BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27336_g1_i1 len=1266 path=[1:0-1265]

Length=1266
                                                                      Score     E

dbj|BAG55005.1|  auxin-responsive Aux/IAA gene family member            285   2e-90   Ipomoea nil [qian niu]
gb|AFK36086.1|  unknown                                                 284   1e-89   
gb|AAD32146.1|AF123508_1  Nt-iaa28 deduced protein                      283   2e-89   Nicotiana tabacum [American tobacco]
ref|XP_009761467.1|  PREDICTED: auxin-responsive protein IAA16          283   2e-89   
ref|XP_007050421.1|  Indole-3-acetic acid inducible 14 isoform 1        284   4e-89   
ref|XP_004289900.1|  PREDICTED: auxin-induced protein AUX28-like        282   5e-89   
ref|XP_010278165.1|  PREDICTED: auxin-responsive protein IAA16-like     281   2e-88   
gb|AEE25653.1|  auxin-responsive protein                                280   2e-88   
ref|XP_009367750.1|  PREDICTED: auxin-induced protein AUX28-like        281   2e-88   
ref|XP_010274203.1|  PREDICTED: auxin-responsive protein IAA16-like     280   2e-88   
gb|AFK37379.1|  unknown                                                 280   3e-88   
gb|KHF98789.1|  Auxin-responsive IAA14 -like protein                    279   7e-88   
ref|XP_009610435.1|  PREDICTED: auxin-responsive protein IAA16          279   7e-88   
ref|XP_011079949.1|  PREDICTED: auxin-induced protein AUX28-like        278   9e-88   
ref|XP_002284133.1|  PREDICTED: auxin-responsive protein IAA14          278   1e-87   Vitis vinifera
emb|CBI26357.3|  unnamed protein product                                278   1e-87   
ref|NP_001241599.1|  uncharacterized protein LOC100803065               278   1e-87   
ref|XP_004495392.1|  PREDICTED: auxin-responsive protein IAA14-li...    278   2e-87   
ref|XP_006383686.1|  auxin-induced protein aux28                        277   2e-87   
ref|XP_008382962.1|  PREDICTED: auxin-induced protein AUX28-like        278   2e-87   
ref|XP_002319075.1|  hypothetical protein POPTR_0013s03870g             278   3e-87   Populus trichocarpa [western balsam poplar]
ref|XP_003591806.1|  Indoleacetic acid-induced-like protein             277   3e-87   
ref|XP_011032399.1|  PREDICTED: auxin-responsive protein IAA16-like     277   4e-87   
gb|AEE25650.1|  auxin-responsive protein                                277   4e-87   
gb|ABH01143.1|  auxin-regulated protein                                 277   4e-87   Populus tomentosa [Chinese white poplar]
ref|XP_011038568.1|  PREDICTED: auxin-responsive protein IAA16-like     277   4e-87   
emb|CAH59413.1|  auxin resistance protein                               276   5e-87   Plantago major [cart-track plant]
gb|KHN18836.1|  Auxin-induced protein AUX28                             276   6e-87   
ref|XP_006382798.1|  hypothetical protein POPTR_0005s05560g             276   7e-87   
ref|XP_002302075.1|  auxin-induced protein aux28                        276   7e-87   Populus trichocarpa [western balsam poplar]
ref|XP_007223810.1|  hypothetical protein PRUPE_ppa010698mg             276   8e-87   
ref|XP_007034956.1|  Indole-3-acetic acid 7 isoform 1                   276   1e-86   
gb|AAM21317.1|AF373100_1  auxin-regulated protein                       276   1e-86   Populus tremula x Populus tremuloides
gb|KDO68557.1|  hypothetical protein CISIN_1g026823mg                   275   1e-86   
ref|NP_001266049.1|  IAA9 protein                                       276   1e-86   
ref|XP_007162490.1|  hypothetical protein PHAVU_001G156600g             276   1e-86   
ref|NP_001268036.1|  uncharacterized protein LOC100250231               275   1e-86   
ref|XP_006432923.1|  hypothetical protein CICLE_v10002290mg             276   1e-86   
gb|KHG19190.1|  Auxin-responsive IAA16 -like protein                    275   2e-86   
gb|KDO48905.1|  hypothetical protein CISIN_1g026005mg                   275   2e-86   
gb|KDP40274.1|  hypothetical protein JCGZ_02272                         275   3e-86   
gb|AEE25654.1|  auxin-responsive protein                                275   3e-86   
ref|XP_007144686.1|  hypothetical protein PHAVU_007G176600g             275   4e-86   
ref|XP_006443921.1|  hypothetical protein CICLE_v10022032mg             274   4e-86   
ref|XP_004493739.1|  PREDICTED: auxin-induced protein AUX28-like        275   4e-86   
ref|XP_002520980.1|  Auxin-induced protein AUX28, putative              274   4e-86   Ricinus communis
gb|KFK39592.1|  hypothetical protein AALP_AA3G264300                    274   5e-86   
ref|XP_010025014.1|  PREDICTED: auxin-responsive protein IAA16-like     275   7e-86   
gb|ACU18407.1|  unknown                                                 274   8e-86   Glycine max [soybeans]
ref|NP_001275398.1|  auxin/indole-3-acetic acid 3                       274   9e-86   
ref|XP_008224185.1|  PREDICTED: auxin-responsive protein IAA14          273   1e-85   
ref|XP_008372303.1|  PREDICTED: auxin-induced protein AUX28-like        274   1e-85   
ref|XP_009611797.1|  PREDICTED: auxin-responsive protein IAA14          273   1e-85   
emb|CDO99148.1|  unnamed protein product                                273   1e-85   
gb|KHG04941.1|  Auxin-induced AUX28                                     273   1e-85   
gb|KHN05057.1|  Auxin-responsive protein IAA14                          273   2e-85   
ref|XP_009591035.1|  PREDICTED: auxin-responsive protein IAA7-like      272   2e-85   
ref|XP_011042427.1|  PREDICTED: auxin-induced protein AUX28-like        272   2e-85   
ref|XP_006298251.1|  hypothetical protein CARUB_v10014321mg             274   3e-85   
ref|XP_009354870.1|  PREDICTED: auxin-induced protein AUX28-like        273   3e-85   
gb|AGV54230.1|  auxin-induced protein AUX28                             272   3e-85   
gb|AFK42876.1|  unknown                                                 272   3e-85   
ref|XP_007143877.1|  hypothetical protein PHAVU_007G109500g             271   5e-85   
ref|XP_010679165.1|  PREDICTED: auxin-responsive protein IAA14-like     273   5e-85   
ref|XP_003521268.1|  PREDICTED: auxin-induced protein AUX28-like        271   7e-85   
gb|AFZ78617.1|  hypothetical protein                                    271   8e-85   
ref|XP_011091113.1|  PREDICTED: auxin-responsive protein IAA14          271   8e-85   
gb|AAM96891.1|  auxin-responsive protein IAA1                           269   9e-85   Mirabilis jalapa
ref|NP_001236693.1|  auxin-induced protein AUX28                        271   9e-85   
gb|KDP23667.1|  hypothetical protein JCGZ_23500                         271   1e-84   
ref|XP_007030567.1|  Indoleacetic acid-induced protein 16               271   1e-84   
ref|XP_010102292.1|  Auxin-responsive protein IAA16                     271   1e-84   
gb|KHN02537.1|  Auxin-induced protein AUX28                             271   1e-84   
ref|NP_001240213.1|  auxin-induced protein ali50                        270   2e-84   
gb|ACL81167.1|  auxin-responsive protein IAA1                           271   2e-84   Mirabilis jalapa
ref|XP_009135842.1|  PREDICTED: auxin-responsive protein IAA7-like      270   2e-84   
ref|XP_003556389.2|  PREDICTED: auxin-responsive protein IAA14-like     273   2e-84   
ref|XP_004495802.1|  PREDICTED: auxin-responsive protein IAA16-like     270   2e-84   
gb|EYU30526.1|  hypothetical protein MIMGU_mgv1a012831mg                270   2e-84   
ref|XP_011082603.1|  PREDICTED: auxin-responsive protein IAA14-like     269   3e-84   
ref|XP_011026048.1|  PREDICTED: auxin-induced protein AUX28-like        269   3e-84   
gb|ACJ83896.1|  unknown                                                 269   4e-84   Medicago truncatula
gb|ACJ84642.1|  unknown                                                 270   4e-84   Medicago truncatula
ref|XP_011030586.1|  PREDICTED: auxin-responsive protein IAA14-li...    269   4e-84   
gb|AFK44393.1|  unknown                                                 269   4e-84   
gb|ACU21378.1|  unknown                                                 269   5e-84   Glycine max [soybeans]
ref|XP_010552451.1|  PREDICTED: auxin-responsive protein IAA14-like     268   5e-84   
ref|XP_010532600.1|  PREDICTED: auxin-responsive protein IAA14          268   6e-84   
gb|EYU46510.1|  hypothetical protein MIMGU_mgv1a013084mg                268   7e-84   
gb|KFK37887.1|  hypothetical protein AALP_AA3G042100                    268   7e-84   
ref|XP_006298436.1|  hypothetical protein CARUB_v10014507mg             268   8e-84   
ref|XP_008451270.1|  PREDICTED: auxin-induced protein AUX28-like        268   9e-84   
gb|AFS44507.1|  auxin repressor                                         268   1e-83   
dbj|BAJ34138.1|  unnamed protein product                                268   1e-83   
ref|XP_009364490.1|  PREDICTED: auxin-responsive protein IAA16          268   1e-83   
ref|XP_002311658.1|  aux/IAA family protein                             268   1e-83   Populus trichocarpa [western balsam poplar]
ref|XP_007147174.1|  hypothetical protein PHAVU_006G102100g             269   1e-83   
ref|XP_010466604.1|  PREDICTED: auxin-responsive protein IAA7-like      268   1e-83   
ref|XP_006408159.1|  hypothetical protein EUTSA_v10021441mg             267   1e-83   
ref|XP_010512022.1|  PREDICTED: auxin-responsive protein IAA7           268   2e-83   
ref|XP_002531288.1|  Auxin-responsive protein IAA16, putative           268   2e-83   Ricinus communis
ref|XP_010488346.1|  PREDICTED: auxin-responsive protein IAA7-like      267   2e-83   
gb|AFK44192.1|  unknown                                                 268   2e-83   
ref|XP_010551700.1|  PREDICTED: auxin-responsive protein IAA14          267   2e-83   
ref|XP_006406100.1|  hypothetical protein EUTSA_v10021428mg             267   3e-83   
gb|KHG01271.1|  Auxin-responsive IAA14 -like protein                    267   3e-83   
ref|XP_011027555.1|  PREDICTED: auxin-responsive protein IAA14 is...    267   3e-83   
ref|XP_004288427.1|  PREDICTED: auxin-responsive protein IAA14-like     266   4e-83   
ref|XP_002517023.1|  Auxin-responsive protein IAA7, putative            265   4e-83   Ricinus communis
ref|NP_001267662.1|  auxin-induced protein AUX28-like                   266   4e-83   
ref|XP_006362195.1|  PREDICTED: auxin-responsive protein IAA14-like     266   4e-83   
ref|NP_001288939.1|  auxin-responsive protein IAA16                     266   5e-83   
ref|XP_002281771.1|  PREDICTED: auxin-responsive protein IAA16-like     266   5e-83   Vitis vinifera
emb|CBI35213.3|  unnamed protein product                                264   5e-83   
emb|CAN63268.1|  hypothetical protein VITISV_013635                     266   6e-83   Vitis vinifera
emb|CDY50750.1|  BnaAnng10570D                                          268   6e-83   
ref|XP_009777122.1|  PREDICTED: auxin-responsive protein IAA14-like     265   6e-83   
ref|XP_004172452.1|  PREDICTED: auxin-responsive protein IAA14-like     266   6e-83   
ref|NP_001266070.1|  IAA14                                              266   6e-83   
gb|AAM65301.1|  indoleacetic acid (IAA)-inducible gene (IAA7)           266   7e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008465181.1|  PREDICTED: auxin-responsive protein IAA14-like     266   7e-83   
ref|XP_008362015.1|  PREDICTED: auxin-responsive protein IAA14-like     266   8e-83   
ref|NP_188945.1|  auxin-responsive protein IAA7                         266   9e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010038039.1|  PREDICTED: auxin-induced protein AUX28-like        267   1e-82   
emb|CDY41894.1|  BnaC05g47100D                                          264   2e-82   
ref|NP_001280973.1|  auxin-responsive protein IAA16                     265   3e-82   
ref|XP_011030585.1|  PREDICTED: auxin-responsive protein IAA14-li...    264   4e-82   
ref|NP_187124.1|  auxin-responsive protein IAA16                        264   4e-82   Arabidopsis thaliana [mouse-ear cress]
gb|KFK24541.1|  hypothetical protein AALP_AAs58011U000100               263   5e-82   
ref|XP_009337294.1|  PREDICTED: auxin-responsive protein IAA14-like     264   5e-82   
ref|XP_008218270.1|  PREDICTED: auxin-responsive protein IAA16          264   6e-82   
ref|XP_006414696.1|  hypothetical protein EUTSA_v10026031mg             264   6e-82   
ref|XP_008235328.1|  PREDICTED: auxin-induced protein AUX28-like        264   7e-82   
gb|KEH43017.1|  auxin-responsive AUX/IAA family protein                 264   8e-82   
gb|AAD32147.1|AF123509_1  Nt-iaa4.1 deduced protein                     262   9e-82   Nicotiana tabacum [American tobacco]
gb|ADL36587.1|  ARF domain class transcription factor                   261   1e-81   
ref|XP_010917602.1|  PREDICTED: auxin-responsive protein IAA30 is...    263   1e-81   
gb|ADJ68049.1|  auxin responsive protein                                263   1e-81   
ref|XP_010024036.1|  PREDICTED: auxin-responsive protein IAA14-like     263   1e-81   
ref|XP_002883395.1|  hypothetical protein ARALYDRAFT_319024             263   1e-81   
ref|NP_001280875.1|  auxin-responsive protein IAA14-like                262   2e-81   
ref|XP_009418923.1|  PREDICTED: auxin-responsive protein IAA30-like     262   2e-81   
ref|XP_011027545.1|  PREDICTED: auxin-responsive protein IAA14 is...    262   3e-81   
ref|XP_010556884.1|  PREDICTED: auxin-responsive protein IAA17          261   3e-81   
ref|XP_002884465.1|  indoleacetic acid-induced protein 16               261   4e-81   
emb|CDY10349.1|  BnaC05g29300D                                          261   4e-81   
ref|XP_002315736.1|  aux/IAA family protein                             263   4e-81   Populus trichocarpa [western balsam poplar]
ref|XP_009776553.1|  PREDICTED: auxin-responsive protein IAA14-like     261   5e-81   
ref|NP_001239753.1|  uncharacterized protein LOC100781847               261   5e-81   
ref|XP_010435110.1|  PREDICTED: auxin-responsive protein IAA14          261   5e-81   
ref|XP_006284476.1|  hypothetical protein CARUB_v10005662mg             260   6e-81   
ref|XP_010674855.1|  PREDICTED: auxin-induced protein AUX28             263   7e-81   
ref|XP_010440448.1|  PREDICTED: auxin-responsive protein IAA14-like     260   7e-81   
ref|XP_010418365.1|  PREDICTED: auxin-responsive protein IAA16          260   7e-81   
ref|XP_010450026.1|  PREDICTED: auxin-responsive protein IAA14-like     260   8e-81   
ref|XP_007201400.1|  hypothetical protein PRUPE_ppa010342mg             261   9e-81   
ref|XP_007205640.1|  hypothetical protein PRUPE_ppa009254mg             263   9e-81   
gb|KHN22078.1|  Auxin-responsive protein IAA16                          260   1e-80   
ref|XP_010485858.1|  PREDICTED: auxin-responsive protein IAA16-like     260   1e-80   
ref|NP_001275031.1|  auxin-responsive protein IAA14-like                259   1e-80   
ref|XP_009124981.1|  PREDICTED: auxin-responsive protein IAA16-like     260   1e-80   
ref|XP_006420094.1|  hypothetical protein CICLE_v10005789mg             259   1e-80   
ref|XP_004302055.1|  PREDICTED: auxin-responsive protein IAA16-like     260   2e-80   
ref|NP_193191.2|  auxin-responsive protein IAA14                        259   2e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009774251.1|  PREDICTED: auxin-responsive protein IAA16-like     258   3e-80   
ref|XP_011073485.1|  PREDICTED: auxin-responsive protein IAA14          259   3e-80   
ref|XP_004134096.1|  PREDICTED: auxin-responsive protein IAA14-li...    258   6e-80   
gb|ABD98055.1|  auxin-regulated protein                                 259   6e-80   Striga asiatica [witchweed]
dbj|BAH15071.1|  indole-3-acetic acid 14 transcription factor like      258   7e-80   Malus prunifolia
ref|XP_008438588.1|  PREDICTED: auxin-responsive protein IAA14-like     258   8e-80   
ref|XP_006443920.1|  hypothetical protein CICLE_v10022032mg             258   8e-80   
ref|NP_001266039.1|  IAA7 protein                                       257   9e-80   
ref|XP_010936171.1|  PREDICTED: auxin-responsive protein IAA30-like     258   1e-79   
ref|XP_008810170.1|  PREDICTED: auxin-responsive protein IAA30-like     258   1e-79   
ref|XP_002868277.1|  hypothetical protein ARALYDRAFT_493451             257   2e-79   
ref|XP_006366663.1|  PREDICTED: auxin-responsive protein IAA16-like     256   2e-79   
ref|NP_001288823.1|  auxin-responsive protein IAA7                      257   2e-79   
ref|XP_006838867.1|  hypothetical protein AMTR_s00002p00266760          256   3e-79   
ref|XP_010463960.1|  PREDICTED: auxin-responsive protein IAA16-like     256   3e-79   
gb|EYU32514.1|  hypothetical protein MIMGU_mgv1a012542mg                256   5e-79   
gb|AAC49055.1|  IAA14                                                   252   1e-78   Arabidopsis thaliana [mouse-ear cress]
emb|CAC84710.1|  aux/IAA protein                                        256   2e-78   Populus tremula x Populus tremuloides
gb|ABI36487.1|  AUX/IAA7 A                                              251   2e-78   
ref|XP_008788131.1|  PREDICTED: auxin-responsive protein IAA30-like     254   2e-78   
ref|XP_006605305.1|  PREDICTED: uncharacterized protein LOC100499...    254   3e-78   
ref|XP_009107777.1|  PREDICTED: auxin-responsive protein IAA14          253   3e-78   
ref|XP_009420668.1|  PREDICTED: auxin-responsive protein IAA30-like     254   4e-78   
ref|XP_010917600.1|  PREDICTED: auxin-responsive protein IAA30 is...    254   4e-78   
emb|CDY47148.1|  BnaA08g05350D                                          253   4e-78   
ref|NP_001266055.1|  IAA10 protein                                      252   8e-78   
dbj|BAJ84870.1|  predicted protein                                      253   8e-78   
dbj|BAK01326.1|  predicted protein                                      253   9e-78   
ref|XP_007034957.1|  Indole-3-acetic acid inducible 14 isoform 2        251   9e-78   
emb|CDY63910.1|  BnaC01g43640D                                          253   1e-77   
ref|XP_010923478.1|  PREDICTED: auxin-responsive protein IAA30-li...    253   1e-77   
ref|XP_002306817.1|  hypothetical protein POPTR_0005s23980g             252   1e-77   Populus trichocarpa [western balsam poplar]
ref|XP_004495391.1|  PREDICTED: auxin-responsive protein IAA14-li...    252   2e-77   
emb|CAN72026.1|  hypothetical protein VITISV_014421                     253   2e-77   Vitis vinifera
ref|XP_008462706.1|  PREDICTED: auxin-responsive protein IAA16-li...    251   2e-77   
emb|CDY30017.1|  BnaC01g39910D                                          251   2e-77   
ref|XP_003521753.1|  PREDICTED: auxin-responsive protein IAA16-like     251   3e-77   
dbj|BAI94494.1|  Aux/IAA protein                                        251   3e-77   
gb|KHN31465.1|  Auxin-responsive protein IAA16                          251   3e-77   
gb|KEH42778.1|  auxin-responsive AUX/IAA family protein                 251   4e-77   
ref|XP_009398568.1|  PREDICTED: auxin-responsive protein IAA30-like     251   8e-77   
emb|CAC84711.1|  aux/IAA protein                                        249   2e-76   Populus tremula x Populus tremuloides
gb|EPS64756.1|  hypothetical protein M569_10024                         248   2e-76   
gb|EYU33008.1|  hypothetical protein MIMGU_mgv1a012321mg                249   4e-76   
gb|ACU19136.1|  unknown                                                 248   4e-76   Glycine max [soybeans]
ref|XP_004142529.1|  PREDICTED: auxin-responsive protein IAA16-like     248   5e-76   
gb|ABM53874.1|  IAA6                                                    245   5e-76   Cestrum elegans
ref|XP_004963100.1|  PREDICTED: auxin-responsive protein IAA30-like     249   7e-76   
ref|XP_003579189.1|  PREDICTED: auxin-responsive protein IAA30-like     248   7e-76   
emb|CDY62130.1|  BnaC08g47390D                                          247   1e-75   
gb|ABM53872.1|  IAA4                                                    244   1e-75   Cestrum elegans
gb|ABI36493.1|  AUX/IAA16 A                                             243   2e-75   
ref|XP_002443496.1|  hypothetical protein SORBIDRAFT_08g020580          248   2e-75   Sorghum bicolor [broomcorn]
ref|XP_008455985.1|  PREDICTED: auxin-responsive protein IAA16 is...    246   3e-75   
gb|KHN30563.1|  Auxin-responsive protein IAA14                          246   3e-75   
ref|XP_004982377.1|  PREDICTED: auxin-responsive protein IAA30-li...    247   4e-75   
emb|CDY10694.1|  BnaA05g16680D                                          242   1e-74   
gb|EPS60474.1|  hypothetical protein M569_14329                         243   2e-74   
ref|XP_007201399.1|  hypothetical protein PRUPE_ppa010342mg             244   2e-74   
gb|ADL70671.1|  indole-3-acetic acid inducible 16                       241   2e-74   
ref|XP_009413916.1|  PREDICTED: auxin-responsive protein IAA30-like     244   2e-74   
ref|XP_003554705.1|  PREDICTED: auxin-responsive protein IAA16-li...    243   3e-74   
emb|CDP06818.1|  unnamed protein product                                244   4e-74   
ref|XP_006408158.1|  hypothetical protein EUTSA_v10021441mg             243   5e-74   
ref|XP_006304183.1|  hypothetical protein CARUB_v10010236mg             243   5e-74   
emb|CDX89832.1|  BnaA10g02500D                                          242   8e-74   
gb|ADL70672.1|  indole-3-acetic acid inducible 16                       239   1e-73   
ref|NP_001237212.1|  uncharacterized protein LOC100499872               241   1e-73   
ref|XP_004982376.1|  PREDICTED: auxin-responsive protein IAA30-li...    243   2e-73   
gb|ACF88333.1|  unknown                                                 242   3e-73   Zea mays [maize]
ref|XP_010483317.1|  PREDICTED: auxin-responsive protein IAA17-like     241   3e-73   
ref|XP_010457463.1|  PREDICTED: auxin-responsive protein IAA17          240   4e-73   
ref|XP_010087762.1|  Auxin-responsive protein IAA7                      243   4e-73   
gb|KGN60808.1|  hypothetical protein Csa_2G010920                       240   5e-73   
gb|EEE53551.1|  hypothetical protein OsJ_36765                          238   5e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010475075.1|  PREDICTED: auxin-responsive protein IAA17-like     240   5e-73   
emb|CDY18214.1|  BnaC05g02370D                                          239   6e-73   
gb|ADL70673.1|  indole-3-acetic acid inducible 16                       237   8e-73   
gb|KEH43016.1|  auxin-responsive AUX/IAA family protein                 239   1e-72   
emb|CDY15493.1|  BnaA08g27770D                                          239   1e-72   
ref|XP_009119323.1|  PREDICTED: auxin-responsive protein IAA17-like     239   1e-72   
