEVKGYLQA  281



>ref|XP_007030739.1| Adenosine-5'-phosphosulfate (APS) kinase 3 [Theobroma cacao]
 gb|EOY11241.1| Adenosine-5'-phosphosulfate (APS) kinase 3 [Theobroma cacao]
Length=75

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPPLN EI + Q +G C +PG +A  V+SYLE+KGYL 
Sbjct  25   IKGFTGIDDPYEPPLNCEIEIQQKDGDCPTPGAMAGEVVSYLEEKGYLR  73



>ref|XP_010679637.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic isoform X2 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010679638.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=207

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYE PLN EIVL Q    C+SP ++A+IV+SYLE+ GYL+A
Sbjct  158  IKGFTGVDDPYERPLNCEIVLQQKPDTCTSPCEMAEIVVSYLEEHGYLQA  207



>ref|XP_011078782.1| PREDICTED: adenylyl-sulfate kinase 3 [Sesamum indicum]
 ref|XP_011078783.1| PREDICTED: adenylyl-sulfate kinase 3 [Sesamum indicum]
 ref|XP_011078784.1| PREDICTED: adenylyl-sulfate kinase 3 [Sesamum indicum]
Length=206

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYE PLN EI + Q +G C +P ++A  V+SYLEDKGYLEA
Sbjct  157  IKGFTGIDDPYETPLNCEIEIRQEDGNCPTPNEMAGQVVSYLEDKGYLEA  206



>ref|XP_009375667.1| PREDICTED: adenylyl-sulfate kinase 3 [Pyrus x bretschneideri]
Length=290

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EIVL    G C SP ++A+ V+SYLED+G+L+A
Sbjct  241  IKGFTGIDDPYEPPLNCEIVLTHKGGACPSPCEMAEEVVSYLEDQGFLQA  290



>ref|XP_008355371.1| PREDICTED: adenylyl-sulfate kinase 3-like [Malus domestica]
Length=290

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EIVL    G C SP ++A+ V+SYLED+G+L+A
Sbjct  241  IKGFTGIDDPYEPPLNCEIVLTHKGGACPSPCEMAEEVVSYLEDQGFLQA  290



>emb|CBI22451.3| unnamed protein product [Vitis vinifera]
Length=246

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            I+GFTGI DPYEPPLN EIVL  SE  C+SP D+A+ VI YLE+ GYL+A
Sbjct  197  IQGFTGIHDPYEPPLNCEIVLKHSEEVCTSPRDMAEKVIHYLEENGYLQA  246



>ref|XP_002276818.1| PREDICTED: adenylyl-sulfate kinase 3 [Vitis vinifera]
 emb|CBI29945.3| unnamed protein product [Vitis vinifera]
Length=207

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPPLN EI + Q +G C SP D+A  V++YLE+KG+L+
Sbjct  158  IKGFTGIDDPYEPPLNCEIEIQQKDGVCPSPNDMAGDVVTYLEEKGFLQ  206



>ref|XP_002525424.1| adenylsulfate kinase, putative [Ricinus communis]
 gb|EEF36914.1| adenylsulfate kinase, putative [Ricinus communis]
Length=207

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYEPPLN EI L + +G C +PG +A  V+SYLEDKG+L
Sbjct  158  IKGFTGIDDPYEPPLNCEIELEEKDGVCPTPGAMAGQVVSYLEDKGFL  205



>ref|XP_011030338.1| PREDICTED: adenylyl-sulfate kinase 3-like [Populus euphratica]
 ref|XP_011015121.1| PREDICTED: adenylyl-sulfate kinase 3-like [Populus euphratica]
Length=280

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYE PL++EIVL  + G CS+P D+A  VISYLE+KGYL+A
Sbjct  231  IKGFTGIDDPYESPLDAEIVLRCNTGDCSTPSDMAGEVISYLEEKGYLQA  280



>ref|XP_006426123.1| hypothetical protein CICLE_v10026239mg [Citrus clementina]
 ref|XP_006426124.1| hypothetical protein CICLE_v10026239mg [Citrus clementina]
 gb|ESR39363.1| hypothetical protein CICLE_v10026239mg [Citrus clementina]
 gb|ESR39364.1| hypothetical protein CICLE_v10026239mg [Citrus clementina]
Length=279

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            +KGFTGIDDPYEPPLN EIVL Q+   C SP D+ + V+SYL+D G+L A
Sbjct  230  VKGFTGIDDPYEPPLNCEIVLKQTGDDCPSPADMVETVVSYLDDNGFLRA  279



>ref|XP_010647917.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X2 [Vitis vinifera]
Length=261

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            I+GFTGI DPYEPPLN EIVL  SE  C+SP D+A+ VI YLE+ GYL+A
Sbjct  212  IQGFTGIHDPYEPPLNCEIVLKHSEEVCTSPRDMAEKVIHYLEENGYLQA  261



>ref|XP_007030729.1| Adenosine-5'-phosphosulfate (APS) kinase 3 isoform 2 [Theobroma 
cacao]
 gb|EOY11231.1| Adenosine-5'-phosphosulfate (APS) kinase 3 isoform 2 [Theobroma 
cacao]
Length=158

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPPLN EI + Q +G C +PG +A  V+SYLE+KGYL 
Sbjct  108  IKGFTGIDDPYEPPLNCEIEIQQKDGDCPTPGAMAGEVVSYLEEKGYLR  156



>ref|XP_010054581.1| PREDICTED: adenylyl-sulfate kinase 3-like [Eucalyptus grandis]
Length=206

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPL  EI L Q +G C +PG +A  V+SYLE+KG+LE+
Sbjct  157  IKGFTGIDDPYEPPLKCEIELSQKDGICPAPGAMAGKVVSYLEEKGFLES  206



>ref|XP_010679636.1| PREDICTED: adenylyl-sulfate kinase 3 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=301

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYE PLN EIVL Q    C+SP ++A+IV+SYLE+ GYL+A
Sbjct  252  IKGFTGVDDPYERPLNCEIVLQQKPDTCTSPCEMAEIVVSYLEEHGYLQA  301



>ref|XP_002265518.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X1 [Vitis vinifera]
Length=308

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            I+GFTGI DPYEPPLN EIVL  SE  C+SP D+A+ VI YLE+ GYL+A
Sbjct  259  IQGFTGIHDPYEPPLNCEIVLKHSEEVCTSPRDMAEKVIHYLEENGYLQA  308



>ref|XP_004289810.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=263

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYE PLN EI L   EG C SP ++A+ VISYLE+KG+L+A
Sbjct  214  IKGFTGIDDPYESPLNCEIALKHKEGECMSPCEMAEEVISYLEEKGFLQA  263



>ref|XP_007030728.1| Adenosine-5'-phosphosulfate (APS) kinase 3 isoform 1 [Theobroma 
cacao]
 gb|EOY11230.1| Adenosine-5'-phosphosulfate (APS) kinase 3 isoform 1 [Theobroma 
cacao]
Length=208

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPPLN EI + Q +G C +PG +A  V+SYLE+KGYL 
Sbjct  158  IKGFTGIDDPYEPPLNCEIEIQQKDGDCPTPGAMAGEVVSYLEEKGYLR  206



>gb|KDP39700.1| hypothetical protein JCGZ_02720 [Jatropha curcas]
Length=208

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPPLN EI + + +G C +P  +A  V+SYLEDKGYL+
Sbjct  158  IKGFTGIDDPYEPPLNCEIEIQEKDGVCPTPTAMAGQVVSYLEDKGYLQ  206



>ref|XP_009599487.1| PREDICTED: adenylyl-sulfate kinase 3-like [Nicotiana tomentosiformis]
Length=207

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI + Q +G   +P ++A  V+SY+ED+G+LEA
Sbjct  158  IKGFTGIDDPYEPPLNCEIEIQQKDGLVPAPNEMAGQVVSYMEDRGFLEA  207



>gb|KCW89869.1| hypothetical protein EUGRSUZ_A02099 [Eucalyptus grandis]
Length=332

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPL  EI L Q +G C +PG +A  V+SYLE+KG+LE+
Sbjct  283  IKGFTGIDDPYEPPLKCEIELSQKDGICPAPGAMAGKVVSYLEEKGFLES  332



>ref|XP_009797311.1| PREDICTED: adenylyl-sulfate kinase 3-like [Nicotiana sylvestris]
 ref|XP_009797312.1| PREDICTED: adenylyl-sulfate kinase 3-like [Nicotiana sylvestris]
Length=207

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI + Q +G   +P ++A  V+SY+ED+G+LEA
Sbjct  158  IKGFTGIDDPYEPPLNCEIEIQQKDGLVPAPNEMAGQVVSYMEDRGFLEA  207



>ref|XP_010934822.1| PREDICTED: adenylyl-sulfate kinase 3 [Elaeis guineensis]
 ref|XP_010934829.1| PREDICTED: adenylyl-sulfate kinase 3 [Elaeis guineensis]
Length=207

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPPLN EI + Q  GFC  P D+A  V++YLE+KG+++
Sbjct  158  IKGFTGIDDPYEPPLNCEIEIKQENGFCPPPSDMAGEVVTYLEEKGFMQ  206



>ref|XP_006600139.1| PREDICTED: uncharacterized protein LOC100500116 isoform X2 [Glycine 
max]
Length=230

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP + EIVL Q    C SP D+A+ VISYLE+ GYL A
Sbjct  181  IKGFTGIDDPYEPPCSCEIVLQQKGSDCKSPSDMAEEVISYLEENGYLRA  230



>ref|XP_006579946.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic isoform X4 
[Glycine max]
Length=222

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP + EIVL Q    C SP D+A+ VISYLE+ GYL A
Sbjct  173  IKGFTGIDDPYEPPSSCEIVLQQKGSNCKSPSDMAEEVISYLEENGYLRA  222



>ref|XP_002465684.1| hypothetical protein SORBIDRAFT_01g043710 [Sorghum bicolor]
 gb|EER92682.1| hypothetical protein SORBIDRAFT_01g043710 [Sorghum bicolor]
Length=273

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP+N EIV+   +G C SP  +AK V+SYLE+ GYL+A
Sbjct  224  IKGFTGIDDPYEPPVNGEIVITMKDGECPSPKAMAKQVLSYLEENGYLQA  273



>ref|XP_006579947.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic isoform X5 
[Glycine max]
 gb|KHN06018.1| Adenylyl-sulfate kinase, chloroplastic [Glycine soja]
Length=207

