BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27354_g1_i1 len=684 path=[662:0-683]

Length=684
                                                                      Score     E

ref|XP_004245223.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    6e-09   
ref|NP_001238176.1|  uncharacterized protein LOC100305883 precursor   61.2    8e-09   
ref|XP_006367904.1|  PREDICTED: non-specific lipid-transfer prote...  58.9    5e-08   
gb|AAT80665.1|  lipid transfer protein precursor                      58.5    7e-08   Malus domestica [apple tree]
ref|XP_006358720.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    1e-07   
gb|AAT80652.1|  lipid transfer protein precursor                      57.8    1e-07   Malus domestica [apple tree]
gb|ADR66943.1|  non-specific lipid transfer protein                   56.6    4e-07   
sp|Q9M5X8.1|NLTP_PRUAV  RecName: Full=Non-specific lipid-transfer...  56.2    4e-07   Prunus avium [gean]
gb|ADR66942.1|  non-specific lipid transfer protein                   56.2    5e-07   
gb|AAT80650.1|  lipid transfer protein precursor                      55.5    9e-07   Malus domestica [apple tree]
ref|XP_004245408.1|  PREDICTED: non-specific lipid-transfer prote...  55.5    1e-06   
ref|XP_004240614.2|  PREDICTED: non-specific lipid-transfer prote...  55.8    1e-06   
gb|AAY83343.1|  non-specific lipid transfer protein precursor         54.7    2e-06   Fragaria x ananassa
gb|AAT80663.1|  lipid transfer protein precursor                      54.7    2e-06   Malus domestica [apple tree]
gb|AAY83345.1|  non-specific lipid transfer protein precursor         54.7    2e-06   Fragaria x ananassa
sp|Q9M5X6.1|NLTP_PYRCO  RecName: Full=Non-specific lipid-transfer...  54.3    2e-06   Pyrus communis
gb|ABB96481.1|  non-specific lipid transfer protein precursor         54.3    2e-06   Malus domestica [apple tree]
sp|P82534.1|NLTP1_PRUDO  RecName: Full=Non-specific lipid-transfe...  53.9    2e-06   Prunus domestica
ref|XP_004245407.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    4e-06   
ref|XP_010253094.1|  PREDICTED: non-specific lipid-transfer prote...  53.5    4e-06   
ref|XP_010922736.1|  PREDICTED: non-specific lipid-transfer prote...  53.5    5e-06   
ref|XP_009346912.1|  PREDICTED: non-specific lipid-transfer protein   53.5    5e-06   
ref|XP_008391369.1|  PREDICTED: non-specific lipid-transfer protein   53.1    7e-06   
ref|XP_009770883.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    7e-06   
gb|AAR22488.1|  allergen Mal d 3                                      52.8    8e-06   Malus domestica [apple tree]
gb|AAT80649.1|  lipid transfer protein precursor                      52.8    1e-05   Malus domestica [apple tree]
gb|AEC04836.1|  lipid transfer protein                                52.8    1e-05   
ref|XP_009593826.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    1e-05   
gb|AET05731.1|  lipid transfer protein isoform b                      52.0    1e-05   
emb|CAC86258.1|  lipid transfer protein                               52.4    1e-05   Fragaria x ananassa
gb|KHN40624.1|  Non-specific lipid-transfer protein 3                 54.7    2e-05   
gb|ABG54494.1|  putative allergen Rub i 3                             52.0    2e-05   Rubus idaeus [European raspberry]
gb|ADR66947.1|  non-specific lipid transfer protein                   52.0    2e-05   
gb|AAK28533.1|AF329829_1  lipid transfer protein precursor            52.0    2e-05   Corylus avellana [European hazelnut]
gb|AGH27863.1|  lipid transfer protein precursor                      52.0    2e-05   
ref|NP_001281295.1|  non-specific lipid-transfer protein precursor    51.6    2e-05   
gb|ADR66953.1|  non-specific lipid transfer protein                   51.6    2e-05   
ref|XP_009372013.1|  PREDICTED: non-specific lipid-transfer protein   51.6    2e-05   
sp|P81651.2|NLTP1_PRUAR  RecName: Full=Non-specific lipid-transfe...  51.2    2e-05   Prunus armeniaca
emb|CCD33109.1|  lipid transfer protein                               51.6    2e-05   
gb|ADR66948.1|  non-specific lipid transfer protein                   51.6    3e-05   
ref|XP_008798551.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    3e-05   
gb|AET05730.1|  lipid transfer protein isoform a                      50.8    4e-05   
gb|AAY83342.1|  non-specific lipid transfer protein precursor         51.2    4e-05   Fragaria x ananassa
ref|XP_003516421.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    4e-05   
gb|ADR66950.1|  non-specific lipid transfer protein                   50.8    4e-05   
ref|XP_008350568.1|  PREDICTED: non-specific lipid-transfer prote...  50.8    4e-05   
gb|AAQ74628.1|  lipid tranfer protein II                              50.8    5e-05   Vigna radiata [mung bean]
ref|XP_008388341.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    5e-05   
ref|XP_007206674.1|  hypothetical protein PRUPE_ppa023110mg           50.8    5e-05   
sp|Q43017.1|NLTP1_PRUDU  RecName: Full=Non-specific lipid-transfe...  50.8    5e-05   Prunus dulcis [sweet almond]
gb|EYU42013.1|  hypothetical protein MIMGU_mgv1a016621mg              50.4    5e-05   
ref|XP_004302624.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    6e-05   
emb|CAB96874.1|  mal d 3                                              50.1    6e-05   Malus domestica [apple tree]
gb|ADR66949.1|  non-specific lipid transfer protein                   50.4    6e-05   
ref|XP_009781151.1|  PREDICTED: non-specific lipid-transfer prote...  50.8    6e-05   
gb|AET05732.1|  lipid transfer protein isoform c                      50.1    6e-05   
ref|XP_008350569.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    7e-05   
ref|XP_008244970.1|  PREDICTED: non-specific lipid-transfer prote...  50.1    7e-05   
ref|XP_008244959.1|  PREDICTED: non-specific lipid-transfer prote...  50.1    8e-05   
ref|XP_004245406.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    8e-05   
gb|AAM22768.1|  lipid transfer protein                                49.7    9e-05   Prunus persica
gb|AAL32039.1|AF439280_1  lipid transfer protein-like protein         50.1    9e-05   Retama raetam [retem]
gb|EPS66894.1|  hypothetical protein M569_07878                       50.1    9e-05   
ref|XP_007206159.1|  hypothetical protein PRUPE_ppa013554mg           50.1    9e-05   
ref|XP_002532869.1|  Nonspecific lipid-transfer protein precursor...  50.1    1e-04   Ricinus communis
gb|ACP43542.1|  lipid transfer protein                                50.1    1e-04   Chimonanthus praecox [wintersweet]
ref|NP_001268074.1|  lipid transfer protein precursor                 50.1    1e-04   
ref|XP_004302608.1|  PREDICTED: non-specific lipid-transfer prote...  49.7    1e-04   
gb|AAY83344.1|  non-specific lipid transfer protein precursor         49.7    1e-04   Fragaria x ananassa
ref|NP_001044654.1|  Os01g0822900                                     49.7    1e-04   Oryza sativa Japonica Group [Japonica rice]
gb|AGH27866.1|  lipid transfer protein precursor                      49.7    1e-04   
emb|CAB96876.2|  pru p 1                                              49.3    1e-04   Prunus persica
pdb|2ALG|A  Chain A, Crystal Structure Of Peach Pru P3, The Proto...  49.3    1e-04   
gb|AAV40850.1|  lipid transfer protein 1 precursor                    49.7    1e-04   Prunus persica
ref|XP_010509135.1|  PREDICTED: non-specific lipid-transfer prote...  49.3    1e-04   
gb|ABF06565.1|  non-specific lipid transfer-like protein              49.3    2e-04   Prosopis juliflora [algorrobo]
gb|AAY83346.1|  non-specific lipid transfer protein precursor         49.3    2e-04   Fragaria x ananassa
ref|XP_003522128.1|  PREDICTED: non-specific lipid-transfer prote...  49.3    2e-04   
gb|AAQ96338.1|  lipid transfer protein                                49.3    2e-04   Vitis aestivalis
emb|CBW38498.1|  lipid transfer protein                               48.9    2e-04   
gb|AGH13363.1|  lipid transfer protein                                48.9    2e-04   
ref|XP_006644921.1|  PREDICTED: non-specific lipid-transfer prote...  49.3    2e-04   
ref|XP_002458690.1|  hypothetical protein SORBIDRAFT_03g038280        49.3    2e-04   Sorghum bicolor [broomcorn]
emb|CBW38501.1|  lipid transfer protein                               48.9    2e-04   
ref|XP_007140137.1|  hypothetical protein PHAVU_008G087100g           50.8    2e-04   
gb|AEI70830.1|  non-specific lipid-transfer protein                   48.9    2e-04   
gb|AFR43292.1|  lipid transfer protein precursor                      48.9    2e-04   
gb|ADR66946.1|  non-specific lipid transfer protein                   48.9    2e-04   
ref|XP_010252074.1|  PREDICTED: non-specific lipid-transfer prote...  48.9    2e-04   
ref|XP_010517150.1|  PREDICTED: non-specific lipid-transfer prote...  48.9    2e-04   
ref|NP_001241144.1|  uncharacterized protein LOC100817318 precursor   48.9    3e-04   
gb|KHG30577.1|  Non-specific lipid-transfer                           48.9    3e-04   
ref|XP_011095132.1|  PREDICTED: non-specific lipid-transfer prote...  48.5    3e-04   
gb|AEI70828.1|  non-specific lipid-transfer protein                   48.5    3e-04   
ref|NP_001147136.1|  LOC100280743 precursor                           48.5    3e-04   Zea mays [maize]
gb|AFR43293.1|  lipid transfer protein precursor                      48.5    3e-04   
sp|P81402.1|NLTP1_PRUPE  RecName: Full=Non-specific lipid-transfe...  48.1    3e-04   Prunus persica
gb|AFR43291.1|  lipid transfer protein precursor                      48.5    3e-04   
gb|AFR43285.1|  lipid transfer protein precursor                      48.5    4e-04   
gb|ABA29446.1|  non-specific lipid transfer protein                   48.5    4e-04   Vitis vinifera
ref|XP_008244949.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    4e-04   
gb|KHL91133.1|  hypothetical protein QW71_36410                       48.1    4e-04   
sp|Q39794.1|NLTP_GERHY  RecName: Full=Non-specific lipid-transfer...  48.1    4e-04   Gerbera hybrid cultivar
gb|KHG09722.1|  Non-specific lipid-transfer                           48.1    4e-04   
gb|AGW21344.1|  lipid transfer protein                                48.1    4e-04   
emb|CBW38499.1|  lipid transfer protein                               47.8    5e-04   
gb|KHN33231.1|  Non-specific lipid-transfer protein 1                 48.1    5e-04   
emb|CBW38503.1|  lipid transfer protein                               47.8    5e-04   
ref|NP_001240073.1|  uncharacterized protein LOC100815185 precursor   48.1    5e-04   
ref|XP_010464583.1|  PREDICTED: non-specific lipid-transfer prote...  47.8    5e-04   
gb|ACE07189.1|  Art v 3 allergen precursor                            47.8    5e-04   Artemisia vulgaris [common wormwood]
ref|XP_006367906.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    5e-04   
gb|KHN44829.1|  Non-specific lipid-transfer protein 1                 49.3    6e-04   
emb|CBW38504.1|  lipid transfer protein                               47.4    6e-04   
emb|CDP14199.1|  unnamed protein product                              47.8    6e-04   
ref|XP_010043291.1|  PREDICTED: non-specific lipid-transfer prote...  47.8    7e-04   
gb|AEI70827.1|  non-specific lipid-transfer protein                   47.4    7e-04   
ref|XP_010464489.1|  PREDICTED: non-specific lipid-transfer prote...  47.4    8e-04   
gb|AAL27855.1|  lipid transfer protein precursor                      47.4    8e-04   Davidia involucrata
sp|Q39950.1|NLTP_HELAN  RecName: Full=Non-specific lipid-transfer...  47.4    8e-04   Helianthus annuus
ref|XP_010505484.1|  PREDICTED: non-specific lipid-transfer prote...  47.4    8e-04   
ref|XP_006281297.1|  hypothetical protein CARUB_v10027347mg           47.8    8e-04   
ref|XP_010509136.1|  PREDICTED: non-specific lipid-transfer prote...  47.4    9e-04   
gb|AEI70829.1|  non-specific lipid-transfer protein                   47.4    9e-04   
gb|ACZ06858.1|  lipid transfer protein                                47.4    9e-04   
emb|CBW38497.1|  lipid transfer protein                               47.0    9e-04   
ref|XP_004963700.1|  PREDICTED: non-specific lipid-transfer prote...  47.4    0.001   