ref|XP_009111119.1|  PREDICTED: auxin-responsive protein IAA17          239   1e-72   
ref|NP_171921.1|  auxin-responsive protein IAA17                        239   2e-72   Arabidopsis thaliana [mouse-ear cress]
gb|ACU19616.1|  unknown                                                 239   2e-72   Glycine max [soybeans]
gb|AAM64837.1|  putative auxin-induced protein, IAA17/AXR3-1            238   2e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AFK43673.1|  unknown                                                 239   4e-72   
gb|KDP21369.1|  hypothetical protein JCGZ_21840                         238   4e-72   
ref|XP_002889499.1|  hypothetical protein ARALYDRAFT_470401             238   4e-72   
gb|ABI36490.1|  AUX/IAA7 C                                              234   4e-72   
ref|XP_006418149.1|  hypothetical protein EUTSA_v10008679mg             237   5e-72   
ref|NP_001067209.1|  Os12g0601300                                       239   5e-72   Oryza sativa Japonica Group [Japonica rice]
emb|CAB46059.1|  IAA7 like protein                                      238   6e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010550916.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    235   2e-71   
ref|XP_004156465.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    236   2e-71   
gb|AAC39440.1|  IAA17/AXR3-1 protein                                    234   9e-71   Arabidopsis thaliana [mouse-ear cress]
gb|ACF87179.1|  unknown                                                 234   4e-70   Zea mays [maize]
ref|XP_006418150.1|  hypothetical protein EUTSA_v10008679mg             232   7e-70   
emb|CDY32537.1|  BnaA09g50590D                                          232   7e-70   
ref|NP_001150626.1|  IAA30 - auxin-responsive Aux/IAA family member     233   7e-70   Zea mays [maize]
ref|XP_009118658.1|  PREDICTED: auxin-responsive protein IAA17-like     232   8e-70   
gb|AAV50046.1|  auxin-induced protein                                   230   1e-69   Saccharum hybrid cultivar Pindar
emb|CDY63072.1|  BnaCnng41350D                                          237   1e-69   
ref|XP_008455992.1|  PREDICTED: auxin-responsive protein IAA16 is...    231   2e-69   
emb|CDY10068.1|  BnaC08g43830D                                          231   2e-69   
ref|XP_004134097.1|  PREDICTED: auxin-responsive protein IAA14-li...    230   2e-69   
gb|ADL70678.1|  indole-3-acetic acid inducible 16                       228   3e-69   
gb|ABR17764.1|  unknown                                                 233   4e-69   Picea sitchensis
gb|KFK31703.1|  hypothetical protein AALP_AA6G148100                    228   1e-68   
gb|ABK24636.1|  unknown                                                 233   2e-68   Picea sitchensis
ref|XP_010522504.1|  PREDICTED: auxin-responsive protein IAA17-like     228   2e-68   
gb|ABR16139.1|  unknown                                                 234   5e-68   Picea sitchensis
ref|XP_009417112.1|  PREDICTED: auxin-responsive protein IAA30-like     228   6e-68   
ref|XP_009421456.1|  PREDICTED: auxin-responsive protein IAA21-like     229   1e-67   
dbj|BAJ97201.1|  predicted protein                                      226   2e-67   
ref|XP_006664171.1|  PREDICTED: auxin-responsive protein IAA30-like     226   3e-67   
gb|ADL70681.1|  indole-3-acetic acid inducible 16                       223   3e-67   
ref|XP_004150437.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    225   7e-67   
ref|XP_006432922.1|  hypothetical protein CICLE_v10002290mg             223   1e-66   
gb|KDO56957.1|  hypothetical protein CISIN_1g019236mg                   228   1e-66   
ref|XP_006465643.1|  PREDICTED: auxin-responsive protein IAA8-lik...    228   1e-66   
gb|KDO48904.1|  hypothetical protein CISIN_1g026005mg                   223   2e-66   
ref|XP_006426926.1|  hypothetical protein CICLE_v10025988mg             227   2e-66   
emb|CBI36106.3|  unnamed protein product                                224   3e-66   
ref|XP_006850381.1|  hypothetical protein AMTR_s00184p00030540          228   3e-66   
ref|XP_008462746.1|  PREDICTED: auxin-responsive protein IAA27          224   7e-66   
gb|ABR16302.1|  unknown                                                 225   8e-66   
ref|XP_010254042.1|  PREDICTED: auxin-responsive protein IAA27-like     225   9e-66   
emb|CBI28036.3|  unnamed protein product                                219   9e-66   
ref|XP_002284282.1|  PREDICTED: auxin-responsive protein IAA27-like     224   1e-65   
gb|KHG27397.1|  Auxin-responsive IAA27 -like protein                    220   3e-65   
ref|XP_009380572.1|  PREDICTED: auxin-responsive protein IAA21-li...    222   3e-65   
ref|XP_002464208.1|  hypothetical protein SORBIDRAFT_01g014130          221   3e-65   
ref|XP_010925905.1|  PREDICTED: auxin-responsive protein IAA17-like     223   4e-65   
gb|ADL70670.1|  indole-3-acetic acid inducible 16                       217   4e-65   
ref|XP_010915883.1|  PREDICTED: auxin-responsive protein IAA17-like     223   5e-65   
ref|XP_008802939.1|  PREDICTED: auxin-responsive protein IAA17-like     222   6e-65   
ref|XP_007024229.1|  Phytochrome-associated protein 2 isoform 2         222   1e-64   
ref|XP_010275506.1|  PREDICTED: auxin-responsive protein IAA9 iso...    223   1e-64   
gb|ADL70680.1|  indole-3-acetic acid inducible 16                       215   2e-64   
ref|XP_010275505.1|  PREDICTED: auxin-responsive protein IAA9 iso...    223   2e-64   
ref|XP_010275504.1|  PREDICTED: auxin-responsive protein IAA9 iso...    223   2e-64   
ref|XP_007050422.1|  Indole-3-acetic acid inducible 14 isoform 2        218   3e-64   
ref|XP_009390697.1|  PREDICTED: auxin-responsive protein IAA17-like     220   4e-64   
gb|AAP44405.1|  auxin-induced protein 2                                 219   4e-64   
ref|XP_010254653.1|  PREDICTED: auxin-responsive protein IAA9-like      222   4e-64   
ref|XP_008783241.1|  PREDICTED: auxin-responsive protein IAA17-li...    220   5e-64   
ref|XP_002284118.1|  PREDICTED: auxin-responsive protein IAA27          220   5e-64   
ref|XP_009388718.1|  PREDICTED: auxin-responsive protein IAA17-like     219   6e-64   
ref|XP_004150556.1|  PREDICTED: auxin-responsive protein IAA27-like     219   8e-64   
gb|ADB93631.2|  indole-3-acetic acid inducible 16                       213   8e-64   
ref|XP_009409066.1|  PREDICTED: auxin-responsive protein IAA17-like     219   9e-64   
ref|NP_001280937.1|  auxin-responsive protein IAA27                     219   1e-63   
emb|CAC85936.1|  putative auxin induced transcription factor Aux/IAA    218   1e-63   
ref|XP_004512542.1|  PREDICTED: auxin-responsive protein IAA8-like      219   2e-63   
gb|AAM12952.1|  auxin-regulated protein                                 219   2e-63   
gb|KHG03466.1|  Auxin-responsive IAA27 -like protein                    218   3e-63   
ref|XP_006432921.1|  hypothetical protein CICLE_v10002290mg             214   3e-63   
gb|KEH42779.1|  auxin-responsive AUX/IAA family protein                 214   4e-63   
ref|XP_010249636.1|  PREDICTED: auxin-responsive protein IAA27          218   4e-63   
ref|XP_003612933.1|  Auxin-responsive protein (Aux/IAA)                 218   4e-63   
gb|AEV89263.1|  IAA9                                                    217   4e-63   
ref|XP_009336858.1|  PREDICTED: auxin-responsive protein IAA27-like     217   4e-63   
gb|KDO48907.1|  hypothetical protein CISIN_1g026005mg                   214   5e-63   
gb|ABB55368.1|  Aux/IAA protein-like                                    218   5e-63   
ref|NP_001275473.1|  Aux/IAA protein                                    218   6e-63   
ref|XP_009789143.1|  PREDICTED: auxin-responsive protein IAA8-like      218   7e-63   
ref|XP_004302884.1|  PREDICTED: auxin-responsive protein IAA27-like     217   7e-63   
ref|XP_009381047.1|  PREDICTED: auxin-responsive protein IAA17-like     216   8e-63   
gb|KHN16618.1|  Auxin-responsive protein IAA27                          215   1e-62   
ref|XP_006471686.1|  PREDICTED: auxin-responsive protein IAA16-li...    213   1e-62   
ref|XP_009793769.1|  PREDICTED: auxin-responsive protein IAA27-like     215   1e-62   
gb|ABY48132.1|  GH1 protein                                             216   1e-62   
ref|XP_008793078.1|  PREDICTED: auxin-responsive protein IAA27-li...    216   1e-62   
ref|XP_009771095.1|  PREDICTED: auxin-responsive protein IAA8-like      214   2e-62   
emb|CAI77628.1|  Aux/IAA protein                                        215   2e-62   
ref|XP_006833393.1|  hypothetical protein AMTR_s00109p00120700          216   2e-62   
gb|KDO48906.1|  hypothetical protein CISIN_1g026005mg                   212   2e-62   
ref|XP_004287443.1|  PREDICTED: auxin-responsive protein IAA27-like     215   2e-62   
ref|XP_002303297.1|  auxin-responsive protein IAA27                     216   2e-62   
emb|CDP02673.1|  unnamed protein product                                217   2e-62   
ref|XP_007013106.1|  Phytochrome-associated protein 2 isoform 1         215   3e-62   
ref|XP_011073641.1|  PREDICTED: auxin-responsive protein IAA9-like      216   3e-62   
ref|XP_009398379.1|  PREDICTED: auxin-responsive protein IAA30-like     213   3e-62   
gb|KHG09793.1|  Auxin-responsive IAA27 -like protein                    216   3e-62   
ref|XP_010320058.1|  PREDICTED: auxin-responsive protein (Aux/IAA...    216   3e-62   
gb|AEI70506.1|  auxin-responsive protein                                215   3e-62   
ref|NP_001265888.1|  auxin-responsive protein (Aux/IAA)                 216   4e-62   
ref|XP_010924571.1|  PREDICTED: auxin-responsive protein IAA27-like     214   4e-62   
ref|XP_009352507.1|  PREDICTED: auxin-responsive protein IAA27-like     214   4e-62   
ref|XP_006451212.1|  hypothetical protein CICLE_v10009070mg             214   4e-62   
ref|XP_009608764.1|  PREDICTED: auxin-responsive protein IAA8-like      215   5e-62   
ref|XP_006584572.1|  PREDICTED: uncharacterized protein LOC100795...    215   6e-62   
ref|NP_001267710.1|  auxin-responsive protein IAA9-like                 215   6e-62   
ref|XP_009617338.1|  PREDICTED: auxin-responsive protein IAA27-like     213   7e-62   
ref|XP_006466369.1|  PREDICTED: auxin-responsive protein IAA9-like      216   7e-62   
ref|XP_006426197.1|  hypothetical protein CICLE_v10025873mg             216   8e-62   
ref|XP_008444965.1|  PREDICTED: auxin-responsive protein IAA9-like      215   1e-61   
ref|XP_002516003.1|  Auxin-responsive protein IAA27, putative           215   1e-61   
ref|XP_010526458.1|  PREDICTED: auxin-responsive protein IAA27          213   1e-61   
emb|CAD10639.1|  IAA9 protein                                           214   1e-61   
ref|NP_001240013.1|  uncharacterized protein LOC100804423               213   2e-61   
ref|XP_007152862.1|  hypothetical protein PHAVU_004G166400g             213   2e-61   
ref|XP_007013107.1|  Phytochrome-associated protein 2 isoform 2         212   3e-61   
ref|XP_007160318.1|  hypothetical protein PHAVU_002G311500g             211   3e-61   
gb|KHN46011.1|  Auxin-responsive protein IAA9                           213   3e-61   
gb|EYU41350.1|  hypothetical protein MIMGU_mgv1a009380mg                213   3e-61   
ref|XP_011016963.1|  PREDICTED: auxin-responsive protein IAA9-like      214   3e-61   
gb|EMS64858.1|  Auxin-responsive protein IAA30                          212   4e-61   
ref|XP_002302351.1|  auxin-responsive family protein                    213   4e-61   
emb|CAC84706.1|  aux/IAA protein                                        213   4e-61   
ref|NP_001241389.1|  uncharacterized protein LOC100783314               213   4e-61   
ref|XP_003615390.1|  Auxin-responsive protein IAA5                      213   4e-61   
ref|NP_001239808.1|  uncharacterized protein LOC100778529               211   5e-61   
ref|XP_006381732.1|  hypothetical protein POPTR_0006s16640g             211   5e-61   
ref|XP_006433732.1|  hypothetical protein CICLE_v10001479mg             213   5e-61   
ref|XP_009612337.1|  PREDICTED: auxin-responsive protein IAA27-like     212   5e-61   
ref|XP_009406220.1|  PREDICTED: auxin-responsive protein IAA21-like     210   6e-61   
gb|ABW24025.1|  aux/IAA protein                                         206   6e-61   
gb|AFZ78618.1|  hypothetical protein                                    213   6e-61   
ref|XP_008228477.1|  PREDICTED: auxin-responsive protein IAA27-like     212   6e-61   
ref|XP_002867425.1|  phytochrome-associated protein 2                   211   7e-61   
emb|CDP03299.1|  unnamed protein product                                212   7e-61   
gb|KHN09036.1|  Auxin-responsive protein IAA8                           213   7e-61   
ref|XP_011010527.1|  PREDICTED: auxin-responsive protein IAA27-li...    212   8e-61   
ref|NP_194637.1|  phytochrome-associated protein 2                      211   8e-61   
ref|XP_007156440.1|  hypothetical protein PHAVU_003G286200g             212   8e-61   
ref|XP_006394000.1|  hypothetical protein EUTSA_v10004532mg             212   9e-61   
ref|XP_007158315.1|  hypothetical protein PHAVU_002G142500g             212   1e-60   
gb|EYU44549.1|  hypothetical protein MIMGU_mgv1a010252mg                211   1e-60   
ref|XP_010023411.1|  PREDICTED: auxin-responsive protein IAA9 iso...    213   1e-60   
gb|ACJ84551.1|  unknown                                                 212   1e-60   
emb|CDP00957.1|  unnamed protein product                                212   1e-60   
ref|XP_007137671.1|  hypothetical protein PHAVU_009G146000g             212   1e-60   
gb|ADL70679.1|  indole-3-acetic acid inducible 16                       205   1e-60   
gb|AGV54485.1|  auxin-responsive protein                                212   1e-60   
ref|XP_011009359.1|  PREDICTED: auxin-responsive protein IAA27-like     211   2e-60   
emb|CDO98008.1|  unnamed protein product                                211   2e-60   
emb|CBI19314.3|  unnamed protein product                                210   2e-60   
ref|XP_010098105.1|  Auxin-responsive protein IAA27                     211   2e-60   
ref|XP_007205358.1|  hypothetical protein PRUPE_ppa007194mg             212   2e-60   
ref|XP_003628839.1|  Indoleacetic acid-induced-like protein             211   2e-60   
ref|XP_002298231.1|  hypothetical protein POPTR_0001s18680g             211   3e-60   
ref|XP_008236708.1|  PREDICTED: auxin-responsive protein IAA9           212   3e-60   
ref|XP_006284170.1|  hypothetical protein CARUB_v10005309mg             209   3e-60   
ref|XP_008348505.1|  PREDICTED: auxin-responsive protein IAA21-li...    210   3e-60   
ref|XP_002514266.1|  Auxin-responsive protein IAA27, putative           209   3e-60   
ref|XP_006475665.1|  PREDICTED: auxin-responsive protein IAA27-li...    209   3e-60   
gb|AFK49626.1|  unknown                                                 211   3e-60   
gb|ACV31210.1|  auxin/indole-3-acetic acid 4                            206   3e-60   
gb|KFK29453.1|  hypothetical protein AALP_AA7G136400                    209   4e-60   
gb|KHN41649.1|  Auxin-responsive protein IAA27                          209   4e-60   
gb|KCW69643.1|  hypothetical protein EUGRSUZ_F03050                     210   4e-60   
gb|ADL36578.1|  ARF domain class transcription factor                   211   4e-60   
ref|XP_009344514.1|  PREDICTED: auxin-responsive protein IAA9           211   4e-60   
ref|XP_010664066.1|  PREDICTED: aux/IAA protein isoform X1              211   4e-60   
gb|AGV54609.1|  auxin-induced protein                                   208   4e-60   
ref|XP_003534212.1|  PREDICTED: auxin-responsive protein IAA27          209   5e-60   
gb|AAL92850.1|  Aux/IAA protein                                         211   5e-60   
gb|ACJ84768.1|  unknown                                                 205   5e-60   
ref|XP_008793077.1|  PREDICTED: auxin-responsive protein IAA27-li...    209   6e-60   
gb|KHN08222.1|  Auxin-responsive protein IAA8                           210   6e-60   
ref|XP_007150643.1|  hypothetical protein PHAVU_005G169600g             209   7e-60   
gb|ABM53871.1|  IAA3                                                    203   7e-60   
ref|NP_001268170.1|  Aux/IAA protein                                    210   7e-60   
ref|XP_010447892.1|  PREDICTED: auxin-responsive protein IAA27          209   8e-60   
ref|NP_569017.2|  auxin-responsive protein IAA9                         209   8e-60   
ref|XP_011099452.1|  PREDICTED: auxin-responsive protein IAA9-like      210   8e-60   
ref|XP_009380571.1|  PREDICTED: auxin-responsive protein IAA21-li...    209   8e-60   
gb|KHN04889.1|  Auxin-responsive protein IAA8                           207   8e-60   
ref|XP_009130522.1|  PREDICTED: auxin-responsive protein IAA9-lik...    204   8e-60   
gb|KDP37265.1|  hypothetical protein JCGZ_06321                         209   9e-60   
ref|NP_001280795.1|  auxin-responsive protein IAA8-like                 210   9e-60   
ref|XP_007225724.1|  hypothetical protein PRUPE_ppa006744mg             210   1e-59   
ref|XP_004141756.1|  PREDICTED: auxin-responsive protein IAA8-like      209   1e-59   
ref|XP_009786555.1|  PREDICTED: auxin-responsive protein IAA27-like     207   1e-59   
ref|XP_006343091.1|  PREDICTED: auxin-responsive protein IAA27-like     207   1e-59   
ref|XP_004503453.1|  PREDICTED: auxin-responsive protein IAA27-like     207   1e-59   
ref|XP_004981820.1|  PREDICTED: auxin-responsive protein IAA13-li...    205   1e-59   
ref|XP_011072390.1|  PREDICTED: auxin-responsive protein IAA27          208   1e-59   
ref|XP_010547581.1|  PREDICTED: auxin-responsive protein IAA9-lik...    209   1e-59   
gb|AFK41338.1|  unknown                                                 204   2e-59   
ref|XP_009366395.1|  PREDICTED: auxin-responsive protein IAA8-like      209   2e-59   
ref|XP_008378626.1|  PREDICTED: auxin-responsive protein IAA8-like      209   2e-59   
ref|XP_009624916.1|  PREDICTED: auxin-responsive protein IAA27-like     207   2e-59   
gb|ADB93632.2|  indole-3-acetic acid inducible 16                       202   2e-59   
gb|AAB70005.1|  GH1 protein                                             208   2e-59   
ref|XP_008219180.1|  PREDICTED: auxin-responsive protein IAA8-like      209   2e-59   
emb|CDY68170.1|  BnaCnng57860D                                          207   2e-59   
sp|Q75GK0.1|IAA11_ORYSJ  RecName: Full=Auxin-responsive protein I...    205   2e-59   
gb|ADL70676.1|  indole-3-acetic acid inducible 16                       202   2e-59   
ref|XP_007225727.1|  hypothetical protein PRUPE_ppa006744mg             210   2e-59   
ref|XP_002463898.1|  hypothetical protein SORBIDRAFT_01g008480          205   2e-59   
ref|NP_974355.1|  auxin-responsive protein IAA7                         204   2e-59   
ref|XP_003519213.1|  PREDICTED: auxin-responsive protein IAA9-like      209   2e-59   
ref|XP_010521483.1|  PREDICTED: auxin-responsive protein IAA27-li...    205   3e-59   
ref|XP_003517136.1|  PREDICTED: auxin-responsive protein IAA9 iso...    209   3e-59   
ref|XP_003534264.1|  PREDICTED: auxin-responsive protein IAA9           208   3e-59   
gb|AFK38170.1|  unknown                                                 208   3e-59   
ref|XP_009416499.1|  PREDICTED: auxin-responsive protein IAA21-like     206   3e-59   
ref|XP_008789309.1|  PREDICTED: auxin-responsive protein IAA27-like     207   3e-59   
ref|XP_008462174.1|  PREDICTED: auxin-responsive protein IAA27-like     208   3e-59   
ref|XP_007135656.1|  hypothetical protein PHAVU_010G147200g             207   3e-59   
ref|XP_004288310.1|  PREDICTED: auxin-responsive protein IAA9-like      208   4e-59   
ref|XP_003544843.1|  PREDICTED: auxin-responsive protein IAA9           208   4e-59   
ref|XP_004509716.1|  PREDICTED: auxin-responsive protein IAA9-lik...    207   4e-59   
ref|XP_009112193.1|  PREDICTED: auxin-responsive protein IAA9-lik...    206   4e-59   
gb|AFK38538.1|  unknown                                                 207   4e-59   
gb|ADL70677.1|  indole-3-acetic acid inducible 16                       201   5e-59   
ref|XP_004490496.1|  PREDICTED: auxin-responsive protein IAA9-like      208   5e-59   
ref|XP_003630761.1|  Auxin-responsive protein (Aux/IAA)                 206   7e-59   
gb|AFK49596.1|  unknown                                                 205   7e-59   
dbj|BAJ33683.1|  unnamed protein product                                206   7e-59   
ref|XP_006394001.1|  hypothetical protein EUTSA_v10004532mg             207   8e-59   
gb|KHG13564.1|  Auxin-responsive IAA9 -like protein                     207   8e-59   
gb|KDP32156.1|  hypothetical protein JCGZ_12617                         208   9e-59   
ref|XP_004509715.1|  PREDICTED: auxin-responsive protein IAA9-lik...    207   9e-59   
ref|XP_008339000.1|  PREDICTED: auxin-responsive protein IAA8-lik...    207   9e-59   
ref|XP_010433139.1|  PREDICTED: auxin-responsive protein IAA27-like     206   1e-58   
ref|XP_008348504.1|  PREDICTED: auxin-responsive protein IAA21-li...    206   1e-58   
ref|XP_009774736.1|  PREDICTED: auxin-responsive protein IAA27-like     205   1e-58   
gb|KEH27147.1|  auxin response factor                                   203   1e-58   
ref|XP_010438351.1|  PREDICTED: auxin-responsive protein IAA27-like     205   1e-58   
ref|XP_006412880.1|  hypothetical protein EUTSA_v10025542mg             207   1e-58   
ref|XP_007047689.1|  Transcription factor, putative isoform 3           206   1e-58   
ref|XP_010521482.1|  PREDICTED: auxin-responsive protein IAA8-lik...    206   1e-58   
ref|XP_003597715.1|  Auxin-responsive protein IAA                       206   2e-58   
ref|XP_010521481.1|  PREDICTED: auxin-responsive protein IAA8-lik...    206   2e-58   
ref|XP_009353580.1|  PREDICTED: auxin-responsive protein IAA21-like     206   2e-58   
gb|EAZ27868.1|  hypothetical protein OsJ_11821                          202   2e-58   
ref|XP_010062501.1|  PREDICTED: auxin-responsive protein IAA27          206   2e-58   
ref|XP_004172702.1|  PREDICTED: auxin-induced protein AUX28-like        201   2e-58   
ref|XP_006353472.1|  PREDICTED: auxin-responsive protein IAA27          204   2e-58   
emb|CDY18679.1|  BnaA09g07160D                                          205   2e-58   
ref|XP_009614298.1|  PREDICTED: auxin-responsive protein IAA27-like     203   2e-58   
ref|XP_007047687.1|  Transcription factor, putative isoform 1           206   2e-58   
ref|NP_001266052.1|  IAA8                                               204   2e-58   