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP + EIVL Q    C SP D+A+ VISYLE+ GYL A
Sbjct  158  IKGFTGIDDPYEPPSSCEIVLQQKGSNCKSPSDMAEEVISYLEENGYLRA  207



>ref|XP_006600140.1| PREDICTED: uncharacterized protein LOC100500116 isoform X3 [Glycine 
max]
 ref|XP_006600141.1| PREDICTED: uncharacterized protein LOC100500116 isoform X4 [Glycine 
max]
 ref|XP_006600142.1| PREDICTED: uncharacterized protein LOC100500116 isoform X5 [Glycine 
max]
 ref|XP_006600143.1| PREDICTED: uncharacterized protein LOC100500116 isoform X6 [Glycine 
max]
 gb|KHN23243.1| Adenylyl-sulfate kinase, chloroplastic [Glycine soja]
Length=207

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP + EIVL Q    C SP D+A+ VISYLE+ GYL A
Sbjct  158  IKGFTGIDDPYEPPCSCEIVLQQKGSDCKSPSDMAEEVISYLEENGYLRA  207



>ref|XP_007155832.1| hypothetical protein PHAVU_003G235300g [Phaseolus vulgaris]
 gb|ESW27826.1| hypothetical protein PHAVU_003G235300g [Phaseolus vulgaris]
Length=306

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYE P + EIVL Q    C SP D+A+IVISYLE+ GYL A
Sbjct  257  IKGFTGIDDPYEAPCSCEIVLQQKGSGCKSPSDMAEIVISYLEENGYLRA  306



>ref|XP_010023311.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic isoform X2 
[Eucalyptus grandis]
Length=208

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPL+ EIVL Q    C+SP ++A+ VI +LE+KGYL A
Sbjct  159  IKGFTGIDDPYEPPLDCEIVLQQKGSKCASPCEMAEEVIGFLEEKGYLRA  208



>ref|XP_008658407.1| PREDICTED: adenylyl-sulfate kinase isoform X4 [Zea mays]
 gb|AFW89311.1| adenylyl-sulfate kinase [Zea mays]
Length=223

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP+N EIV+   +G C SP  +AK V+ YLE+ GYL+A
Sbjct  174  IKGFTGIDDPYEPPINGEIVIKMKDGECPSPKAMAKQVLCYLEENGYLQA  223



>gb|ACF82149.1| unknown [Zea mays]
Length=223

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP+N EIV+   +G C SP  +AK V+ YLE+ GYL+A
Sbjct  174  IKGFTGIDDPYEPPINGEIVIKMKDGECPSPKAMAKQVLCYLEENGYLQA  223



>gb|EPS62027.1| adenylyl-sulfate kinase, chloroplastic, partial [Genlisea aurea]
Length=215

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYE PLN+EIVL   +G C SP  +A+ ++SYLE KGYL+A
Sbjct  166  IKGFTGIDDPYEKPLNAEIVLEAVDGNCDSPNAMAERIVSYLEWKGYLKA  215



>ref|XP_006579944.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic isoform X2 
[Glycine max]
Length=300

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP + EIVL Q    C SP D+A+ VISYLE+ GYL A
Sbjct  251  IKGFTGIDDPYEPPSSCEIVLQQKGSNCKSPSDMAEEVISYLEENGYLRA  300



>ref|XP_006600138.1| PREDICTED: uncharacterized protein LOC100500116 isoform X1 [Glycine 
max]
Length=310

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP + EIVL Q    C SP D+A+ VISYLE+ GYL A
Sbjct  261  IKGFTGIDDPYEPPCSCEIVLQQKGSDCKSPSDMAEEVISYLEENGYLRA  310



>ref|NP_001144141.1| adenylyl-sulfate kinase [Zea mays]
 gb|ACF78868.1| unknown [Zea mays]
 gb|ACG38195.1| hypothetical protein [Zea mays]
 gb|ACL54468.1| unknown [Zea mays]
 gb|AFW89309.1| adenylyl-sulfate kinase [Zea mays]
Length=270

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP+N EIV+   +G C SP  +AK V+ YLE+ GYL+A
Sbjct  221  IKGFTGIDDPYEPPINGEIVIKMKDGECPSPKAMAKQVLCYLEENGYLQA  270



>ref|XP_008658404.1| PREDICTED: adenylyl-sulfate kinase isoform X3 [Zea mays]
 ref|XP_008658405.1| PREDICTED: adenylyl-sulfate kinase isoform X3 [Zea mays]
 ref|XP_008658406.1| PREDICTED: adenylyl-sulfate kinase isoform X3 [Zea mays]
Length=233

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP+N EIV+   +G C SP  +AK V+ YLE+ GYL+A
Sbjct  184  IKGFTGIDDPYEPPINGEIVIKMKDGECPSPKAMAKQVLCYLEENGYLQA  233



>ref|XP_010257674.1| PREDICTED: adenylyl-sulfate kinase 3 [Nelumbo nucifera]
Length=208

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPPLN E+ + Q++G C +P  +A  VISYLE+KG+L+
Sbjct  158  IKGFTGIDDPYEPPLNCEMEIQQNDGICPTPSAMAGQVISYLEEKGFLQ  206



>gb|AFW89313.1| hypothetical protein ZEAMMB73_907084 [Zea mays]
Length=207

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP+N EIV+   +G C SP  +AK V+ YLE+ GYL+A
Sbjct  158  IKGFTGIDDPYEPPINGEIVIKMKDGECPSPKAMAKQVLCYLEENGYLQA  207



>ref|XP_006579943.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic isoform X1 
[Glycine max]
Length=307

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP + EIVL Q    C SP D+A+ VISYLE+ GYL A
Sbjct  258  IKGFTGIDDPYEPPSSCEIVLQQKGSNCKSPSDMAEEVISYLEENGYLRA  307



>ref|XP_010070656.1| PREDICTED: adenylyl-sulfate kinase 3 isoform X1 [Eucalyptus grandis]
 ref|XP_010070657.1| PREDICTED: adenylyl-sulfate kinase 3 isoform X1 [Eucalyptus grandis]
 ref|XP_010023310.1| PREDICTED: adenylyl-sulfate kinase 3 isoform X1 [Eucalyptus grandis]
 gb|KCW59553.1| hypothetical protein EUGRSUZ_H02306 [Eucalyptus grandis]
Length=294

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPL+ EIVL Q    C+SP ++A+ VI +LE+KGYL A
Sbjct  245  IKGFTGIDDPYEPPLDCEIVLQQKGSKCASPCEMAEEVIGFLEEKGYLRA  294



>ref|XP_008658402.1| PREDICTED: adenylyl-sulfate kinase isoform X1 [Zea mays]
Length=296

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP+N EIV+   +G C SP  +AK V+ YLE+ GYL+A
Sbjct  247  IKGFTGIDDPYEPPINGEIVIKMKDGECPSPKAMAKQVLCYLEENGYLQA  296



>ref|XP_006590296.1| PREDICTED: uncharacterized protein LOC100786331 isoform X2 [Glycine 
max]
Length=239

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP + EIVL Q    C SP D A+IVISYLE  GYL A
Sbjct  190  IKGFTGIDDPYEPPYSCEIVLQQKGSECMSPSDTAEIVISYLEKNGYLLA  239



>gb|EMS45667.1| Adenylyl-sulfate kinase 1, chloroplastic [Triticum urartu]
Length=158

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYE PLN EI + + +G C SP D+A  VI+YLEDKG+L
Sbjct  109  IKGFTGIDDPYEAPLNCEIEIKEVDGVCPSPSDMAAQVITYLEDKGFL  156



>ref|XP_009613594.1| PREDICTED: adenylyl-sulfate kinase 3 [Nicotiana tomentosiformis]
 ref|XP_009613595.1| PREDICTED: adenylyl-sulfate kinase 3 [Nicotiana tomentosiformis]
Length=208

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI + Q +G   +P ++A  V+SY+ED+G+LEA
Sbjct  158  IKGFTGIDDPYEPPLNCEIEIQQKDGVVPTPHEMAGQVVSYMEDRGFLEA  207



>ref|XP_006408245.1| hypothetical protein EUTSA_v10021488mg [Eutrema salsugineum]
 gb|ESQ49698.1| hypothetical protein EUTSA_v10021488mg [Eutrema salsugineum]
Length=219

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN EI L + EG C SP  +A+ VISYLEDKG+L+
Sbjct  169  IKGFTGIDDPYESPLNCEIELKEKEGKCPSPVAMAEEVISYLEDKGFLQ  217



>ref|XP_009354618.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic-like isoform 
X3 [Pyrus x bretschneideri]
Length=186

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPL  EIVL Q      +PG++A+ +ISYLE+KGYL+A
Sbjct  137  IKGFTGVDDPYEPPLKCEIVLQQKGTDSVTPGEMAETMISYLEEKGYLQA  186



>ref|XP_010111685.1| Adenylyl-sulfate kinase 1 [Morus notabilis]
 gb|EXC31476.1| Adenylyl-sulfate kinase 1 [Morus notabilis]
Length=291

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI+L    G C+SP ++A+ V+SYL +KG+L+A
Sbjct  242  IKGFTGIDDPYEPPLNCEIILGHKGGACASPCEMAEEVMSYLGEKGFLQA  291



>gb|KHF97681.1| Adenylyl-sulfate kinase, chloroplastic [Gossypium arboreum]
Length=300

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  8    GFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            GFTGIDDPYEPPLN E+ L Q    C+SP ++A+IVISYLE+KGYL+A
Sbjct  253  GFTGIDDPYEPPLNCELELPQKGNNCASPCEIAEIVISYLEEKGYLQA  300



>ref|NP_187040.1| adenosine-5'-phosphosulfate (APS) kinase 3 [Arabidopsis thaliana]
 sp|Q9SRW7.1|APK3_ARATH RecName: Full=Adenylyl-sulfate kinase 3; AltName: Full=ATP adenosine-5'-phosphosulfate 
3'-phosphotransferase 3; AltName: 
Full=Adenosine-5'-phosphosulfate kinase 3; Short=APS kinase 
3 [Arabidopsis thaliana]
 gb|AAF00628.1|AC009540_5 putative adenylylsulfate kinase [Arabidopsis thaliana]
 gb|AEE74010.1| adenosine-5'-phosphosulfate (APS) kinase 3 [Arabidopsis thaliana]
Length=208