>ref|XP_004245223.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=128

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 53/113 (47%), Gaps = 5/113 (4%)
 Frame = -3

Query  604  LLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVKSNL  425
            +LL C+A  V+   ++A  S           T +EPC  Y+  GG +VP  CC+ +KS L
Sbjct  15   MLLICIA--VVMATITATTSQDATLTCNTVFTTLEPCLSYVLGGGLSVPSECCNGIKSML  72

Query  424  K---VFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCS  275
                    R + C CI+ +V  A      R   +PG+C  +   K + H +CS
Sbjct  73   NGAYTIADRQSACKCIKSVVSSAAPGPVSRAAKVPGICKANVPFKISPHVDCS  125



>ref|NP_001238176.1| uncharacterized protein LOC100305883 precursor [Glycine max]
 gb|ACU13784.1| unknown [Glycine max]
Length=125

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 60/129 (47%), Gaps = 9/129 (7%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            M  S    L W+ + C+  GV+    S  P A       Q  +N+ PC  Y+  GG+TVP
Sbjct  1    MGKSVVEKLLWMAIVCLVLGVI----SITPKAQAAVTCNQVVSNLTPCISYVLNGGKTVP  56

Query  457  KVCCDAVKSNLKVFGK---RTTVCDCIQDLVEG--ATEEQTDRFFALPGMCVDDSRLKFT  293
              CC+ +K+   +      R TVC CI++ V      +   DR  ALP  C  +   + +
Sbjct  57   GPCCNGIKTLFNLAHSTPDRQTVCKCIKNAVSAFHYGKSNVDRAAALPKQCGVNIPCQIS  116

Query  292  RHTNCSLVE  266
              T+C+ V+
Sbjct  117  PSTDCTRVQ  125



>ref|XP_006367904.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=116

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 42/84 (50%), Gaps = 3/84 (4%)
 Frame = -3

Query  511  TNIEPCYDYLQKGGETVPKVCCDAVKSNLKVFGK---RTTVCDCIQDLVEGATEEQTDRF  341
            +N+EPC  ++  GG TVP  CC  +KS L   G    R + C CI+ L   A   Q  R 
Sbjct  32   SNLEPCLGFVLNGGPTVPSACCSGLKSLLVAAGTTADRQSACKCIKSLASSANGVQIGRA  91

Query  340  FALPGMCVDDSRLKFTRHTNCSLV  269
              LPG+C      + + + +CS +
Sbjct  92   SQLPGICNAHIPYQISPNVDCSKI  115



>gb|AAT80665.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 59/127 (46%), Gaps = 15/127 (12%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            MA S  +NL  ++  CMA  V          A+   C  Q  +N+ PC+DY++ GG  VP
Sbjct  1    MASSAVINLALVVALCMAVSV----------AHAITCG-QVSSNLVPCFDYVRSGGP-VP  48

Query  457  KVCCDAVKSN---LKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRH  287
              CC+ +++     K    R   C+C++ L    +        +LPG C  +   K +  
Sbjct  49   PACCNGIRTINGLAKTTPDRQAACNCLKSLAGSVSGVNPGNVESLPGKCGVNVPYKISTS  108

Query  286  TNCSLVE  266
            TNC+ V+
Sbjct  109  TNCATVK  115



>ref|XP_006358720.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=119

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 4/85 (5%)
 Frame = -3

Query  511  TNIEPCYDYLQKGGETVPKVCCDAVKS---NLKVFGKRTTVCDCIQDLVEGATEEQTDRF  341
            ++++PC  Y+  GG  VP  CC+ +KS   N      R   C C+++L   AT+EQ DR 
Sbjct  36   SDLKPCLSYVLVGGN-VPTECCNGLKSLITNATTTEDRQMACSCVKNLATAATDEQVDRA  94

Query  340  FALPGMCVDDSRLKFTRHTNCSLVE  266
             +LPG C  +   K +R  +C+ V+
Sbjct  95   ASLPGKCGVNVPFKISRDVDCTKVK  119



>gb|AAT80652.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80660.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80661.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80662.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 59/127 (46%), Gaps = 15/127 (12%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            MA S  +NL  ++  CMA  V          A+   C  Q  +N+ PC+DY++ GG  VP
Sbjct  1    MASSAVINLALVVALCMAVSV----------AHAITCG-QVSSNLVPCFDYVRSGGP-VP  48

Query  457  KVCCDAVKSN---LKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRH  287
              CC+ +++     K    R   C+C++ L    +        +LPG C  +   K +  
Sbjct  49   PACCNGIRTINGLAKTTPDRQAACNCLKSLAGSVSGVNPGNAESLPGKCGVNVPYKISTS  108

Query  286  TNCSLVE  266
            TNC+ V+
Sbjct  109  TNCATVK  115



>gb|ADR66943.1| non-specific lipid transfer protein [Prunus avium]
Length=117

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 45/88 (51%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +N+ PC  Y+ +GG  VP  CC+ +++  NL K    R T C+C++ L         
Sbjct  31   QVSSNLAPCIPYV-RGGGAVPPACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNA  89

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   ALPG C  +   K +  TNC+ V+
Sbjct  90   NNAAALPGKCGVNVPYKISPSTNCATVK  117



>sp|Q9M5X8.1|NLTP_PRUAV RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Pru av 3; Flags: Precursor [Prunus avium]
 gb|AAF26449.1| lipid transfer protein precursor [Prunus avium]
Length=117

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 45/88 (51%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +N+ PC  Y+ +GG  VP  CC+ +++  NL K    R T C+C++ L         
Sbjct  31   QVSSNLAPCIAYV-RGGGAVPPACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNA  89

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   ALPG C  +   K +  TNC+ V+
Sbjct  90   NNAAALPGKCGVNVPYKISPSTNCATVK  117



>gb|ADR66942.1| non-specific lipid transfer protein [Prunus avium]
 gb|ADR66944.1| non-specific lipid transfer protein [Prunus avium]
Length=117

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 45/88 (51%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +N+ PC  Y+ +GG  VP  CC+ +++  NL K    R T C+C++ L         
Sbjct  31   QVSSNLAPCIAYV-RGGGAVPPACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNA  89

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   ALPG C  +   K +  TNC+ V+
Sbjct  90   NNAAALPGKCGVNVPYKISPSTNCATVK  117



>gb|AAT80650.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80651.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80653.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80654.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80655.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80656.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80657.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80658.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80659.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 58/127 (46%), Gaps = 15/127 (12%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            MA S  + L  ++  CMA  V          A+   C  Q  +N+ PC+DY++ GG  VP
Sbjct  1    MASSAVIKLALVVALCMAVSV----------AHAITCG-QVSSNLVPCFDYVRSGGP-VP  48

Query  457  KVCCDAVKSN---LKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRH  287
              CC+ +++     K    R   C+C++ L    +        +LPG C  +   K +  
Sbjct  49   PACCNGIRTINGLAKTTPDRQAACNCLKSLAGSVSGVNPGNAESLPGKCGVNVPYKISTS  108

Query  286  TNCSLVE  266
            TNC+ V+
Sbjct  109  TNCATVK  115



>ref|XP_004245408.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=120

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 3/85 (4%)
 Frame = -3

Query  511  TNIEPCYDYLQKGGETVPKVCCDAVKSNLKV---FGKRTTVCDCIQDLVEGATEEQTDRF  341
            +++EPC  Y+  GG +VP  CC   KS L +      R + C CI+     A E Q  R 
Sbjct  36   SSLEPCLGYVLGGGLSVPSECCGGSKSLLSMGCTIDDRQSACKCIKSAGSNANEAQLSRA  95

Query  340  FALPGMCVDDSRLKFTRHTNCSLVE  266
              LP +C  +   K + H +CS V 
Sbjct  96   ATLPRICKTNVPFKISPHVDCSKVN  120



>ref|XP_004240614.2| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=158

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 47/84 (56%), Gaps = 4/84 (5%)
 Frame = -3

Query  508  NIEPCYDYLQKGGETVPKVCCDAVKSNLK---VFGKRTTVCDCIQDLVEGATEEQTDRFF  338
            +++PC +Y+  GG  VP  CC+ +KS +        R ++C C++ L   AT+EQ DR  
Sbjct  76   DLKPCLNYVLVGGN-VPAECCNGLKSLIVKAITTADRQSICSCLKSLATTATDEQVDRAA  134

Query  337  ALPGMCVDDSRLKFTRHTNCSLVE  266
            +LPG C      K +R  +C+ V+
Sbjct  135  SLPGKCGVKVPFKISRDVDCTKVK  158



>gb|AAY83343.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 60/128 (47%), Gaps = 15/128 (12%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            MA+S  + L  + L C+        + A P A    C  Q  ++I PC +Y++ GG  VP
Sbjct  1    MAISTAMKLSLVALLCI--------VVALPIAQAITCG-QVASSIAPCVNYVKSGGA-VP  50

Query  457  KVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQTDRFFA-LPGMCVDDSRLKFTR  290
              CC+ V+   S  K    R T C+C++    GA +       A LPG C  +   K + 
Sbjct  51   AACCNGVRSLNSAAKTTADRQTTCNCLKQ-ASGAIKGLNPNLAAGLPGKCGVNVPYKIST  109

Query  289  HTNCSLVE  266
             TNC+ V+
Sbjct  110  STNCAAVK  117



>gb|AAT80663.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80664.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 58/127 (46%), Gaps = 15/127 (12%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            MA S  +NL  ++  CMA  V          A+   C  Q  +N+ PC+DY++  G  VP
Sbjct  1    MASSAVINLALVVALCMAVSV----------AHAITCG-QVSSNLVPCFDYVRSDGP-VP  48

Query  457  KVCCDAVKSN---LKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRH  287
              CC+ +++     K    R   C+C++ L    +        +LPG C  +   K +  
Sbjct  49   PACCNGIRTINGLAKTTPDRQAACNCLKSLAGSVSGVNPGNAESLPGKCGVNVPYKISTS  108

Query  286  TNCSLVE  266
            TNC+ V+
Sbjct  109  TNCATVK  115



>gb|AAY83345.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (47%), Gaps = 15/128 (12%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            MA+S  + L  + L C+        + A P A    C  Q  ++I PC +Y++ GG  VP
Sbjct  1    MAISTAMKLSLVALLCI--------VVALPIAQAITCG-QVASSISPCVNYVKSGGA-VP  50

Query  457  KVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQTDRFFA-LPGMCVDDSRLKFTR  290
              CC+ ++   S  K    R T C+C++    GA +       A LPG C  +   K + 
Sbjct  51   AACCNGIRSLNSAAKTTADRQTTCNCLKQ-ASGAIKGLNPNLAAGLPGKCGVNVPYKIST  109

Query  289  HTNCSLVE  266
             TNC+ V+
Sbjct  110  STNCAAVK  117



>sp|Q9M5X6.1|NLTP_PYRCO RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Pyr c 3; Flags: Precursor [Pyrus communis]
 gb|AAF26451.1| lipid transfer protein precursor [Pyrus communis]
Length=115

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 57/127 (45%), Gaps = 15/127 (12%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            MA S  + L  ++  CMA  V          A+   C  Q   N+ PC +Y++ GG  VP
Sbjct  1    MASSAVIKLALVVALCMAVSV----------AHAITCS-QVSANLAPCINYVRSGGA-VP  48

Query  457  KVCCDAVKSN---LKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRH  287
              CC+ +K+     K    R   C+C+++L    +        +LPG C  +   K +  
Sbjct  49   PACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTS  108

Query  286  TNCSLVE  266
            TNC+ V+
Sbjct  109  TNCATVK  115



>gb|ABB96481.1| non-specific lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 58/127 (46%), Gaps = 15/127 (12%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            MA S   NL  ++  CMA  V          A+   C  Q  +++ PC  Y++ GG  VP
Sbjct  1    MASSAVTNLALVVALCMAVSV----------AHAITCG-QVTSSLAPCIGYVRSGGA-VP  48

Query  457  KVCCDAVKSN---LKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRH  287
              CC+ +++     +    R T C+C+++L    +    +    LPG C  +   K +  
Sbjct  49   PACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTS  108

Query  286  TNCSLVE  266
            TNC+ V+
Sbjct  109  TNCATVK  115



>sp|P82534.1|NLTP1_PRUDO RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Major allergen Pru d 3; AltName: Allergen=Pur 
d 3 [Prunus domestica]
Length=91

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 45/88 (51%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +N+ PC +Y+ KGG  VP  CC+ +++  NL +    R   C+C++ L         
Sbjct  5    QVSSNLAPCINYV-KGGGAVPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNP  63

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   ALPG C  +   K +  TNC+ V+
Sbjct  64   NNAAALPGKCGVNVPYKISASTNCATVK  91