>dbj|BAG55005.1| auxin-responsive Aux/IAA gene family member [Ipomoea nil]
Length=225

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 159/193 (82%), Gaps = 9/193 (5%)
 Frame = -1

Query  960  VDLKLKLSSKDSQIHASDHNKANNKD-----ADVTKPPAKAQVVGWPPVRSYRRNILAAN  796
            VDLKLKLSSK+S +   ++ K NN +     +D TKPPAKAQVVGWPPVRSYR+NIL+  
Sbjct  37   VDLKLKLSSKESNVDQVENLKDNNNNVVTSPSDSTKPPAKAQVVGWPPVRSYRKNILSG-  95

Query  795  NHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCEA  616
              QK+ GE  S   A LVKVS+DGAPYLRKVDL MYKSY +LS+AL KMF SFTIGNC  
Sbjct  96   --QKAAGES-SGGGAALVKVSVDGAPYLRKVDLKMYKSYHELSEALGKMFSSFTIGNCGT  152

Query  615  QGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIG  436
             G KDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPW MFV+SCKRLRIMKG+EAIG
Sbjct  153  HGFKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWNMFVDSCKRLRIMKGSEAIG  212

Query  435  LAPRAMEKCKNRS  397
            LAPRA+EKCKNRS
Sbjct  213  LAPRAVEKCKNRS  225



>gb|AFK36086.1| unknown [Lotus japonicus]
Length=257

 Score =   284 bits (726),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 162/216 (75%), Gaps = 24/216 (11%)
 Frame = -1

Query  981  FEETHQH---VDLKLKLSSKDSQIHASDHNKANNKD---------ADVTKPPAKAQVVGW  838
            F ET      VDL L LSSK+     +D ++    +         AD  KPPAKAQVVGW
Sbjct  45   FSETESETDTVDLMLNLSSKEPTSAGADPSQKPKTNLQKEKTLLPADPAKPPAKAQVVGW  104

Query  837  PPVRSYRRNILAANNHQKSGGEDGSDKA---------AVLVKVSMDGAPYLRKVDLSMYK  685
            PPVRS+R+N+LA    QKS GE+   +          A  VKVSMDGAPYLRKVDL MYK
Sbjct  105  PPVRSFRKNMLAV---QKSVGEESGGEKSNNGGGGGGASFVKVSMDGAPYLRKVDLKMYK  161

Query  684  SYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGD  505
            SY+DLSD+LAKMF SFTIG CE+QGMKDFMNESKLM++LN+SDYVPTYEDKDGDWMLVGD
Sbjct  162  SYRDLSDSLAKMFSSFTIGTCESQGMKDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGD  221

Query  504  VPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            VPWEMFVESCKRLRIMKG EAIGLAPRAMEKCKNRS
Sbjct  222  VPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNRS  257



>gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tabacum]
Length=240

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 153/198 (77%), Gaps = 7/198 (4%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHN---KANNKDADVTKPPAKAQVVGWPPVRSYRRN  811
            F ET   VDLKL LSSKDS +     N   K N    D  KPPAKAQVVGWPPVRS+R+N
Sbjct  47   FSET---VDLKLNLSSKDSTVDNQVDNIKEKKNIAPTDPAKPPAKAQVVGWPPVRSFRKN  103

Query  810  ILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTI  631
            +L    +    GE  S   A  VKVS+DGAPYLRKVDL MYKSYQ LSDAL KMF SFTI
Sbjct  104  VLTVQKNSTGNGES-SGGGAAFVKVSVDGAPYLRKVDLKMYKSYQQLSDALGKMFSSFTI  162

Query  630  GNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG  451
            GNC   G KDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG
Sbjct  163  GNCGTHGFKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKG  222

Query  450  TEAIGLAPRAMEKCKNRS  397
            +EAIGLAPRA+EKCKNRS
Sbjct  223  SEAIGLAPRAVEKCKNRS  240



>ref|XP_009761467.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana sylvestris]
Length=240

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 153/198 (77%), Gaps = 7/198 (4%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHN---KANNKDADVTKPPAKAQVVGWPPVRSYRRN  811
            F ET   VDLKL LSSKDS +     N   K N    D  KPPAKAQVVGWPPVRS+R+N
Sbjct  47   FSET---VDLKLNLSSKDSTVDNQVDNIKEKKNIAPTDPAKPPAKAQVVGWPPVRSFRKN  103

Query  810  ILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTI  631
            +L    +    GE  S   A  VKVS+DGAPYLRKVDL MYKSYQ LSDAL KMF SFTI
Sbjct  104  VLTVQKNSTGNGES-SGGGAAFVKVSVDGAPYLRKVDLKMYKSYQQLSDALGKMFSSFTI  162

Query  630  GNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG  451
            GNC   G KDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG
Sbjct  163  GNCGTHGFKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKG  222

Query  450  TEAIGLAPRAMEKCKNRS  397
            +EAIGLAPRA+EKCKNRS
Sbjct  223  SEAIGLAPRAVEKCKNRS  240



>ref|XP_007050421.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
 gb|EOX94578.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
Length=305

 Score =   284 bits (727),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 154/197 (78%), Gaps = 5/197 (3%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKAN--NKDADVTKPPAKAQVVGWPPVRSYRRNI  808
            F ET   VDLKL LSSK+S     +  + N      D  KPPAKAQVVGWPPVRS+R+N+
Sbjct  112  FSET---VDLKLNLSSKESSGVDPNEKEKNLLPCATDPAKPPAKAQVVGWPPVRSFRKNM  168

Query  807  LAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIG  628
             A         E G    A  VKVSMDGAPYLRKVDL MYK+Y +LSDALAKMF SFTIG
Sbjct  169  FATQKSSSEESEKGGAGNAAFVKVSMDGAPYLRKVDLRMYKTYLELSDALAKMFSSFTIG  228

Query  627  NCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGT  448
            NC +QG+KDFMNESKLM++LN SDYVPTYEDKDGDWMLVGDVPW+MFVESCKRLRIMKGT
Sbjct  229  NCGSQGVKDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPWDMFVESCKRLRIMKGT  288

Query  447  EAIGLAPRAMEKCKNRS  397
            EAIGLAPRAMEKCKNRS
Sbjct  289  EAIGLAPRAMEKCKNRS  305



>ref|XP_004289900.1| PREDICTED: auxin-induced protein AUX28-like [Fragaria vesca subsp. 
vesca]
Length=250

 Score =   282 bits (721),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 159/205 (78%), Gaps = 14/205 (7%)
 Frame = -1

Query  978  EETHQHVDLKLKLSSKDSQIHAS-------DHNKANNKD--ADVTKPPAKAQVVGWPPVR  826
            +E+   VDLKL LSSKD    A        + NK  N D  AD  KPPAKAQVVGWPPVR
Sbjct  49   DESSACVDLKLNLSSKDGSSTAEKSKSLMMNKNKEKNVDLPADPAKPPAKAQVVGWPPVR  108

Query  825  SYRRNILAANNHQKSGGEDGSDKA--AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            S+R+N+L+A   QKS   D S     A LVKVSMDGAPYLRKVDL+MYK+Y  LSDALAK
Sbjct  109  SFRKNMLSA---QKSSTTDESKAGGNAALVKVSMDGAPYLRKVDLNMYKTYPQLSDALAK  165

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFTIGNC +QG  DFMNE KLM++LN SDY+PTYEDKDGDWMLVGDVPWEMFVESCK
Sbjct  166  MFSSFTIGNCGSQGTIDFMNERKLMDLLNDSDYIPTYEDKDGDWMLVGDVPWEMFVESCK  225

Query  471  RLRIMKGTEAIGLAPRAMEKCKNRS  397
            RLRIMKG EA+GLAPRAMEKCKNRS
Sbjct  226  RLRIMKGKEAVGLAPRAMEKCKNRS  250



>ref|XP_010278165.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=251

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 156/196 (80%), Gaps = 7/196 (4%)
 Frame = -1

Query  966  QHVDLKLKLSSKDSQIHASDH-NKANNKDA-----DVTKPPAKAQVVGWPPVRSYRRNIL  805
            + VDLKL L SK+S +  S+  N    K+      D+ KPPAKAQVVGWPPVRS+R+NIL
Sbjct  57   ETVDLKLNLPSKESVMDPSEKKNSPKEKNLLPCTNDLAKPPAKAQVVGWPPVRSFRKNIL  116

Query  804  AANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGN  625
            +        GE  S  AA  VKVSMDGAPYLRKVDL MYKSYQ+LSDAL KMF SFTIGN
Sbjct  117  SVQKSSTEEGEKVSSSAA-FVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTIGN  175

Query  624  CEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTE  445
            C  QGMKDFMNESKLM++LN S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG+E
Sbjct  176  CGPQGMKDFMNESKLMDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSE  235

Query  444  AIGLAPRAMEKCKNRS  397
            AIGLAPRA+EKCK RS
Sbjct  236  AIGLAPRAVEKCKKRS  251



>gb|AEE25653.1| auxin-responsive protein [Gossypium hirsutum]
Length=249

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 162/201 (81%), Gaps = 12/201 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHAS---DHNKANNKDA---DVTKPPAKAQVVGWPPVRSY  820
            F ET   VDLKL L SK+S +  +   D N +  K     D  KPPAKAQVVGWPPVRSY
Sbjct  55   FSET---VDLKLNLQSKESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSY  111

Query  819  RRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGS  640
            R+NI+A   +QK+  E+  +  A LVKVSMDGAPYLRKVDL MYKSYQ+LSDALAKMF S
Sbjct  112  RKNIMA---NQKNSSEESGNSGAALVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSS  168

Query  639  FTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRI  460
            FT+GN   QGM DFMNESKLM++LN+SDYVP+YEDKDGDWMLVGDVPW+MFV+SCKRLRI
Sbjct  169  FTMGNYGPQGMIDFMNESKLMDLLNSSDYVPSYEDKDGDWMLVGDVPWQMFVDSCKRLRI  228

Query  459  MKGTEAIGLAPRAMEKCKNRS  397
            MKG+EAIGLAPRAMEKCK+R+
Sbjct  229  MKGSEAIGLAPRAMEKCKSRA  249



>ref|XP_009367750.1| PREDICTED: auxin-induced protein AUX28-like [Pyrus x bretschneideri]
Length=259

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 159/214 (74%), Gaps = 21/214 (10%)
 Frame = -1

Query  975  ETHQHVDLKLKLSS----------KDSQIHASDHNKANNKD-----ADVTKPPA-KAQVV  844
            +T   VDLKL LSS          KD     S  NK  N +     +D  KPPA KAQVV
Sbjct  46   DTSTCVDLKLNLSSNSKEANSTGGKDGSAEKSKTNKEKNNNLDFPASDPAKPPAAKAQVV  105

Query  843  GWPPVRSYRRNILAANNHQKSGGED-----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSY  679
            GWPPVRS+R+N+  A  +  + GE      G +  AVLVKVSMDGAPYLRKVDL MYKSY
Sbjct  106  GWPPVRSFRKNMFTAVQNSTNDGESEQMNKGGNNNAVLVKVSMDGAPYLRKVDLKMYKSY  165

Query  678  QDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVP  499
             +LSDALAKMF SFTIGNC +QGMKDFMNESKLM+VLN SDY+PTYEDKDGDWMLVGDVP
Sbjct  166  PELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVLNGSDYIPTYEDKDGDWMLVGDVP  225

Query  498  WEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            WEMFVESCKRLRIMK  EA+GLAPRAMEKCKNRS
Sbjct  226  WEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNRS  259



>ref|XP_010274203.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=252

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 158/201 (79%), Gaps = 10/201 (5%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIH-ASDHNKANNKDA-----DVTKPPAKAQVVGWPPVRSY  820
            F ET   VDLKL L +K+S +  A   N    K+      D  KPPAKAQVVGWPPVRS+
Sbjct  56   FAET---VDLKLNLPTKESVLDPAEKKNSPKEKNLLPCSNDPAKPPAKAQVVGWPPVRSF  112

Query  819  RRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGS  640
            R+NIL+ +      GE  S  AA  VKVSMDGAPYLRKVDL MYKSYQ+LSDAL KMF S
Sbjct  113  RKNILSVHKSSTEEGEKVSSSAA-FVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSS  171

Query  639  FTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRI  460
            FTIGNC  QGMKDFMNESKLM++LN S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRI
Sbjct  172  FTIGNCGPQGMKDFMNESKLMDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRI  231

Query  459  MKGTEAIGLAPRAMEKCKNRS  397
            MKG+EAIGLAPRA+EKCKNRS
Sbjct  232  MKGSEAIGLAPRAVEKCKNRS  252



>gb|AFK37379.1| unknown [Medicago truncatula]
Length=236

 Score =   280 bits (715),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 159/197 (81%), Gaps = 6/197 (3%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            F ET   VDLKL L +K+  ++    +K      D  KPPAKAQVVGWPPVRSY++N++A
Sbjct  44   FSET---VDLKLNLQTKE-DLNEKSASKEKTLLKDPAKPPAKAQVVGWPPVRSYKKNMMA  99

Query  801  --ANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIG  628
               NN + +     +  AAV VKVSMDGAPYLRKVDL+MYK+Y+DLSDALAKMF SFTIG
Sbjct  100  QKVNNTEDTEKTTSNTTAAVFVKVSMDGAPYLRKVDLTMYKTYKDLSDALAKMFSSFTIG  159

Query  627  NCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGT  448
            N  AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKG+
Sbjct  160  NYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGS  219

Query  447  EAIGLAPRAMEKCKNRS  397
            EAIGLAPRAMEKCKNRS
Sbjct  220  EAIGLAPRAMEKCKNRS  236



>gb|KHF98789.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=249

 Score =   279 bits (714),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 162/201 (81%), Gaps = 12/201 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHAS---DHNKANNKDA---DVTKPPAKAQVVGWPPVRSY  820
            F ET   VDLKL L SK+S +  +   D N +  K     D  KPPAKAQ+VGWPPVRSY
Sbjct  55   FSET---VDLKLNLQSKESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQMVGWPPVRSY  111

Query  819  RRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGS  640
            R+NI+A   +QK+  E+  +  A LVKVSMDGAPYLRKVDL MYKSYQ+LSDALAKMF S
Sbjct  112  RKNIMA---NQKNSSEESGNSGAALVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSS  168

Query  639  FTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRI  460
            FT+GN   QGM DFMNESKLM++LN+SDYVP+YEDKDGDWMLVGDVPW+MFV+SCKRLRI
Sbjct  169  FTMGNYGPQGMIDFMNESKLMDLLNSSDYVPSYEDKDGDWMLVGDVPWQMFVDSCKRLRI  228

Query  459  MKGTEAIGLAPRAMEKCKNRS  397
            MKG+EAIGLAPRAMEKCK+R+
Sbjct  229  MKGSEAIGLAPRAMEKCKSRA  249



>ref|XP_009610435.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana tomentosiformis]
Length=240

 Score =   279 bits (713),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 152/198 (77%), Gaps = 7/198 (4%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASD---HNKANNKDADVTKPPAKAQVVGWPPVRSYRRN  811
            F ET   VDLKL LSSKDS +         K N    D +KPPAKAQVVGWPPVRS+R+N
Sbjct  47   FSET---VDLKLNLSSKDSTVDNQVDKMKEKKNIAPTDPSKPPAKAQVVGWPPVRSFRKN  103

Query  810  ILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTI  631
            +L         GE  S   A  VKVS+DGAPYLRKVDL MYKSYQ LSDAL KMF SFTI
Sbjct  104  VLNVQKKSTGNGES-SGGGAAFVKVSVDGAPYLRKVDLKMYKSYQQLSDALGKMFSSFTI  162

Query  630  GNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG  451
            GNC   G KDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG
Sbjct  163  GNCGNHGFKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKG  222

Query  450  TEAIGLAPRAMEKCKNRS  397
            +EAIGLAPRA+EKCKNRS
Sbjct  223  SEAIGLAPRAVEKCKNRS  240



>ref|XP_011079949.1| PREDICTED: auxin-induced protein AUX28-like [Sesamum indicum]
Length=244

 Score =   278 bits (712),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 160/205 (78%), Gaps = 13/205 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKD-SQIHASD-HNKANNKDA-------DVTKPPAKAQVVGWPPV  829
            +EET   VDLKL LS+KD   +  SD   K  +K+        D  KPPAKAQVVGWPPV
Sbjct  43   YEET---VDLKLNLSTKDVGNLDQSDLKEKTLSKEKNLLPCPNDSVKPPAKAQVVGWPPV  99

Query  828  RSYRRNILAANNHQKSG-GEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            RS+R+N++A      S   E GS  AA  VKVSMDGAPYLRKVDL MYKSYQ+LSDAL K
Sbjct  100  RSFRKNVMAVQKVSDSEETEKGSGGAAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALGK  159

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFTIG C++QGM DFMNESKLM++LN SDYVPTYEDKDGDWMLVGDVPWEMFVESCK
Sbjct  160  MFSSFTIGKCDSQGMMDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  219

Query  471  RLRIMKGTEAIGLAPRAMEKCKNRS  397
            RLRIMKGTEA GLAPRAMEKCK+RS
Sbjct  220  RLRIMKGTEAKGLAPRAMEKCKSRS  244



>ref|XP_002284133.1| PREDICTED: auxin-responsive protein IAA14 [Vitis vinifera]
Length=243

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 160/201 (80%), Gaps = 12/201 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA-------DVTKPPAKAQVVGWPPVRS  823
            F ET   VDLKL L SK+S +  +++ K   K+        D  KPPAKAQVVGWPPVRS
Sbjct  47   FSET---VDLKLNLQSKESVVDLNENVKCPPKEKNLLPCTKDPAKPPAKAQVVGWPPVRS  103

Query  822  YRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFG  643
            +R+NI+A  N  + G E GS  AA  VKV MDGAPYLRKVDL MYKSYQ+LSDAL KMF 
Sbjct  104  FRKNIMAQKNSSEEG-EKGSSGAA-FVKVCMDGAPYLRKVDLKMYKSYQELSDALGKMFS  161

Query  642  SFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLR  463
            SFT+GN  AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLR
Sbjct  162  SFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  221

Query  462  IMKGTEAIGLAPRAMEKCKNR  400
            IMKG+EAIGLAPRAMEKCKNR
Sbjct  222  IMKGSEAIGLAPRAMEKCKNR  242



>emb|CBI26357.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 160/201 (80%), Gaps = 12/201 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA-------DVTKPPAKAQVVGWPPVRS  823
            F ET   VDLKL L SK+S +  +++ K   K+        D  KPPAKAQVVGWPPVRS
Sbjct  41   FSET---VDLKLNLQSKESVVDLNENVKCPPKEKNLLPCTKDPAKPPAKAQVVGWPPVRS  97

Query  822  YRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFG  643
            +R+NI+A  N  + G E GS  AA  VKV MDGAPYLRKVDL MYKSYQ+LSDAL KMF 
Sbjct  98   FRKNIMAQKNSSEEG-EKGSSGAA-FVKVCMDGAPYLRKVDLKMYKSYQELSDALGKMFS  155

Query  642  SFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLR  463
            SFT+GN  AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLR
Sbjct  156  SFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  215

Query  462  IMKGTEAIGLAPRAMEKCKNR  400
            IMKG+EAIGLAPRAMEKCKNR
Sbjct  216  IMKGSEAIGLAPRAMEKCKNR  236



>ref|NP_001241599.1| uncharacterized protein LOC100803065 [Glycine max]
 gb|ACU20028.1| unknown [Glycine max]
 gb|KHN03840.1| Auxin-induced protein AUX28 [Glycine soja]
Length=248

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 162/213 (76%), Gaps = 20/213 (9%)
 Frame = -1

Query  981  FEETHQ----HVDLKLKLSSKDSQIHAS-------DHNKANNKDA-----DVTKPPAKAQ  850
            F ET       VDL L LS K++   A+       ++ K + K+      D  KPPAKAQ
Sbjct  38   FSETETDETTSVDLMLNLSPKEASAAATTDGADPRENPKTSPKEKNLPLLDPAKPPAKAQ  97

Query  849  VVGWPPVRSYRRNILAANNHQKSGGEDGSDKA--AVLVKVSMDGAPYLRKVDLSMYKSYQ  676
            VVGWPPVRS+R+N+ AA   + SGGE+    +  A  VKVSMDGAPYLRKVDL MYKSY 
Sbjct  98   VVGWPPVRSFRKNMFAA--QKSSGGEESEKNSPNASFVKVSMDGAPYLRKVDLKMYKSYP  155