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN EI L + EG C SP  +A+ VISYLEDKG+L+
Sbjct  158  IKGFTGIDDPYESPLNCEIELKEKEGECPSPVAMAEEVISYLEDKGFLQ  206



>ref|XP_009354615.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009354616.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
Length=225

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPL  EIVL Q      +PG++A+ +ISYLE+KGYL+A
Sbjct  176  IKGFTGVDDPYEPPLKCEIVLQQKGTDSVTPGEMAETMISYLEEKGYLQA  225



>ref|XP_006298545.1| hypothetical protein CARUB_v10014638mg [Capsella rubella]
 gb|EOA31443.1| hypothetical protein CARUB_v10014638mg [Capsella rubella]
Length=208

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN EI L + EG C SP  +A+ VISYLEDKG+L+
Sbjct  158  IKGFTGIDDPYESPLNCEIELKEKEGECPSPVAMAEEVISYLEDKGFLQ  206



>ref|XP_010515733.1| PREDICTED: adenylyl-sulfate kinase 3 [Camelina sativa]
 ref|XP_010463857.1| PREDICTED: adenylyl-sulfate kinase 3 [Camelina sativa]
 ref|XP_010463858.1| PREDICTED: adenylyl-sulfate kinase 3 [Camelina sativa]
 ref|XP_010485755.1| PREDICTED: adenylyl-sulfate kinase 3 [Camelina sativa]
Length=208

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN EI L + EG C SP  +A+ VISYLEDKG+L+
Sbjct  158  IKGFTGIDDPYESPLNCEIELKEKEGECPSPVAMAEEVISYLEDKGFLQ  206



>ref|XP_009354617.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009354619.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like isoform 
X2 [Pyrus x bretschneideri]
Length=207

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYEPPL  EIVL Q      +PG++A+ +ISYLE+KGYL+A
Sbjct  158  IKGFTGVDDPYEPPLKCEIVLQQKGTDSVTPGEMAETMISYLEEKGYLQA  207



>ref|XP_008802703.1| PREDICTED: adenylyl-sulfate kinase 3-like [Phoenix dactylifera]
Length=207

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN EI +    GFC  P D+A+ V++YLEDKG+L+
Sbjct  158  IKGFTGIDDPYERPLNCEIEIKPENGFCPPPSDMARQVLTYLEDKGFLQ  206



>gb|KDO78881.1| hypothetical protein CISIN_1g023675mg [Citrus sinensis]
Length=279

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            +KGFTGIDDPYEPPLN EIVL Q    C SP D+ + V+SYL++ G+L A
Sbjct  230  VKGFTGIDDPYEPPLNCEIVLKQMGDDCPSPADMVETVVSYLDENGFLRA  279



>ref|XP_006466435.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006466436.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic-like isoform 
X2 [Citrus sinensis]
Length=279

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            +KGFTGIDDPYEPPLN EIVL Q    C SP D+ + V+SYL++ G+L A
Sbjct  230  VKGFTGIDDPYEPPLNCEIVLKQMGDDCPSPADMVETVVSYLDENGFLRA  279



>gb|KHN12998.1| Adenylyl-sulfate kinase, chloroplastic [Glycine soja]
Length=296

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP + EIVL Q    C SP D A+IVISYLE  GYL A
Sbjct  247  IKGFTGIDDPYEPPYSCEIVLQQKGSECMSPSDTAEIVISYLEKNGYLLA  296



>ref|NP_001241077.1| uncharacterized protein LOC100786331 [Glycine max]
 gb|ACU23688.1| unknown [Glycine max]
Length=296

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP + EIVL Q    C SP D A+IVISYLE  GYL A
Sbjct  247  IKGFTGIDDPYEPPYSCEIVLQQKGSECMSPSDTAEIVISYLEKNGYLLA  296



>gb|KHG08681.1| Adenylyl-sulfate kinase 1, chloroplastic -like protein [Gossypium 
arboreum]
 gb|KHG28433.1| Adenylyl-sulfate kinase 1, chloroplastic -like protein [Gossypium 
arboreum]
Length=282

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN E+ L      C+SP ++A+ VISYLE+KGYL A
Sbjct  233  IKGFTGIDDPYEPPLNCELALPPKGNSCASPCEMAETVISYLEEKGYLHA  282



>ref|XP_010236603.1| PREDICTED: adenylyl-sulfate kinase 3 [Brachypodium distachyon]
 ref|XP_010236606.1| PREDICTED: adenylyl-sulfate kinase 3 [Brachypodium distachyon]
 ref|XP_010236607.1| PREDICTED: adenylyl-sulfate kinase 3 [Brachypodium distachyon]
 ref|XP_010236611.1| PREDICTED: adenylyl-sulfate kinase 3 [Brachypodium distachyon]
Length=208

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYE PLN EI + + +G C SP D+ K V++YLEDKG+L
Sbjct  159  IKGFTGIDDPYEAPLNCEIEIKELDGVCPSPSDMTKQVVAYLEDKGFL  206



>ref|XP_006443425.1| hypothetical protein CICLE_v10022273mg [Citrus clementina]
 ref|XP_006479111.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006479112.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X2 [Citrus 
sinensis]
 ref|XP_006479113.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X3 [Citrus 
sinensis]
 ref|XP_006479114.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X4 [Citrus 
sinensis]
 gb|ESR56665.1| hypothetical protein CICLE_v10022273mg [Citrus clementina]
Length=207

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYEPPLN EI + Q +G C +P  +A  V+SYLE++GYL
Sbjct  158  IKGFTGIDDPYEPPLNCEIEIKQKDGVCPTPNAMAGQVVSYLEEEGYL  205



>ref|XP_006657874.1| PREDICTED: adenylyl-sulfate kinase 3-like [Oryza brachyantha]
Length=328

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYEPPLN EI + + +G C SP D+A  V++YLE+KG+L
Sbjct  279  IKGFTGIDDPYEPPLNCEIEIKEVDGVCPSPSDMAGQVVTYLEEKGFL  326



>ref|XP_007156712.1| hypothetical protein PHAVU_002G010900g [Phaseolus vulgaris]
 ref|XP_007156713.1| hypothetical protein PHAVU_002G010900g [Phaseolus vulgaris]
 gb|ESW28706.1| hypothetical protein PHAVU_002G010900g [Phaseolus vulgaris]
 gb|ESW28707.1| hypothetical protein PHAVU_002G010900g [Phaseolus vulgaris]
Length=301

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPP + EIVL Q    C+S GD+ +IVISYL+ KGYL 
Sbjct  252  IKGFTGIDDPYEPPYSCEIVLQQKGSECTSLGDMTEIVISYLDKKGYLR  300



>ref|XP_010276378.1| PREDICTED: adenylyl-sulfate kinase 3-like [Nelumbo nucifera]
Length=208

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPPLN EI + Q +G C +P  +A  V+SYLE+KG+L+
Sbjct  158  IKGFTGIDDPYEPPLNCEIEIQQKDGICPTPLVMAGQVVSYLEEKGFLQ  206



>gb|AES94540.2| sulfate adenylyltransferase subunit 1/adenylylsulfate kinase 
[Medicago truncatula]
Length=315

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQS-EGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP + EIVLHQ  E  C SP + A+ VISYLE  GYL A
Sbjct  265  IKGFTGIDDPYEPPCSCEIVLHQQKESDCMSPSNAAEKVISYLEKNGYLRA  315



>ref|XP_002319692.2| hypothetical protein POPTR_0013s05450g [Populus trichocarpa]
 gb|EEE95615.2| hypothetical protein POPTR_0013s05450g [Populus trichocarpa]
Length=215

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPPL  EI L Q +G C +P  +   V+SYLE+KGYLE
Sbjct  165  IKGFTGIDDPYEPPLQCEIELQQIDGVCPTPTAMGGQVVSYLEEKGYLE  213



>ref|XP_002319694.1| adenylylsulfate kinase family protein [Populus trichocarpa]
 ref|XP_011034380.1| PREDICTED: adenylyl-sulfate kinase 3 [Populus euphratica]
 gb|EEE95617.1| adenylylsulfate kinase family protein [Populus trichocarpa]
Length=208

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPPL  EI L Q +G C +P  +   V+SYLE+KGYLE
Sbjct  158  IKGFTGIDDPYEPPLQCEIELQQIDGVCPTPTAMGGQVVSYLEEKGYLE  206



>dbj|BAJ96620.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=227

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYE PLN EI + + +G C SP D+A  VI+YLE+KG+L
Sbjct  178  IKGFTGIDDPYEAPLNCEIEIKEVDGVCPSPSDMATQVITYLEEKGFL  225



>ref|XP_003608523.1| Adenylyl-sulfate kinase [Medicago truncatula]
 gb|AES90720.1| adenylylsulfate kinase [Medicago truncatula]
Length=306

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP   EI+L Q    C SP D+A+ VISYLE  G+L+A
Sbjct  257  IKGFTGIDDPYEPPCCCEIILQQKGSDCKSPKDMAETVISYLEKSGHLQA  306



>gb|ACU23241.1| unknown [Glycine max]
Length=207

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP+N EI + Q  G C +P  +A  V++YLE+KG+LE+
Sbjct  158  IKGFTGIDDPYEPPINCEIEIKQENGNCPTPTMMAGQVVTYLENKGFLES  207



>ref|XP_003554016.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X1 [Glycine 
max]
 ref|XP_006604235.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X2 [Glycine 
max]
 ref|XP_006604236.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X3 [Glycine 
max]
 gb|KHN34698.1| Adenylyl-sulfate kinase 1, chloroplastic [Glycine soja]
Length=207

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP+N EI + Q  G C +P  +A  V++YLE+KG+LE+
Sbjct  158  IKGFTGIDDPYEPPINCEIEIKQENGNCPTPTMMAGQVVTYLENKGFLES  207



>ref|XP_006651143.1| PREDICTED: adenylyl-sulfate kinase 3-like [Oryza brachyantha]
Length=231

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYE P+NSEIV+   +G C SP  +A+ V+ YLE+ GYL+A
Sbjct  182  IKGFTGIDDPYESPVNSEIVIKMVDGECPSPKSMARHVLCYLEENGYLQA  231



>ref|XP_009420648.1| PREDICTED: adenylyl-sulfate kinase 3-like [Musa acuminata subsp. 
malaccensis]
Length=207

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYEPPLN EI + Q  G C SP  +A  V+ YLE+KG+L
Sbjct  158  IKGFTGIDDPYEPPLNCEIEIKQENGVCPSPNAMAGQVVGYLEEKGFL  205