>ref|XP_004245407.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=117

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 3/84 (4%)
 Frame = -3

Query  511  TNIEPCYDYLQKGGETVPKVCCDAVKSNLKVFGK---RTTVCDCIQDLVEGATEEQTDRF  341
            T++EPC  ++  GG TVP  CC  +KS L   G    R + C CI+ L   A   Q  R 
Sbjct  33   TDLEPCLGFVLNGGLTVPSACCGGLKSLLVAAGTTADRQSACKCIKSLASSANGVQIGRA  92

Query  340  FALPGMCVDDSRLKFTRHTNCSLV  269
              LP +C  +   + + + +CS +
Sbjct  93   TQLPRICKVNVPYQISPNVDCSKI  116



>ref|XP_010253094.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=119

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 42/88 (48%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  ++I PC +YLQKGG  VP  CC  VK   S  K    R T C+C++         Q 
Sbjct  33   QVVSSIAPCLNYLQKGG-AVPPACCSGVKSLNSAAKTTPDRQTACNCLKSAAVSNPSIQA  91

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                +LP  C  +   K +  T+CS V+
Sbjct  92   GLASSLPAKCGVNVPYKISPSTDCSKVK  119



>ref|XP_010922736.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=120

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 45/107 (42%), Gaps = 4/107 (4%)
 Frame = -3

Query  577  VLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVKSNL---KVFGKR  407
            VL   L A P         Q   ++ PC  YL+ GG   P+ CC  V+S L   +    R
Sbjct  15   VLAMVLLASPRGTKAITCPQVYGDLNPCIQYLRSGGAVAPQ-CCSGVRSLLAAARTVTDR  73

Query  406  TTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
             T C CI+    G +     R  ALPG C      K +  T+CS + 
Sbjct  74   RTACRCIKTAAAGLSGLDIGRARALPGKCGVSIPYKISASTDCSKIN  120



>ref|XP_009346912.1| PREDICTED: non-specific lipid-transfer protein [Pyrus x bretschneideri]
Length=115

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 58/128 (45%), Gaps = 17/128 (13%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            MA S  + L  ++  CMA  V          A+   C  Q  +N+ PC +Y++ GG  VP
Sbjct  1    MASSAVIKLALVVALCMAVSV----------AHAITCG-QVSSNLAPCINYVRSGGA-VP  48

Query  457  KVCCDAVKSNLKVFGK----RTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTR  290
              CC+ +K+ +    K    R   C+C++ L    +        +LPG C  +   K + 
Sbjct  49   PACCNGIKT-INALAKTTPDRQAACNCLKSLSGSISGVNPGNAESLPGKCGVNVPYKIST  107

Query  289  HTNCSLVE  266
             TNC+ V+
Sbjct  108  STNCATVK  115



>ref|XP_008391369.1| PREDICTED: non-specific lipid-transfer protein [Malus domestica]
Length=113

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 55/124 (44%), Gaps = 15/124 (12%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            MA S  + L  ++  CMA  V          A+   C  Q  +N+ PC  YL+ GG  VP
Sbjct  1    MASSAVIKLALVVALCMAVSV----------AHAITCG-QVSSNLAPCIGYLRGGGP-VP  48

Query  457  KVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRH  287
              CC+ ++   S  +    R  VC+C++ L    +        +LPG C  +   K +  
Sbjct  49   PACCNGIRTINSLAETTPDRQAVCNCLKSLASSVSGVNPGNAESLPGKCGVNVPYKISTS  108

Query  286  TNCS  275
            TNC+
Sbjct  109  TNCT  112



>ref|XP_009770883.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=121

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 45/84 (54%), Gaps = 4/84 (5%)
 Frame = -3

Query  508  NIEPCYDYLQKGGETVPKVCCDAVKSNLKVFGKRT---TVCDCIQDLVEGATEEQTDRFF  338
            ++EPC  Y+  GG +VP  CC  +KS L     RT   + C C++ +   AT +Q  R  
Sbjct  39   SLEPCLGYVL-GGASVPPECCSGLKSLLGAARTRTDRQSACQCVKSVASSATGDQISRAA  97

Query  337  ALPGMCVDDSRLKFTRHTNCSLVE  266
            ++PG+C      K + + +CS ++
Sbjct  98   SIPGICKAKLPFKISANVDCSKIK  121



>gb|AAR22488.1| allergen Mal d 3 [Malus domestica]
Length=115

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 58/127 (46%), Gaps = 15/127 (12%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            MA S  + L  ++  CMA  V          A+   C  Q  +++ PC  Y++ GG  VP
Sbjct  1    MACSAVIKLALVVALCMAVSV----------AHAITCG-QVTSSLAPCIGYVRSGGA-VP  48

Query  457  KVCCDAVKSN---LKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRH  287
              CC+ +++     +    R T C+C+++L    +    +    LPG C  +   K +  
Sbjct  49   PACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTS  108

Query  286  TNCSLVE  266
            TNC+ V+
Sbjct  109  TNCATVK  115



>gb|AAT80649.1| lipid transfer protein precursor [Malus domestica]
 gb|ABB96482.1| non-specific lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 57/127 (45%), Gaps = 15/127 (12%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            MA S    L  ++  CMA  V          A+   C  Q  +++ PC  Y++ GG  VP
Sbjct  1    MASSAVTKLALVVALCMAVSV----------AHAITCG-QVTSSLAPCIGYVRNGGA-VP  48

Query  457  KVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRH  287
              CC+ ++   S  +    R T C+C+++L    +    +    LPG C  +   K +  
Sbjct  49   PACCNGIRTINSLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTS  108

Query  286  TNCSLVE  266
            TNC+ V+
Sbjct  109  TNCATVK  115



>gb|AEC04836.1| lipid transfer protein [Dimocarpus longan]
Length=115

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 53/121 (44%), Gaps = 12/121 (10%)
 Frame = -3

Query  619  LNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDA  440
            L L   L+ACM        L   P A       Q  +++ PC  YL+ GG +VP  CC+ 
Sbjct  4    LKLVCALVACM--------LVVSPVAQAAITCGQVTSSVAPCIQYLRSGG-SVPPPCCNG  54

Query  439  VKS---NLKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCSLV  269
            +KS     +    R   C C+Q+  +      T+    LPG C  +   K +  TNC+ V
Sbjct  55   IKSLNNAARTTPDRQQACRCLQNAAKAIPGINTNLAAGLPGKCGVNIPYKISTSTNCASV  114

Query  268  E  266
            +
Sbjct  115  K  115



>ref|XP_009593826.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
tomentosiformis]
Length=128

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 45/84 (54%), Gaps = 4/84 (5%)
 Frame = -3

Query  508  NIEPCYDYLQKGGETVPKVCCDAVKSNL---KVFGKRTTVCDCIQDLVEGATEEQTDRFF  338
            ++EPC  Y+  GG +VP  CC  +KS L   +    R + C C++ +   AT +Q  R  
Sbjct  46   SLEPCLGYVL-GGASVPPECCSGLKSLLSAARTRMDRQSACQCVKTVASSATGDQISRAA  104

Query  337  ALPGMCVDDSRLKFTRHTNCSLVE  266
            ++PG+C      K + + +CS ++
Sbjct  105  SIPGICKAKVPFKISANVDCSKIK  128



>gb|AET05731.1| lipid transfer protein isoform b, partial [Pyrus communis]
Length=94

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 43/88 (49%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKSN---LKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q   N+ PC +Y++ GG  VP  CC+ +K+     K    R   C+C+++L    +    
Sbjct  8    QVSANLAPCINYVRSGGA-VPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNP  66

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                +LPG C  +   K +  TNC+ V+
Sbjct  67   GNAESLPGKCGVNVPYKISTSTNCATVK  94



>emb|CAC86258.1| lipid transfer protein [Fragaria x ananassa]
Length=117

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 54/128 (42%), Gaps = 15/128 (12%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            MA S  + L  + L C+        + A P A    C  Q  +NI PC  Y++ GG  VP
Sbjct  1    MASSTAMKLSLVALLCI--------VVALPIAQAITCG-QVASNISPCLTYVKSGGA-VP  50

Query  457  KVCCDAVKSNLKVFGK----RTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTR  290
              CC  ++ NL    K    R   C+C++    G      +    LPG C      K + 
Sbjct  51   AACCSGIR-NLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKIST  109

Query  289  HTNCSLVE  266
             TNC+ V+
Sbjct  110  TTNCAAVK  117



>gb|KHN40624.1| Non-specific lipid-transfer protein 3 [Glycine soja]
Length=408

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 58/126 (46%), Gaps = 9/126 (7%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            M  S    L W+ + C+  GV+    S  P A       Q  +N+ PC  Y+  GG+ VP
Sbjct  1    MGKSVVEKLLWMAIVCLVLGVI----SITPKAQAAVTCNQVVSNLTPCISYVLNGGKAVP  56

Query  457  KVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEG--ATEEQTDRFFALPGMCVDDSRLKFT  293
              CC+ +K+  NL      R TVC CI++ V      +   DR  ALP  C  +   + +
Sbjct  57   GPCCNGIKTLFNLAHSTPDRQTVCKCIKNAVSAFHYGKSNVDRAAALPKQCGVNIPYQIS  116

Query  292  RHTNCS  275
              T+C+
Sbjct  117  PSTDCT  122



>gb|ABG54494.1| putative allergen Rub i 3 [Rubus idaeus]
Length=117

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 53/127 (42%), Gaps = 13/127 (10%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            MA S  + L  + L C+   V        P A    C  Q   N+ PC++Y++ GG  VP
Sbjct  1    MACSAVMKLALVALLCIVVAV--------PVAQAITCG-QVTQNVAPCFNYVKNGGA-VP  50

Query  457  KVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRH  287
              CC+ V+   S  K    R   C+C+++               LPG C      K +  
Sbjct  51   AACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCGVSVPYKISTS  110

Query  286  TNCSLVE  266
            TNC+ V+
Sbjct  111  TNCATVK  117



>gb|ADR66947.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 46/88 (52%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  Y+ +GG  VP  CC+ +++  NL +    R T C+C++ L    +    
Sbjct  31   QVSSSLAPCIGYV-RGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNP  89

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   ALPG C  +   K +  TNC+ V+
Sbjct  90   NNAAALPGKCGVNIPYKISASTNCATVK  117



>gb|AAK28533.1|AF329829_1 lipid transfer protein precursor [Corylus avellana]
Length=115

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 49/107 (46%), Gaps = 4/107 (4%)
 Frame = -3

Query  577  VLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVKS---NLKVFGKR  407
            VL   + A P A  +    Q   N+ PC  YL+ GG  +P  CC  V++     +    R
Sbjct  10   VLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGG-VLPPSCCKGVRAVNDASRTTSDR  68

Query  406  TTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
             + C+C++D  +G      +    LPG C  +   K +  TNC+ V+
Sbjct  69   QSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK  115



>gb|AGH27863.1| lipid transfer protein precursor [Prunus mira]
 gb|AGW21339.1| lipid transfer protein [Prunus mira]
Length=117

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 43/88 (49%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +N+ PC  Y+ +GG  VP  CC+ +++  NL +    R   C+C++ L         
Sbjct  31   QVSSNLAPCIPYV-RGGGAVPPTCCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNP  89

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   ALPG C      K +  TNC+ V+
Sbjct  90   NNAAALPGKCGVSIPYKISASTNCATVK  117



>ref|NP_001281295.1| non-specific lipid-transfer protein precursor [Malus domestica]
 sp|Q9M5X7.1|NLTP_MALDO RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Mal d 3; Flags: Precursor [Malus domestica]
 gb|AAF26450.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80633.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80634.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80635.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80636.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80637.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80638.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80639.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80640.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80641.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80642.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80643.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80644.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80645.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80646.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80647.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80648.1| lipid transfer protein precursor [Malus domestica]
 gb|AAV64878.1| major allergen and lipid transfer protein Mal d 3 [Malus domestica]
Length=115

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 57/127 (45%), Gaps = 15/127 (12%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            MA S    L  ++  CMA  V          A+   C  Q  +++ PC  Y++ GG  VP
Sbjct  1    MASSAVTKLALVVALCMAVSV----------AHAITCG-QVTSSLAPCIGYVRSGGA-VP  48

Query  457  KVCCDAVKSN---LKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRH  287
              CC+ +++     +    R T C+C+++L    +    +    LPG C  +   K +  
Sbjct  49   PACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTS  108

Query  286  TNCSLVE  266
            TNC+ V+
Sbjct  109  TNCATVK  115



>gb|ADR66953.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 44/88 (50%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +N+ PC  Y+ KGG  VP  CC+ +++  NL +    R   C+C++ L         
Sbjct  31   QVSSNLAPCIPYV-KGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNP  89

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   ALPG C  +   + +  TNC+ V+
Sbjct  90   NNAAALPGKCGVNIPYQISPSTNCANVK  117



>ref|XP_009372013.1| PREDICTED: non-specific lipid-transfer protein [Pyrus x bretschneideri]
Length=115