Query  675  DLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPW  496
            +LSDAL KMF SFTIGNCE+QG KDFMNESKLM++LN+SDYVPTYED+DGDWMLVGDVPW
Sbjct  156  ELSDALGKMFSSFTIGNCESQGFKDFMNESKLMDLLNSSDYVPTYEDRDGDWMLVGDVPW  215

Query  495  EMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            EMFVESCKRLRIMKG EAIGLAPRA+EKCKNRS
Sbjct  216  EMFVESCKRLRIMKGKEAIGLAPRAVEKCKNRS  248



>ref|XP_004495392.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Cicer 
arietinum]
Length=240

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 157/201 (78%), Gaps = 9/201 (4%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKD--ADVTKPPAKAQVVGWPPVRSYRRNI  808
            F ET   VDLKL L S    ++ +  N + +K    D  KPPAKAQVVGWPPVRSYR+N+
Sbjct  43   FSET---VDLKLNLQSNKEDLNDNSKNVSKDKTLLKDPAKPPAKAQVVGWPPVRSYRKNM  99

Query  807  LA--ANNHQKSGGE--DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGS  640
            +A   NN  + G E    S  A   VKVSMDGAPYLRKVDL+MY +Y+DLSDALAKMF S
Sbjct  100  MAQKVNNSDQDGNEKTTSSTTAGTFVKVSMDGAPYLRKVDLTMYNTYKDLSDALAKMFSS  159

Query  639  FTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRI  460
            FT G   AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFVESCKRLRI
Sbjct  160  FTTGKYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRI  219

Query  459  MKGTEAIGLAPRAMEKCKNRS  397
            MKG+EAIGLAPRAMEKCKNRS
Sbjct  220  MKGSEAIGLAPRAMEKCKNRS  240



>ref|XP_006383686.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|ERP61483.1| auxin-induced protein aux28 [Populus trichocarpa]
Length=237

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 157/202 (78%), Gaps = 12/202 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQI---HASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRN  811
            F ET   VDLKL LSSK+  I   H     + N    D  KPPAKAQVVGWPPVRS+R+N
Sbjct  39   FSET---VDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  810  ILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFG  643
            +LA    + S  ++ +DK     A  VKVSMDGAPYLRKVDL MYK+Y +LSDAL KMF 
Sbjct  96   MLAV--QKSSTDQESTDKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYHELSDALGKMFS  153

Query  642  SFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLR  463
            SFTIGNC + GMKDF+NESKL+++LN +DYVPTYEDKDGDWMLVGDVPW+MFVESCKRLR
Sbjct  154  SFTIGNCGSHGMKDFLNESKLIDLLNGTDYVPTYEDKDGDWMLVGDVPWDMFVESCKRLR  213

Query  462  IMKGTEAIGLAPRAMEKCKNRS  397
            IMKGTEA GLAPRAMEKCKNRS
Sbjct  214  IMKGTEATGLAPRAMEKCKNRS  235



>ref|XP_008382962.1| PREDICTED: auxin-induced protein AUX28-like [Malus domestica]
Length=257

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 156/209 (75%), Gaps = 21/209 (10%)
 Frame = -1

Query  960  VDLKLKLSS----------KDSQIHASDHNKANNKD-----ADVTKPPA-KAQVVGWPPV  829
            VDLKL LS+          KD     S  NK  N +     +D  KPPA KAQVVGWPPV
Sbjct  49   VDLKLNLSNNSKETNSTGGKDGSAEKSKTNKEKNNNLDFRASDPAKPPAAKAQVVGWPPV  108

Query  828  RSYRRNILAANNHQKSGGED-----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSD  664
            RS+R+N+  A     + GE      GS+  AVLVKVSMDGAPYLRKVDL MYKSY +LSD
Sbjct  109  RSFRKNMFTAVQKSTNDGESEQMNKGSNNNAVLVKVSMDGAPYLRKVDLKMYKSYPELSD  168

Query  663  ALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFV  484
            ALAKMF SFTIGNC +QGMKDFMNE KLM+VLN SDY+PTYEDKDGDWMLVGDVPWEMFV
Sbjct  169  ALAKMFSSFTIGNCGSQGMKDFMNERKLMDVLNGSDYIPTYEDKDGDWMLVGDVPWEMFV  228

Query  483  ESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            ESCKRLRIMK  EA+GLAPRAMEKCKNRS
Sbjct  229  ESCKRLRIMKSKEAVGLAPRAMEKCKNRS  257



>ref|XP_002319075.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
 gb|EEE94998.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
Length=246

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 156/202 (77%), Gaps = 11/202 (5%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNK------DADVTKPPAKAQVVGWPPVRSY  820
            F ET   VDLKL LS+K+S     +      K        D  KPPAKAQVVGWPP+RS+
Sbjct  47   FSET---VDLKLNLSTKESGKGGDEEKVMKEKTVAPPASTDPAKPPAKAQVVGWPPIRSF  103

Query  819  RRNILAANNHQKSGGE-DGSDKAAV-LVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            R+N++A   +    GE  GS    V  VKVSMDGAPYLRKVDL +YKSYQ+LSDAL KMF
Sbjct  104  RKNVMAVQKNSNDNGEKSGSSGTGVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMF  163

Query  645  GSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
             SFTIGNC +QGMKDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPWEMFV+SCKRL
Sbjct  164  SSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRL  223

Query  465  RIMKGTEAIGLAPRAMEKCKNR  400
            RIMKG+EAIGLAPRA+EKCKNR
Sbjct  224  RIMKGSEAIGLAPRAVEKCKNR  245



>ref|XP_003591806.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AES62057.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=236

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 157/197 (80%), Gaps = 6/197 (3%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            F ET   VDLKL L +K+  ++    +K      D  KPPAKAQVVGWPPVRSYR+N++A
Sbjct  44   FSET---VDLKLNLQTKE-DLNEKSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA  99

Query  801  --ANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIG  628
               NN + +     +  AA  VKVSMDGAPYLRKVDL+MYK+Y+DLSDALAKMF SFT G
Sbjct  100  QKVNNTEDTEKTTSNTTAAAFVKVSMDGAPYLRKVDLTMYKTYKDLSDALAKMFSSFTTG  159

Query  627  NCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGT  448
            N  AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKG+
Sbjct  160  NYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGS  219

Query  447  EAIGLAPRAMEKCKNRS  397
            EAIGLAPRAMEKCKNRS
Sbjct  220  EAIGLAPRAMEKCKNRS  236



>ref|XP_011032399.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=249

 Score =   277 bits (709),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 158/205 (77%), Gaps = 13/205 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA-------DVTKPPAKAQVVGWPPVRS  823
            F ET   VDLKL LS+K++    SD  K   K+        D  KPP+KAQVVGWPP+RS
Sbjct  48   FSET---VDLKLNLSTKETGKDGSDQEKVATKEKTVAPRPNDPAKPPSKAQVVGWPPIRS  104

Query  822  YRRNILAANNHQKSGGEDGSDKA---AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            +R+N++A   +    GE  S      A  VKVSMDGAPYLRKVDL +YKSY++LSDAL K
Sbjct  105  FRKNVMAVQKNNNDEGEKASSSGTTGAAFVKVSMDGAPYLRKVDLKLYKSYRELSDALGK  164

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFTIGNC +QG KDFMNESKL+++LN+S+YVPTYEDKDGDWMLVGDVPW MFV+SCK
Sbjct  165  MFSSFTIGNCGSQGTKDFMNESKLIDLLNSSEYVPTYEDKDGDWMLVGDVPWGMFVDSCK  224

Query  471  RLRIMKGTEAIGLAPRAMEKCKNRS  397
            RLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  225  RLRIMKGSEAIGLAPRAVEKCKNRS  249



>gb|AEE25650.1| auxin-responsive protein [Gossypium hirsutum]
Length=253

 Score =   277 bits (709),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 160/205 (78%), Gaps = 15/205 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKD--SQIHASD------HNKANN--KDADVTKPPAKAQVVGWPP  832
            F ET   VDLKL LSSK   S I  +D      H + N      D  KPPAKAQVVGWPP
Sbjct  54   FSET---VDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVVGWPP  110

Query  831  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            VRS+R+N+LA    QKS  E+  +KAA LVKVSMDGAPYLRKVDL MY SY  LSDALAK
Sbjct  111  VRSFRKNMLATTT-QKSSSEESGEKAA-LVKVSMDGAPYLRKVDLRMYTSYHQLSDALAK  168

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFTIGNC +QGMKDFMNESKLM++LN SDYVPTYEDKDGD MLVGDVPWEMFVESCK
Sbjct  169  MFSSFTIGNCGSQGMKDFMNESKLMDLLNGSDYVPTYEDKDGDRMLVGDVPWEMFVESCK  228

Query  471  RLRIMKGTEAIGLAPRAMEKCKNRS  397
            RLRIMKGTEAIGLAP+A+EKCK RS
Sbjct  229  RLRIMKGTEAIGLAPKAVEKCKKRS  253



>gb|ABH01143.1| auxin-regulated protein [Populus tomentosa]
Length=258

 Score =   277 bits (709),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 159/205 (78%), Gaps = 13/205 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA-------DVTKPPAKAQVVGWPPVRS  823
            F ET   VDLKL LS+KD+    SD  KA  K+        D  KPP+KAQVVGWPP+RS
Sbjct  50   FSET---VDLKLNLSTKDTGKDGSDQEKAAMKEKAVAPRPNDPAKPPSKAQVVGWPPIRS  106

Query  822  YRRNILAANNHQKSGGEDGSDKAAV---LVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            +R+N++A   +    GE  S   A     VKVSMDGAPYLRKVDL +YKSY++LSDAL K
Sbjct  107  FRKNVMAVQKNSNDEGEKASSSGATGAAFVKVSMDGAPYLRKVDLKLYKSYRELSDALGK  166

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFTIGNC +QG K+FMNESKL+++LN+S+YVPTYEDKDGDWMLVGDVPW MFV+SCK
Sbjct  167  MFSSFTIGNCGSQGTKEFMNESKLIDLLNSSEYVPTYEDKDGDWMLVGDVPWGMFVDSCK  226

Query  471  RLRIMKGTEAIGLAPRAMEKCKNRS  397
            RLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  227  RLRIMKGSEAIGLAPRAVEKCKNRS  251



>ref|XP_011038568.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=246

 Score =   277 bits (708),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 157/202 (78%), Gaps = 11/202 (5%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNK------DADVTKPPAKAQVVGWPPVRSY  820
            F ET   VDLKL LS+K+S     +      K        D  KPPAKAQVVGWPP+RS+
Sbjct  47   FSET---VDLKLNLSTKESGKGVVEEKVMKEKTVAPPASTDPAKPPAKAQVVGWPPIRSF  103

Query  819  RRNILAANNHQKSGGE-DGSDKAAV-LVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            R+N++A   +    GE  GS  A V  VKVSMDGAPYLRKVDL +YKSYQ+LSDAL KMF
Sbjct  104  RKNVMAVQKNSNDNGEKSGSGGAGVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMF  163

Query  645  GSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
             SFTIGNC +QGMKDFMNESKL+++LN S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRL
Sbjct  164  SSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRL  223

Query  465  RIMKGTEAIGLAPRAMEKCKNR  400
            RIMKG+EAIGLAPRA+EKCKNR
Sbjct  224  RIMKGSEAIGLAPRAVEKCKNR  245



>emb|CAH59413.1| auxin resistance protein [Plantago major]
Length=227

 Score =   276 bits (706),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 152/191 (80%), Gaps = 5/191 (3%)
 Frame = -1

Query  969  HQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANNH  790
             Q VDLKL LSSKD  +        N K+    KPPAKAQVVGWPPVR++R+N++A    
Sbjct  42   EQTVDLKLNLSSKD--LPNQTDLAENKKNDQPVKPPAKAQVVGWPPVRNFRKNVMAVQKT  99

Query  789  QKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQG  610
            +K+    GS   A  VKVSMDGAPYLRKVDL MYK+Y++LSDAL KMF SFT+  C+AQG
Sbjct  100  EKAEESGGS---AAFVKVSMDGAPYLRKVDLKMYKTYEELSDALGKMFSSFTMSKCDAQG  156

Query  609  MKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLA  430
            M DFMNESKLM++LN SDYVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGTEAIGLA
Sbjct  157  MMDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLA  216

Query  429  PRAMEKCKNRS  397
            PRAMEKCK+RS
Sbjct  217  PRAMEKCKSRS  227



>gb|KHN18836.1| Auxin-induced protein AUX28 [Glycine soja]
Length=246

 Score =   276 bits (707),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 159/211 (75%), Gaps = 19/211 (9%)
 Frame = -1

Query  981  FEETHQ----HVDLKLKLSSKDSQIHASDHNKANNKDA---------DVTKPPAKAQVVG  841
            F ET       VDL L LS K++        +   K +         D  KPPAKAQVVG
Sbjct  39   FSETETDETATVDLMLNLSPKEAAAADGADPREKPKTSPKEKTLLLPDPAKPPAKAQVVG  98

Query  840  WPPVRSYRRNILAANNHQKSGGEDGSDKA---AVLVKVSMDGAPYLRKVDLSMYKSYQDL  670
            WPPVRS+R+N+ AA   QKS G + S+K+   A  VKVSMDGAPYLRKVDL MYKSY +L
Sbjct  99   WPPVRSFRKNMFAA---QKSSGGEESEKSSPNASFVKVSMDGAPYLRKVDLKMYKSYPEL  155

Query  669  SDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEM  490
            SDAL KMF SFTIGNCE+QG KDFMNESKLM++LN+SDYVPTYED+DGDWMLVGDVPWEM
Sbjct  156  SDALGKMFSSFTIGNCESQGFKDFMNESKLMDLLNSSDYVPTYEDRDGDWMLVGDVPWEM  215

Query  489  FVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            FVESCKRLRIMKG EAIGLAPRA+EKCKNRS
Sbjct  216  FVESCKRLRIMKGKEAIGLAPRAVEKCKNRS  246



>ref|XP_006382798.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
 gb|ABK94241.1| unknown [Populus trichocarpa]
 gb|ERP60595.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
Length=250

 Score =   276 bits (707),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 159/206 (77%), Gaps = 14/206 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA-------DVTKPPAKAQVVGWPPVRS  823
            F ET   VDLKL LS+K++    SD  K   K+        D  KPP+KAQVVGWPP+RS
Sbjct  48   FSET---VDLKLNLSTKETGKDGSDQEKVVMKEKTVAPRPNDPAKPPSKAQVVGWPPIRS  104

Query  822  YRRNILAANNHQKSGGE----DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALA  655
            +R+N++A   +    GE     G+   A  VKVSMDGAPYLRKVDL +YKSY++LSDAL 
Sbjct  105  FRKNVMAVQKNSNDEGEKASSSGTTGTAAFVKVSMDGAPYLRKVDLKLYKSYRELSDALG  164

Query  654  KMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESC  475
            KMF SFTIGNC +QG KDFMNESKL+++LN+S+YVPTYEDKDGDWMLVGDVPW MFV+SC
Sbjct  165  KMFSSFTIGNCGSQGTKDFMNESKLIDLLNSSEYVPTYEDKDGDWMLVGDVPWGMFVDSC  224

Query  474  KRLRIMKGTEAIGLAPRAMEKCKNRS  397
            KRLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  225  KRLRIMKGSEAIGLAPRAVEKCKNRS  250



>ref|XP_002302075.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|EEE81348.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|AFZ78622.1| hypothetical protein [Populus tomentosa]
Length=237

 Score =   276 bits (706),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 160/205 (78%), Gaps = 16/205 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDS------QIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  820
            F ET   VDLKLKLSSK+S      +  +S   + N    D  KPPAKAQVVGWPPVRS+
Sbjct  37   FSET---VDLKLKLSSKESGADPNHEKTSSLQREKNLLATDPAKPPAKAQVVGWPPVRSF  93

Query  819  RRNILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            R+N+LA    QKS  +   +K     A  VKVSMDGAPYLRKVDL MYK+YQ+LSDAL K
Sbjct  94   RKNMLAV---QKSSTDQECEKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYQELSDALGK  150

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFTIGNC + G+KDF+NESKL+++LN +DYVPTYEDKDGDWMLVGDVPW+MFVESCK
Sbjct  151  MFSSFTIGNCGSHGLKDFLNESKLIDLLNGTDYVPTYEDKDGDWMLVGDVPWDMFVESCK  210

Query  471  RLRIMKGTEAIGLAPRAMEKCKNRS  397
            RLRIMKGTEA GLAPRAMEKCKNRS
Sbjct  211  RLRIMKGTEATGLAPRAMEKCKNRS  235



>ref|XP_007223810.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
 gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
Length=239

 Score =   276 bits (706),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 156/201 (78%), Gaps = 9/201 (4%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKD------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  820
            F ET   +DLKL L SK+        I + + N       D  KPPAKAQVVGWPPVRSY
Sbjct  42   FSET---IDLKLNLQSKEDLNDNVKNIASKEKNNLLTCTKDPAKPPAKAQVVGWPPVRSY  98

Query  819  RRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGS  640
            R+NI+A  +  +   E GS  +A  VKV MDGAPYLRKVDL MYKSYQ+LS++LAKMF S
Sbjct  99   RKNIMAQKSSSEESTEKGSGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNSLAKMFSS  158

Query  639  FTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRI  460
            FT+G   AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRI
Sbjct  159  FTMGYYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRI  218

Query  459  MKGTEAIGLAPRAMEKCKNRS  397
            MKG+EAIGLAPRAMEKCKNRS
Sbjct  219  MKGSEAIGLAPRAMEKCKNRS  239



>ref|XP_007034956.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
 gb|EOY05882.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
Length=254

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 164/207 (79%), Gaps = 18/207 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--------DVTKPPAKAQVVGWPPVR  826
            F ET   VDLKL L SK++ +  + + +  +K+         D  KPPAKAQVVGWPPVR
Sbjct  54   FSET---VDLKLNLQSKETGMDLNKNIENGSKEKTLLPACTKDPAKPPAKAQVVGWPPVR  110

Query  825  SYRRNILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDAL  658
            SYR+NI+A   +QK+  E+   KA    A  VKVSMDGAPYLRKVDL MYKSYQ+LSDAL
Sbjct  111  SYRKNIMA---NQKNSCEESDKKASSGGAAFVKVSMDGAPYLRKVDLKMYKSYQELSDAL  167

Query  657  AKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVES  478
            AKMF SFT+GN  AQGM DFMNESKLM++LN+SDYVPTYEDKDGDWMLVGDVPWEMFV+S
Sbjct  168  AKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVDS  227

Query  477  CKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            CKRLRIMKG+EAIGLAPRAMEKCK+R+
Sbjct  228  CKRLRIMKGSEAIGLAPRAMEKCKSRA  254



>gb|AAM21317.1|AF373100_1 auxin-regulated protein [Populus tremula x Populus tremuloides]
Length=249

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 158/205 (77%), Gaps = 13/205 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA-------DVTKPPAKAQVVGWPPVRS  823
            F ET   VDLKL LS+K++    SD  K   K+        D  KPP+KAQVVGWPP+RS
Sbjct  48   FSET---VDLKLNLSTKETGKDGSDQEKVVMKEKTVAPRPNDPAKPPSKAQVVGWPPIRS  104

Query  822  YRRNILAANNHQKSGGEDGSDKAAV---LVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            +R+N++A   +    GE  S   A     VKVSMDGAPYLRKVDL +YKSY++LSDAL K
Sbjct  105  FRKNVMAVQKNSNDEGEKASSSGATGAAFVKVSMDGAPYLRKVDLKLYKSYRELSDALGK  164

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFTIGNC +QG KDFMNESKL+++LN+S+YVPTYEDKDGDWMLVGDVPW MFV+SCK
Sbjct  165  MFSSFTIGNCGSQGTKDFMNESKLIDLLNSSEYVPTYEDKDGDWMLVGDVPWGMFVDSCK  224

Query  471  RLRIMKGTEAIGLAPRAMEKCKNRS  397
            RLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  225  RLRIMKGSEAIGLAPRAVEKCKNRS  249



>gb|KDO68557.1| hypothetical protein CISIN_1g026823mg [Citrus sinensis]
Length=232

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 154/202 (76%), Gaps = 14/202 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVT----KPPAKAQVVGWPPVRSYRR  814
            F ET   VDLKL LSSKD+        K  N     T    KPPAK QVVGWPPVRS+R+
Sbjct  36   FSET---VDLKLNLSSKDTSEKVKSFQKEKNPLPRATDPPAKPPAKTQVVGWPPVRSFRK  92

Query  813  NILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            N+L     QKS GE+ SD A    A  VKVSMDGAPYLRKVDL MY +YQDL  AL KMF
Sbjct  93   NMLGV--VQKSSGEE-SDMAGGNNAAFVKVSMDGAPYLRKVDLRMYNTYQDLYHALGKMF  149

Query  645  GSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
             SFTIGNC +QGMKDFMNESKLM++LN SDYVPTYEDKDGDWMLVGDVPW MFVESCKRL
Sbjct  150  SSFTIGNCGSQGMKDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPWGMFVESCKRL  209

Query  465  RIMKGTEAIGLAPRAMEKCKNR  400
            RI+KGTEAIGLAPRAMEKCKNR
Sbjct  210  RIVKGTEAIGLAPRAMEKCKNR  231



>ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum]
 gb|AEX00359.1| IAA16 [Solanum lycopersicum]
Length=251

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 158/209 (76%), Gaps = 17/209 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLS-SKDS------QIHASDH--NKANN----KDADVTKPPAKAQVVG  841
            F ET   VDLKL LS SKDS       I+  D+   K NN       D  KPPAKAQVVG
Sbjct  46   FSET---VDLKLNLSNSKDSTLMDNININQVDNMKEKKNNIVVPSSNDPAKPPAKAQVVG  102

Query  840  WPPVRSYRRNILAANNHQKSGGE-DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSD  664
            WPPVRS+R+N++    +    GE  G+   A  VKVS+DGAPYLRKVDL MYKSYQ LSD
Sbjct  103  WPPVRSFRKNVMTVQKNTTGAGEISGTGTGAAFVKVSVDGAPYLRKVDLKMYKSYQQLSD  162

Query  663  ALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFV  484
            AL KMF SFTIGNC  QG KDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPWEMFV
Sbjct  163  ALGKMFSSFTIGNCGTQGFKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFV  222

Query  483  ESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            +SCKRLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  223  DSCKRLRIMKGSEAIGLAPRAVEKCKNRS  251



>ref|XP_007162490.1| hypothetical protein PHAVU_001G156600g [Phaseolus vulgaris]
 gb|ESW34484.1| hypothetical protein PHAVU_001G156600g [Phaseolus vulgaris]
Length=246

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 159/212 (75%), Gaps = 20/212 (9%)
 Frame = -1

Query  981  FEETHQH-----VDLKLKLSSKDSQIHASDHNKANNKD-------ADVTKPPAKAQVVGW  838
            F ET        VDL L LSSK+    A   +K N          AD  KPPAKAQVVGW
Sbjct  38   FSETETQDDTATVDLMLNLSSKEPTTGADPTHKHNTLPKEKTLLPADPAKPPAKAQVVGW  97