>ref|XP_010247330.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X2 [Nelumbo 
nucifera]
Length=308

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLNSEIVL   EG  +SP D+A+ VI YLE+KG L A
Sbjct  260  IKGFTGIDDPYEPPLNSEIVLKHEEG-SASPFDMAEKVILYLEEKGLLRA  308



>ref|XP_010247329.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X1 [Nelumbo 
nucifera]
Length=311

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLNSEIVL   EG  +SP D+A+ VI YLE+KG L A
Sbjct  263  IKGFTGIDDPYEPPLNSEIVLKHEEG-SASPFDMAEKVILYLEEKGLLRA  311



>ref|XP_004985300.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic-like isoform 
X2 [Setaria italica]
Length=226

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP+N EIV+   +G C SP  +AK V+ YLE+ G L+A
Sbjct  177  IKGFTGIDDPYEPPVNGEIVIQMKDGECPSPKAMAKQVMCYLEENGCLQA  226



>ref|XP_007204742.1| hypothetical protein PRUPE_ppa011498mg [Prunus persica]
 gb|EMJ05941.1| hypothetical protein PRUPE_ppa011498mg [Prunus persica]
Length=208

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN EI + Q +G C  P  LA  V+SYLE+KG+L+
Sbjct  158  IKGFTGIDDPYERPLNCEIEIEQKDGVCPKPAALAGQVVSYLEEKGFLQ  206



>ref|NP_001237036.1| uncharacterized protein LOC100500116 [Glycine max]
 gb|ACU15009.1| unknown [Glycine max]
Length=207

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEP  + EIVL Q    C SP D+A+ VISYLE+ GYL A
Sbjct  158  IKGFTGIDDPYEPLCSCEIVLQQKGSDCKSPSDMAEEVISYLEENGYLRA  207



>dbj|BAJ92303.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=291

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYE PLN EI + + +G C SP D+A  VI+YLE+KG+L
Sbjct  242  IKGFTGIDDPYEAPLNCEIEIKEVDGVCPSPSDMATQVITYLEEKGFL  289



>ref|XP_010549674.1| PREDICTED: adenylyl-sulfate kinase 3 [Tarenaya hassleriana]
Length=190

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYE PLN EI L + EG C SP  +A+ VISYLE+KG+L
Sbjct  134  IKGFTGIDDPYESPLNCEIELKEKEGECPSPVAMAEEVISYLEEKGFL  181



>ref|XP_010555367.1| PREDICTED: adenylyl-sulfate kinase 2, chloroplastic [Tarenaya 
hassleriana]
Length=287

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL-HQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPPL+ EIVL H  + + SSP  +A+ +ISYLE KGYL 
Sbjct  237  IKGFTGIDDPYEPPLDCEIVLKHTGDNYSSSPRKMAETIISYLESKGYLR  286



>ref|NP_001060064.1| Os07g0573100 [Oryza sativa Japonica Group]
 dbj|BAC83149.1| putative adenosine-5'-phosphosulfate kinase [Oryza sativa Japonica 
Group]
 dbj|BAF21978.1| Os07g0573100 [Oryza sativa Japonica Group]
 gb|EEE67449.1| hypothetical protein OsJ_24824 [Oryza sativa Japonica Group]
Length=345

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLNSEI + + +G C SP D+A  V++YLE+KG+L 
Sbjct  296  IKGFTGIDDPYESPLNSEIEIKEVDGVCPSPSDMAGQVVTYLEEKGFLH  344



>ref|XP_002460898.1| hypothetical protein SORBIDRAFT_02g037100 [Sorghum bicolor]
 gb|EER97419.1| hypothetical protein SORBIDRAFT_02g037100 [Sorghum bicolor]
Length=336

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYE PLN EI + +++G C SP D+A  V++YLE+KG+L
Sbjct  287  IKGFTGIDDPYEAPLNCEIEIKEADGVCPSPSDMAGQVVTYLEEKGFL  334



>ref|XP_004985299.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic-like isoform 
X1 [Setaria italica]
Length=273

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP+N EIV+   +G C SP  +AK V+ YLE+ G L+A
Sbjct  224  IKGFTGIDDPYEPPVNGEIVIQMKDGECPSPKAMAKQVMCYLEENGCLQA  273



>gb|KHN46776.1| Adenylyl-sulfate kinase 1, chloroplastic [Glycine soja]
Length=207

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP+N EI + Q  G C +P  +A  V++YLE+KG+LE+
Sbjct  158  IKGFTGIDDPYEPPINCEIEIKQENGDCPTPTLMAGQVVTYLENKGFLES  207



>ref|XP_003548742.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X1 [Glycine 
max]
 ref|XP_006598976.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X2 [Glycine 
max]
 ref|XP_006598977.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X3 [Glycine 
max]
 ref|XP_006598978.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X4 [Glycine 
max]
 ref|XP_006598979.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X5 [Glycine 
max]
Length=207

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP+N EI + Q  G C +P  +A  V++YLE+KG+LE+
Sbjct  158  IKGFTGIDDPYEPPINCEIEIKQENGDCPTPTLMAGQVVTYLENKGFLES  207



>ref|XP_002884417.1| hypothetical protein ARALYDRAFT_896410 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60676.1| hypothetical protein ARALYDRAFT_896410 [Arabidopsis lyrata subsp. 
lyrata]
Length=208

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN EI L + EG C SP  +A+ VI YLEDKG+L+
Sbjct  158  IKGFTGIDDPYESPLNCEIELKEKEGECPSPVAMAEEVIFYLEDKGFLQ  206



>ref|XP_004493162.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004493163.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like isoform 
X2 [Cicer arietinum]
 ref|XP_004493164.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like isoform 
X3 [Cicer arietinum]
Length=207

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI + +  G C +P  +A  V+SYLE+KG+LE 
Sbjct  158  IKGFTGIDDPYEPPLNCEIEIKEDGGICPTPTVMAGQVVSYLEEKGFLEC  207



>ref|XP_007030733.1| Uncharacterized protein TCM_026474 [Theobroma cacao]
 gb|EOY11235.1| Uncharacterized protein TCM_026474 [Theobroma cacao]
Length=73

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            + GFT IDDPYEPPLN EI + Q +G C +PG +A  V+ YLEDKGYL+
Sbjct  23   VVGFTDIDDPYEPPLNCEIEIQQKDGDCPTPGAMAGEVVFYLEDKGYLQ  71



>tpg|DAA41181.1| TPA: hypothetical protein ZEAMMB73_656997 [Zea mays]
Length=158

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYE PLN EI + + +G C SP D+A  V++YLE+KG+L
Sbjct  109  IKGFTGIDDPYEAPLNCEIEIKEIDGVCPSPSDMAGQVVTYLEEKGFL  156



>ref|XP_008240467.1| PREDICTED: adenylyl-sulfate kinase 3 [Prunus mume]
 ref|XP_008240468.1| PREDICTED: adenylyl-sulfate kinase 3 [Prunus mume]
Length=208

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN EI + Q +G C  P  +A  V+SYLE+KG+L+
Sbjct  158  IKGFTGIDDPYERPLNCEIEIEQKDGVCPKPAAMAGQVVSYLEEKGFLQ  206



>emb|CDY63896.1| BnaA01g34620D [Brassica napus]
Length=293

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL-HQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN E+VL H  + F SSP  +A+ +ISYL++KGYLE
Sbjct  243  IKGFTGIDDPYEAPLNCEVVLKHTGDDFSSSPRQMAENIISYLQNKGYLE  292



>ref|XP_009128991.1| PREDICTED: adenylyl-sulfate kinase 2, chloroplastic [Brassica 
rapa]
Length=293

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL-HQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN E+VL H  + F SSP  +A+ +ISYL++KGYLE
Sbjct  243  IKGFTGIDDPYEAPLNCEVVLKHTGDDFSSSPRQMAENIISYLQNKGYLE  292



>ref|NP_001136943.1| adenylyl-sulfate kinase isoform 1 [Zea mays]
 ref|XP_008667370.1| PREDICTED: adenylyl-sulfate kinase isoform 1 isoform X1 [Zea 
mays]
 ref|XP_008667371.1| PREDICTED: adenylyl-sulfate kinase isoform 1 isoform X1 [Zea 
mays]
 ref|XP_008667372.1| PREDICTED: adenylyl-sulfate kinase isoform 1 isoform X1 [Zea 
mays]
 ref|XP_008667373.1| PREDICTED: adenylyl-sulfate kinase isoform 1 isoform X1 [Zea 
mays]
 ref|XP_008667374.1| PREDICTED: adenylyl-sulfate kinase isoform 1 isoform X1 [Zea 
mays]
 gb|ACF82941.1| unknown [Zea mays]
 gb|ACN27167.1| unknown [Zea mays]
 gb|ACN29261.1| unknown [Zea mays]
 gb|ACR33916.1| unknown [Zea mays]
 tpg|DAA41175.1| TPA: adenylyl-sulfate kinase isoform 1 [Zea mays]
 tpg|DAA41176.1| TPA: adenylyl-sulfate kinase isoform 2 [Zea mays]
 tpg|DAA41177.1| TPA: adenylyl-sulfate kinase isoform 3 [Zea mays]
 tpg|DAA41178.1| TPA: adenylyl-sulfate kinase isoform 4 [Zea mays]
 tpg|DAA41179.1| TPA: adenylyl-sulfate kinase isoform 5 [Zea mays]
 tpg|DAA41180.1| TPA: adenylyl-sulfate kinase isoform 6 [Zea mays]
Length=208

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYE PLN EI + + +G C SP D+A  V++YLE+KG+L
Sbjct  159  IKGFTGIDDPYEAPLNCEIEIKEIDGVCPSPSDMAGQVVTYLEEKGFL  206



>ref|XP_004511836.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic-like [Cicer 
arietinum]
Length=319

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGF-CSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP + EI+L Q +G  C SP + A++VISYLE  GYL A
Sbjct  269  IKGFTGIDDPYEPPCSCEILLKQQKGSDCMSPSNAAEVVISYLEKNGYLRA  319



>gb|EAZ25960.1| hypothetical protein OsJ_09815 [Oryza sativa Japonica Group]
Length=228

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYE P+NSEIV+   +G C SP  +A+ V+ YLE+ GYL+A
Sbjct  179  IKGFTGIDDPYESPVNSEIVIKMVDGECPSPKAMAQHVLCYLEENGYLQA  228