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 48/106 (45%), Gaps = 4/106 (4%)
 Frame = -3

Query  574  LFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVKSN---LKVFGKRT  404
            L  ALS   S        Q  +++ PC +Y  KGG  VP  CC+ +++     +    R 
Sbjct  11   LVVALSMAVSVAHAITCGQVTSSLAPCINY-AKGGGVVPPACCNGIRTINGIARTTADRQ  69

Query  403  TVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
              C+C+++L         +   ALPG C  +   K +  TNC+ V+
Sbjct  70   AACNCLKNLAGSIRGVNPNNAAALPGKCGVNVPYKISTSTNCATVK  115



>sp|P81651.2|NLTP1_PRUAR RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Major allergen Pru ar 3; AltName: Allergen=Pur 
ar 3 [Prunus armeniaca]
Length=91

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 46/88 (52%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  Y+ +GG  VP  CC+ +++  NL +    R T C+C++ L    +    
Sbjct  5    QVSSSLAPCIGYV-RGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNP  63

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   ALPG C  +   K +  TNC+ V+
Sbjct  64   NNAAALPGKCGVNIPYKISASTNCATVK  91



>emb|CCD33109.1| lipid transfer protein [Vigna radiata]
Length=116

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 43/89 (48%), Gaps = 6/89 (7%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKV-CCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQ  353
            Q  +++ PC  YLQKGG  VP   CC  VK   S       R T C+C+++L    +   
Sbjct  30   QVASSLAPCISYLQKGG--VPSASCCSGVKALNSAASTTADRKTACNCLKNLAGPKSGIN  87

Query  352  TDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                 +LPG C  +   K +  TNC+ ++
Sbjct  88   EGNAASLPGKCKVNVPYKISTSTNCANIK  116



>gb|ADR66948.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 46/88 (52%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  Y+ +GG  VP  CC+ +++  NL +    R T C+C++ L    +    
Sbjct  31   QVSSSLAPCIGYV-RGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNP  89

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   ALPG C  +   K +  TNC+ V+
Sbjct  90   NNAAALPGKCGVNIPYKISISTNCAAVK  117



>ref|XP_008798551.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=118

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 44/106 (42%), Gaps = 4/106 (4%)
 Frame = -3

Query  574  LFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVKSNL---KVFGKRT  404
            L   L A P         Q   ++ PC  YL+ GG   P+ CC  V+S L   +    R 
Sbjct  14   LAMVLLASPRGTKAITCPQVYGDLTPCIQYLRSGGAVAPQ-CCSGVRSLLAAARTVTDRR  72

Query  403  TVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            T C CI+    G +     R  ALPG C      K +  T+CS + 
Sbjct  73   TACRCIKTAAAGLSGLDIGRASALPGKCGVSIPYKISPSTDCSKIN  118



>gb|AET05730.1| lipid transfer protein isoform a, partial [Pyrus communis]
Length=94

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKSNLKVFGK---RTTVCDCIQDLVEGATEEQT  350
            Q  +N+ PC +Y++ GG  VP  CC+ +K+   +      R   C+C+++L    +    
Sbjct  8    QVSSNLAPCINYVRSGGA-VPPACCNGIKTINGLANTTPDRQAACNCLKNLAGSVSGVNP  66

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                +LPG C  +   K +  TNC+ V+
Sbjct  67   GNAESLPGKCGVNVPYKISTSTNCATVK  94



>gb|AAY83342.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 54/128 (42%), Gaps = 15/128 (12%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            MA S  + L  + L C+        + A P A    C  Q  +NI PC  Y++ GG  VP
Sbjct  1    MASSTAMKLSLVALLCI--------VVALPIAQAITCG-QVASNISPCVTYVKSGGA-VP  50

Query  457  KVCCDAVKSNLKVFGK----RTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTR  290
              CC  ++ NL    K    R   C+C++    G      +    LPG C      K + 
Sbjct  51   APCCSGIR-NLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKIST  109

Query  289  HTNCSLVE  266
             TNC+ V+
Sbjct  110  TTNCAAVK  117



>ref|XP_003516421.1| PREDICTED: non-specific lipid-transfer protein 1-like [Glycine 
max]
Length=117

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 52/119 (44%), Gaps = 11/119 (9%)
 Frame = -3

Query  613  LPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVK  434
            L  ++LACM   V    +             Q   N+ PC  +LQ GG  V + CC+ V+
Sbjct  7    LACMVLACMVVMVAHNTVQGIRCG-------QVQGNLAPCLGFLQNGGA-VSRGCCNGVR  58

Query  433  S---NLKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            S   N +  G R  VC+C++       +       ALPG C  +   K +  TNC+ ++
Sbjct  59   SIVNNARTTGDRRAVCNCLKIAAGAVRKLNPYNAQALPGKCGVNIPYKISTSTNCNSIK  117



>gb|ADR66950.1| non-specific lipid transfer protein [Prunus sargentii]
 gb|ADR66951.1| non-specific lipid transfer protein [Prunus sargentii]
 gb|ADR66952.1| non-specific lipid transfer protein [Prunus sargentii]
Length=117

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 43/88 (49%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +N+ PC  Y+ +GG  VP  CC+ +++  NL +    R   C+C++ L         
Sbjct  31   QVSSNLAPCIPYV-RGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNP  89

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +    LPG C  +   K +  TNC+ V+
Sbjct  90   NNAAVLPGKCGVNIPYKISPSTNCATVK  117



>ref|XP_008350568.1| PREDICTED: non-specific lipid-transfer protein isoform X1 [Malus 
domestica]
Length=124

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (52%), Gaps = 4/85 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKSN---LKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +N+ PC +Y+++GG  VP  CC+ +++     +    R T C+C+++L    +    
Sbjct  29   QVTSNLGPCINYVRRGGA-VPPACCNGIRTINGLARTTADRQTTCNCLKNLAGSISGVNP  87

Query  349  DRFFALPGMCVDDSRLKFTRHTNCS  275
            +   ALP  C  +   K +  TNC+
Sbjct  88   NNAAALPVKCGVNVPFKISTSTNCA  112



>gb|AAQ74628.1| lipid tranfer protein II [Vigna radiata]
 emb|CCF23017.1| lipid transfer protein [Vigna radiata]
 emb|CCF23314.1| lipid transfer protein [Vigna radiata]
Length=116

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 43/89 (48%), Gaps = 6/89 (7%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKV-CCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQ  353
            Q  +++ PC  YLQKGG  VP   CC  VK   S       R T C+C+++L    +   
Sbjct  30   QVASSLAPCISYLQKGG--VPSASCCSGVKALNSAASTTADRKTACNCLKNLAGPKSGIN  87

Query  352  TDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                 +LPG C  +   K +  TNC+ ++
Sbjct  88   EGNAASLPGKCKVNVPYKISTFTNCANIK  116



>ref|XP_008388341.1| PREDICTED: non-specific lipid-transfer protein-like [Malus domestica]
Length=113

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (52%), Gaps = 4/85 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKSN---LKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +N+ PC +Y+++GG  VP  CC+ +++     +    R T C+C+++L    +    
Sbjct  29   QVTSNLGPCINYVRRGGA-VPPACCNGIRTINGLARTTADRQTTCNCLKNLAGSISGVNP  87

Query  349  DRFFALPGMCVDDSRLKFTRHTNCS  275
            +   ALP  C  +   K +  TNC+
Sbjct  88   NNAAALPVKCGVNVPFKISTSTNCA  112



>ref|XP_007206674.1| hypothetical protein PRUPE_ppa023110mg [Prunus persica]
 gb|EMJ07873.1| hypothetical protein PRUPE_ppa023110mg [Prunus persica]
Length=118

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 42/88 (48%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +N+ PC  Y+ +GG  VP  CC+ +++  NL K    R   C+C++ L         
Sbjct  32   QLFSNLAPCIPYV-RGGGAVPPACCNGIRNVNNLAKTTPDRQAACNCLKQLSASIPGVNP  90

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   ALPG C      K +  TNC  V+
Sbjct  91   NNAAALPGKCGVSIPYKISASTNCKTVK  118



>sp|Q43017.1|NLTP1_PRUDU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Flags: Precursor [Prunus dulcis]
 emb|CAA65475.1| lipid transfer protein [Prunus dulcis]
 gb|ACE80964.1| putative allergen Pru du 3.01 [Prunus dulcis x Prunus persica]
 gb|ACH58427.1| lipid transfer protein [Prunus dulcis]
 gb|ADR66954.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 44/88 (50%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +N+ PC  Y+ +GG  VP  CC+ +++  NL +    R   C+C++ L         
Sbjct  31   QVSSNLAPCIPYV-RGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNP  89

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   ALPG C  +   + +  TNC+ V+
Sbjct  90   NNAAALPGKCGVNIPYQISPSTNCANVK  117



>gb|EYU42013.1| hypothetical protein MIMGU_mgv1a016621mg [Erythranthe guttata]
Length=114

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 38/87 (44%), Gaps = 3/87 (3%)
 Frame = -3

Query  517  FGTNIEPCYDYLQKGGETVPKVCCDAVKS---NLKVFGKRTTVCDCIQDLVEGATEEQTD  347
              + + PC +++  GG T P  CC+ +K+          R  VC C++ +   AT     
Sbjct  28   VASTLSPCINFVLYGGPTPPTSCCEGIKTLYNEATATADRQAVCSCLKSVASSATPAIIS  87

Query  346  RFFALPGMCVDDSRLKFTRHTNCSLVE  266
               ALPG C      K +  T+CS V 
Sbjct  88   NAAALPGKCGVSIPYKISPSTDCSSVH  114



>ref|XP_004302624.1| PREDICTED: non-specific lipid-transfer protein 1-like [Fragaria 
vesca subsp. vesca]
 gb|AAY83341.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 6/89 (7%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  ++I PC +Y++ GG  VP  CC+ ++   S  K    R   C+C++    GA +   
Sbjct  31   QVASSISPCVNYVKSGGA-VPAACCNGIRSLNSAAKTTADRQATCNCLKQ-ASGAIKGLN  88

Query  349  DRFFA-LPGMCVDDSRLKFTRHTNCSLVE  266
                A LPG C      K +  TNC+ V+
Sbjct  89   PSLAAGLPGKCGVSVPYKISTSTNCAAVK  117



>emb|CAB96874.1| mal d 3 [Malus domestica]
Length=91

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 44/88 (50%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKSN---LKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  Y++ GG  VP  CC+ +++     +    R T C+C+++L    +    
Sbjct  5    QVTSSLAPCIGYVRSGGA-VPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNP  63

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +    LPG C  +   K +  TNC+ V+
Sbjct  64   NNAAGLPGKCGVNVPYKISTSTNCATVK  91



>gb|ADR66949.1| non-specific lipid transfer protein [Prunus sargentii]
Length=117

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 43/88 (49%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVK--SNL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +N+ PC  Y+ +GG  VP  CC+ ++  +NL +    R   C+C++ L         
Sbjct  31   QVSSNLAPCIPYV-RGGGAVPPACCNGIRDVNNLARTTPDRQAACNCLKQLSASVPGVNP  89

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +    LPG C  +   K +  TNC+ V+
Sbjct  90   NNAAVLPGKCGVNIPYKISPSTNCATVK  117



>ref|XP_009781151.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=123

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 43/84 (51%), Gaps = 4/84 (5%)
 Frame = -3

Query  508  NIEPCYDYLQKGGETVPKVCCDAVKS---NLKVFGKRTTVCDCIQDLVEGATEEQTDRFF  338
            +++PC  Y+  GG +VP+ CC  +KS   N      R + C C+++L   AT E+  R  
Sbjct  41   DLQPCLSYVLVGG-SVPEECCSGLKSLLANATTTPDRQSACSCVKNLASAATGEEVSRAA  99

Query  337  ALPGMCVDDSRLKFTRHTNCSLVE  266
            ++ G C  +   K +   +CS V 
Sbjct  100  SITGQCGANVPFKISPDVDCSKVN  123



>gb|AET05732.1| lipid transfer protein isoform c, partial [Pyrus communis]
Length=94

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKSNLKVFGK---RTTVCDCIQDLVEGATEEQT  350
            Q  +N+ PC +Y++ GG  VP  CC+ +K+   +      R   C+C+++L    +    
Sbjct  8    QVSSNLAPCINYVRSGGA-VPPACCNGIKTINGLANTTPDRQAACNCLKNLAGSVSGVNP  66

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                +LPG C  +   K +  TNC+ V+
Sbjct  67   GNAESLPGKCGVNVPCKISTPTNCATVK  94



>ref|XP_008350569.1| PREDICTED: non-specific lipid-transfer protein isoform X2 [Malus 
domestica]
Length=123