Query  837  PPVRSYRRNILAANNHQKSGGEDG---SDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLS  667
            PPVRS+R+N+LA    QKS GE+    S   A  VKVSMDGAPYLRKVDL MY+SY++LS
Sbjct  98   PPVRSFRKNMLAV---QKSVGEESEKNSSPNASFVKVSMDGAPYLRKVDLKMYQSYRELS  154

Query  666  DALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMF  487
            D+L KMF SFTIGNCE+QGMKDFMNESKLM++LN+SDYVPTYEDKDGDWMLVGDVPWEMF
Sbjct  155  DSLGKMFSSFTIGNCESQGMKDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWEMF  214

Query  486  VESCKRLRIMKGTEAI--GLAPRAMEKCKNRS  397
            VESCKRLRIMKG EAI  GLAPRAM K KNRS
Sbjct  215  VESCKRLRIMKGKEAIGLGLAPRAMAKSKNRS  246



>ref|NP_001268036.1| uncharacterized protein LOC100250231 [Vitis vinifera]
 gb|ADR80321.1| indole-3-acetic acid-induced protein 16 [Vitis vinifera]
Length=238

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 155/198 (78%), Gaps = 8/198 (4%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDS---QIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRN  811
            F ET   VDLKL L SKDS   Q        A     D  KPPAKAQVVGWPPVRS+R+N
Sbjct  46   FSET---VDLKLNLLSKDSVADQAEKMKEKSALPPSNDPAKPPAKAQVVGWPPVRSFRKN  102

Query  810  ILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTI  631
            IL    +     E+ +  +A  VKVSMDGAPYLRKVDL MYKSYQ+LSDAL KMF SFTI
Sbjct  103  ILTVQKNSSE--EEKASSSAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTI  160

Query  630  GNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG  451
            GNC +QGMKDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG
Sbjct  161  GNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG  220

Query  450  TEAIGLAPRAMEKCKNRS  397
            +EAIGLAPRA+EKCKNRS
Sbjct  221  SEAIGLAPRAVEKCKNRS  238



>ref|XP_006432923.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 ref|XP_006471684.1| PREDICTED: auxin-responsive protein IAA16-like isoform X1 [Citrus 
sinensis]
 gb|ESR46163.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=245

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 158/200 (79%), Gaps = 16/200 (8%)
 Frame = -1

Query  960  VDLKLKLSSKDSQ-IHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRRNILAAN  796
            VDLKL LS+K+S  I      K  +  A    D++KPPAKAQVVGWPPVRS+R+NI+A  
Sbjct  50   VDLKLNLSTKESGGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSFRKNIMAVQ  109

Query  795  NHQKSGGEDGSDKA-------AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSF  637
                   E+G +KA          VKVSMDGAPYLRKVDL +YKSYQ+LSDAL KMF SF
Sbjct  110  KDN----EEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSF  165

Query  636  TIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIM  457
            TIGNC +QGMKDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPW+MFV+SCKRLRIM
Sbjct  166  TIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWDMFVDSCKRLRIM  225

Query  456  KGTEAIGLAPRAMEKCKNRS  397
            KG+EAIGLAPRA+EKCKNRS
Sbjct  226  KGSEAIGLAPRAVEKCKNRS  245



>gb|KHG19190.1| Auxin-responsive IAA16 -like protein [Gossypium arboreum]
Length=246

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 159/208 (76%), Gaps = 19/208 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            F ET   V+LKL LSSK++    SD  K  +   D  KPPAKAQVVGWPPVRS+R+NI+A
Sbjct  45   FSET---VNLKLNLSSKETVAEDSDEMKEKS-STDTAKPPAKAQVVGWPPVRSFRKNIMA  100

Query  801  ANNHQKSGGEDGSDKAA-------------VLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  661
                + S  E+G  K A               VKVSMDGAPYLRKVDL +YKSYQ LSDA
Sbjct  101  V--QKASSEEEGGSKKAGNSAAATTTTTAAAFVKVSMDGAPYLRKVDLKLYKSYQQLSDA  158

Query  660  LAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVE  481
            L+KMF SFTIGNC + GMKDFMNESKL+++LN S+YVPTYED+DGDWMLVGDVPWEMFV+
Sbjct  159  LSKMFSSFTIGNCGSHGMKDFMNESKLIDLLNGSEYVPTYEDRDGDWMLVGDVPWEMFVD  218

Query  480  SCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            +CKRLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  219  TCKRLRIMKGSEAIGLAPRAVEKCKNRS  246



>gb|KDO48905.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=245

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 159/200 (80%), Gaps = 16/200 (8%)
 Frame = -1

Query  960  VDLKLKLSSKDSQ-IHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRRNILAAN  796
            VDLKL LS+K+S  I   +  K  +  A    D++KPPAK+QVVGWPPVRS+R+NI+A  
Sbjct  50   VDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSFRKNIMAVQ  109

Query  795  NHQKSGGEDGSDKA-------AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSF  637
                   E+G +KA          VKVSMDGAPYLRKVDL +YKSYQ+LSDAL KMF SF
Sbjct  110  KDN----EEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSF  165

Query  636  TIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIM  457
            TIGNC +QGMKDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPW+MFV+SCKRLRIM
Sbjct  166  TIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWDMFVDSCKRLRIM  225

Query  456  KGTEAIGLAPRAMEKCKNRS  397
            KG+EAIGLAPRA+EKCKNRS
Sbjct  226  KGSEAIGLAPRAVEKCKNRS  245



>gb|KDP40274.1| hypothetical protein JCGZ_02272 [Jatropha curcas]
Length=241

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 163/205 (80%), Gaps = 16/205 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA---------DVTKPPAKAQVVGWPPV  829
            F ET   VDLKL L +KD  +  +++ K  +KD          D  KPPAKAQVVGWPPV
Sbjct  43   FAET---VDLKLNLQAKDGVMDLNENIKNASKDKNHLPTSTIKDPAKPPAKAQVVGWPPV  99

Query  828  RSYRRNILAANNHQKSGGEDGSDK-AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            RSYR+NI+A   +QK+  ++G    +A  VKV MDGAPYLRKVDL MYKSYQ+LSDALAK
Sbjct  100  RSYRKNIMA---NQKNNSDEGEKSLSAAFVKVCMDGAPYLRKVDLKMYKSYQELSDALAK  156

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFT+GN  AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV+SCK
Sbjct  157  MFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCK  216

Query  471  RLRIMKGTEAIGLAPRAMEKCKNRS  397
            RLRIMKG+EAIGLAPRAMEKCK+R+
Sbjct  217  RLRIMKGSEAIGLAPRAMEKCKSRT  241



>gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum]
Length=246

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 159/208 (76%), Gaps = 19/208 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            F ET   V+LKL LSSK++    SD  K  +   D  KPPAKAQVVGWPPVRS+R+NI+A
Sbjct  45   FSET---VNLKLNLSSKETVAEDSDKMKEKS-STDPAKPPAKAQVVGWPPVRSFRKNIMA  100

Query  801  ANNHQKSGGEDGSDKAA-------------VLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  661
                + S  E+G  K A               VKVSMDGAPYLRKVDL +YKSYQ LSDA
Sbjct  101  V--QKASSEEEGGSKKAGNSAAAITTTTAAAFVKVSMDGAPYLRKVDLKLYKSYQQLSDA  158

Query  660  LAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVE  481
            L+KMF SFTIGNC + GMKDFMNESKL+++LN S+YVPTYEDKDGDWMLVGDVPWEMFV+
Sbjct  159  LSKMFSSFTIGNCGSHGMKDFMNESKLIDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVD  218

Query  480  SCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            SCKRLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  219  SCKRLRIMKGSEAIGLAPRAVEKCKNRS  246



>ref|XP_007144686.1| hypothetical protein PHAVU_007G176600g [Phaseolus vulgaris]
 gb|ESW16680.1| hypothetical protein PHAVU_007G176600g [Phaseolus vulgaris]
Length=245

 Score =   275 bits (702),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 154/206 (75%), Gaps = 12/206 (6%)
 Frame = -1

Query  981  FEETHQH---VDLKLKLSSKDSQIHAS----DHNKANNKD----ADVTKPPAKAQVVGWP  835
            F ET      VDL L LS K++    S    +  K + KD     D  KPPAK QVVGWP
Sbjct  41   FSETQTETTTVDLMLNLSPKEAASAPSPDPRNMPKTSPKDNTLIPDPAKPPAKEQVVGWP  100

Query  834  PVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALA  655
            PVRS+R+N+ AA        E  S  A+  VKVSMDGAPYLRKVDL MYKSY +LSDAL 
Sbjct  101  PVRSFRKNMFAAQKSMVEESEKNSPNAS-FVKVSMDGAPYLRKVDLKMYKSYPELSDALG  159

Query  654  KMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESC  475
            KMF SFTIGNCE+QG KDFMNESKLM++LN+SD VPTYED+DGDWMLVGDVPWEMFVESC
Sbjct  160  KMFSSFTIGNCESQGFKDFMNESKLMDLLNSSDCVPTYEDRDGDWMLVGDVPWEMFVESC  219

Query  474  KRLRIMKGTEAIGLAPRAMEKCKNRS  397
            KRLRIMKG EAIGLAPRAMEKCKNRS
Sbjct  220  KRLRIMKGKEAIGLAPRAMEKCKNRS  245



>ref|XP_006443921.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 ref|XP_006479598.1| PREDICTED: auxin-induced protein AUX28-like [Citrus sinensis]
 gb|ESR57161.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=232

 Score =   274 bits (701),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 155/202 (77%), Gaps = 14/202 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVT----KPPAKAQVVGWPPVRSYRR  814
            F ET   VDLKL LSSKD+        K  +     T    KPPAK QVVGWPPVRS+R+
Sbjct  36   FSET---VDLKLNLSSKDTSEKVKSFQKEKHPLPRATDPPAKPPAKTQVVGWPPVRSFRK  92

Query  813  NILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            N+L     QKS GE+ SD A    A  VKVSMDGAPYLRKVDL MY +Y+DL DAL KMF
Sbjct  93   NMLGV--VQKSSGEE-SDMAGGNNAAFVKVSMDGAPYLRKVDLRMYNTYKDLYDALGKMF  149

Query  645  GSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
             SFTIGNC +QGMKDFMNESKLM++LN SDYVPTYEDKDGDWMLVGDVPW MFVESCKRL
Sbjct  150  SSFTIGNCGSQGMKDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPWGMFVESCKRL  209

Query  465  RIMKGTEAIGLAPRAMEKCKNR  400
            RI+KGTEAIGLAPRAMEKCKNR
Sbjct  210  RIVKGTEAIGLAPRAMEKCKNR  231



>ref|XP_004493739.1| PREDICTED: auxin-induced protein AUX28-like [Cicer arietinum]
Length=246

 Score =   275 bits (702),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 159/206 (77%), Gaps = 18/206 (9%)
 Frame = -1

Query  975  ETHQH-VDLKLKLSSK---DSQIHASDHNKANNKD-----ADVTKPPAKAQVVGWPPVRS  823
            ET  H +DL L LS+     S++   D+ K   K+     AD  KPPAKAQVVGWPPVRS
Sbjct  45   ETQDHTMDLMLNLSTNKEPTSEVDPIDNTKILQKENTLLPADPAKPPAKAQVVGWPPVRS  104

Query  822  YRRNILAANNHQKSG----GEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALA  655
            YR+N+LA    QKS     GE+  + A   VKVSMDGAPYLRKVDL +Y SY  LSD+L 
Sbjct  105  YRKNMLAM---QKSSNDVVGEE--NNAISFVKVSMDGAPYLRKVDLKIYNSYSQLSDSLG  159

Query  654  KMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESC  475
            KMF SFTIGNCE+QGMKDFMNESKLM++LN SDYVPTYEDKDGDWM+VGDVPWEMFVESC
Sbjct  160  KMFSSFTIGNCESQGMKDFMNESKLMDLLNNSDYVPTYEDKDGDWMVVGDVPWEMFVESC  219

Query  474  KRLRIMKGTEAIGLAPRAMEKCKNRS  397
            KRLRIMKG EAIG+APRAMEKCKNRS
Sbjct  220  KRLRIMKGKEAIGIAPRAMEKCKNRS  245



>ref|XP_002520980.1| Auxin-induced protein AUX28, putative [Ricinus communis]
 gb|EEF41397.1| Auxin-induced protein AUX28, putative [Ricinus communis]
Length=244

 Score =   274 bits (701),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 162/204 (79%), Gaps = 16/204 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA------DVTKPPAKAQVVGWPPVRSY  820
            F ET   VDLKL LSSK+  I  +D+ K  +++       D  KPPAKAQVVGWPPVRS+
Sbjct  48   FSET---VDLKLNLSSKEPGIDPNDNTKTISRENNLLSADDPAKPPAKAQVVGWPPVRSF  104

Query  819  RRNILAANNHQKSGGEDGSDKAAV---LVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKM  649
            R+++L     QKS  E+ ++K  +    VKVSMDGAPYLRKVDL MYKSYQ+LSDAL KM
Sbjct  105  RKHMLTV---QKSSNEE-TEKLGLNPTFVKVSMDGAPYLRKVDLKMYKSYQELSDALGKM  160

Query  648  FGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR  469
            F SFTIGNC +QGMKDF+NESKL+++LN +DYVPTYEDKDGDWMLVGDVPW+MFVESCKR
Sbjct  161  FSSFTIGNCGSQGMKDFLNESKLIDLLNGTDYVPTYEDKDGDWMLVGDVPWKMFVESCKR  220

Query  468  LRIMKGTEAIGLAPRAMEKCKNRS  397
            LRIMKGTEA GLAPRAMEK KNRS
Sbjct  221  LRIMKGTEATGLAPRAMEKRKNRS  244



>gb|KFK39592.1| hypothetical protein AALP_AA3G264300 [Arabis alpina]
Length=235

 Score =   274 bits (700),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 163/204 (80%), Gaps = 15/204 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA---DVTKPPAKAQVVGWPPVRSYRRN  811
            F ET   VDL L L S   +    ++  A  K++   D TKPPAKAQVVGWPPVR+YR+N
Sbjct  38   FSET---VDLMLNLQSNKEEAVDLNNIAAAPKESLLKDPTKPPAKAQVVGWPPVRNYRKN  94

Query  810  ILAANNHQKSGG--EDGSDKA---AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            ++     QK+ G  E  SDKA   A LVKVSMDGAPYLRKVDL+MYKSYQDLSDALAKMF
Sbjct  95   MM---TQQKTTGSEEASSDKAGTGAALVKVSMDGAPYLRKVDLNMYKSYQDLSDALAKMF  151

Query  645  GSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
             SFT+GN  AQGM DFMNESKLM++LN+S+YVP+YEDKDGDWMLVGDVPWEMFVESCKRL
Sbjct  152  SSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRL  211

Query  465  RIMKGTEAIGLAPRAMEK-CKNRS  397
            RIMKG+EAIGLAPRAMEK CKNRS
Sbjct  212  RIMKGSEAIGLAPRAMEKYCKNRS  235



>ref|XP_010025014.1| PREDICTED: auxin-responsive protein IAA16-like [Eucalyptus grandis]
 gb|KCW61599.1| hypothetical protein EUGRSUZ_H04335 [Eucalyptus grandis]
Length=270

 Score =   275 bits (702),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 163/225 (72%), Gaps = 35/225 (16%)
 Frame = -1

Query  966  QHVDLKLKLSSKD-----SQIHASD--HNKANNKDA---------------------DVT  871
            + VDLKL  SSK+      +I AS     K N+ D                      +V 
Sbjct  46   ETVDLKLNFSSKEDGGSVEKIRASAPAEKKMNSSDGKEKSVAAAAAAAAPPPPSSSSEVA  105

Query  870  KPPAKAQVVGWPPVRSYRRNILA----ANNHQKSGGEDGSDKA---AVLVKVSMDGAPYL  712
            KPPAKAQVVGWPPVRS+R+NI+A     ++  + GG  G+  A   A  VKVSMDGAPYL
Sbjct  106  KPPAKAQVVGWPPVRSFRKNIMAVQKSGSDEAEKGGSSGNGAATSGAAFVKVSMDGAPYL  165

Query  711  RKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDK  532
            RKVDL +YKSYQDLSDALAKMF SFTIGNC + GMKDFMNESKL+++LN SDYVPTYEDK
Sbjct  166  RKVDLKLYKSYQDLSDALAKMFSSFTIGNCGSGGMKDFMNESKLIDLLNGSDYVPTYEDK  225

Query  531  DGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            DGDWMLVGDVPW+MFV+SCKRLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  226  DGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  270



>gb|ACU18407.1| unknown [Glycine max]
Length=246

 Score =   274 bits (700),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 158/211 (75%), Gaps = 19/211 (9%)
 Frame = -1

Query  981  FEETHQ----HVDLKLKLSSKDSQIHASDHNKANNKDA---------DVTKPPAKAQVVG  841
            F ET       VDL L LS K++        +   K +         D  KPPAKAQVVG
Sbjct  39   FSETETDETATVDLMLNLSPKEAAAADGADPREKPKTSPKEKTLLLPDPAKPPAKAQVVG  98

Query  840  WPPVRSYRRNILAANNHQKSGGEDGSDKA---AVLVKVSMDGAPYLRKVDLSMYKSYQDL  670
            WPPVRS+R+N+ AA   QKS G + S+K+   A  VKVSMDGAPYLRKVDL MYKSY +L
Sbjct  99   WPPVRSFRKNMFAA---QKSSGGEESEKSSPNASFVKVSMDGAPYLRKVDLKMYKSYPEL  155

Query  669  SDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEM  490
            SDAL KMF SFTIGNCE+QG KDFMNESKLM++LN+SDYVPTYED+DGDWMLVGDVPWEM
Sbjct  156  SDALGKMFSSFTIGNCESQGFKDFMNESKLMDLLNSSDYVPTYEDRDGDWMLVGDVPWEM  215

Query  489  FVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            FVESCKRL IMKG EAIGLAPRA+EKCKNRS
Sbjct  216  FVESCKRLHIMKGKEAIGLAPRAVEKCKNRS  246



>ref|NP_001275398.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
 gb|ACV31209.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
Length=249

 Score =   274 bits (700),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 157/207 (76%), Gaps = 15/207 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLS-SKDS----QIHASDH--NKANN----KDADVTKPPAKAQVVGWP  835
            F ET   VDLKL LS SKDS     I+  D+   K NN       D  K PAKAQVVGWP
Sbjct  46   FSET---VDLKLNLSNSKDSTLMDNINQVDNMKEKKNNIVVPSSNDPAKSPAKAQVVGWP  102

Query  834  PVRSYRRNILAANNHQKSGGED-GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDAL  658
            PVRS+R+N++    +    GE  G+   A  VKVS+DGAPYLRKVDL MYKSYQ LSDAL
Sbjct  103  PVRSFRKNVMTVQKNTTGAGESSGTGTGAAFVKVSVDGAPYLRKVDLKMYKSYQQLSDAL  162

Query  657  AKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVES  478
             KMF SFTIGNC  QG KDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPWEMFV+S
Sbjct  163  GKMFSSFTIGNCGTQGFKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDS  222

Query  477  CKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            CKRLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  223  CKRLRIMKGSEAIGLAPRAVEKCKNRS  249



>ref|XP_008224185.1| PREDICTED: auxin-responsive protein IAA14 [Prunus mume]
Length=248

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 157/201 (78%), Gaps = 9/201 (4%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVT------KPPAKAQVVGWPPVRSY  820
            F ET   +DLKL L SK+       +N +  K+  +T      KPPAKAQVVGWPPVRSY
Sbjct  51   FSET---IDLKLNLQSKEDLNDKVKNNASKEKNNLLTCTKYPAKPPAKAQVVGWPPVRSY  107

Query  819  RRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGS  640
            R+NI+A  +  +   E GS  +A  VKV MDGAPYLRKVDL MYKSYQ+LS++LAKMF S
Sbjct  108  RKNIMAQKSSSEESTEKGSGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNSLAKMFSS  167

Query  639  FTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRI  460
            FT+G    QGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRI
Sbjct  168  FTMGYYGPQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRI  227

Query  459  MKGTEAIGLAPRAMEKCKNRS  397
            MKG+EAIGLAPRAMEKCKNRS
Sbjct  228  MKGSEAIGLAPRAMEKCKNRS  248



>ref|XP_008372303.1| PREDICTED: auxin-induced protein AUX28-like [Malus domestica]
Length=257

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 155/214 (72%), Gaps = 21/214 (10%)
 Frame = -1

Query  975  ETHQHVDLKLKLSS----------KDSQIHASDHNKANNKDADV-----TKPPA-KAQVV  844
            +T   VDLKL LS+          KD     S  NK  N   D+      KPPA KAQVV
Sbjct  44   DTSTCVDLKLNLSNSSKEANSTGGKDGIAVKSKTNKEKNNHLDLPASDPAKPPAAKAQVV  103

Query  843  GWPPVRSYRRNILAANNHQKSGGED-----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSY  679
            GWPPVRS+R+N+        + GE      G +  AVLVKVSMDGAPYLRKVDL MYKSY
Sbjct  104  GWPPVRSFRKNMFTGVQKSSNDGESEQMNKGGNNNAVLVKVSMDGAPYLRKVDLKMYKSY  163

Query  678  QDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVP  499
             +LSDALAKMF SFTIGNC +QGMKDFMNESKLM+VLN SDY PTYEDKDGDWMLVGDVP
Sbjct  164  PELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVLNGSDYTPTYEDKDGDWMLVGDVP  223

Query  498  WEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            WEMFVESCKRLRIMK  EA+GLAPRAMEKCKNRS
Sbjct  224  WEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNRS  257



>ref|XP_009611797.1| PREDICTED: auxin-responsive protein IAA14 [Nicotiana tomentosiformis]
Length=243

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 155/203 (76%), Gaps = 11/203 (5%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNK-----DADVTKPPAKAQVVGWPPVRSYR  817
            F ET   VDLKL L S DS       +K  N      + D  KPPAKAQVVGWPPVRS+R
Sbjct  44   FSET---VDLKLNLQSNDSSGLDLKKDKMKNPSKETCNKDSAKPPAKAQVVGWPPVRSFR  100

Query  816  RNILAANNH---QKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            +NI+A       ++S    G   +A  VKVSMDGAPYLRKVDL MYKSYQ LSDALAKMF
Sbjct  101  KNIMAQKGSSICEESENSKGGSSSAAFVKVSMDGAPYLRKVDLKMYKSYQQLSDALAKMF  160

Query  645  GSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
             SFT+GN  AQGM DFMNE KLM++LN+SDYVPTYEDKDGDWMLVGDVPW+MFV+SCKRL
Sbjct  161  SSFTMGNYGAQGMIDFMNERKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWQMFVDSCKRL  220

Query  465  RIMKGTEAIGLAPRAMEKCKNRS  397
            RIMKG+EAIGLAPRAMEKCK+RS
Sbjct  221  RIMKGSEAIGLAPRAMEKCKSRS  243



>emb|CDO99148.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 157/197 (80%), Gaps = 6/197 (3%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--DVTKPPA-KAQVVGWPPVRSYRRN  811
            F ET   VDLKL L   +  +   +  KA  K+A  D  KPPA KAQVVGWPPVRS+R+N
Sbjct  45   FSET---VDLKLNLQPNEPVVDLKEKMKAPAKEATKDPVKPPAAKAQVVGWPPVRSFRKN  101