>ref|XP_009136250.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like [Brassica 
rapa]
Length=277

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L Q EG  +SP ++A+ V++YLE KGYL+A
Sbjct  229  IKGFTGIDDPYEPPLNCEISLGQ-EGTGTSPIEMAETVVAYLEHKGYLKA  277



>gb|ACN25636.1| unknown [Zea mays]
Length=199

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYE PLN EI + + +G C SP D+A  V++YLE+KG+L
Sbjct  150  IKGFTGIDDPYEAPLNCEIEIKEIDGVCPSPSDMAGQVVTYLEEKGFL  197



>ref|XP_008667369.1| PREDICTED: adenylyl-sulfate kinase isoform 1 isoform X2 [Zea 
mays]
Length=242

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYE PLN EI + + +G C SP D+A  V++YLE+KG+L
Sbjct  193  IKGFTGIDDPYEAPLNCEIEIKEIDGVCPSPSDMAGQVVTYLEEKGFL  240



>tpg|DAA41174.1| TPA: adenylyl-sulfate kinase [Zea mays]
Length=243

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYE PLN EI + + +G C SP D+A  V++YLE+KG+L
Sbjct  194  IKGFTGIDDPYEAPLNCEIEIKEIDGVCPSPSDMAGQVVTYLEEKGFL  241



>ref|XP_002532415.1| adenylsulfate kinase, putative [Ricinus communis]
 gb|EEF29956.1| adenylsulfate kinase, putative [Ricinus communis]
Length=288

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L  + G  +SP ++A+ VISY+E+ GYL+A
Sbjct  239  IKGFTGIDDPYEPPLNCEISLKLNNGENASPCEMAEEVISYMEENGYLQA  288



>gb|AFK37560.1| unknown [Medicago truncatula]
Length=207

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI + + +G C +P  +A  V++YLE+KG+LE 
Sbjct  158  IKGFTGIDDPYEPPLNCEIEIKEDDGDCPTPKVMAGQVVTYLEEKGFLEC  207



>emb|CDY37220.1| BnaA09g08410D [Brassica napus]
Length=273

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L Q EG  +SP ++A+ V++YLE KGYL A
Sbjct  225  IKGFTGIDDPYEPPLNCEISLGQ-EGTGTSPIEMAETVVAYLEHKGYLNA  273



>ref|XP_007047526.1| Adenylyl-sulfate kinase isoform 2 [Theobroma cacao]
 gb|EOX91683.1| Adenylyl-sulfate kinase isoform 2 [Theobroma cacao]
Length=207

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN E+VL Q     +SP ++A+ VIS+LE+KG+L+A
Sbjct  158  IKGFTGIDDPYEPPLNCELVLPQKGINYASPCEMAETVISFLEEKGFLQA  207



>ref|XP_009123212.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic [Brassica 
rapa]
Length=273

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L Q EG  +SP ++A+ V++YLE KGYL A
Sbjct  225  IKGFTGIDDPYEPPLNCEISLGQ-EGTGTSPIEMAETVVAYLEHKGYLNA  273



>ref|XP_010488913.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like [Camelina 
sativa]
Length=275

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L + EG  +SP ++A++++ YLE+KGYL+A
Sbjct  227  IKGFTGIDDPYEPPLNCEISLGR-EGSGTSPIEMAEVIVGYLENKGYLQA  275



>emb|CDX81460.1| BnaC09g08710D [Brassica napus]
Length=273

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L Q EG  +SP ++A+ V++YLE KGYL A
Sbjct  225  IKGFTGIDDPYEPPLNCEISLGQ-EGTGTSPIEMAETVVAYLEHKGYLNA  273



>ref|XP_010517725.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like [Camelina 
sativa]
Length=275

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L + EG  +SP ++A++++ YLE+KGYL+A
Sbjct  227  IKGFTGIDDPYEPPLNCEISLGR-EGSGTSPIEMAEVIVGYLENKGYLQA  275



>gb|EAY88937.1| hypothetical protein OsI_10422 [Oryza sativa Indica Group]
Length=275

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYE P+NSEIV+   +G C SP  +A+ V+ YLE+ GYL+A
Sbjct  226  IKGFTGIDDPYESPVNSEIVIKMVDGECPSPKAMAQHVLCYLEENGYLQA  275



>gb|AFK41167.1| unknown [Lotus japonicus]
 gb|AFK41581.1| unknown [Lotus japonicus]
Length=207

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI + Q  G C +P  +A  V  YLE+KG+LE 
Sbjct  158  IKGFTGIDDPYEPPLNCEIEIKQEGGVCPTPNVMAGQVACYLEEKGFLEC  207



>ref|XP_010467257.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic [Camelina 
sativa]
Length=275

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L + EG  +SP ++A++++ YLE+KGYL+A
Sbjct  227  IKGFTGIDDPYEPPLNCEISLGR-EGSGTSPIEMAEVIVGYLENKGYLQA  275



>gb|KEH23530.1| sulfate adenylyltransferase subunit 1/adenylylsulfate kinase 
[Medicago truncatula]
Length=207

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI + + +G C +P  +A  V++YLE+KG+LE 
Sbjct  158  IKGFTGIDDPYEPPLNCEIEIKEDDGDCPTPKVMAGQVVTYLEEKGFLEC  207



>gb|AFK41675.1| unknown [Medicago truncatula]
Length=207

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI + + +G C +P  +A  V++YLE+KG+LE 
Sbjct  158  IKGFTGIDDPYEPPLNCEIEIKEDDGDCPTPKVMAGQVVTYLEEKGFLEC  207



>emb|CDY64897.1| BnaC05g47640D [Brassica napus]
Length=180

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN EI L + EG C SP  +A+ VI+YLE KG+L+
Sbjct  130  IKGFTGIDDPYESPLNCEIELKEKEGECPSPVTMAEEVIAYLEAKGFLQ  178



>ref|XP_009353136.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X2 [Pyrus x 
bretschneideri]
Length=175

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPP N EI + Q  G C  P  +A  V+SYLE+KG+L 
Sbjct  125  IKGFTGIDDPYEPPENCEIEIEQENGVCPMPAAMAGQVVSYLEEKGFLR  173



>ref|XP_003558559.1| PREDICTED: adenylyl-sulfate kinase 3-like [Brachypodium distachyon]
Length=276

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYE P+NSEIV+   +G C SP  +A  V+ YLE+ GYL+A
Sbjct  227  IKGFTGVDDPYESPVNSEIVIKMEDGECPSPKAMANQVLCYLEENGYLQA  276



>ref|XP_009763439.1| PREDICTED: adenylyl-sulfate kinase 3-like [Nicotiana sylvestris]
 ref|XP_009763440.1| PREDICTED: adenylyl-sulfate kinase 3-like [Nicotiana sylvestris]
Length=208

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI + Q +G   +P ++A  V+SY+E +G+L+A
Sbjct  158  IKGFTGIDDPYEPPLNCEIEIQQKDGVVPTPHEMAGQVVSYMEGRGFLKA  207



>ref|XP_007047525.1| Adenosine-5\'-phosphosulfate kinase 3 isoform 1 [Theobroma cacao]
 gb|EOX91682.1| Adenosine-5\'-phosphosulfate kinase 3 isoform 1 [Theobroma cacao]
Length=288

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN E+VL Q     +SP ++A+ VIS+LE+KG+L+A
Sbjct  239  IKGFTGIDDPYEPPLNCELVLPQKGINYASPCEMAETVISFLEEKGFLQA  288



>ref|XP_009353134.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009353135.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X1 [Pyrus x 
bretschneideri]
Length=208

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPP N EI + Q  G C  P  +A  V+SYLE+KG+L 
Sbjct  158  IKGFTGIDDPYEPPENCEIEIEQENGVCPMPAAMAGQVVSYLEEKGFLR  206



>ref|XP_009109428.1| PREDICTED: adenylyl-sulfate kinase 2, chloroplastic-like [Brassica 
rapa]
Length=269

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN E+VL  ++  C SP  +A+ +ISYL+DKGYLE
Sbjct  221  IKGFTGIDDPYEAPLNCEVVLKHTDVSC-SPRQMAENIISYLQDKGYLE  268



>emb|CDY50861.1| BnaA05g37220D [Brassica napus]
Length=208

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN EI L + EG C SP  +A+ VI+YLE KG+L+
Sbjct  158  IKGFTGIDDPYESPLNCEIELKEKEGECPSPVAMAEEVIAYLEAKGFLQ  206



>emb|CDX90373.1| BnaA08g16110D [Brassica napus]
Length=276

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN E+VL  ++  C SP  +A+ +ISYL+DKGYLE
Sbjct  228  IKGFTGIDDPYEAPLNCEVVLKHTDVSC-SPRQMAENIISYLQDKGYLE  275



>ref|XP_010272582.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X1 [Nelumbo 
nucifera]
Length=317

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            I+GFTG+DDPYEPPL+ EI+L Q  G CSS  D+AK VI YLE+K +L A
Sbjct  269  IRGFTGVDDPYEPPLDCEIILKQKRG-CSSACDMAKEVIMYLEEKRFLHA  317



>ref|XP_008372758.1| PREDICTED: adenylyl-sulfate kinase 3-like [Malus domestica]
Length=320

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            I+GFTGIDDPYE PL+ EIVL    G C SP ++A+ V+SYLED+G+L+A
Sbjct  271  IEGFTGIDDPYEQPLDCEIVLSHKGGACPSPCEMAEEVVSYLEDQGFLQA  320



>ref|XP_003611582.1| Adenylyl-sulfate kinase [Medicago truncatula]
Length=362

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQS-EGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYEPP + EIVLHQ  E  C SP + A+ VISYLE  GYL
Sbjct  269  IKGFTGIDDPYEPPCSCEIVLHQQKESDCMSPSNAAEKVISYLEKNGYL  317



>ref|XP_006298172.1| hypothetical protein CARUB_v10014222mg, partial [Capsella rubella]
 gb|EOA31070.1| hypothetical protein CARUB_v10014222mg, partial [Capsella rubella]
Length=313

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L + EG  +SP ++A++V+ YLE KGYL+A
Sbjct  265  IKGFTGIDDPYEPPLNCEISLGR-EGSGTSPIEMAEVVVGYLEKKGYLQA  313