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (52%), Gaps = 4/85 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKSN---LKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +N+ PC +Y+++GG  VP  CC+ +++     +    R T C+C+++L    +    
Sbjct  29   QVTSNLGPCINYVRRGGA-VPPACCNGIRTINGLARTTADRQTTCNCLKNLAGSISGVNP  87

Query  349  DRFFALPGMCVDDSRLKFTRHTNCS  275
            +   ALP  C  +   K +  TNC+
Sbjct  88   NNAAALPVKCGVNVPFKISTSTNCA  112



>ref|XP_008244970.1| PREDICTED: non-specific lipid-transfer protein 1 [Prunus mume]
Length=117

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 43/88 (49%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCD---AVKSNLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC +Y++KGG  VP  CC+   AV    +    R   C+C++ L    +    
Sbjct  31   QVSSSLAPCINYVRKGG-VVPPACCNGIRAVNGLARTTPDRRAACNCLKQLSGSISGVNP  89

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +    LPG C  +   K +  TNC+ V+
Sbjct  90   NNAAGLPGKCGVNIPYKISASTNCATVK  117



>ref|XP_008244959.1| PREDICTED: non-specific lipid-transfer protein 1-like [Prunus 
mume]
Length=117

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 41/88 (47%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVK--SNL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +N+ PC  Y+ KGG  VP  CC  ++  S L K    R   C+C++ L    +    
Sbjct  31   QVSSNLAPCIPYV-KGGGAVPPACCKGIRTVSGLAKTTADRQAACNCLKQLSGSISGVNP  89

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   ALPG C  +   K     NC+ V+
Sbjct  90   NNAAALPGKCGVNVPYKINTFINCAAVK  117



>ref|XP_004245406.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=122

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 56/116 (48%), Gaps = 5/116 (4%)
 Frame = -3

Query  604  LLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVKS--  431
            LLL C+A      +++AE +     C   + + +EPC  Y+  GG +VP  CC+ +KS  
Sbjct  9    LLLICIAVATT-PSIAAEDAITVVTCSTVY-SRLEPCLGYVLGGGLSVPSECCNGIKSLH  66

Query  430  -NLKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
               +    R   C C++++   AT  +  R   L G+C  ++  K     +CS V+
Sbjct  67   RAARTTADRQRFCRCLKNVRSNATNTRISRASQLTGICKVNALFKIRPDFDCSKVK  122



>gb|AAM22768.1| lipid transfer protein [Prunus persica]
Length=90

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 4/87 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +N+ PC  Y++ GG  VP  CC+ +++  NL +    R   C+C++ L         
Sbjct  5    QVSSNLAPCIPYVRVGGA-VPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNP  63

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLV  269
            +   ALPG C      K +  TNC+ V
Sbjct  64   NNAAALPGKCGVHIPYKISASTNCATV  90



>gb|AAL32039.1|AF439280_1 lipid transfer protein-like protein [Retama raetam]
Length=117

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 49/107 (46%), Gaps = 5/107 (5%)
 Frame = -3

Query  577  VLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKR  407
            +    + A P A    C  Q  +N+ PC  YLQ+GG  VP  CC+ VK   S+ +    +
Sbjct  12   ICMVMVGAAPIAQAITCG-QVVSNLTPCITYLQRGGA-VPGQCCNGVKTLVSSAQTTADK  69

Query  406  TTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
             T C+C++               +LPG C  +   K +  TNC+ ++
Sbjct  70   QTACNCLKSTAATIPNINFGNAGSLPGKCGVNLPYKISPSTNCASIK  116



>gb|EPS66894.1| hypothetical protein M569_07878 [Genlisea aurea]
Length=112

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 2/78 (3%)
 Frame = -3

Query  505  IEPCYDYLQKGGETVPKVCCD--AVKSNLKVFGKRTTVCDCIQDLVEGATEEQTDRFFAL  332
            + PC++Y+  GG   P+ C    A+K +      R TVC+C+Q L   A+         L
Sbjct  33   LYPCFNYVINGGTPPPQCCSSVSALKQSAATTADRQTVCNCLQQLAGQASPSMMSNAGKL  92

Query  331  PGMCVDDSRLKFTRHTNC  278
            PGMC  +     +  TNC
Sbjct  93   PGMCGVNIGFTISTSTNC  110



>ref|XP_007206159.1| hypothetical protein PRUPE_ppa013554mg [Prunus persica]
 gb|AAV64877.1| non-specific lipid transfer protein [Prunus persica]
 gb|ACE80965.1| putative allergen Pru p 3.01 [Prunus dulcis x Prunus persica]
 gb|ADR66939.1| non-specific lipid transfer protein [Prunus persica]
 gb|ADR66940.1| non-specific lipid transfer protein [Prunus persica var. nucipersica]
 gb|ADR66941.1| non-specific lipid transfer protein [Prunus persica var. nucipersica]
 gb|AFN71202.1| non-specific lipid transfer protein LTP1 precursor [Prunus persica]
 gb|EMJ07358.1| hypothetical protein PRUPE_ppa013554mg [Prunus persica]
 gb|AGH27867.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27868.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27869.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27870.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27871.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27872.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27873.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27874.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27875.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27876.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27877.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27878.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27879.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27880.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27881.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27882.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27883.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27884.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27885.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27886.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27887.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27888.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27889.1| lipid transfer protein precursor [Prunus persica]
 gb|AGW21334.1| lipid transfer protein [Prunus persica]
 gb|AGW21335.1| lipid transfer protein [Prunus persica]
 gb|AGW21336.1| lipid transfer protein [Prunus persica]
 gb|AGW21337.1| lipid transfer protein [Prunus persica]
 gb|AGW21338.1| lipid transfer protein [Prunus persica]
 gb|AGW21341.1| lipid transfer protein [Prunus persica]
 gb|AGW21342.1| lipid transfer protein [Prunus persica]
 gb|AGW21343.1| lipid transfer protein [Prunus persica]
 gb|AGW21345.1| lipid transfer protein [Prunus persica]
 gb|AGW21346.1| lipid transfer protein [Prunus persica]
 gb|AGW21347.1| lipid transfer protein [Prunus persica]
 gb|AGW21348.1| lipid transfer protein [Prunus persica]
 gb|AGW21349.1| lipid transfer protein [Prunus persica]
 gb|AGW21350.1| lipid transfer protein [Prunus persica]
 gb|AGW21351.1| lipid transfer protein [Prunus persica]
 gb|AGW21352.1| lipid transfer protein [Prunus persica]
 gb|AGW21353.1| lipid transfer protein [Prunus persica]
 gb|AGW21354.1| lipid transfer protein [Prunus persica]
 gb|AGW21355.1| lipid transfer protein [Prunus persica]
 gb|AGW21356.1| lipid transfer protein [Prunus persica]
 gb|AGW21357.1| lipid transfer protein [Prunus persica]
 gb|AGW21358.1| lipid transfer protein [Prunus persica]
Length=117

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 43/88 (49%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  Y+ +GG  VP  CC+ +++  NL +    R   C+C++ L         
Sbjct  31   QVSSSLAPCIPYV-RGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNP  89

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   ALPG C      K +  TNC+ V+
Sbjct  90   NNAAALPGKCGVSIPYKISASTNCATVK  117



>ref|XP_002532869.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
 gb|EEF29523.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
Length=116

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 4/89 (4%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKV-CCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQ  353
            Q  +++ PC +YL+  G T P   CC+ V+   S  K    R T C C++    G    Q
Sbjct  28   QVASSLGPCLNYLKGAGGTAPSAACCNGVRGINSAAKTTADRQTACQCLKSAANGIPGLQ  87

Query  352  TDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                 +LPG C  +   K +  TNC  ++
Sbjct  88   PKLAESLPGNCNVNIPYKISLSTNCQSIK  116



>gb|ACP43542.1| lipid transfer protein [Chimonanthus praecox]
Length=119

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 56/111 (50%), Gaps = 8/111 (7%)
 Frame = -3

Query  589  MAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVKS---NLKV  419
            M + +L ++L AE +A+     +   +++ PC  YL+ GG +VP  CC  VKS     K 
Sbjct  14   MFSSILLSSLQAE-AAFSCGTVV---SSLTPCLTYLKSGG-SVPTTCCSGVKSLNAAAKT  68

Query  418  FGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
               R T C+C+++   G T  + +   +LP  C  +   K +  T+CS V 
Sbjct  69   TPDRQTACNCMKNAAAGITGLKLELAGSLPTKCGVNIPYKISPSTDCSKVN  119



>ref|NP_001268074.1| lipid transfer protein precursor [Vitis vinifera]
 gb|AAO33394.1|AF467946_1 lipid transfer protein isoform 4 [Vitis vinifera]
Length=119

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 37/87 (43%), Gaps = 4/87 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  + + PC  YLQKGG  VP  CC  +K   S  K  G R   C C++      +    
Sbjct  33   QVASALSPCISYLQKGGA-VPAGCCSGIKSLNSAAKTTGDRQAACKCLKTFSSSVSGINY  91

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLV  269
                 LPG C      K +  T+CS V
Sbjct  92   GLASGLPGKCGVSVPYKISPSTDCSKV  118



>ref|XP_004302608.1| PREDICTED: non-specific lipid-transfer protein-like isoform 1 
[Fragaria vesca subsp. vesca]
 ref|XP_004302609.1| PREDICTED: non-specific lipid-transfer protein-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=116

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 41/88 (47%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS---NLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q   N+ PC++Y++ GG  VP  CC+ ++S     K    R   C+C++           
Sbjct  30   QVTQNVAPCFNYVKSGGA-VPAACCNGIRSLNSAAKTTADRKQTCNCLKSAAGSIKGLNA  88

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +    LPG C  +   K +  TNC+ V+
Sbjct  89   NLAAGLPGKCGVNVPYKISTSTNCNNVK  116



>gb|AAY83344.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 59/128 (46%), Gaps = 15/128 (12%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            MA+S  + L  + L C+        + A P A    C  Q  ++I PC +Y++ GG  VP
Sbjct  1    MAISTAMKLSLVALLCI--------VVALPIAQAITCG-QVASSIAPCVNYVKSGGA-VP  50

Query  457  KVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQTDRFFA-LPGMCVDDSRLKFTR  290
              CC+ ++   S  K    R T C+C++    GA +       A LPG    +   K + 
Sbjct  51   AGCCNGIRSLNSAAKTTADRQTTCNCLKQ-ASGAIKGLNPNLAAGLPGKXGVNVPYKIST  109

Query  289  HTNCSLVE  266
             TNC+ V+
Sbjct  110  STNCAAVK  117



>ref|NP_001044654.1| Os01g0822900 [Oryza sativa Japonica Group]
 dbj|BAD73499.1| putative lipid transfer protein [Oryza sativa Japonica Group]
 dbj|BAD87070.1| putative lipid transfer protein [Oryza sativa Japonica Group]
 dbj|BAF06568.1| Os01g0822900 [Oryza sativa Japonica Group]
 gb|EAY76313.1| hypothetical protein OsI_04247 [Oryza sativa Indica Group]
 gb|EAZ13979.1| hypothetical protein OsJ_03904 [Oryza sativa Japonica Group]
 dbj|BAG96400.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92575.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99561.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99603.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99771.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99850.1| unnamed protein product [Oryza sativa Japonica Group]
Length=120

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 41/84 (49%), Gaps = 5/84 (6%)
 Frame = -3

Query  505  IEPCYDYLQKGGETVPKVCCDAVKSNLKVFGK---RTTVCDCIQDLVEGAT-EEQTDRFF  338
            + PC  Y+Q GG TVP+ CC  ++S L        R T+C C++++  GA+      R  
Sbjct  38   LMPCLPYVQAGG-TVPRACCGGIQSLLAAANNTPDRRTICGCLKNVANGASGGPYITRAA  96

Query  337  ALPGMCVDDSRLKFTRHTNCSLVE  266
            ALP  C      K +   NC+ + 
Sbjct  97   ALPSKCNVSLPYKISTSVNCNAIN  120



>gb|AGH27866.1| lipid transfer protein precursor [Prunus kansuensis]
 gb|AGW21340.1| lipid transfer protein [Prunus kansuensis]
Length=117

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 43/88 (49%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  Y+ +GG  VP  CC+ +++  NL +    R   C+C++ L         
Sbjct  31   QVSSSLAPCIAYV-RGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNP  89

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   ALPG C      K +  TNC+ V+
Sbjct  90   NNAAALPGKCGVSIPYKISASTNCATVK  117



>emb|CAB96876.2| pru p 1 [Prunus persica]
Length=91

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 43/88 (49%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  Y+ +GG  VP  CC+ +++  NL +    R   C+C++ L         
Sbjct  5    QVSSSLAPCIPYV-RGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNP  63

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   ALPG C      K +  TNC+ V+
Sbjct  64   NNAAALPGKCGVSIPYKISASTNCATVK  91



>pdb|2ALG|A Chain A, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
 pdb|2ALG|B Chain B, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
 pdb|2B5S|A Chain A, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
 pdb|2B5S|B Chain B, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
Length=92