Query  810  ILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTI  631
            I+A  ++ +    + +  +A  VKVSMDGAPYLRKVDL MYKSYQ+LSDALAKMF SFT+
Sbjct  102  IMAQKSNTEEAAAEKAGSSAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTM  161

Query  630  GNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG  451
            GN   QGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG
Sbjct  162  GNYGPQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKG  221

Query  450  TEAIGLAPRAMEKCKNR  400
            +EAIGLAPRAMEKCK+R
Sbjct  222  SEAIGLAPRAMEKCKSR  238



>gb|KHG04941.1| Auxin-induced AUX28 [Gossypium arboreum]
Length=235

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 151/189 (80%), Gaps = 5/189 (3%)
 Frame = -1

Query  960  VDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQKS  781
            VDLKL L S  S     D N   +       PPAKAQVVGWPPVRS+R+N+LA    QKS
Sbjct  51   VDLKLNLIST-SPTDDKDKNIVPSHLDPAKPPPAKAQVVGWPPVRSFRKNMLAT---QKS  106

Query  780  GGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGM-K  604
             G + S + A  VKVSMDGAPYLRKVDL MYK+YQ LSDALAKMF SFTIGNC +QG+ K
Sbjct  107  SGSEDSGEKAAFVKVSMDGAPYLRKVDLRMYKTYQQLSDALAKMFSSFTIGNCGSQGLLK  166

Query  603  DFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPR  424
            DFMNESKLM++LN SDYVPTYEDKDGD MLVGDVPWEMF+ESCKRLRIMKGTEAIGLAPR
Sbjct  167  DFMNESKLMDLLNGSDYVPTYEDKDGDLMLVGDVPWEMFIESCKRLRIMKGTEAIGLAPR  226

Query  423  AMEKCKNRS  397
            AMEKCKNRS
Sbjct  227  AMEKCKNRS  235



>gb|KHN05057.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=245

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 160/203 (79%), Gaps = 14/203 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSK-DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL  805
            F ET   VDLKL L SK D   +  + +K      D  KPPAKAQVVGWPPVRSYR+N++
Sbjct  49   FSET---VDLKLNLHSKEDLNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMM  105

Query  804  AANNHQKSGGEDGSDK-------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            A    QK   ED ++K       +   VKVSMDGAPYLRKVDL+MYKSY++LSDALAKMF
Sbjct  106  AV---QKVSTEDVAEKTTSSTANSGAFVKVSMDGAPYLRKVDLTMYKSYKELSDALAKMF  162

Query  645  GSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
             SFT+GN  AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFVESCKRL
Sbjct  163  SSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  222

Query  465  RIMKGTEAIGLAPRAMEKCKNRS  397
            RIMKG+EAIGLAPRAMEKCK+RS
Sbjct  223  RIMKGSEAIGLAPRAMEKCKSRS  245



>ref|XP_009591035.1| PREDICTED: auxin-responsive protein IAA7-like [Nicotiana tomentosiformis]
Length=225

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 153/202 (76%), Gaps = 12/202 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDS--------QIHASDHNKANNKDADVTKPPAKAQVVGWPPVR  826
            F ET   VDLKL   + DS        +I      +  N + D  KPPAKAQVVGWPPVR
Sbjct  27   FSET---VDLKLNFQTNDSSSAMDLKEKIKTPTTKEIANCNKDSVKPPAKAQVVGWPPVR  83

Query  825  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            S+R+N++A  N+ +   E  S  A   VKV MDGAPYLRKVDL MYKSYQ LSDALAKMF
Sbjct  84   SFRKNVMAQKNNTEET-EKSSATAVAFVKVCMDGAPYLRKVDLKMYKSYQQLSDALAKMF  142

Query  645  GSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
             SFT+GN  AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRL
Sbjct  143  SSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRL  202

Query  465  RIMKGTEAIGLAPRAMEKCKNR  400
            RIMKG+EAIGLAPRAMEKCK R
Sbjct  203  RIMKGSEAIGLAPRAMEKCKRR  224



>ref|XP_011042427.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 156/202 (77%), Gaps = 12/202 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQI---HASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRN  811
            F ET   VDLKL LSSK+  I   H     + N    D  KPPAKAQVVGWPPVRS+R+N
Sbjct  39   FSET---VDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  810  ILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFG  643
            +LA    + S  ++ +DK     A  VKVSMDGAPYLRKVDL MYK+Y +LSDAL +MF 
Sbjct  96   MLAV--QKSSTDQESTDKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYHELSDALGEMFS  153

Query  642  SFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLR  463
            SFTIGNC + GMKDF+NESKL+++L  +DYVPTYEDKDGDWMLVGDVPW+MFVESCKRLR
Sbjct  154  SFTIGNCGSHGMKDFLNESKLIDLLTGTDYVPTYEDKDGDWMLVGDVPWDMFVESCKRLR  213

Query  462  IMKGTEAIGLAPRAMEKCKNRS  397
            IMKGTEA GLAPRAMEKCK+RS
Sbjct  214  IMKGTEATGLAPRAMEKCKSRS  235



>ref|XP_006298251.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
 gb|EOA31149.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
Length=285

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 162/203 (80%), Gaps = 14/203 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKL-SSKDSQI---HASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRR  814
            F ET   VDL L L S+K+  +   + +   K  N   D  KPPAKAQVVGWPPVR+YR+
Sbjct  89   FSET---VDLMLNLQSNKEGSVDLNNVAASPKEKNLIKDPAKPPAKAQVVGWPPVRNYRK  145

Query  813  NILAANNHQKSGG--EDGSDKA-AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFG  643
            NI+     QK+ G  E  S+KA A LVKVSMDGAPYLRKVDL MYKSYQDLSDALAKMF 
Sbjct  146  NIM---TQQKTSGTEEASSEKAGAGLVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFS  202

Query  642  SFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLR  463
            SFT+GN  AQGM DFMNESKLMN+LN+S+YVP+YEDKDGDWMLVGDVPWEMFVESCKRLR
Sbjct  203  SFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLR  262

Query  462  IMKGTEAIGLAPRAMEK-CKNRS  397
            IMKG+EAIGLAPRAMEK CKNRS
Sbjct  263  IMKGSEAIGLAPRAMEKYCKNRS  285



>ref|XP_009354870.1| PREDICTED: auxin-induced protein AUX28-like [Pyrus x bretschneideri]
Length=257

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 158/214 (74%), Gaps = 21/214 (10%)
 Frame = -1

Query  975  ETHQHVDLKLKLSSKDSQIHAS------------DHNKANNKD---ADVTKPPA-KAQVV  844
            +T   VDLKL LS+     +++            D  K N+ D   +D  KPPA KAQVV
Sbjct  44   DTSTCVDLKLNLSNSSKAANSTGGKDGSADKSKTDKEKNNHLDLPASDPAKPPAAKAQVV  103

Query  843  GWPPVRSYRRNILAANNHQKSGGED-----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSY  679
            GWPPVRS+R+N+  A     + GE      G +  AVLVKVSMDGAPYLRKVDL MYKSY
Sbjct  104  GWPPVRSFRKNMFTAVQKSSNDGESEQMNKGGNNNAVLVKVSMDGAPYLRKVDLKMYKSY  163

Query  678  QDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVP  499
             +LSDALAKMF SFTIGNC +QGMKDFMNESKLM+VLN SDY+PTYEDKDGDWMLVGDVP
Sbjct  164  PELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVLNGSDYIPTYEDKDGDWMLVGDVP  223

Query  498  WEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            WEMFVESCKRLRIMK  EA+GLAPRAMEKCKN S
Sbjct  224  WEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNIS  257



>gb|AGV54230.1| auxin-induced protein AUX28 [Phaseolus vulgaris]
Length=245

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 153/206 (74%), Gaps = 12/206 (6%)
 Frame = -1

Query  981  FEETHQH---VDLKLKLSSKDSQIHAS----DHNKANNKD----ADVTKPPAKAQVVGWP  835
            F ET      VDL L LS K++    S    +  K + KD     D  KPPAK QVVGWP
Sbjct  41   FSETQTETTTVDLMLNLSPKEAASAPSPDPRNMPKTSPKDNTLIPDPAKPPAKEQVVGWP  100

Query  834  PVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALA  655
            PVRS+R+N+ AA        E  S  A+  VKVSMDGAPYLRKVDL MYK+Y +LSDAL 
Sbjct  101  PVRSFRKNMFAAQKSMVEESEKNSPNAS-FVKVSMDGAPYLRKVDLKMYKNYPELSDALG  159

Query  654  KMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESC  475
            KMF SFTIGNCE+QG KDFMNESKLM+ LN+SD VPTYED+DGDWMLVGDVPWEMFVESC
Sbjct  160  KMFSSFTIGNCESQGFKDFMNESKLMDFLNSSDCVPTYEDRDGDWMLVGDVPWEMFVESC  219

Query  474  KRLRIMKGTEAIGLAPRAMEKCKNRS  397
            KRLRIMKG EAIGLAPRAMEKCKNRS
Sbjct  220  KRLRIMKGKEAIGLAPRAMEKCKNRS  245



>gb|AFK42876.1| unknown [Medicago truncatula]
 gb|KEH23853.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=250

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  882  ADVTKPPAKAQVVGWPPVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKV  703
            AD  KPPAKAQVVGWPPVRSYR+N+LA    +       +  A   VKVSMDGAPYLRKV
Sbjct  89   ADPAKPPAKAQVVGWPPVRSYRKNMLAMQKSESEKNSSSNFNAITFVKVSMDGAPYLRKV  148

Query  702  DLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGD  523
            DL MY SY  LSD+L KMF SFTIGNCE+QGMKDFMNESKLM++LN SDYVPTYEDKDGD
Sbjct  149  DLKMYTSYSQLSDSLGKMFSSFTIGNCESQGMKDFMNESKLMDLLNNSDYVPTYEDKDGD  208

Query  522  WMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            WMLVGDVPWEMFVESCKRLRIMKG EAIG+APRAMEKCKNRS
Sbjct  209  WMLVGDVPWEMFVESCKRLRIMKGKEAIGIAPRAMEKCKNRS  250



>ref|XP_007143877.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
 gb|ESW15871.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
Length=244

 Score =   271 bits (694),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 160/203 (79%), Gaps = 16/203 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKD--ADVTKPPAKAQVVGWPPVRSYRRNI  808
            F ET   VDLKL L +K+  ++ +  N    K    D TK PAKAQVVGWPPVRSYR+N+
Sbjct  50   FSET---VDLKLNLQAKE-DLNENLKNAPEEKTLLKDPTKQPAKAQVVGWPPVRSYRKNM  105

Query  807  LAANNHQKSGGEDGSDK------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            +     QK   EDG++K      +   VKVSMDGAPYLRKVDL+MYKSY+DLSDALAKMF
Sbjct  106  MT----QKVSTEDGAEKTTSSTASGAFVKVSMDGAPYLRKVDLTMYKSYKDLSDALAKMF  161

Query  645  GSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
             SFT+GN  AQGM DFMNE KLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFVESCKRL
Sbjct  162  SSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  221

Query  465  RIMKGTEAIGLAPRAMEKCKNRS  397
            RIMKG+EAIGLAPRAMEKCK+RS
Sbjct  222  RIMKGSEAIGLAPRAMEKCKSRS  244



>ref|XP_010679165.1| PREDICTED: auxin-responsive protein IAA14-like [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score =   273 bits (697),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 152/199 (76%), Gaps = 8/199 (4%)
 Frame = -1

Query  978  EETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAA  799
            E+T     L L  +   + + A D   ++  +AD  KPPAKAQVVGWPPVRSYR+N+LA 
Sbjct  83   EQTATSAPLDLMKNDNKADVSA-DKEISSKVNADSVKPPAKAQVVGWPPVRSYRKNMLAV  141

Query  798  NNHQKSGGEDGS-----DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFT  634
               + +GG D       +    LVKVSMDGAPYLRKVDL MYKSYQDLSDAL KMF SFT
Sbjct  142  --QKTTGGPDSETEKPMNGGGALVKVSMDGAPYLRKVDLKMYKSYQDLSDALGKMFSSFT  199

Query  633  IGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMK  454
            +GN  AQGM DFMNESKLM++LN SDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMK
Sbjct  200  LGNYGAQGMIDFMNESKLMDLLNDSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMK  259

Query  453  GTEAIGLAPRAMEKCKNRS  397
            G EA GLAPRAMEKCKNRS
Sbjct  260  GKEAAGLAPRAMEKCKNRS  278



>ref|XP_003521268.1| PREDICTED: auxin-induced protein AUX28-like [Glycine max]
 gb|KHN10705.1| Auxin-induced protein AUX28 [Glycine soja]
Length=254

 Score =   271 bits (694),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 159/201 (79%), Gaps = 16/201 (8%)
 Frame = -1

Query  960  VDLKLKLSSKDSQIHA--SDHNKANNKD-----ADVTKPPAKAQVVGWPPVRSYRRNILA  802
            VDL L LSSK++   A  +D +K   K+     AD  KPPAKAQVVGWPPVRS+R+N+LA
Sbjct  57   VDLMLNLSSKEAAAAADPTDKHKTLPKEKTLLPADPAKPPAKAQVVGWPPVRSFRKNMLA  116

Query  801  ANNHQKSGGED----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFT  634
                QKS GE+     S   A  VKVSMDGAPYLRKVDL MYKSY++LSD+L KMF SFT
Sbjct  117  V---QKSVGEENEKNSSSPNASFVKVSMDGAPYLRKVDLKMYKSYRELSDSLGKMFSSFT  173

Query  633  IGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMK  454
            IGNCE+QGMKDFMNESKL ++LN+SDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMK
Sbjct  174  IGNCESQGMKDFMNESKLNDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMK  233

Query  453  GTEAI--GLAPRAMEKCKNRS  397
            G EAI  GLAPRAM K KNRS
Sbjct  234  GKEAIGLGLAPRAMAKSKNRS  254



>gb|AFZ78617.1| hypothetical protein [Populus tomentosa]
Length=248

 Score =   271 bits (693),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 160/206 (78%), Gaps = 14/206 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNK-ANNKDA---------DVTKPPAKAQVVGWPP  832
            F ET   VDLKL L +KD  +  +D+ K   +KD          D  KPPAKAQVVGWPP
Sbjct  46   FAET---VDLKLNLQAKDGVMDLNDNIKNITSKDKNHLPAAAIKDPAKPPAKAQVVGWPP  102

Query  831  VRSYRRNILAANNHQKSGGEDGSD-KAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALA  655
            VRSYR+N++A  N  + G +  +   +A  VKV MDGAPYLRKVDL MY+SYQ+LSDALA
Sbjct  103  VRSYRKNVMAQKNASEEGEKTSTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQELSDALA  162

Query  654  KMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESC  475
            KMF SFT+GN  AQGM DFMNESKLM++LN+S+YVP+YEDKDGDWMLVGDVPWEMFV SC
Sbjct  163  KMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVNSC  222

Query  474  KRLRIMKGTEAIGLAPRAMEKCKNRS  397
            KRLRIMKG+EAIGLAPRAMEKCK+R+
Sbjct  223  KRLRIMKGSEAIGLAPRAMEKCKSRT  248



>ref|XP_011091113.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=241

 Score =   271 bits (692),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 155/203 (76%), Gaps = 15/203 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRR  814
            F ET   VDLKL L   +S         A +K      D  KPPAKAQVVGWPPVRS+R+
Sbjct  44   FSET---VDLKLNLQPNESAALDLKETSAMDKPVLPPKDPVKPPAKAQVVGWPPVRSFRK  100

Query  813  NILAANNHQKSGGEDG-----SDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKM  649
            NI+A   HQKS  E+      S   A  VKVSMDGAPYLRKVDL MYKSYQ+LSDALAKM
Sbjct  101  NIMA---HQKSSDEEAEKAACSSPTAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALAKM  157

Query  648  FGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR  469
            F SFT+GN   QGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPW+MFV+SCKR
Sbjct  158  FSSFTMGNYGTQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWQMFVDSCKR  217

Query  468  LRIMKGTEAIGLAPRAMEKCKNR  400
            LRIMKG+EAIGLAPRAMEKCK+R
Sbjct  218  LRIMKGSEAIGLAPRAMEKCKSR  240



>gb|AAM96891.1| auxin-responsive protein IAA1 [Mirabilis jalapa]
Length=194

 Score =   269 bits (688),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 149/178 (84%), Gaps = 10/178 (6%)
 Frame = -1

Query  912  SDHNKAN--NKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQKSGG--EDGSDKAAV-  748
            +D+ K N  N +AD+ KPPAKAQVVGWPPVRSYR+N+LA    QKS G  E  S+K A  
Sbjct  19   NDNTKVNGANNNADLAKPPAKAQVVGWPPVRSYRKNMLAV---QKSTGAPESESEKPAAN  75

Query  747  --LVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMN  574
              LVKVSMDGAPYLRKVDL +YKSYQDLSDAL KMF SFT+GN  +QGM DFMNESKLM+
Sbjct  76   GGLVKVSMDGAPYLRKVDLKLYKSYQDLSDALGKMFSSFTLGNYGSQGMIDFMNESKLMD  135

Query  573  VLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNR  400
            ++N SDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG EA GLAPRAMEKCKNR
Sbjct  136  LINGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNR  193



>ref|NP_001236693.1| auxin-induced protein AUX28 [Glycine max]
 sp|P13089.1|AUX28_SOYBN RecName: Full=Auxin-induced protein AUX28 [Glycine max]
 gb|AAA33945.1| auxin-regulated protein (Aux28) [Glycine max]
Length=243

 Score =   271 bits (692),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 155/207 (75%), Gaps = 13/207 (6%)
 Frame = -1

Query  978  EETHQHVDLKLKLSSKDSQIH------ASDHNKANNKD-----ADVTKPPAKAQVVGWPP  832
            +E+   VDL L LSSK++          +D +K   K+     AD  KPPAK QVVGWPP
Sbjct  37   DESATTVDLMLNLSSKEAATTAAAAADPTDKHKTLPKEKTLLPADPAKPPAKTQVVGWPP  96

Query  831  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            VRS+R+N+LA         E  S   A  VKVSMDGAPYLRKVDL MYKSY++LSD+L K
Sbjct  97   VRSFRKNMLAVQKSVGEESEKNSSPNASFVKVSMDGAPYLRKVDLKMYKSYRELSDSLGK  156

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFT GNCE+QGMKDFMNESKL ++LN+SDYVPTYEDKDGDWMLVGDVPWEMFVESCK
Sbjct  157  MFSSFTFGNCESQGMKDFMNESKLNDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  216

Query  471  RLRIMKGTEAI--GLAPRAMEKCKNRS  397
            RLRIMKG EAI  GLAPRAM KCKNRS
Sbjct  217  RLRIMKGKEAIGLGLAPRAMAKCKNRS  243



>gb|KDP23667.1| hypothetical protein JCGZ_23500 [Jatropha curcas]
Length=248

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 160/205 (78%), Gaps = 16/205 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA-DVTKPPAKAQVVGWPPVRSYRRNIL  805
            F ET   VDLKL LS+K+S        K +   + D  KPPAKAQVVGWPP+RS+R+N++
Sbjct  50   FSET---VDLKLNLSTKESGKEEKMKEKTDVPSSNDPAKPPAKAQVVGWPPIRSFRKNVM  106

Query  804  AANNHQKSGGEDGS---------DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            +    QKS G++             +A  VKVSMDGAPYLRKVDL +YKSYQ+LSDAL K
Sbjct  107  SV---QKSNGDEAEKAATATAAGSSSAAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGK  163

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFTIGNC +QGMKDFMNESKL+++LN S+YVPTYEDKDGDWMLVGDVPWEMF++SCK
Sbjct  164  MFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFIDSCK  223

Query  471  RLRIMKGTEAIGLAPRAMEKCKNRS  397
            RLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  224  RLRIMKGSEAIGLAPRAVEKCKNRS  248



>ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
 gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
Length=249

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 158/209 (76%), Gaps = 18/209 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKD------ADVTKPPAKAQVVGWPPVRSY  820
            F ET   VDLKL LS+    + A +  K   K       AD  KPPAKAQVVGWPPVRS+
Sbjct  45   FSET---VDLKLNLSTAKEAV-ADEAEKVKKKSTVAPRSADPAKPPAKAQVVGWPPVRSF  100

Query  819  RRNILAA--NNHQKSGGEDGSDKAAV------LVKVSMDGAPYLRKVDLSMYKSYQDLSD  664
            R+NI+A   N+    G + GS            VKVSMDGAPYLRKVDL +YKSYQ+LSD
Sbjct  101  RKNIMAVQKNSSDVEGEKAGSSNTTTATVAAAFVKVSMDGAPYLRKVDLKLYKSYQELSD  160

Query  663  ALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFV  484
            AL KMF SFTIGNC +QGMKDFMNESKL+++LN S+YVPTYEDKDGDWMLVGDVPWEMFV
Sbjct  161  ALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFV  220

Query  483  ESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            +SCKRLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  221  DSCKRLRIMKGSEAIGLAPRAVEKCKNRS  249



>ref|XP_010102292.1| Auxin-responsive protein IAA16 [Morus notabilis]
 gb|EXB93235.1| Auxin-responsive protein IAA16 [Morus notabilis]
Length=257

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 162/210 (77%), Gaps = 21/210 (10%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDS----QIHASD-HNKANNKDADVTKPPAKAQVVGWPPVRSYR  817
            F ET   VDLKL LSSKDS    Q+   +      +   D  KPPAKAQVVGWPPVRS+R
Sbjct  54   FPET---VDLKLNLSSKDSGSLDQVDKKEIKTSPVSPSTDSVKPPAKAQVVGWPPVRSFR  110

Query  816  RNILAANNHQKSGGEDGSDKAAV----------LVKVSMDGAPYLRKVDLSMYKSYQDLS  667
            +NI++A   QK+ G+  + KA             VKVSMDGAPYLRKVDL +YKSYQ+LS
Sbjct  111  KNIVSA---QKNSGDHEAVKAGGGGGGSSSSAAFVKVSMDGAPYLRKVDLKLYKSYQELS  167

Query  666  DALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMF  487
            DAL KMF SFTIGNC +QGMKDFMNESKL+++LN S+YVPTYEDKDGDWMLVGDVPWEMF
Sbjct  168  DALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDKDGDWMLVGDVPWEMF  227

Query  486  VESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            V+SCKRLRIMKG+EAIGLAPRA+EKCKNR+
Sbjct  228  VDSCKRLRIMKGSEAIGLAPRAVEKCKNRT  257



>gb|KHN02537.1| Auxin-induced protein AUX28 [Glycine soja]
Length=252

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 155/207 (75%), Gaps = 13/207 (6%)
 Frame = -1