>gb|KFK39980.1| hypothetical protein AALP_AA3G314300 [Arabis alpina]
Length=275

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYE PLN EI L Q EG  +SP ++A+ V+ YLE+KGYL+A
Sbjct  227  IKGFTGIDDPYEAPLNCEIALGQ-EGSGTSPTEMAEKVVGYLENKGYLQA  275



>ref|XP_008787194.1| PREDICTED: adenylyl-sulfate kinase 3-like [Phoenix dactylifera]
Length=242

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPL+ EIV+    G C SP  +A  VISYL + G+L+A
Sbjct  193  IKGFTGIDDPYEPPLDCEIVIEAKAGECPSPVAMADQVISYLNNNGFLQA  242



>ref|XP_010530704.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic [Tarenaya 
hassleriana]
Length=277

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 3/51 (6%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL-HQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLNSEI L H+  G  +SP ++A+ V+ YLE KGYL A
Sbjct  229  IKGFTGIDDPYEPPLNSEIALKHERSG--TSPIEMAETVVEYLEKKGYLRA  277



>emb|CDX69374.1| BnaC01g00790D [Brassica napus]
Length=294

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL-HQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN E+VL H  + F SSP  +A+ +I YL++KGYLE
Sbjct  244  IKGFTGIDDPYEAPLNCEVVLKHTGDDFSSSPRQMAENIICYLQNKGYLE  293



>emb|CDP14316.1| unnamed protein product [Coffea canephora]
Length=211

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYE P N EI L Q  G C +P ++A  V+SYL+ KG+L+A
Sbjct  162  IKGFTGIDDPYEAPSNCEIELRQINGVCPAPSEMAGKVVSYLDGKGFLQA  211



>emb|CDY39470.1| BnaC03g60800D [Brassica napus]
Length=262

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL-HQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN E+VL H  +    SP  +A+ +ISYL+DKGYLE
Sbjct  212  IKGFTGIDDPYEAPLNCEVVLKHTGDDVSCSPRQMAENIISYLQDKGYLE  261



>ref|XP_007030742.1| Adenosine-5'-phosphosulfate (APS) kinase 3 [Theobroma cacao]
 gb|EOY11244.1| Adenosine-5'-phosphosulfate (APS) kinase 3 [Theobroma cacao]
Length=236

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +2

Query  8    GFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGY  142
            GFTGIDDPYEPPLN EI + Q +G C +PG +A  V+SYLE+KG+
Sbjct  181  GFTGIDDPYEPPLNCEIEIQQKDGDCPTPGAMAGEVVSYLEEKGW  225



>ref|XP_006351363.1| PREDICTED: adenylyl-sulfate kinase 3-like [Solanum tuberosum]
Length=207

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L   +G   +P ++A  V+SY+E+ G+LEA
Sbjct  158  IKGFTGIDDPYEPPLNCEIELQLKDGIVPTPHEMAGQVVSYMENGGFLEA  207



>emb|CDX93145.1| BnaA03g38670D [Brassica napus]
Length=277

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L + EG  +SP ++A+ V++YLE KGYL+A
Sbjct  229  IKGFTGIDDPYEPPLNCEISLGE-EGTGTSPIEMAETVVAYLEHKGYLKA  277



>ref|XP_009394753.1| PREDICTED: adenylyl-sulfate kinase 3-like [Musa acuminata subsp. 
malaccensis]
Length=293

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPL+ EIV+ Q    C +P  +A+ VIS+L+ KG+L+A
Sbjct  244  IKGFTGIDDPYEPPLDCEIVIQQKGSQCPTPKVMAEQVISFLDKKGFLQA  293



>dbj|BAJ96358.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=277

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYE P+NSEIV+      C SP  +AK V+SYLE+ GYL+A
Sbjct  228  IKGFTGVDDPYESPVNSEIVIKMEGEECPSPKAMAKQVLSYLEENGYLQA  277



>ref|XP_006409637.1| hypothetical protein EUTSA_v10022805mg [Eutrema salsugineum]
 gb|ESQ51090.1| hypothetical protein EUTSA_v10022805mg [Eutrema salsugineum]
Length=275

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 3/51 (6%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL-HQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L H++ G  +SP ++A+ V++YLE KGYL+A
Sbjct  227  IKGFTGIDDPYEPPLNCEIALGHEATG--TSPIEMAETVVAYLEHKGYLQA  275



>emb|CDY65440.1| BnaCnng47170D [Brassica napus]
Length=278

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L + EG  +SP ++A+ V++YLE KGYL+A
Sbjct  230  IKGFTGIDDPYEPPLNCEISLGE-EGTGTSPIEMAETVVAYLEHKGYLKA  278



>ref|XP_010938967.1| PREDICTED: adenylyl-sulfate kinase 3 isoform X1 [Elaeis guineensis]
Length=284

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPPL+SEIV+    G C  P  +A+ +ISYL D G+L+
Sbjct  235  IKGFTGIDDPYEPPLDSEIVIEPKVGECPPPAAMAEQIISYLNDNGFLQ  283



>ref|XP_004249302.1| PREDICTED: adenylyl-sulfate kinase 3-like [Solanum lycopersicum]
Length=207

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI +   +G   +P ++A  V+SY+E++G+LEA
Sbjct  158  IKGFTGIDDPYEPPLNCEIEIQLKDGVVPTPHEMAGQVVSYMENEGFLEA  207



>ref|XP_010938968.1| PREDICTED: adenylyl-sulfate kinase 3 isoform X2 [Elaeis guineensis]
Length=216

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPPL+SEIV+    G C  P  +A+ +ISYL D G+L+
Sbjct  167  IKGFTGIDDPYEPPLDSEIVIEPKVGECPPPAAMAEQIISYLNDNGFLQ  215



>ref|XP_009362562.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X2 [Pyrus x 
bretschneideri]
Length=282

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IK FTG+DDPYEPPL  E    Q  G C SPG++A+ VISYLE+KGYL+A
Sbjct  237  IKSFTGVDDPYEPPLKCE----QKGGDCVSPGEMAETVISYLEEKGYLQA  282



>ref|XP_008341116.1| PREDICTED: adenylyl-sulfate kinase 3 isoform X2 [Malus domestica]
Length=282

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IK FTG+DDPYEPPL  E    Q  G C SPG++A+ VISYLE+KGYL+A
Sbjct  237  IKSFTGVDDPYEPPLKCE----QKGGDCVSPGEMAETVISYLEEKGYLQA  282



>ref|XP_010942792.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X2 [Elaeis 
guineensis]
Length=235

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPL+ EI +    G C SP  +A+ VISYL + G+L+A
Sbjct  186  IKGFTGIDDPYEPPLDCEIAIEAKAGECPSPVAMAEQVISYLNENGFLQA  235



>gb|EYU20667.1| hypothetical protein MIMGU_mgv1a013619mg [Erythranthe guttata]
Length=215

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 39/52 (75%), Gaps = 2/52 (4%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSE--GFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYE PLNSEI + Q E  G C +P ++A  V+++LE KGYL A
Sbjct  157  IKGFTGIDDPYEAPLNSEIEIKQKEEDGECPTPNEMAGQVVTFLEHKGYLHA  208



>gb|ABR17904.1| unknown [Picea sitchensis]
Length=338

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP   EIV+    G C +P ++A+ V+SYLE+KG L+A
Sbjct  289  IKGFTGIDDPYEPPECCEIVMQPRNGVCPTPKEMAEQVVSYLEEKGLLKA  338



>ref|XP_009396045.1| PREDICTED: adenylyl-sulfate kinase 3-like [Musa acuminata subsp. 
malaccensis]
Length=289

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTG+DDPYE PL+ EIV+ Q++G C +P  +A+ +IS+L++ G+L+A
Sbjct  240  IKGFTGVDDPYESPLDCEIVIQQNDGKCPTPKAMAEQIISFLDNNGFLQA  289



>ref|XP_009412960.1| PREDICTED: adenylyl-sulfate kinase 3-like [Musa acuminata subsp. 
malaccensis]
Length=208

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSE-GFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPPLN EI + + E G C SP  +A  V+ YLE+KG+L+
Sbjct  158  IKGFTGIDDPYEPPLNCEIEIQEEENGVCPSPCAMAGQVVGYLEEKGFLQ  207



>ref|XP_010942790.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X1 [Elaeis 
guineensis]
Length=285

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPL+ EI +    G C SP  +A+ VISYL + G+L+A
Sbjct  236  IKGFTGIDDPYEPPLDCEIAIEAKAGECPSPVAMAEQVISYLNENGFLQA  285



>gb|AGN12804.1| adenylyl-sulfate kinase 2 [Leavenworthia alabamica]
Length=289

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL-HQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYE PLN E+VL H  +    SP  +A+ +ISYL++KGYLE+
Sbjct  239  IKGFTGIDDPYEAPLNCEVVLKHTGDDLSCSPRQMAENIISYLQNKGYLES  289



>ref|XP_009130398.1| PREDICTED: adenylyl-sulfate kinase 3 [Brassica rapa]
 ref|XP_009130399.1| PREDICTED: adenylyl-sulfate kinase 3 [Brassica rapa]
Length=203

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN EI L + EG C S   +A+ VI+YLE KG+L+
Sbjct  153  IKGFTGIDDPYESPLNCEIELKEKEGECPSSVAMAEEVIAYLEAKGFLQ  201



>emb|CDY08724.1| BnaA06g25000D [Brassica napus]
Length=283

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPL+ EIV+  +    SS  ++A+IV+SYL+  GYL+A
Sbjct  225  IKGFTGIDDPYEPPLDCEIVIQNNRDENSSLSEMAEIVVSYLDQNGYLKA  274



>ref|XP_010431974.1| PREDICTED: adenylyl-sulfate kinase 2, chloroplastic [Camelina 
sativa]
Length=289

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL-HQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN E+VL H  E    SP  +A+ +ISYL++KGYLE
Sbjct  239  IKGFTGIDDPYEAPLNCEVVLKHTGEDSSCSPRQMAENIISYLQNKGYLE  288



>ref|XP_002883855.1| hypothetical protein ARALYDRAFT_480365 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60114.1| hypothetical protein ARALYDRAFT_480365 [Arabidopsis lyrata subsp. 
lyrata]
Length=277

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L + EG  +SP ++A+ V+ YL++KGYL+A
Sbjct  229  IKGFTGIDDPYEPPLNCEISLGR-EGSGTSPIEMAEKVVGYLDNKGYLQA  277