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 43/88 (49%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  Y+ +GG  VP  CC+ +++  NL +    R   C+C++ L         
Sbjct  6    QVSSSLAPCIPYV-RGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNP  64

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   ALPG C      K +  TNC+ V+
Sbjct  65   NNAAALPGKCGVSIPYKISASTNCATVK  92



>gb|AAV40850.1| lipid transfer protein 1 precursor [Prunus persica]
Length=117

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 43/88 (49%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  Y+ +GG  VP  CC+ +++  NL +    R   C+C++ L         
Sbjct  31   QASSSLAPCIPYV-RGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNP  89

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   ALPG C      K +  TNC+ V+
Sbjct  90   NNAAALPGKCGVSIPYKISASTNCATVK  117



>ref|XP_010509135.1| PREDICTED: non-specific lipid-transfer protein 1-like [Camelina 
sativa]
Length=118

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 53/127 (42%), Gaps = 14/127 (11%)
 Frame = -3

Query  631  LSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKV  452
            ++  + L  L LACM      TA +A      N       +N+ PC  Y+ +GG  +P  
Sbjct  1    MAGVMKLACLFLACMIVAGPITANAALSCGAVN-------SNLGPCIGYVLQGG-VIPPA  52

Query  451  CCDAVKSNLKVFGK----RTTVCDCIQDLVEG-ATEEQTDRFFALPGMCVDDSRLKFTRH  287
            CC  V+ NL    +    R   C+CIQ++  G        R   +P  C  +   K +  
Sbjct  53   CCTGVR-NLNNMARTTPDRQQACNCIQNVARGLGAGLNAGRVAGIPKACGVNIPYKISTS  111

Query  286  TNCSLVE  266
            TNC  V 
Sbjct  112  TNCKTVR  118



>gb|ABF06565.1| non-specific lipid transfer-like protein [Prosopis juliflora]
Length=117

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 49/107 (46%), Gaps = 5/107 (5%)
 Frame = -3

Query  577  VLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVKSNL---KVFGKR  407
            VL  AL   P A    C  Q  +++ PC  YLQKGG   P  CC+ VKS +   +    +
Sbjct  12   VLCVALVVAPMAEAVTCG-QVSSSLAPCIAYLQKGGTPAPG-CCNGVKSLVGAAQTTADK  69

Query  406  TTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
              VC+C++               +LP +C  +   K +  TNC+ ++
Sbjct  70   QAVCNCLKGAAGQVPGLNNQYAQSLPSLCGVNIPYKISTSTNCASIK  116



>gb|AAY83346.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 41/89 (46%), Gaps = 6/89 (7%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKSNLKVFGK----RTTVCDCIQDLVEGATEEQ  353
            Q   N+ PC++Y++ GG  VP  CC  V SNL    K    R   C+C++          
Sbjct  31   QVTHNVAPCFNYVKSGGA-VPAACCKGV-SNLNSMAKTTADRQQTCNCLKSAAGSIKGLN  88

Query  352  TDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
             +    LPG C  +   K +  TNC+ V+
Sbjct  89   ANLAAGLPGKCGVNVPYKISTSTNCNNVK  117



>ref|XP_003522128.1| PREDICTED: non-specific lipid-transfer protein 1-like [Glycine 
max]
Length=117

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 49/119 (41%), Gaps = 11/119 (9%)
 Frame = -3

Query  613  LPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVK  434
            L W++L CM        + A  +     C  Q   N+ PC  +L  GG  V + CC+ V+
Sbjct  7    LAWVVLVCM------VVMGAHNTVQGITCG-QVQGNLAPCLGFLHNGGA-VTRGCCNGVR  58

Query  433  S---NLKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            S   N +    R  VC+C+           T    ALPG C      K +  TNC+ + 
Sbjct  59   SIVSNARTTADRRGVCNCLMVAAGAVRRFNTYNAQALPGKCGVYIPYKISTSTNCNSIR  117



>gb|AAQ96338.1| lipid transfer protein [Vitis aestivalis]
Length=119

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 38/87 (44%), Gaps = 4/87 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  + + PC  YLQKGG  VP  CC  +K   S+ K    R   C C+++     +    
Sbjct  33   QVASALSPCISYLQKGGA-VPPACCSGIKSLNSSAKTTADRQAACKCLKNFSSTVSGINL  91

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLV  269
                 LPG C      K +  T+C+ V
Sbjct  92   SLASGLPGKCGVSVPYKISPSTDCTKV  118



>emb|CBW38498.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 38/88 (43%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  YL KGG  VP  CC  VK   S  K    R   C C++      +    
Sbjct  16   QVSSSLAPCISYLTKGGA-VPPACCSGVKSLNSAAKTTPDRQAACGCLKSAYNSISGVNA  74

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                +LPG C      K +  T+CS V+
Sbjct  75   GNAASLPGKCGVSIPYKISPSTDCSKVQ  102



>gb|AGH13363.1| lipid transfer protein, partial [Helianthus annuus]
Length=102

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 38/88 (43%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  YL KGG  VP  CC  VK   S  K    R   C C++      +    
Sbjct  16   QVSSSLAPCISYLTKGG-AVPPACCSGVKSLNSAAKTTPDRQAACGCLKSAYNSISGINA  74

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                +LPG C      K +  T+CS V+
Sbjct  75   GNAASLPGKCGVSIPYKISPSTDCSKVQ  102



>ref|XP_006644921.1| PREDICTED: non-specific lipid-transfer protein 6-like [Oryza 
brachyantha]
Length=120

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 40/84 (48%), Gaps = 5/84 (6%)
 Frame = -3

Query  505  IEPCYDYLQKGGETVPKVCCDAVKSNLKVFGK---RTTVCDCIQDLVEGAT-EEQTDRFF  338
            + PC  Y+Q GG TVP+ CC  ++S L        R T+C C++ +  GA+      R  
Sbjct  38   LMPCLPYVQAGG-TVPRACCGGIQSLLAAANNTPDRRTICGCLKSVANGASGGPYITRAA  96

Query  337  ALPGMCVDDSRLKFTRHTNCSLVE  266
            ALP  C      K +   NC+ + 
Sbjct  97   ALPSKCNVSLPYKISTSVNCNAIN  120



>ref|XP_002458690.1| hypothetical protein SORBIDRAFT_03g038280 [Sorghum bicolor]
 gb|EES03810.1| hypothetical protein SORBIDRAFT_03g038280 [Sorghum bicolor]
Length=123

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 42/87 (48%), Gaps = 5/87 (6%)
 Frame = -3

Query  511  TNIEPCYDYLQKGGETVPKVCCDAVKSNLKVFGK---RTTVCDCIQDLVEGATEEQT--D  347
            + + PC  ++Q GG   P+ CC  ++S L        R T+C C++++  GA    T  +
Sbjct  37   STLMPCLPFVQMGGAMPPQPCCGGIRSLLAQANNTPDRRTICGCLKNVANGANGSDTYIN  96

Query  346  RFFALPGMCVDDSRLKFTRHTNCSLVE  266
            R  ALP  C      K + + NC+ + 
Sbjct  97   RAAALPSKCGVSLPYKISTNVNCNTIN  123



>emb|CBW38501.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 38/88 (43%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  YL KGG  VP  CC  VK   S  K    R   C C++      +    
Sbjct  16   QVSSSLAPCISYLTKGG-AVPPACCSGVKSLNSAAKTTPDRQAACGCLKSAYNSISGINA  74

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                +LPG C      K +  T+CS V+
Sbjct  75   GNAASLPGKCGVSIPYKISPSTDCSKVQ  102



>ref|XP_007140137.1| hypothetical protein PHAVU_008G087100g [Phaseolus vulgaris]
 gb|ESW12131.1| hypothetical protein PHAVU_008G087100g [Phaseolus vulgaris]
Length=212

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 55/122 (45%), Gaps = 11/122 (9%)
 Frame = -3

Query  616  NLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAV  437
            N+  L +ACM   VL   +   P            T++ PC  YL  GG T    CC+ V
Sbjct  96   NMASLKVACMV--VLCMGVVGAPMMAQAISCGDVTTDLAPCLSYLMNGG-TASDACCEGV  152

Query  436  KSNLKVFG---KRTTVCDCIQDLVE--GATEEQTDRFFALPGMCVDDSRLKFTRHTNCSL  272
            +S L   G   ++ TVC+C++D     G  +       ALPG+C      K +R TNC+ 
Sbjct  153  RSILGAAGTTSEKQTVCNCLKDAANNFGINDNYAQ---ALPGLCNVSVPYKISRSTNCAN  209

Query  271  VE  266
            + 
Sbjct  210  IR  211



>gb|AEI70830.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 38/88 (43%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS---NLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  YL KGG  VP  CC  VKS     K    R   C C++      +    
Sbjct  30   QVSSSLAPCISYLTKGGA-VPPACCSGVKSLNCAAKTTPDRQAACGCLKSAYNSISGINA  88

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                +LPG C      K +  T+CS V+
Sbjct  89   GNAASLPGKCGVSIPYKISPSTDCSKVQ  116



>gb|AFR43292.1| lipid transfer protein precursor [Gossypium hirsutum]
Length=120

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 50/112 (45%), Gaps = 4/112 (4%)
 Frame = -3

Query  589  MAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGET-VPKVCCDAVKS---NLK  422
            +A GV+   +   P A       Q  + + PC  Y++  G   VP  CC+ ++S     +
Sbjct  9    LACGVVLCLVVGAPLAEGAISCGQVISALAPCIPYVRNNGAGGVPASCCNGIRSLNEAAQ  68

Query  421  VFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
               +R + C+C++ L    +    D    LPGMC   S  K +  TNC  V+
Sbjct  69   STPERQSACNCVKALAASISGINYDLTNKLPGMCGVHSPFKISPSTNCKSVK  120



>gb|ADR66946.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 42/88 (48%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q   ++ PC  Y+  GG  VP  CC+ +++  NL K    R   C+C++ L         
Sbjct  31   QVSNSVAPCIPYVIGGGA-VPPACCNGIRNVENLAKTTADRQAACNCLKQLSGSIPGVNP  89

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   ALPG C  +   K +  TNC+ V+
Sbjct  90   NNAAALPGKCGVNVPYKISISTNCAAVK  117



>ref|XP_010252074.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=120

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 46/107 (43%), Gaps = 4/107 (4%)
 Frame = -3

Query  577  VLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVKS---NLKVFGKR  407
            VL   + A P+A          T + PC +YLQ GG  VP  CC+ VK+     K    R
Sbjct  15   VLAFMVVAAPNAEAAITCGMVATQMTPCVNYLQNGGP-VPAACCNGVKTLYGAAKTTPDR  73

Query  406  TTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
             T C C++         +     +LPG C      K +  T+CS V+
Sbjct  74   QTTCSCMKSAATQVPTIKVGNAASLPGKCGITIPYKISPTTDCSKVK  120



>ref|XP_010517150.1| PREDICTED: non-specific lipid-transfer protein 1-like [Camelina 
sativa]
Length=118

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 53/127 (42%), Gaps = 14/127 (11%)
 Frame = -3

Query  631  LSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKV  452
            ++  + L  L LACM      TA +A      N       +N+ PC  Y+ +GG  +P  
Sbjct  1    MAGVMKLACLFLACMIVAGPITADAALSCGAVN-------SNLGPCIGYVLQGG-VIPPA  52

Query  451  CCDAVKSNLKVFGK----RTTVCDCIQDLVEG-ATEEQTDRFFALPGMCVDDSRLKFTRH  287
            CC  V+ NL    +    R   C+CIQ +  G  +     R   +P  C  +   K +  
Sbjct  53   CCTGVR-NLNSMARTTPDRQQACNCIQTVARGLGSGLNAGRVAGIPKACGVNIPYKISTS  111

Query  286  TNCSLVE  266
            TNC  V 
Sbjct  112  TNCKTVR  118



>ref|NP_001241144.1| uncharacterized protein LOC100817318 precursor [Glycine max]
 gb|ACU20523.1| unknown [Glycine max]
Length=122

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/116 (28%), Positives = 53/116 (46%), Gaps = 6/116 (5%)
 Frame = -3

Query  598  LACMAAGV-LFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVKS---  431
            +AC+ A + +  A+S  P A       Q   ++ PC  YL+ GG+     CC+ VKS   
Sbjct  7    VACVVAMMCMVVAMSVTPMAQAAITCGQVAGDVSPCLSYLRSGGKP-SDACCNGVKSLSG  65

Query  430  NLKVFGKRTTVCDCIQDLVEGATEE-QTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
              K    R   C+C+++L     +        +LPG C  +   K +  TNC+ ++
Sbjct  66   AAKTTADRQAACNCLKNLANNMGQSLNAGNAASLPGKCGVNIPYKISTSTNCATIK  121