Query  978  EETHQHVDLKLKLSSKDSQIH------ASDHNKANNKD-----ADVTKPPAKAQVVGWPP  832
            +E+   VDL L LSSK++          +D +K   K+     AD  KPPAK QVVGWPP
Sbjct  46   DESATTVDLMLNLSSKEAATTAAAAADPTDKHKTLPKEKTLLPADPAKPPAKTQVVGWPP  105

Query  831  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            VRS+R+N+LA         E  S   A  VKVSMDGAPYLRKVDL MYKSY++LSD+L K
Sbjct  106  VRSFRKNMLAVQKSVGEESEKNSSPNASFVKVSMDGAPYLRKVDLKMYKSYRELSDSLGK  165

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFT GNCE+QGMKDFMNESKL ++LN+SDYVPTYEDKDGDWMLVGDVPWEMFVESCK
Sbjct  166  MFSSFTFGNCESQGMKDFMNESKLNDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  225

Query  471  RLRIMKGTEAI--GLAPRAMEKCKNRS  397
            RLRIMKG EAI  GLAPRAM KCKNRS
Sbjct  226  RLRIMKGKEAIGLGLAPRAMAKCKNRS  252



>ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max]
 gb|ACR39367.1| Aux/IAA protein [Glycine max]
Length=239

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 159/204 (78%), Gaps = 15/204 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSK-DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL  805
            F ET   VDLKL L +K D   +  + +K      D  KPPAKAQVVGWPPVRSYR+N++
Sbjct  42   FSET---VDLKLNLQTKEDLNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMM  98

Query  804  AANNHQKSGGEDGSDK--------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKM  649
            A    QK   E+ ++K        +   VKVSMDGAPYLRKVDL+MYKSY+DLSDALAKM
Sbjct  99   AV---QKVSNEEVAEKTTSSTIANSGAFVKVSMDGAPYLRKVDLTMYKSYKDLSDALAKM  155

Query  648  FGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR  469
            F SFT+GN  AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV SCKR
Sbjct  156  FSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVGSCKR  215

Query  468  LRIMKGTEAIGLAPRAMEKCKNRS  397
            LRIMKG+EAIGLAPRAMEKCK+RS
Sbjct  216  LRIMKGSEAIGLAPRAMEKCKSRS  239



>gb|ACL81167.1| auxin-responsive protein IAA1, partial [Mirabilis jalapa]
Length=263

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 149/178 (84%), Gaps = 10/178 (6%)
 Frame = -1

Query  912  SDHNKAN--NKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQKSGG--EDGSDKAAV-  748
            +D+ K N  N +AD+ KPPAKAQVVGWPPVRSYR+N+LA    QKS G  E  S+K A  
Sbjct  88   NDNTKVNGANNNADLAKPPAKAQVVGWPPVRSYRKNMLAV---QKSTGAPESESEKPAAN  144

Query  747  --LVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMN  574
              LVKVSMDGAPYLRKVDL +YKSYQDLSDAL KMF SFT+GN  +QGM DFMNESKLM+
Sbjct  145  GGLVKVSMDGAPYLRKVDLKLYKSYQDLSDALGKMFSSFTLGNYGSQGMIDFMNESKLMD  204

Query  573  VLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNR  400
            ++N SDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG EA GLAPRAMEKCKNR
Sbjct  205  LINGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNR  262



>ref|XP_009135842.1| PREDICTED: auxin-responsive protein IAA7-like [Brassica rapa]
 emb|CDX92973.1| BnaA03g36950D [Brassica napus]
Length=237

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 161/206 (78%), Gaps = 17/206 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLS-SKDSQIHASDHNKANNKD--ADVTKPPAKAQVVGWPPVRSYRRN  811
            F ET   +DL L L  +K+  +  ++   +  K    D  KPPAKAQVVGWPPVR+YR+N
Sbjct  38   FSET---MDLMLNLQCNKEETVDLNNATASKEKTLLKDPAKPPAKAQVVGWPPVRNYRKN  94

Query  810  ILAANNHQKSGGED-------GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            ++     QK+ GE+       G+   A LVKVSMDGAPYLRKVDL+MYKSYQDLSDALAK
Sbjct  95   MMT---QQKTSGEEEASSEKAGNGGGAALVKVSMDGAPYLRKVDLTMYKSYQDLSDALAK  151

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFT+GN  AQGM DFMNESKLMN+LN+S+YVP+YEDKDGDWMLVGDVPWEMFV+SCK
Sbjct  152  MFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVQSCK  211

Query  471  RLRIMKGTEAIGLAPRAMEK-CKNRS  397
            RLRIMKG+EAIGLAPRAMEK CKNRS
Sbjct  212  RLRIMKGSEAIGLAPRAMEKYCKNRS  237



>ref|XP_003556389.2| PREDICTED: auxin-responsive protein IAA14-like [Glycine max]
Length=331

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 159/203 (78%), Gaps = 14/203 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSK-DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL  805
            F ET   VDLKL L SK D   +  + +K      D  KPPAKAQVVGWPPVRSYR+N++
Sbjct  135  FSET---VDLKLNLHSKEDLNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMM  191

Query  804  AANNHQKSGGEDGSDKAA-------VLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            A    QK   ED ++K           VKVSMDGAPYLRKVDL+MYKSY++LSDALAKMF
Sbjct  192  AV---QKVSTEDVAEKTTSSTANPGAFVKVSMDGAPYLRKVDLTMYKSYKELSDALAKMF  248

Query  645  GSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
             SFT+GN  AQGM DFMNESKLM++LN+S+YVP+YEDKDGDWMLVGDVPWEMFVESCKRL
Sbjct  249  SSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRL  308

Query  465  RIMKGTEAIGLAPRAMEKCKNRS  397
            RIMKG+EAIGLAPRAMEKCK+RS
Sbjct  309  RIMKGSEAIGLAPRAMEKCKSRS  331



>ref|XP_004495802.1| PREDICTED: auxin-responsive protein IAA16-like [Cicer arietinum]
Length=252

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 158/208 (76%), Gaps = 16/208 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLS------SKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  820
            F ET  +VDLKL LS      S  S I     NK  +K +    P AKAQVVGWPPVRS+
Sbjct  48   FSET-SNVDLKLNLSPTNDSVSPSSTIPLVPANKVKDKTSTTAPPRAKAQVVGWPPVRSF  106

Query  819  RRNIL---AANNH----QKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  661
            R+NI+    +NN     +K+ G  G + A   VKVSMDGAPYLRKVDL +YKSYQ+LSDA
Sbjct  107  RKNIVNVQKSNNEVEAEKKTSGSGGGNGA--FVKVSMDGAPYLRKVDLKLYKSYQELSDA  164

Query  660  LAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVE  481
            LAKMF SFTIGNC +Q  KDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPWEMFV 
Sbjct  165  LAKMFSSFTIGNCGSQVTKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVG  224

Query  480  SCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            SCKRLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  225  SCKRLRIMKGSEAIGLAPRAVEKCKNRS  252



>gb|EYU30526.1| hypothetical protein MIMGU_mgv1a012831mg [Erythranthe guttata]
Length=239

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 154/200 (77%), Gaps = 11/200 (6%)
 Frame = -1

Query  966  QHVDLKLKLSSKDSQ------IHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL  805
            + +DLKL+L++  S       I  + H K    + +  KPP+K QVVGWPPVRS+R+NIL
Sbjct  39   ESIDLKLELNTLSSSGNNNNNIDENIHQKNLKAEENNAKPPSKTQVVGWPPVRSFRKNIL  98

Query  804  AANNHQKSGGEDGSDK-----AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGS  640
            A   +  SG    +DK     AA  VKVS+DGAPYLRKVDL MY SYQ LSDAL KMF S
Sbjct  99   AVQKNSSSGATTEADKSSGGAAAAFVKVSLDGAPYLRKVDLKMYTSYQQLSDALGKMFSS  158

Query  639  FTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRI  460
            FTIGNC ++G+KD MNESKL+++LN SDYVPTYEDKDGDWMLVGDVPWEMFV+SCKR+RI
Sbjct  159  FTIGNCGSEGIKDLMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRI  218

Query  459  MKGTEAIGLAPRAMEKCKNR  400
            MKG+EAIGLAPRA+EKCKNR
Sbjct  219  MKGSEAIGLAPRAVEKCKNR  238



>ref|XP_011082603.1| PREDICTED: auxin-responsive protein IAA14-like [Sesamum indicum]
Length=215

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 152/199 (76%), Gaps = 22/199 (11%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            FEET   +D KL  +S    I+            D  KPPAKAQVVGWPPVRS+R+NI+A
Sbjct  35   FEET---LDFKLNFASNGENIN------------DSVKPPAKAQVVGWPPVRSFRKNIMA  79

Query  801  ANNHQKSG----GEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFT  634
                +KSG     E GS      VKVSMDGAPYLRK+DL MYK+YQ+LSDAL KMF SFT
Sbjct  80   V---KKSGDSEDNEKGSGGGGAFVKVSMDGAPYLRKIDLKMYKTYQELSDALGKMFSSFT  136

Query  633  IGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMK  454
            +G C+ QGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPW+MFVESCKRLR+MK
Sbjct  137  MGKCDTQGMMDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWQMFVESCKRLRVMK  196

Query  453  GTEAIGLAPRAMEKCKNRS  397
            GTEA GLAPRAMEKCK+RS
Sbjct  197  GTEAKGLAPRAMEKCKSRS  215



>ref|XP_011026048.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 158/206 (77%), Gaps = 18/206 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKA-------NNKDADVTKPPAKAQVVGWPPVRS  823
            F ET   VDLKLKLSSK+ +    +H K        N    D  KPPAKAQVVGWPPVRS
Sbjct  37   FSET---VDLKLKLSSKE-RGAGPNHEKTRSLQREKNILATDPAKPPAKAQVVGWPPVRS  92

Query  822  YRRNILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALA  655
            +R+N+LA    QKS  +   +K     A  VKVSMDGAPYLRKVDL MYK+YQ+LS AL 
Sbjct  93   FRKNMLAV---QKSSTDQECEKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYQELSGALE  149

Query  654  KMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESC  475
            +MF SFTIGNC + G+KDF+NESKL+++LN +DYVPTYEDKDGDWMLVGDVPW+MFVESC
Sbjct  150  EMFSSFTIGNCGSHGLKDFLNESKLIDLLNGTDYVPTYEDKDGDWMLVGDVPWDMFVESC  209

Query  474  KRLRIMKGTEAIGLAPRAMEKCKNRS  397
            KRLRIMKGTEA GLAPRAMEKCKNRS
Sbjct  210  KRLRIMKGTEATGLAPRAMEKCKNRS  235



>gb|ACJ83896.1| unknown [Medicago truncatula]
 gb|AFK48514.1| unknown [Medicago truncatula]
 gb|KEH42620.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=245

 Score =   269 bits (688),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 156/207 (75%), Gaps = 12/207 (6%)
 Frame = -1

Query  981  FEETHQH-----VDLKLKLSSKDSQI--HASDHNKANNKDADVTKPPAKAQVVGWPPVRS  823
            F ET        VDLKL LS+K+           KA        KPPAKAQVVGWPPVRS
Sbjct  39   FSETESESETNTVDLKLNLSTKEGATDPQFKPKEKALLLSDSGAKPPAKAQVVGWPPVRS  98

Query  822  YRRNILAAN----NHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALA  655
            +R+N+ AA       ++S  ++ ++     VKVSMDGAPYLRKVDL MYKSY +LSDALA
Sbjct  99   FRKNMFAAQKSNEGSEESEKKNSNNNPISFVKVSMDGAPYLRKVDLKMYKSYPELSDALA  158

Query  654  KMFGSFTIGNCEAQGMKDFMNES-KLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVES  478
            KMF SFT GNCE+QG+KDFMNES KLM++LN+SDYVPTYEDKDGDWMLVGDVPWEMF++S
Sbjct  159  KMFNSFTTGNCESQGIKDFMNESNKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFIDS  218

Query  477  CKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            CKRLRIMKG EAIGLAPRAMEKCKNRS
Sbjct  219  CKRLRIMKGKEAIGLAPRAMEKCKNRS  245



>gb|ACJ84642.1| unknown [Medicago truncatula]
Length=250

 Score =   270 bits (689),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  882  ADVTKPPAKAQVVGWPPVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKV  703
            AD  KPPAKAQVVGWPPVRSYR+N+LA    +       +  A   VKVSMDGAPYLRKV
Sbjct  89   ADPAKPPAKAQVVGWPPVRSYRKNMLAMQKSESEKNSSSNFNAITFVKVSMDGAPYLRKV  148

Query  702  DLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGD  523
            DL MY SY  LSD+L KMF SFTIGNCE+QGMKDFMNESKLM++LN SDYVPTYEDKDGD
Sbjct  149  DLKMYTSYSQLSDSLGKMFSSFTIGNCESQGMKDFMNESKLMDLLNNSDYVPTYEDKDGD  208

Query  522  WMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            WMLVGDVPW MFVESCKRLRIMKG EAIG+APRAMEKCKNRS
Sbjct  209  WMLVGDVPWGMFVESCKRLRIMKGKEAIGIAPRAMEKCKNRS  250



>ref|XP_011030586.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   269 bits (688),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 160/208 (77%), Gaps = 18/208 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDS---------QIHASDHNK---ANNKDADVTKPPAKAQVVGW  838
            F ET   VDLKL L +K+           I + D N+   A  KD    KPPAKAQVVGW
Sbjct  46   FAET---VDLKLNLQAKEGVMDLNENIKNIASKDKNQLPAATIKDP--AKPPAKAQVVGW  100

Query  837  PPVRSYRRNILAANNHQKSGGEDGSD-KAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  661
            PPVRSYR+N+LA  N  + G +  +   +A  VKV MDGAPYLRKVDL MY+SYQ+LSDA
Sbjct  101  PPVRSYRKNVLAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQELSDA  160

Query  660  LAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVE  481
            LAKMF SFT+GN  AQGM DFMNESKLM++LN+S+YVP+YEDKDGDWMLVGDVPWEMFV+
Sbjct  161  LAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVD  220

Query  480  SCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            SCKRLRIMKG+EAIGLAPRAMEKCK+R+
Sbjct  221  SCKRLRIMKGSEAIGLAPRAMEKCKSRT  248



>gb|AFK44393.1| unknown [Lotus japonicus]
Length=242

 Score =   269 bits (688),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 155/199 (78%), Gaps = 7/199 (4%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSK-DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL  805
            F ET   VDLKL L SK D      + +K      D  KPPAKAQVVGWPPVRSYR+N++
Sbjct  47   FSET---VDLKLNLQSKEDLNDDVKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMM  103

Query  804  AAN-NHQKSGGEDGSDKAA--VLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFT  634
                N++  G E  +   A     KVSMDGAPYLRKVDL+MYKSY++LSDALAKMF SFT
Sbjct  104  VQKVNNEDQGTEKTTSSTAGGAFAKVSMDGAPYLRKVDLTMYKSYKELSDALAKMFSSFT  163

Query  633  IGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMK  454
            +GN  AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMK
Sbjct  164  MGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMK  223

Query  453  GTEAIGLAPRAMEKCKNRS  397
            G+EAIGLAPRAMEKCKNRS
Sbjct  224  GSEAIGLAPRAMEKCKNRS  242



>gb|ACU21378.1| unknown [Glycine max]
Length=252

 Score =   269 bits (688),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 154/207 (74%), Gaps = 13/207 (6%)
 Frame = -1

Query  978  EETHQHVDLKLKLSSKDSQIH------ASDHNKANNKD-----ADVTKPPAKAQVVGWPP  832
            +E+   VDL L LSSK++          +D +K   K+     AD  KPPAK QVVGWPP
Sbjct  46   DESATTVDLMLNLSSKEAATAAAAAADPTDKHKTLPKEKTLLPADPAKPPAKTQVVGWPP  105

Query  831  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            VRS+R+N+LA         E  S   A  VKVSMDG PYLRKVDL MYKSY++LSD+L K
Sbjct  106  VRSFRKNMLAVQKSVGEESEKNSSPNASFVKVSMDGTPYLRKVDLKMYKSYRELSDSLGK  165

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFT GNCE+QGMKDFMNESKL ++LN+SDYVPTYEDKDGDWMLVGDVPWEMFVESCK
Sbjct  166  MFSSFTFGNCESQGMKDFMNESKLNDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  225

Query  471  RLRIMKGTEAI--GLAPRAMEKCKNRS  397
            RLRIMKG EAI  GLAPRAM KCKNRS
Sbjct  226  RLRIMKGKEAIGLGLAPRAMAKCKNRS  252



>ref|XP_010552451.1| PREDICTED: auxin-responsive protein IAA14-like [Tarenaya hassleriana]
Length=235

 Score =   268 bits (686),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 159/199 (80%), Gaps = 11/199 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTK----PPAKAQVVGWPPVRSYRR  814
            F ET   VDLKL L +    +    +N A +K   V+K    PPAKAQVVGWPPVR+YR+
Sbjct  44   FSET---VDLKLNLQTNKEGV-VDLNNVAKDKSLLVSKDHAKPPAKAQVVGWPPVRNYRK  99

Query  813  NILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFT  634
            N++A   HQKS   +    AA  VKVSMDGAPYLRKVDL MYKSYQ+LSDALAKMF SFT
Sbjct  100  NMMA---HQKSSAVEEEKAAAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFT  156

Query  633  IGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMK  454
            +GN  AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPW+MFV+SCKRLRIMK
Sbjct  157  MGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWQMFVDSCKRLRIMK  216

Query  453  GTEAIGLAPRAMEKCKNRS  397
            G+EAIGLAPRA+EKCKNRS
Sbjct  217  GSEAIGLAPRAVEKCKNRS  235



>ref|XP_010532600.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=229

 Score =   268 bits (686),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 156/195 (80%), Gaps = 6/195 (3%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            F ET   VDLKL L + + Q    D   A+    D  KPP+KAQVVGWPPVR+YR+N++A
Sbjct  41   FSET---VDLKLNLQT-NKQEGVMDLTNASKVSKDPAKPPSKAQVVGWPPVRNYRKNVMA  96

Query  801  ANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNC  622
              N + S  E+    AA  VKVSMDGAPYLRKVDL M+KSYQDLSDALAKMF SFT+G+ 
Sbjct  97   --NQKNSAMEEEEKAAAAFVKVSMDGAPYLRKVDLKMHKSYQDLSDALAKMFSSFTMGSY  154

Query  621  EAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEA  442
             AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPW MFVESCKRLRIMKG+EA
Sbjct  155  GAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWLMFVESCKRLRIMKGSEA  214

Query  441  IGLAPRAMEKCKNRS  397
            IGLAPRAMEKCKNRS
Sbjct  215  IGLAPRAMEKCKNRS  229



>gb|EYU46510.1| hypothetical protein MIMGU_mgv1a013084mg [Erythranthe guttata]
Length=231

 Score =   268 bits (685),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 154/206 (75%), Gaps = 14/206 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSK----DSQIHASDHNKANNKD-------ADVTKPPAKAQVVGWP  835
            F ET   VDLKL LSS     DS I   ++N    K+        D  KPPAKAQVVGWP
Sbjct  29   FSET---VDLKLNLSSAEIGLDSAIDLKENNFNKEKNLLPSSSPTDSVKPPAKAQVVGWP  85

Query  834  PVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALA  655
            PVRS+R+N++A      S   +     A  VKVSMDGAPYLRKVDL MYK+Y++LSDAL 
Sbjct  86   PVRSFRKNVMAVQKRTDSDEAEKGTGGAAFVKVSMDGAPYLRKVDLKMYKTYKELSDALG  145

Query  654  KMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESC  475
            KMF SFTIG C++QGM DFM+ESKLM++LN+SDYVPTYEDKDGDWMLVGDVPWEMFV SC
Sbjct  146  KMFSSFTIGKCDSQGMMDFMSESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVGSC  205

Query  474  KRLRIMKGTEAIGLAPRAMEKCKNRS  397
            KRLRIMKGTEA GLAP+AM+KCK RS
Sbjct  206  KRLRIMKGTEAKGLAPKAMDKCKTRS  231



>gb|KFK37887.1| hypothetical protein AALP_AA3G042100 [Arabis alpina]
Length=232

 Score =   268 bits (685),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 154/210 (73%), Gaps = 24/210 (11%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            F ET   VDLKL LSS  S++         N    V KPPAKAQVVGWPPVRS+R+N+++
Sbjct  32   FSET---VDLKLNLSSTVSEVELE------NMKEKVVKPPAKAQVVGWPPVRSFRKNVMS  82

Query  801  ANNHQKSGGEDGSDKA---------------AVLVKVSMDGAPYLRKVDLSMYKSYQDLS  667
                      +G+DK                   VKVSMDGAPYLRK+DL +YK+YQDLS
Sbjct  83   GQKPTTGDAVEGTDKTSGSSGATSSASAGTTVAYVKVSMDGAPYLRKIDLKLYKTYQDLS  142

Query  666  DALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMF  487
            DAL+KMF SFTIGN   QGMKDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPWEMF
Sbjct  143  DALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMF  202

Query  486  VESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            V+SCKR+RIMKG+EAIGLAPRA+EKCKNRS
Sbjct  203  VDSCKRIRIMKGSEAIGLAPRALEKCKNRS  232



>ref|XP_006298436.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
 gb|EOA31334.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
Length=241

 Score =   268 bits (686),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 157/213 (74%), Gaps = 22/213 (10%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            F ET   VDLKL LSS  +    S     + K+ DV KPPAK QVVGWPPVRS+R+N+++
Sbjct  33   FSET---VDLKLNLSST-AMDSVSGAQLEDIKEKDVVKPPAKTQVVGWPPVRSFRKNVMS  88

Query  801  ANNHQKSGGEDGSDKAAV------------------LVKVSMDGAPYLRKVDLSMYKSYQ  676
                      +G+DK +                    VKVSMDGAPYLRK+DL +YK+YQ
Sbjct  89   GQKPITGDAVEGNDKTSGSSGATSSASACAAAAAAAYVKVSMDGAPYLRKIDLKLYKTYQ  148

Query  675  DLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPW  496
            DLSDAL+KMF SFTIGNC  QGMKDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPW
Sbjct  149  DLSDALSKMFSSFTIGNCGPQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPW  208

Query  495  EMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            EMFV+SCKR+RIMKG+EAIGLAPRA+EKCKNRS
Sbjct  209  EMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  241



>ref|XP_008451270.1| PREDICTED: auxin-induced protein AUX28-like [Cucumis melo]
Length=230

 Score =   268 bits (684),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 152/203 (75%), Gaps = 27/203 (13%)
 Frame = -1

Query  975  ETHQHVDLKLKLSSKDSQIHASDHNKAN----NKD-----ADVTKPPAKAQVVGWPPVRS  823
            ET   VDLKL LSSK++     D   AN    NKD     AD  KPPAKAQVVGWPPVRS
Sbjct  45   ETISKVDLKLNLSSKETVGVGGDDVVANSNPSNKDKAVLTADPAKPPAKAQVVGWPPVRS  104