>gb|AAF17236.1|AF178976_1 adenosine-5'-phosphosulfate kinase [Zea mays]
Length=288

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYE PLN EI + + +G C  P ++A  V++YLE+KG+L
Sbjct  239  IKGFTGIDDPYEAPLNCEIEIKEVDGVCPPPAEMAGQVVTYLEEKGFL  286



>gb|AGN12786.1| adenylyl-sulfate kinase 2 [Leavenworthia alabamica]
Length=289

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL-HQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYE PLN E+VL H  +    SP  +A+ +ISYL++KGYLE+
Sbjct  239  IKGFTGIDDPYEAPLNCEVVLKHTGDDHSCSPRQMAENIISYLQNKGYLES  289



>pdb|3UIE|A Chain A, Crystal Structure Of Adenosine 5'-Phosphosulfate Kinase 
From Arabidopsis Thaliana In Complex With Amppnp And Aps
 pdb|3UIE|B Chain B, Crystal Structure Of Adenosine 5'-Phosphosulfate Kinase 
From Arabidopsis Thaliana In Complex With Amppnp And Aps
 pdb|3UIE|C Chain C, Crystal Structure Of Adenosine 5'-Phosphosulfate Kinase 
From Arabidopsis Thaliana In Complex With Amppnp And Aps
 pdb|4FXP|A Chain A, Crystal Structure Of Adenosine 5'-Phosphosulfate Kinase 
From Arabidopsis Thaliana In Complex With Sulfate And Aps
 pdb|4FXP|B Chain B, Crystal Structure Of Adenosine 5'-Phosphosulfate Kinase 
From Arabidopsis Thaliana In Complex With Sulfate And Aps
 pdb|4FXP|C Chain C, Crystal Structure Of Adenosine 5'-Phosphosulfate Kinase 
From Arabidopsis Thaliana In Complex With Sulfate And Aps
Length=200

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L +  G  +SP ++A+ V+ YL++KGYL+A
Sbjct  153  IKGFTGIDDPYEPPLNCEISLGREGG--TSPIEMAEKVVGYLDNKGYLQA  200



>ref|XP_008386819.1| PREDICTED: adenylyl-sulfate kinase 3-like [Malus domestica]
Length=206

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE P N EI + Q  G C  P  +A  V+SYLE+KG+L+
Sbjct  156  IKGFTGIDDPYERPENCEIEIGQENGVCPMPAAMAGRVVSYLEEKGFLQ  204



>ref|XP_009366451.1| PREDICTED: adenylyl-sulfate kinase 3-like [Pyrus x bretschneideri]
 ref|XP_009366452.1| PREDICTED: adenylyl-sulfate kinase 3-like [Pyrus x bretschneideri]
Length=208

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE P N EI + Q  G C  P  +A  V+SYLE+KG+L+
Sbjct  158  IKGFTGIDDPYERPENCEIEIGQENGVCPMPAAMAGRVVSYLEEKGFLQ  206



>gb|ACG47301.1| adenylyl-sulfate kinase [Zea mays]
Length=337

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYE PLN EI + + +G C  P ++A  V++YLE+KG+L
Sbjct  288  IKGFTGIDDPYEAPLNCEIEIKEVDGVCPPPAEMAGQVVTYLEEKGFL  335



>tpg|DAA63253.1| TPA: adenylyl-sulfate kinase [Zea mays]
Length=341

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYE PLN EI + + +G C  P ++A  V++YLE+KG+L
Sbjct  292  IKGFTGIDDPYEAPLNCEIEIKEVDGVCPPPAEMAGQVVTYLEEKGFL  339



>ref|XP_010672046.1| PREDICTED: adenylyl-sulfate kinase 3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010672047.1| PREDICTED: adenylyl-sulfate kinase 3 [Beta vulgaris subsp. vulgaris]
Length=208

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYEPPL+ EI L   +G C +P D+A  V SYL +KG+L
Sbjct  158  IKGFTGIDDPYEPPLSCEIELKMVDGICPTPLDMAGQVASYLGEKGFL  205



>ref|XP_006573663.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic-like isoform 
X1 [Glycine max]
 ref|XP_006573664.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic-like isoform 
X2 [Glycine max]
Length=106

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLE  130
            IKGFTGIDD YEPP + EIV+ Q    C SPGD A+IVISYLE
Sbjct  57   IKGFTGIDDQYEPPYSCEIVIQQKGSECMSPGDTAEIVISYLE  99



>ref|XP_008391689.1| PREDICTED: adenylyl-sulfate kinase 3 isoform X2 [Malus domestica]
Length=175

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            +KGFTGIDDPYEPP   EI + Q  G C  P  +A  V+SYLE KG+L+
Sbjct  125  VKGFTGIDDPYEPPEKCEIEIEQKNGVCPMPAAMAGQVVSYLEVKGFLQ  173



>ref|XP_008391688.1| PREDICTED: adenylyl-sulfate kinase 3 isoform X1 [Malus domestica]
Length=208

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            +KGFTGIDDPYEPP   EI + Q  G C  P  +A  V+SYLE KG+L+
Sbjct  158  VKGFTGIDDPYEPPEKCEIEIEQKNGVCPMPAAMAGQVVSYLEVKGFLQ  206



>ref|NP_179082.1| Adenylyl-sulfate kinase 1 [Arabidopsis thaliana]
 sp|Q43295.1|APK1_ARATH RecName: Full=Adenylyl-sulfate kinase 1, chloroplastic; AltName: 
Full=ATP adenosine-5'-phosphosulfate 3'-phosphotransferase 
1; AltName: Full=Adenosine-5'-phosphosulfate kinase 1; Short=APS 
kinase 1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA53426.1| APS kinase [Arabidopsis thaliana]
 gb|AAC50035.1| APS kinase [Arabidopsis thaliana]
 gb|AAC50034.1| APS kinase [Arabidopsis thaliana]
 gb|AAC24182.1| putative adenosine phosphosulfate kinase [Arabidopsis thaliana]
 gb|AAL06946.1| At2g14750/F26C24.11 [Arabidopsis thaliana]
 gb|AAM91043.1| At2g14750/F26C24.11 [Arabidopsis thaliana]
 gb|AEC06330.1| adenylyl-sulfate kinase 1 [Arabidopsis thaliana]
Length=276

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L +  G  +SP ++A+ V+ YL++KGYL+A
Sbjct  229  IKGFTGIDDPYEPPLNCEISLGREGG--TSPIEMAEKVVGYLDNKGYLQA  276



>gb|AAM62496.1| putative adenosine phosphosulfate kinase [Arabidopsis thaliana]
Length=276

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L +  G  +SP ++A+ V+ YL++KGYL+A
Sbjct  229  IKGFTGIDDPYEPPLNCEISLGREGG--TSPIEMAEKVVGYLDNKGYLQA  276



>ref|XP_003575801.1| PREDICTED: adenylyl-sulfate kinase 3-like [Brachypodium distachyon]
Length=292

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPP + EIV+    G C++P  +A  V+SYLE  G+L+
Sbjct  243  IKGFTGIDDPYEPPFDCEIVIQCKVGDCAAPKSMADQVVSYLEANGFLQ  291



>gb|AFW89308.1| hypothetical protein ZEAMMB73_907084 [Zea mays]
Length=267

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPP+N   V+   +G C SP  +AK V+ YLE+ GYL+A
Sbjct  221  IKGFTGIDDPYEPPIN---VIKMKDGECPSPKAMAKQVLCYLEENGYLQA  267



>ref|XP_009150696.1| PREDICTED: adenylyl-sulfate kinase 4, chloroplastic [Brassica 
rapa]
Length=277

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 2/52 (4%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL--HQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPL+ EIV+  ++ E   SS  ++A+IV+SYL+  GYL+A
Sbjct  225  IKGFTGIDDPYEPPLDCEIVIQNNRDENSSSSLSEMAEIVVSYLDQNGYLKA  276



>ref|XP_006411795.1| hypothetical protein EUTSA_v10025861mg [Eutrema salsugineum]
 gb|ESQ53248.1| hypothetical protein EUTSA_v10025861mg [Eutrema salsugineum]
Length=296

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL-HQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN E+VL H  +    SP  +A+ +ISYL+ KGYLE
Sbjct  246  IKGFTGIDDPYEAPLNCEVVLKHTGDDVSCSPRQMAENIISYLQSKGYLE  295



>ref|XP_010547945.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like [Tarenaya 
hassleriana]
Length=278

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 3/51 (6%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL-HQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EI L H+S G  + P ++A+ V+ YLE KGYL A
Sbjct  230  IKGFTGIDDPYEPPLNCEIALKHKSSG--NLPMEMAETVVGYLEKKGYLGA  278



>ref|XP_008454396.1| PREDICTED: adenylyl-sulfate kinase 3 [Cucumis melo]
 ref|XP_008454397.1| PREDICTED: adenylyl-sulfate kinase 3 [Cucumis melo]
Length=296

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYE PLN EIVL  + G   SP ++A+ V++YLE KG+L+A
Sbjct  250  IKGFTGIDDPYEVPLNCEIVLKHTGG---SPSEMAEKVLNYLEQKGFLQA  296



>ref|XP_009138548.1| PREDICTED: adenylyl-sulfate kinase 2, chloroplastic-like [Brassica 
rapa]
Length=294

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL-HQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN E+VL H  +    SP  +A+ +ISYL++KGYLE
Sbjct  244  IKGFTGIDDPYEAPLNCEVVLKHTGDDDSCSPRQMAEHIISYLQNKGYLE  293



>emb|CDY31612.1| BnaA03g54400D [Brassica napus]
Length=294

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL-HQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN E+VL H  +    SP  +A+ +ISYL++KGYLE
Sbjct  244  IKGFTGIDDPYEAPLNCEVVLKHTGDDDSCSPRQMAEHIISYLQNKGYLE  293



>ref|XP_006285007.1| hypothetical protein CARUB_v10006314mg [Capsella rubella]
 gb|EOA17905.1| hypothetical protein CARUB_v10006314mg [Capsella rubella]
Length=289

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL-HQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN E+VL H  +    SP  +A+ +ISYL++KGYLE
Sbjct  239  IKGFTGIDDPYEAPLNCEVVLKHTGDEDSCSPRQMAENIISYLQNKGYLE  288



>ref|XP_007161945.1| hypothetical protein PHAVU_001G111000g [Phaseolus vulgaris]
 gb|ESW33939.1| hypothetical protein PHAVU_001G111000g [Phaseolus vulgaris]
Length=208