>gb|KHG30577.1| Non-specific lipid-transfer [Gossypium arboreum]
Length=120

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 52/128 (41%), Gaps = 12/128 (9%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQ-KGGETV  461
            MA S  L L  +++ CM  G         P A       Q   ++ PC +YL+  G   V
Sbjct  1    MASSMSLKLACVVVLCMVVG--------APLAQGAVTCGQVTNSLAPCINYLRGSGAGAV  52

Query  460  PKVCCDAVKS---NLKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTR  290
            P VCC  +KS     +    R   C CI+    G T         LPG C  +   K + 
Sbjct  53   PPVCCSGIKSLNSAAQTTPDRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISP  112

Query  289  HTNCSLVE  266
             T+C+ V+
Sbjct  113  STDCNSVK  120



>ref|XP_011095132.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
Length=123

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 61/127 (48%), Gaps = 7/127 (6%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            MA S  +   +++L  +AA  + +  +A P     +C  +  + + PC++Y+  GG+ VP
Sbjct  1    MARSGMIKATFIVLIAVAA--VVSTEAAAPPPPKISCG-KVTSTLAPCFEYVLNGGK-VP  56

Query  457  KVCCDAVKSNLK---VFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRH  287
              CCD VKS  K       R  VC C++ +   A+    +   +LPG C      + T  
Sbjct  57   NSCCDGVKSLYKEASTTADRREVCVCLKSVTSSASPGVINNAKSLPGKCGVSIPYEITPA  116

Query  286  TNCSLVE  266
             +C+ V+
Sbjct  117  IDCNKVK  123



>gb|AEI70828.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 40/88 (45%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  YL KGG  VP  CC+ VK   S  K    R   C C++      +    
Sbjct  30   QVSSSLAPCIGYLTKGGA-VPPACCNGVKSLNSAAKTTPDRQAACGCLKSAYSSISGINE  88

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                +LPG C  +   K +  T+CS V+
Sbjct  89   GNAASLPGKCGVNIPYKISPGTDCSKVQ  116



>ref|NP_001147136.1| LOC100280743 precursor [Zea mays]
 ref|NP_001281242.1| uncharacterized protein LOC100382960 precursor [Zea mays]
 gb|ACG24635.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG25611.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG34347.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG37789.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACL53179.1| unknown [Zea mays]
 gb|AFS50811.1| putative lipid-transfer protein 3 [Zea mays]
 tpg|DAA57056.1| TPA: non-specific lipid-transfer protein [Zea mays]
Length=123

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 42/87 (48%), Gaps = 5/87 (6%)
 Frame = -3

Query  511  TNIEPCYDYLQKGGETVPKVCCDAVKSNLKVFGK---RTTVCDCIQDLVEGATEEQT--D  347
            + + PC  ++Q GG   P+ CC  ++S L+       R T+C C++++  GA    T   
Sbjct  37   STLMPCLPFVQMGGAMPPQPCCGGIRSLLQQANNTPDRRTICGCLKNVANGANGSGTYIS  96

Query  346  RFFALPGMCVDDSRLKFTRHTNCSLVE  266
            R  ALP  C      K + + NC+ + 
Sbjct  97   RAAALPSKCGVALPYKISTNVNCNTIN  123



>gb|AFR43293.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 50/112 (45%), Gaps = 4/112 (4%)
 Frame = -3

Query  589  MAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGET-VPKVCCDAVKS---NLK  422
            +A GV+   +   P A       Q  + + PC  Y++  G   VP  CC+ ++S     +
Sbjct  9    LACGVVLCLVVGAPLAEGAISCGQAISALAPCIPYVRNNGAGGVPASCCNGIRSLNEAAQ  68

Query  421  VFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
               +R + C+C++ L    +    D    LPGMC   S  K +  TNC  V+
Sbjct  69   STPERQSACNCVKALAASISGINYDLTNKLPGMCGVHSPFKISPSTNCKSVK  120



>sp|P81402.1|NLTP1_PRUPE RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Allergen Pru p 1; AltName: Full=Major allergen 
Pru p 3; AltName: Allergen=Pru p 3 [Prunus persica]
Length=91

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 42/88 (48%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  + + PC  Y+ +GG  VP  CC+ +++  NL +    R   C+C++ L         
Sbjct  5    QVSSALAPCIPYV-RGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNP  63

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   ALPG C      K +  TNC+ V+
Sbjct  64   NNAAALPGKCGVHIPYKISASTNCATVK  91



>gb|AFR43291.1| lipid transfer protein precursor [Gossypium raimondii]
Length=120

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 50/112 (45%), Gaps = 4/112 (4%)
 Frame = -3

Query  589  MAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGET-VPKVCCDAVKS---NLK  422
            +A GV+   +   P A       Q  + + PC  Y++  G   VP  CC+ ++S     +
Sbjct  9    LACGVVLCLVVGAPLAEGAISCGQVISALAPCIPYVRNNGAGGVPAPCCNGIRSLNAAAQ  68

Query  421  VFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
               +R + C+C++ L    +    D    LPGMC   S  K +  TNC  V+
Sbjct  69   STPERQSACNCVKALAASISGINYDLTNKLPGMCGAYSPFKISPSTNCKSVK  120



>gb|AFR43285.1| lipid transfer protein precursor [Gossypium herbaceum subsp. 
africanum]
 gb|AFR43286.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43287.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 49/112 (44%), Gaps = 4/112 (4%)
 Frame = -3

Query  589  MAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGET-VPKVCCDAVKS---NLK  422
            +A GV+   +   P A       Q  + + PC  Y++  G   VP  CC+ ++S     +
Sbjct  9    LACGVVLCLVVGAPLAEGAISCGQVISALAPCIPYVRNNGAGGVPAPCCNGIRSLNAAAQ  68

Query  421  VFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
               +R + C C++ L    +    D    LPGMC   S  K +  TNC  V+
Sbjct  69   STPERQSACSCVKALAASISGINYDLTNKLPGMCGVHSPFKISPSTNCKSVK  120



>gb|ABA29446.1| non-specific lipid transfer protein [Vitis vinifera]
Length=119

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 39/87 (45%), Gaps = 4/87 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++  C +YLQKGG  VP  CC  +K   S  K  G R T C C++      +    
Sbjct  33   QVASSLSQCINYLQKGGA-VPPGCCSGIKSLNSAAKTTGDRQTACKCLKTFSSSISGINF  91

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLV  269
                 LPG C      K +  T+CS V
Sbjct  92   GLASGLPGKCGVSVPYKISPSTDCSKV  118



>ref|XP_008244949.1| PREDICTED: non-specific lipid-transfer protein-like [Prunus mume]
Length=117

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 50/112 (45%), Gaps = 7/112 (6%)
 Frame = -3

Query  589  MAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVKSNLKVFGK  410
            +A  V    + + P AY   C  Q   N+ PC DYL+  G  VPK CC  + SNL   G+
Sbjct  9    LAVFVALCMVVSVPIAYAITCD-QVSRNLVPCLDYLRNCG-AVPKPCCRGI-SNLNDLGR  65

Query  409  ----RTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                R T+C+C++      T         LP  C  +   K   + NC+ VE
Sbjct  66   TTAERRTICNCLKHNASSLTGVNPTMAEELPAKCGVNVPYKIRPNPNCTNVE  117



>gb|KHL91133.1| hypothetical protein QW71_36410 [Paenibacillus sp. IHB B 3415]
Length=115

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 51/114 (45%), Gaps = 7/114 (6%)
 Frame = -3

Query  598  LACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVK---SN  428
            +AC+A  VL   +   P A    C  Q   N+  C  YL+KGG  VP  CC+ V+   S 
Sbjct  6    IACLA--VLCMVVVVAPYAEAVTCG-QVQGNLAQCLGYLRKGG-AVPGPCCNGVRAMNSA  61

Query  427  LKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
             K    R   C C+Q   +  T    +   +LPG C  +   K +  T+CS V 
Sbjct  62   AKTSADRKQTCVCLQQASKSITGINPEAAASLPGKCGVNVPYKISPSTDCSKVH  115



>sp|Q39794.1|NLTP_GERHY RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Gerbera hybrid cultivar]
 emb|CAA83459.1| lipid transfer protein [Gerbera hybrid cultivar]
Length=116

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 41/88 (47%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  + + PC+ YL  GG  VP  CC+ V+   +  K    R T C C++ ++   T    
Sbjct  30   QVTSGLVPCFGYLAAGGP-VPPACCNGVRGLNNAAKTTPDRQTACGCLKGILAANTRINL  88

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +   +LPG C      K T + +CS + 
Sbjct  89   NNANSLPGKCGISIGYKITPNIDCSKIH  116



>gb|KHG09722.1| Non-specific lipid-transfer [Gossypium arboreum]
Length=120

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 55/128 (43%), Gaps = 12/128 (9%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGET-V  461
            MA +  + L W+++ C+  G         P A       Q  + + PC  +++  G   V
Sbjct  1    MASTMSVKLAWVMVLCLIVG--------APLAKGAISCGQVISTLTPCIPFVRNNGAVAV  52

Query  460  PKVCCDAVKS---NLKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTR  290
            P  CC+ ++S     +   +R + C+C++ L    +    D    LP MC   S  K + 
Sbjct  53   PAPCCNGIRSLNAAAQSTPERQSACNCVKALAASISGINYDLTNKLPSMCGVHSPFKISP  112

Query  289  HTNCSLVE  266
             TNC  V+
Sbjct  113  STNCKSVK  120



>gb|AGW21344.1| lipid transfer protein [Prunus persica]
Length=117

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (48%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVKS--NL-KVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  Y+ +GG  VP  CC+ +++  NL +    R   C+C++ L         
Sbjct  31   QVSSSLAPCIPYV-RGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNP  89

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +    LPG C      K +  TNC+ V+
Sbjct  90   NNAAVLPGKCGVSIPYKISASTNCATVK  117



>emb|CBW38499.1| lipid transfer protein [Helianthus annuus]
 emb|CBW38500.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 39/88 (44%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  YL KGG  VP  CC+ VK   +  K    R   C C++      +    
Sbjct  16   QVSSSLAPCIGYLTKGG-AVPPACCNGVKGLNNAAKTTPDRQAACGCLKSAYNSISGINA  74

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                +LPG C      K +  T+CS V+
Sbjct  75   GNAASLPGKCGVSIPYKISPSTDCSKVQ  102



>gb|KHN33231.1| Non-specific lipid-transfer protein 1 [Glycine soja]
Length=133

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 48/116 (41%), Gaps = 11/116 (9%)
 Frame = -3

Query  613  LPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVK  434
            L W++L CM        + A  +     C  Q   N+ PC  +L  GG  V + CC+ V+
Sbjct  7    LAWVVLVCM------VVMGAHNTVQGITCG-QVQGNLAPCLGFLHNGGA-VTRGCCNGVR  58

Query  433  S---NLKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCS  275
            S   N +    R  VC+C+           T    ALPG C      K +  TNC+
Sbjct  59   SIVSNARTTADRRGVCNCLMVAAGAVRRFNTYNAQALPGKCGVYIPYKISTSTNCN  114



>emb|CBW38503.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 39/88 (44%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  YL KGG  VP  CC+ VK   +  K    R   C C++      +    
Sbjct  16   QVSSSLAPCIGYLTKGG-AVPPACCNGVKGLNNAAKTTPDRQAACGCLKSAYNSISGINA  74

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                +LPG C      K +  T+CS V+
Sbjct  75   GNAASLPGKCGVSIPYKISPSTDCSKVQ  102



>ref|NP_001240073.1| uncharacterized protein LOC100815185 precursor [Glycine max]
 gb|ACU20651.1| unknown [Glycine max]
Length=122

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 46/102 (45%), Gaps = 5/102 (5%)
 Frame = -3

Query  559  SAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDC  389
            SA P A       Q   ++ PC+ YL+ GG+   + CC+ VK   S  K    R   C C
Sbjct  21   SAAPMAQAAITCGQVAGDMSPCFSYLRSGGKPS-QACCNGVKSLSSAAKTTADRQGACSC  79

Query  388  IQDLVEGATEE-QTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +++L     +        +LPG C  +   K +  TNC+ ++
Sbjct  80   LKNLANNMGQSLNAGNAASLPGKCGVNIPYKISTSTNCATIK  121



>ref|XP_010464583.1| PREDICTED: non-specific lipid-transfer protein 6-like [Camelina 
sativa]
Length=113

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 40/79 (51%), Gaps = 6/79 (8%)
 Frame = -3

Query  499  PCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGA--TEEQTDRFFA  335
            PC  Y+ +GG TVP+ CC+ +K   S  +    R +VC CI+  + G   T    +   +
Sbjct  32   PCVSYIVQGG-TVPESCCNGIKALNSQAQTSADRQSVCRCIKSAIGGVSYTSNNLNNALS  90

Query  334  LPGMCVDDSRLKFTRHTNC  278
            LP  C  +   +F+  TNC
Sbjct  91   LPSKCGLNLPYRFSPSTNC  109



>gb|ACE07189.1| Art v 3 allergen precursor [Artemisia vulgaris]
Length=117

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 43/86 (50%), Gaps = 4/86 (5%)
 Frame = -3

Query  514  GTNIEPCYDYLQKGGETVPKVCCDAVKS---NLKVFGKRTTVCDCIQDLVEGATEEQTDR  344
             T I PC +YL+KGGE VP  CC  VK      K    R T C+C++   +   + ++D 
Sbjct  33   STKISPCLNYLKKGGE-VPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDF  91

Query  343  FFALPGMCVDDSRLKFTRHTNCSLVE  266
               LP  C  +   K +  T+C+ V+
Sbjct  92   AVPLPSKCGLNLPYKLSLETDCNKVK  117



>ref|XP_006367906.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=121

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 44/85 (52%), Gaps = 3/85 (4%)
 Frame = -3

Query  511  TNIEPCYDYLQKGGETVPKVCCDAVKS---NLKVFGKRTTVCDCIQDLVEGATEEQTDRF  341
            +++EPC  Y+  GG +VP  CC  +KS     +    R   C C++++   AT+ + +R 
Sbjct  37   SSLEPCLGYVLGGGLSVPSECCSGIKSLHRAARTTADRQRFCRCLKNVRSNATDTRINRA  96

Query  340  FALPGMCVDDSRLKFTRHTNCSLVE  266
              L G+C  ++  K     +CS V+
Sbjct  97   SKLTGICKVNAFFKIRPDFDCSKVK  121



>gb|KHN44829.1| Non-specific lipid-transfer protein 1 [Glycine soja]
Length=199

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 49/113 (43%), Gaps = 11/113 (10%)
 Frame = -3

Query  604  LLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVKS--  431
            ++LACM   V    +             Q   N+ PC  +LQ GG  V + CC+ V+S  
Sbjct  10   MVLACMVVMVAHNTVQGIRCG-------QVQGNLAPCLGFLQNGG-AVSRGCCNGVRSIV  61

Query  430  -NLKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCS  275
             N +  G R  VC+C++       +       ALPG C  +   K +  TNC+
Sbjct  62   NNARTTGDRRAVCNCLKIAAGAVRKLNPYNAQALPGKCGVNIPYKISTSTNCN  114



>emb|CBW38504.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 39/88 (44%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  YL KGG  VP  CC+ VK   +  K    R   C C++      +    
Sbjct  16   QVSSSLAPCIGYLTKGG-AVPPACCNGVKGLNNAAKTTPDRQAACGCLKSAYNSISGINA  74

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                +LPG C      K +  T+CS V+
Sbjct  75   GNAASLPGKCGVSIPYKISPSTDCSKVQ  102



>emb|CDP14199.1| unnamed protein product [Coffea canephora]
Length=117

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 49/114 (43%), Gaps = 6/114 (5%)
 Frame = -3

Query  598  LACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVK---SN  428
            +AC+    +  A+S  P A    C    G ++  C  YLQKGG  VP  CC  ++   S 
Sbjct  7    VACLVLMCMLVAVSLAPHAEAITCNTVAG-DLGACLGYLQKGGA-VPAGCCTGIRSLNSQ  64

Query  427  LKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
             K    R T C C++ L  G           LPG C  +     +  TNC+ V+
Sbjct  65   AKTTVDRRTACSCLKSL-AGRVRVNQGLAAGLPGKCGVNVGYPISTSTNCNSVQ  117



>ref|XP_010043291.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW88360.1| hypothetical protein EUGRSUZ_A00746 [Eucalyptus grandis]
Length=119

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 50/127 (39%), Gaps = 11/127 (9%)
 Frame = -3

Query  637  MALSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVP  458
            MA S  L L  +LLACM A       +            Q  +++ PC  Y + G   VP
Sbjct  1    MASSALLKLACVLLACMVAVAPAARAAVT--------CGQVSSSLAPCIPYSRSGAGAVP  52

Query  457  KVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQTDRFFALPGMCVDDSRLKFTRH  287
              CC+ ++   S  +    R   C C++ L    +         LPG C      K +  
Sbjct  53   AACCNGIRSLNSAARTTPDRQAACKCLKSLTGSISGLNYGVVAGLPGKCGVSIPYKISPS  112

Query  286  TNCSLVE  266
            TNC+ V+
Sbjct  113  TNCNSVK  119



>gb|AEI70827.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 39/88 (44%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  YL KGG  VP  CC+ VK   +  K    R   C C++      +    
Sbjct  30   QVSSSLAPCIGYLTKGGA-VPPACCNGVKGLNNAAKTTPDRQAACGCLKSAYNSISGVNA  88

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                +LPG C      K +  T+CS V+
Sbjct  89   GNAASLPGKCGVSIPYKISPGTDCSKVQ  116



>ref|XP_010464489.1| PREDICTED: non-specific lipid-transfer protein 6-like [Camelina 
sativa]
Length=113

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 39/79 (49%), Gaps = 6/79 (8%)
 Frame = -3

Query  499  PCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGA--TEEQTDRFFA  335
            PC  Y+ +GG  VP+ CC+ +K   S  +    R +VC CI+  + G   T    +   +
Sbjct  32   PCVSYIVQGGN-VPESCCNGIKALNSQAQTAADRQSVCRCIKSAIGGVSYTSNNLNNALS  90

Query  334  LPGMCVDDSRLKFTRHTNC  278
            LP  C  +   KF+  TNC
Sbjct  91   LPSKCGLNLPYKFSPSTNC  109



>gb|AAL27855.1| lipid transfer protein precursor [Davidia involucrata]
Length=120

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 40/84 (48%), Gaps = 4/84 (5%)
 Frame = -3

Query  508  NIEPCYDYLQKGGETVPKVCCDAVKS---NLKVFGKRTTVCDCIQDLVEGATEEQTDRFF  338
            ++ PC +YL+KGG  VP  CC+ +KS     K    R   C+C++               
Sbjct  38   SLAPCLNYLKKGGP-VPPACCNGIKSLNAAAKTTADRQAACNCLKTASTSIAGINLSYAS  96

Query  337  ALPGMCVDDSRLKFTRHTNCSLVE  266
            +LPG C  +   K +  T+CS V+
Sbjct  97   SLPGKCGVNVPYKISPSTDCSKVQ  120



>sp|Q39950.1|NLTP_HELAN RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Short=NsLTP; AltName: Full=SDI-9; Flags: Precursor [Helianthus 
annuus]
 emb|CAA63340.1| lipid transfer protein [Helianthus annuus]
Length=116

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 37/88 (42%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  YL KGG  VP  CC  VK   S  K    R   C C++      +    
Sbjct  30   QVSSSLAPCISYLTKGGA-VPPACCSGVKSLNSAAKTTPDRQAACGCLKSAYNSISGVNA  88

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                + PG C      K +  T+CS V+
Sbjct  89   GNAASFPGKCGVSIPYKISPSTDCSKVQ  116



>ref|XP_010505484.1| PREDICTED: non-specific lipid-transfer protein 1-like [Camelina 
sativa]
Length=118

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 52/127 (41%), Gaps = 14/127 (11%)
 Frame = -3

Query  631  LSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKV  452
            ++  + L  L LACM      TA +A              +N+ PC  Y+ +GG  +P  
Sbjct  1    MAGVMKLACLFLACMIVAGPITANAALSCG-------AVSSNLAPCIGYVMQGGA-IPPA  52

Query  451  CCDAVKSNLKVFGK----RTTVCDCIQDLVEG-ATEEQTDRFFALPGMCVDDSRLKFTRH  287
            CC+ V+ NL    +    R   C+CIQ +     +     R   +P  C  +   K +  
Sbjct  53   CCNGVR-NLNSMARTTPDRQQACNCIQSVARNLGSGVNAGRAAGIPKSCGVNIPYKISTS  111

Query  286  TNCSLVE  266
            TNC  V 
Sbjct  112  TNCKTVR  118



>ref|XP_006281297.1| hypothetical protein CARUB_v10027347mg, partial [Capsella rubella]
 gb|EOA14195.1| hypothetical protein CARUB_v10027347mg, partial [Capsella rubella]
Length=137

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 39/87 (45%), Gaps = 4/87 (5%)
 Frame = -3

Query  517  FGTNIEPCYDYLQKGGETVPKVCCDAVKSNLKVFGK---RTTVCDCIQDLVEGATEEQTD  347
              T++ PC +YL KGGE VP  CC  VKS + +      R   C C+Q   +G +     
Sbjct  52   VATSLAPCANYLSKGGE-VPVPCCGGVKSLISMAQTTPDRQQACRCLQSTAKGMSGLDPS  110

Query  346  RFFALPGMCVDDSRLKFTRHTNCSLVE  266
                LPG C        +  TNC  V+
Sbjct  111  LASGLPGKCGVSIPYPISMSTNCDNVK  137



>ref|XP_010509136.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X1 [Camelina sativa]
 ref|XP_010509137.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X2 [Camelina sativa]
Length=118

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 52/127 (41%), Gaps = 14/127 (11%)
 Frame = -3

Query  631  LSKCLNLPWLLLACMAAGVLFTALSAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKV  452
            ++  + L  L LACM      TA +A              +N+ PC  Y+ +GG  +P  
Sbjct  1    MAGVMKLACLFLACMIVAGPITANAALSCG-------AVSSNLAPCIGYVMQGG-VIPPA  52

Query  451  CCDAVKSNLKVFGK----RTTVCDCIQDLVEG-ATEEQTDRFFALPGMCVDDSRLKFTRH  287
            CC+ V+ NL    +    R   C+CIQ +     +     R   +P  C  +   K +  
Sbjct  53   CCNGVR-NLNSMARTTPDRQQACNCIQSVARNLGSGVNAGRAAGIPKSCGVNIPYKISTS  111

Query  286  TNCSLVE  266
            TNC  V 
Sbjct  112  TNCKTVR  118



>gb|AEI70829.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 39/88 (44%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q  +++ PC  YL KGG  VP  CC+ VK   +  K    R   C C++      +    
Sbjct  30   QVSSSLAPCIGYLTKGGA-VPPACCNGVKGLNNAAKTTPDRQAACGCLKSAYNSISGINA  88

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                +LPG C      K +  T+CS V+
Sbjct  89   GNAASLPGKCGVSIPYKISPGTDCSKVQ  116



>gb|ACZ06858.1| lipid transfer protein [Glycine soja]
Length=122

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 45/102 (44%), Gaps = 5/102 (5%)
 Frame = -3

Query  559  SAEPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDC  389
            SA P A       Q   ++ PC+ YL+ GG+   + CC+ VK   S  K    R   C C
Sbjct  21   SAAPMAQAAITCGQVAGDMSPCFSYLRSGGKPS-QACCNGVKSLSSAAKTTADRQGACSC  79

Query  388  IQDLVEGATEE-QTDRFFALPGMCVDDSRLKFTRHTNCSLVE  266
            +++L     +        +LPG C      K +  TNC+ ++
Sbjct  80   LKNLANNMGQSLNAGNAASLPGKCGVSIPYKISTSTNCATIK  121



>emb|CBW38497.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 38/88 (43%), Gaps = 4/88 (5%)
 Frame = -3

Query  520  QFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQDLVEGATEEQT  350
            Q   ++ PC  YL KGG  VP  CC+ VK   +  K    R   C C++      +    
Sbjct  16   QVSNSLAPCIGYLTKGG-AVPPACCNGVKGLNNAAKTTPDRQAACGCLKSAYNSISGINA  74

Query  349  DRFFALPGMCVDDSRLKFTRHTNCSLVE  266
                +LPG C      K +  T+CS V+
Sbjct  75   GNAASLPGKCGVSIPYKISPSTDCSKVQ  102



>ref|XP_004963700.1| PREDICTED: non-specific lipid-transfer protein 2A-like, partial 
[Setaria italica]
Length=127

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/97 (29%), Positives = 45/97 (46%), Gaps = 6/97 (6%)
 Frame = -3

Query  553  EPSAYDNACFLQFGTNIEPCYDYLQKGGETVPKVCCDAVK---SNLKVFGKRTTVCDCIQ  383
             P+    +C   + T + PC  Y+Q GG TVP+ CC  ++   S  +    R  +C C++
Sbjct  21   RPAGAALSCSTVYNT-LMPCLGYVQSGG-TVPRACCSGIQRLVSGARTTPDRRAICTCLK  78

Query  382  DLVEGAT-EEQTDRFFALPGMCVDDSRLKFTRHTNCS  275
            ++  GA       R   LPG C      K + + NC+
Sbjct  79   NVAAGAAGGPYISRAAGLPGRCGVPLPYKLSPNMNCN  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1067077997832