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSE-GFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPP+N EI + Q + G C +P  +A  V++YLE +G+LE
Sbjct  158  IKGFTGIDDPYEPPINCEIEIKQEDSGVCPTPTLMAGQVVTYLEKEGFLE  207



>emb|CDY63923.1| BnaC07g51290D [Brassica napus]
Length=294

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL-HQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN E+VL H  +    SP  +A+ +ISYL++KGYLE
Sbjct  244  IKGFTGIDDPYEAPLNCEVVLKHTGDDDSCSPRQMAEHIISYLQNKGYLE  293



>ref|XP_004152280.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like [Cucumis 
sativus]
 gb|KGN52751.1| hypothetical protein Csa_4G000720 [Cucumis sativus]
Length=296

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYE P N EIVL  + G   SP ++A+ V+SYLE KG+L+A
Sbjct  250  IKGFTGIDDPYEVPFNCEIVLKHTGG---SPSEMAEKVLSYLEQKGFLQA  296



>ref|XP_007161946.1| hypothetical protein PHAVU_001G111000g [Phaseolus vulgaris]
 gb|ESW33940.1| hypothetical protein PHAVU_001G111000g [Phaseolus vulgaris]
Length=224

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSE-GFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPP+N EI + Q + G C +P  +A  V++YLE +G+LE
Sbjct  174  IKGFTGIDDPYEPPINCEIEIKQEDSGVCPTPTLMAGQVVTYLEKEGFLE  223



>ref|XP_004156864.1| PREDICTED: LOW QUALITY PROTEIN: adenylyl-sulfate kinase 1, chloroplastic-like 
[Cucumis sativus]
Length=296

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYE P N EIVL  + G   SP ++A+ V+SYLE KG+L+A
Sbjct  250  IKGFTGIDDPYEVPFNCEIVLKHTGG---SPSEMAEKVMSYLEQKGFLQA  296



>ref|XP_004979791.1| PREDICTED: adenylyl-sulfate kinase, chloroplastic-like [Setaria 
italica]
Length=302

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPP + EIV+    G C SP  +A  V+SYLE  G+LE
Sbjct  253  IKGFTGIDDPYEPPSDCEIVIECKIGDCPSPKSMADQVVSYLEANGFLE  301



>ref|NP_195704.1| adenosine-5'-phosphosulfate-kinase 2 [Arabidopsis thaliana]
 sp|O49196.1|APK2_ARATH RecName: Full=Adenylyl-sulfate kinase 2, chloroplastic; AltName: 
Full=ATP adenosine-5'-phosphosulfate 3'-phosphotransferase 
2; AltName: Full=Adenosine-5'-phosphosulfate kinase 2; Short=APS 
kinase 2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL58913.1|AF462823_1 AT4g39940/T5J17_110 [Arabidopsis thaliana]
 gb|AAC39520.1| adenosine-5'-phosphosulfate-kinase [Arabidopsis thaliana]
 emb|CAB38907.1| adenosine-5'-phosphosulfate-kinase [Arabidopsis thaliana]
 emb|CAB80657.1| adenosine-5'-phosphosulfate-kinase [Arabidopsis thaliana]
 gb|AAM19937.1| AT4g39940/T5J17_110 [Arabidopsis thaliana]
 gb|AEE87142.1| adenosine-5'-phosphosulfate-kinase 2 [Arabidopsis thaliana]
Length=293

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL-HQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE P+N E+VL H  +    SP  +A+ +ISYL++KGYLE
Sbjct  243  IKGFTGIDDPYEAPVNCEVVLKHTGDDESCSPRQMAENIISYLQNKGYLE  292



>gb|ACG40162.1| adenylyl-sulfate kinase 1 [Zea mays]
Length=283

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPP + EIV+    G C SP  +A  V+SYLE  G+L+
Sbjct  234  IKGFTGIDDPYEPPSDCEIVIRCKVGDCPSPESMAGHVVSYLETNGFLQ  282



>gb|ABR16196.1| unknown [Picea sitchensis]
Length=339

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYE P+N E+V+    G C +P ++ + VI+YLE+KG++
Sbjct  292  IKGFTGIDDPYEIPVNCEMVMQLINGICPTPKEMGEHVIAYLEEKGFI  339



>ref|XP_002992810.1| hypothetical protein SELMODRAFT_136031, partial [Selaginella 
moellendorffii]
 gb|EFJ06100.1| hypothetical protein SELMODRAFT_136031, partial [Selaginella 
moellendorffii]
Length=226

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYE P N EIV+   +G   +P ++A  VIS+LE +GYL A
Sbjct  159  IKGFTGIDDPYEEPHNCEIVMEIDDGAVPTPSEMADTVISFLEQEGYLPA  208



>ref|NP_001131924.1| uncharacterized protein LOC100193315 [Zea mays]
 gb|ACF80551.1| unknown [Zea mays]
Length=281

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPP + EIV+    G C SP  +A  V+SYLE  G+L+
Sbjct  232  IKGFTGIDDPYEPPSDCEIVIRCKVGDCPSPESMAGHVVSYLETNGFLQ  280



>ref|XP_002449895.1| hypothetical protein SORBIDRAFT_05g025240 [Sorghum bicolor]
 gb|EES08883.1| hypothetical protein SORBIDRAFT_05g025240 [Sorghum bicolor]
Length=302

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYE P + EIV+H   G C SP  +A  V+SYLE  G+L
Sbjct  253  IKGFTGIDDPYEAPSDCEIVIHCKVGDCPSPKSMADQVVSYLETNGFL  300



>gb|KFK30569.1| hypothetical protein AALP_AA7G278900 [Arabis alpina]
Length=290

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL-HQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN E+VL H  +    SP  +A+ +I+YL+ KGYLE
Sbjct  240  IKGFTGIDDPYEAPLNCEVVLKHTGDDVSCSPPKMAENIIAYLQKKGYLE  289



>gb|AFW60291.1| adenylyl-sulfate kinase [Zea mays]
Length=275

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPP + EIV+    G C SP  +A  V+SYLE  G+L+
Sbjct  226  IKGFTGIDDPYEPPSDCEIVIQCKVGDCPSPESMAGHVVSYLETNGFLQ  274



>ref|XP_002987503.1| hypothetical protein SELMODRAFT_126226, partial [Selaginella 
moellendorffii]
 gb|EFJ11339.1| hypothetical protein SELMODRAFT_126226, partial [Selaginella 
moellendorffii]
Length=226

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYE P N EIV+   +G   +P ++A  VIS+LE +GYL A
Sbjct  159  IKGFTGIDDPYEEPHNCEIVMEIDDGAVPTPSEMADTVISFLEQEGYLPA  208



>ref|XP_004958103.1| PREDICTED: adenylyl-sulfate kinase 1, chloroplastic-like [Setaria 
italica]
Length=336

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYL  145
            IKGFTGIDDPYE PLN EI + + +G C    D+A  V++YLE+KG+L
Sbjct  287  IKGFTGIDDPYEAPLNCEIEIKEVDGVCPPLCDMAGQVVTYLEEKGFL  334



>emb|CDY36498.1| BnaC03g48570D [Brassica napus]
Length=277

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 40/51 (78%), Gaps = 2/51 (4%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL--HQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPPL+ EIV+  ++ E   SS  ++A+IV++YL+  GYL+
Sbjct  225  IKGFTGIDDPYEPPLDCEIVIQNNRDENSSSSLSEMAEIVVTYLDQNGYLK  275



>ref|XP_006663615.1| PREDICTED: adenylyl-sulfate kinase 3-like [Oryza brachyantha]
Length=308

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE P + EIV+  + G C SP  +A  V+SYLE  G+L+
Sbjct  259  IKGFTGIDDPYETPSDCEIVIQCNVGCCPSPKSMADQVVSYLEANGFLQ  307



>gb|KHN36300.1| BTB/POZ domain-containing protein [Glycine soja]
Length=474

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  8    GFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLE  130
            GFTGIDD YEPP + EIV+ Q    C SPGD A+IVISYLE
Sbjct  427  GFTGIDDQYEPPYSCEIVIQQKGSECMSPGDTAEIVISYLE  467



>ref|XP_008808841.1| PREDICTED: adenylyl-sulfate kinase 3-like [Phoenix dactylifera]
 ref|XP_008778952.1| PREDICTED: adenylyl-sulfate kinase 3-like [Phoenix dactylifera]
Length=286

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPP   EIV+   +G C  P  +A+ VISYL   G+L+
Sbjct  235  IKGFTGIDDPYEPPWECEIVIEPKDGECPPPVAMAEQVISYLNSNGFLQ  283



>ref|XP_010437119.1| PREDICTED: adenylyl-sulfate kinase 2, chloroplastic-like [Camelina 
sativa]
Length=289

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVL-HQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYE PLN E++L H  +     P  +A+ +ISYL++KGYLE
Sbjct  239  IKGFTGIDDPYEAPLNCEVLLKHTGDDSSCLPRQMAENIISYLQNKGYLE  288



>gb|EMS64302.1| Adenylyl-sulfate kinase, chloroplastic [Triticum urartu]
Length=286

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLE  148
            IKGFTGIDDPYEPP + EIV+    G C++P  +A  V+SYLE   +L+
Sbjct  237  IKGFTGIDDPYEPPSDCEIVIQCKAGDCATPKSMADQVVSYLEANEFLQ  285



>ref|XP_010550306.1| PREDICTED: adenylyl-sulfate kinase 4, chloroplastic isoform X3 
[Tarenaya hassleriana]
Length=285

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPL  EI+L  +    SS  ++A+ V+SYL+  GYL A
Sbjct  236  IKGFTGIDDPYEPPLKCEIILQHNGDKASSLCEMAETVVSYLDHNGYLIA  285



>ref|XP_010102764.1| Adenylyl-sulfate kinase [Morus notabilis]
 gb|EXB94048.1| Adenylyl-sulfate kinase [Morus notabilis]
Length=271

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    IKGFTGIDDPYEPPLNSEIVLHQSEGFCSSPGDLAKIVISYLEDKGYLEA  151
            IKGFTGIDDPYEPPLN EIVL Q          + + VISYL + GYL+A
Sbjct  222  IKGFTGIDDPYEPPLNCEIVLQQKGKDVVPLCKMTETVISYLGENGYLQA  271



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512662103758