Query  822  YRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFG  643
            +R+N + A                  VKVSMDGAPYLRKVDL MYKSY+ LSDALA MFG
Sbjct  105  FRKNNMLA-----------------FVKVSMDGAPYLRKVDLKMYKSYKQLSDALAAMFG  147

Query  642  SFT-IGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
            SFT IGNC +Q MKDFMNESKLM++L+ SDYVPTYEDKDGDWMLVGDVPWEMFVESCKR+
Sbjct  148  SFTTIGNCGSQEMKDFMNESKLMDLLSGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRV  207

Query  465  RIMKGTEAIGLAPRAMEKCKNRS  397
            RIMKG EAIGLAPRAMEKCKNRS
Sbjct  208  RIMKGKEAIGLAPRAMEKCKNRS  230



>gb|AFS44507.1| auxin repressor, partial [Fragaria x ananassa]
Length=231

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 157/202 (78%), Gaps = 14/202 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKD-----ADVTKPPAKAQVVGWPPVRSYR  817
            F ET   VDLKL L + +  ++ S  N ++ +       D  KPPAKAQVVGWPPVRSYR
Sbjct  37   FSET---VDLKLNLHANEGLMNESVKNVSSREKNLPCIKDPAKPPAKAQVVGWPPVRSYR  93

Query  816  RNILAANNHQKSGGEDGSDKA--AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFG  643
            +N++A    QKS GE+ S     A  VKV MDGAPYLRKVDL MYKSY++LSDAL+KMF 
Sbjct  94   KNVMA----QKSTGEESSTTTEKAAFVKVCMDGAPYLRKVDLKMYKSYKELSDALSKMFS  149

Query  642  SFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLR  463
            SFT G    QGM DFMNESKLM++LN++DYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLR
Sbjct  150  SFTTGYYGTQGMIDFMNESKLMDLLNSTDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  209

Query  462  IMKGTEAIGLAPRAMEKCKNRS  397
            IMKG+EAIGLAP+AMEKCKNRS
Sbjct  210  IMKGSEAIGLAPKAMEKCKNRS  231



>dbj|BAJ34138.1| unnamed protein product [Thellungiella halophila]
Length=234

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 157/208 (75%), Gaps = 18/208 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL-  805
            F ET   VDLKL LSS  + + +       N    V KPPAK QVVGWPPVRS+R+N++ 
Sbjct  32   FSET---VDLKLNLSS--TALDSVSEVDIQNLKGKVVKPPAKTQVVGWPPVRSFRKNVMS  86

Query  804  --------AANNHQKSGGEDGS----DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  661
                    AA   +K+ G  G+    + A   VKVSMDGAPYLRK+DL +YK+YQDLSDA
Sbjct  87   GQKQTTEVAAEGTEKTCGSSGATSSANAAVAYVKVSMDGAPYLRKIDLKLYKTYQDLSDA  146

Query  660  LAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVE  481
            L+KMF SFTIGN   QGMKDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPW+MFV+
Sbjct  147  LSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWKMFVD  206

Query  480  SCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            SCKR+RIMKG+EAIGLAPRA+EKCKNRS
Sbjct  207  SCKRIRIMKGSEAIGLAPRALEKCKNRS  234



>ref|XP_009364490.1| PREDICTED: auxin-responsive protein IAA16 [Pyrus x bretschneideri]
Length=252

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 157/205 (77%), Gaps = 13/205 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADV---------TKPPA-KAQVVGWPP  832
            F ET   VDLKL +SS+D      D  +   K+ +V         TKPPA KAQ VGWPP
Sbjct  50   FAET---VDLKLNISSEDQSAGDEDQVEEMKKEKNVAPVPRSNNPTKPPAAKAQAVGWPP  106

Query  831  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            VRS+R+NILA   +    GE  +   A  VKVS+DGAPYLRKVDL +YKSYQ+LS AL+K
Sbjct  107  VRSFRKNILAVQKNGSEEGEKTNSITAAFVKVSVDGAPYLRKVDLKLYKSYQELSTALSK  166

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFTIGNC +QGMKDF+NESKL+++L+ S+YVP+YEDKDGDWMLVGDVPWEMFV SCK
Sbjct  167  MFSSFTIGNCGSQGMKDFVNESKLIDLLSGSEYVPSYEDKDGDWMLVGDVPWEMFVNSCK  226

Query  471  RLRIMKGTEAIGLAPRAMEKCKNRS  397
            RLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  227  RLRIMKGSEAIGLAPRAVEKCKNRS  251



>ref|XP_002311658.1| aux/IAA family protein [Populus trichocarpa]
 gb|ABK95711.1| unknown [Populus trichocarpa]
 gb|EEE89025.1| aux/IAA family protein [Populus trichocarpa]
Length=248

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 160/206 (78%), Gaps = 14/206 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNK-ANNKDA---------DVTKPPAKAQVVGWPP  832
            F ET   VDLKL L +K+  +  +++ K   +KD          D  KPPAKAQVVGWPP
Sbjct  46   FAET---VDLKLNLQAKEGVMDLNENIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPP  102

Query  831  VRSYRRNILAANNHQKSGGEDGSD-KAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALA  655
            VRSYR+N++A  N  + G +  +   +A  VKV MDGAPYLRKVDL MY+SYQ+LSDALA
Sbjct  103  VRSYRKNVMAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQELSDALA  162

Query  654  KMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESC  475
            KMF SFT+GN  AQGM DFMNESKLM++LN+S+YVP+YEDKDGDWMLVGDVPWEMFV SC
Sbjct  163  KMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVNSC  222

Query  474  KRLRIMKGTEAIGLAPRAMEKCKNRS  397
            KRLRIMKG+EAIGLAPRAMEKCK+R+
Sbjct  223  KRLRIMKGSEAIGLAPRAMEKCKSRT  248



>ref|XP_007147174.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
 gb|ESW19168.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
Length=272

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/220 (65%), Positives = 160/220 (73%), Gaps = 27/220 (12%)
 Frame = -1

Query  978  EETHQHVDLKLKLSSKDSQIHA---SDHNK-------------ANNKDADVTKPPAKAQV  847
            + T   VDLKL LSS  + + A   SD  K             ++    D  KPPAKAQV
Sbjct  54   DTTTASVDLKLNLSSTSNNVSATPSSDMAKDNTASAAANTTTPSSPPVKDPAKPPAKAQV  113

Query  846  VGWPPVRSYRRNILAANNHQKS-------GGEDG---SDKAAVLVKVSMDGAPYLRKVDL  697
            VGWPPVRS+R+NI+  NN QKS       GG  G    +  A  VKVSMDGAPYLRKVDL
Sbjct  114  VGWPPVRSFRKNIVN-NNVQKSNNKEEVQGGTSGRNHGNTGAAFVKVSMDGAPYLRKVDL  172

Query  696  SMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWM  517
             +YKSYQ+LSD+LAKMF SFTI  CE+QGMKDFMNE+KL++ LN SDYVPTYEDKDGDWM
Sbjct  173  KVYKSYQELSDSLAKMFSSFTIDKCESQGMKDFMNETKLIDFLNGSDYVPTYEDKDGDWM  232

Query  516  LVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            LVGDVPWEMFVESCKRLRIMKG+EAIGLAPRA+EK KNRS
Sbjct  233  LVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKRKNRS  272



>ref|XP_010466604.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 158/212 (75%), Gaps = 24/212 (11%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKD------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  820
            F ET   VDL L L S        + + AS   K   KD    KPPAKAQVVGWPPVR+Y
Sbjct  38   FSET---VDLMLNLQSNKEGSVDLNNVAASTKEKTLLKDP--AKPPAKAQVVGWPPVRNY  92

Query  819  RRNILAANNHQKSGGEDGSDK----------AAVLVKVSMDGAPYLRKVDLSMYKSYQDL  670
            R+NI+     + SG E+ S +           A LVKVSMDGAPYLRKVDL MYKSYQDL
Sbjct  93   RKNIM--TQQKASGTEEASSEKAGSGSGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDL  150

Query  669  SDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEM  490
            SDALAKMF SFT+GN  AQGM DFMNESKLMN+LN+S+YVP+YEDKDGDWMLVGDVPWEM
Sbjct  151  SDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEM  210

Query  489  FVESCKRLRIMKGTEAIGLAPRAMEK-CKNRS  397
            FVESCKRLRIMKG+EAIGLAPRAMEK CKNRS
Sbjct  211  FVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  242



>ref|XP_006408159.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49612.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=234

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 157/208 (75%), Gaps = 18/208 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL-  805
            F ET   VDLKL LSS  + + +       N    V KPPAK QVVGWPPVRS+R+N++ 
Sbjct  32   FSET---VDLKLNLSS--TALDSVSEVDIQNLKEKVVKPPAKTQVVGWPPVRSFRKNVMS  86

Query  804  --------AANNHQKSGGEDGS----DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  661
                    AA   +K+ G  G+    + A   VKVSMDGAPYLRK+DL +YK+YQDLSDA
Sbjct  87   GQKQTTEVAAEGTEKTCGSSGATSSANAAVAYVKVSMDGAPYLRKIDLKLYKTYQDLSDA  146

Query  660  LAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVE  481
            L+KMF SFTIGN   QGMKDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPW+MFV+
Sbjct  147  LSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWKMFVD  206

Query  480  SCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            SCKR+RIMKG+EAIGLAPRA+EKCKNRS
Sbjct  207  SCKRIRIMKGSEAIGLAPRALEKCKNRS  234



>ref|XP_010512022.1| PREDICTED: auxin-responsive protein IAA7 [Camelina sativa]
Length=242

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 158/212 (75%), Gaps = 24/212 (11%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKD------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  820
            F ET   VDL L L S        + + AS   K   KD    KPPAKAQVVGWPPVR+Y
Sbjct  38   FSET---VDLMLNLQSNKEGSVDLNNVAASTKEKTLLKDP--AKPPAKAQVVGWPPVRNY  92

Query  819  RRNILAANNHQKSGGEDGSDK----------AAVLVKVSMDGAPYLRKVDLSMYKSYQDL  670
            R+NI+     + SG E+ S +           A LVKVSMDGAPYLRKVDL MYKSYQDL
Sbjct  93   RKNIM--TQQKASGTEEASSEKAGSGSGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDL  150

Query  669  SDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEM  490
            SDALAKMF SFT+GN  AQGM DFMNESKLMN+LN+S+YVP+YEDKDGDWMLVGDVPWEM
Sbjct  151  SDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEM  210

Query  489  FVESCKRLRIMKGTEAIGLAPRAMEK-CKNRS  397
            FVESCKRLRIMKG+EAIGLAPRAMEK CKNRS
Sbjct  211  FVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  242



>ref|XP_002531288.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
 gb|EEF31101.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
Length=257

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 157/215 (73%), Gaps = 23/215 (11%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKD--------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVR  826
            F ET   VDLKL LS+K+         +    +     +   D  KPPAKAQVVGWPP+R
Sbjct  46   FSET---VDLKLNLSTKEPSGKDVIVGEETMKEKATVPSSSNDPAKPPAKAQVVGWPPIR  102

Query  825  SYRRNILAANNHQKSGGEDGSDK------------AAVLVKVSMDGAPYLRKVDLSMYKS  682
            S+R+N++A   +    GE G+              +A  VKVSMDGAPYLRKVDL +YKS
Sbjct  103  SFRKNVMAVQKNSTDEGEKGTATSAPAAAATSGSTSAAFVKVSMDGAPYLRKVDLKLYKS  162

Query  681  YQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDV  502
            YQ+LSDAL KMF SFTIGNC +QGMKDFMNESKL+++LN S+YVPTYEDKDGDWMLVGDV
Sbjct  163  YQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDKDGDWMLVGDV  222

Query  501  PWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            PWEMFV SCKRLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  223  PWEMFVNSCKRLRIMKGSEAIGLAPRAVEKCKNRS  257



>ref|XP_010488346.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 158/212 (75%), Gaps = 24/212 (11%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKD------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  820
            F ET   VDL L L S        + + AS   K   KD    KPPAKAQVVGWPPVR+Y
Sbjct  38   FSET---VDLMLNLQSNKEGSVDLNNVAASTKEKTLLKDP--AKPPAKAQVVGWPPVRNY  92

Query  819  RRNILAANNHQKSGGEDGSDK----------AAVLVKVSMDGAPYLRKVDLSMYKSYQDL  670
            R+NI+     + SG E+ S +           A LVKVSMDGAPYLRKVDL MYKSYQDL
Sbjct  93   RKNIM--TQQKASGTEEASSEKAGSGSGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDL  150

Query  669  SDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEM  490
            SDALAKMF SFT+GN  AQGM DFMNESKLMN+LN+S+YVP+YEDKDGDWMLVGDVPWEM
Sbjct  151  SDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEM  210

Query  489  FVESCKRLRIMKGTEAIGLAPRAMEK-CKNRS  397
            FVESCKRLRIMKG+EAIGLAPRAMEK CKNRS
Sbjct  211  FVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  242



>gb|AFK44192.1| unknown [Medicago truncatula]
Length=253

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 158/211 (75%), Gaps = 19/211 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLS------SKDSQIHASDHNKA--NNKDADVTKPP-AKAQVVGWPPV  829
            F ET  +VDLKL LS      S    I +   NK       A V+ PP AKAQVVGWPPV
Sbjct  46   FSET-ANVDLKLNLSPINDSASSSPTIASVAENKGKDTTTSATVSPPPRAKAQVVGWPPV  104

Query  828  RSYRRNILAANNHQKSGGEDGSDKA-------AVLVKVSMDGAPYLRKVDLSMYKSYQDL  670
            RS+R+NI+  N HQKS  E   DK+          VKVSMDGAPYLRKVDL +YKSYQ+L
Sbjct  105  RSFRKNIV--NVHQKSNSETEVDKSISGGGGNGAFVKVSMDGAPYLRKVDLKLYKSYQEL  162

Query  669  SDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEM  490
            SDALAKMF SFTI NC +Q  KDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPWEM
Sbjct  163  SDALAKMFSSFTIDNCGSQVTKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEM  222

Query  489  FVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            FV+SCKRLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  223  FVQSCKRLRIMKGSEAIGLAPRAVEKCKNRS  253



>ref|XP_010551700.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=234

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 155/199 (78%), Gaps = 12/199 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDS----QIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRR  814
            F ET   VDLKL L + +      ++A D         D  KPPAKAQVVGWPPVR+YR+
Sbjct  44   FSET---VDLKLNLQTNEEGRVVDLNAGDPKNFAGATKDKNKPPAKAQVVGWPPVRNYRK  100

Query  813  NILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFT  634
            N++A    QKS      +KA   VKVSMDGAPYLRKVDL +Y+ YQDLSDALAKMF SFT
Sbjct  101  NMMA---QQKSSSAVEEEKA--FVKVSMDGAPYLRKVDLKIYQCYQDLSDALAKMFSSFT  155

Query  633  IGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMK  454
            +GN  +QGM DFMNESKLM++LN+S+YVP+YEDKDGDWMLVGDVPW+MFVESCKRLRIMK
Sbjct  156  MGNYGSQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWQMFVESCKRLRIMK  215

Query  453  GTEAIGLAPRAMEKCKNRS  397
            G+EAIGLAPRAMEKCKNRS
Sbjct  216  GSEAIGLAPRAMEKCKNRS  234



>ref|XP_006406100.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
 dbj|BAJ33997.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47553.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
Length=239

 Score =   267 bits (682),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 163/207 (79%), Gaps = 17/207 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKL-SSKDSQIHASDHNKANNKDA---DVTKPPAKAQVVGWPPVRSYRR  814
            F ET   VDL L L S+K+  +  ++ + A  +     D +KPPAKAQVVGWPPVR+YR+
Sbjct  38   FSET---VDLMLNLQSNKEGTVDLNNVSAAPKEKTLLKDHSKPPAKAQVVGWPPVRNYRK  94

Query  813  NILAANNHQKSGGEDGSDK-------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALA  655
            NI+     + SG E+ S +       AA LVKVSMDGAPYLRKVDL MYKSYQDLSDALA
Sbjct  95   NIMT--QQKTSGVEEASSEKAGSGGGAAALVKVSMDGAPYLRKVDLKMYKSYQDLSDALA  152

Query  654  KMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESC  475
            KMF SFT+GN  AQGM DFMNESKLMN+LN+S+YVP+YEDKDGDWMLVGDVPWEMFVESC
Sbjct  153  KMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESC  212

Query  474  KRLRIMKGTEAIGLAPRAMEK-CKNRS  397
            KRLRIMKG+EAIGLAPRAMEK CKNRS
Sbjct  213  KRLRIMKGSEAIGLAPRAMEKYCKNRS  239



>gb|KHG01271.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=248

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 157/197 (80%), Gaps = 11/197 (6%)
 Frame = -1

Query  966  QHVDLKLKLSSKDS--QIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANN  793
            + VDLKL L SK+    ++ +  N +  K+    KPPAKAQV+GWPPVRSYR+NI+A   
Sbjct  54   ETVDLKLNLQSKEGCMDLNQNLENGSKEKNHHPAKPPAKAQVLGWPPVRSYRKNIMA---  110

Query  792  HQKSGGEDGSDKA------AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTI  631
            +QK+  ++ SD+A      A  VKV MDGAPYLRKVDL MY SYQ LSDALAKMF SFT+
Sbjct  111  NQKNNSDEISDRASSGSGGAAFVKVCMDGAPYLRKVDLKMYNSYQKLSDALAKMFSSFTM  170

Query  630  GNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG  451
            G+   +GM DFMNESKLM++LN+SDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG
Sbjct  171  GSYGCEGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG  230

Query  450  TEAIGLAPRAMEKCKNR  400
            +EAIGLAPRAMEKCK+R
Sbjct  231  SEAIGLAPRAMEKCKSR  247



>ref|XP_011027555.1| PREDICTED: auxin-responsive protein IAA14 isoform X2 [Populus 
euphratica]
 ref|XP_011029891.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   267 bits (682),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 160/206 (78%), Gaps = 14/206 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNK-ANNKDA---------DVTKPPAKAQVVGWPP  832
            F ET   VDLKL L +K+  +  +++ K   +KD          D  KPPAKAQVVGWPP
Sbjct  46   FAET---VDLKLNLQAKEGVMDLNENIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPP  102

Query  831  VRSYRRNILAANNHQKSGGEDGSD-KAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALA  655
            VRSYR+N++A  N  + G +  +   +A  VKV MDGAPYLRKVDL MY+SYQ+LSDALA
Sbjct  103  VRSYRKNVMAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQELSDALA  162

Query  654  KMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESC  475
            KMF SFT+GN  AQGM DFMNESKLM++LN+S+YVP+YEDKDGDWMLVGDVPWEMFV SC
Sbjct  163  KMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVNSC  222

Query  474  KRLRIMKGTEAIGLAPRAMEKCKNRS  397
            KRLR+MKG+EAIGLAPRAMEKCK+R+
Sbjct  223  KRLRLMKGSEAIGLAPRAMEKCKSRT  248



>ref|XP_004288427.1| PREDICTED: auxin-responsive protein IAA14-like [Fragaria vesca 
subsp. vesca]
Length=238

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 158/202 (78%), Gaps = 14/202 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKD-----ADVTKPPAKAQVVGWPPVRSYR  817
            F ET   VDLKL L + +  ++ S  N ++ +       D  KPPAKAQVVGWPPVRS+R
Sbjct  44   FSET---VDLKLNLHANEGLMNESVKNVSSREKNLPCIKDPAKPPAKAQVVGWPPVRSFR  100

Query  816  RNILAANNHQKSGGEDGSDKA--AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFG  643
            +N++A    QKS GE+ S     A  VKV MDGAPYLRKVDL MYKSY++LSDAL+KMF 
Sbjct  101  KNVMA----QKSTGEESSTTTEKAAFVKVCMDGAPYLRKVDLKMYKSYKELSDALSKMFS  156

Query  642  SFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLR  463
            SFT G   AQGM DFMNESKLM++LN+++YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLR
Sbjct  157  SFTTGYYGAQGMIDFMNESKLMDLLNSTEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  216

Query  462  IMKGTEAIGLAPRAMEKCKNRS  397
            IMKG+EAIGLAP+AMEKCKNRS
Sbjct  217  IMKGSEAIGLAPKAMEKCKNRS  238



>ref|XP_002517023.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
 gb|EEF45186.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
Length=181

 Score =   265 bits (676),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 139/161 (86%), Gaps = 3/161 (2%)
 Frame = -1

Query  879  DVTKPPAKAQVVGWPPVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVD  700
            D  KPPAKAQVVGWPPVRSYR+NI+A  N  + G +  S   A  VKV MDGAPYLRKVD
Sbjct  24   DPAKPPAKAQVVGWPPVRSYRKNIMAQKNTSEEGEKASS---AAFVKVCMDGAPYLRKVD  80

Query  699  LSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDW  520
            L MYKSYQ+LSDALAKMF SFT+GN   QGM DFMNESKLM++LN+S+YVPTYEDKDGDW
Sbjct  81   LKMYKSYQELSDALAKMFSSFTMGNYGTQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDW  140

Query  519  MLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            MLVGDVPWEMFV+SCKRLRIMKG+EAIGLAPRAMEKCK+R+
Sbjct  141  MLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRT  181



>ref|NP_001267662.1| auxin-induced protein AUX28-like [Cucumis sativus]
 dbj|BAA81687.1| unnamed protein product [Cucumis sativus]
 gb|KGN44763.1| hypothetical protein Csa_7G378520 [Cucumis sativus]
Length=230

 Score =   266 bits (680),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 152/203 (75%), Gaps = 27/203 (13%)
 Frame = -1

Query  975  ETHQHVDLKLKLSSKDSQIHASDHNKAN----NKD-----ADVTKPPAKAQVVGWPPVRS  823
            ET   VDLKL LSSK++     D   A+    NKD     AD  KPPAKAQVVGWPPVRS
Sbjct  45   ETISKVDLKLNLSSKETVGVGDDDLVADSNPSNKDKAVLTADPAKPPAKAQVVGWPPVRS  104

Query  822  YRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFG  643
            +R+N + A                  VKVSMDGAPYLRKVDL MYKSY+ LSDALA MFG
Sbjct  105  FRKNNMLA-----------------FVKVSMDGAPYLRKVDLKMYKSYKQLSDALAAMFG  147

Query  642  SFT-IGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
            SFT IGNC +Q MKDFMNESKLM++L+ SDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL
Sbjct  148  SFTTIGNCGSQEMKDFMNESKLMDLLSGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  207

Query  465  RIMKGTEAIGLAPRAMEKCKNRS  397
            RIMKG EAIGLAPRAMEKCKNRS
Sbjct  208  RIMKGKEAIGLAPRAMEKCKNRS  230



>ref|XP_006362195.1| PREDICTED: auxin-responsive protein IAA14-like [Solanum tuberosum]
Length=238

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 154/204 (75%), Gaps = 17/204 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIH-ASDHNKANNK---------DADVTKPPAKAQVVGWPP  832
            F ET   VDLKL     +  I  A ++NK  N          + D  KPPAKAQVVGWPP
Sbjct  41   FSET---VDLKLNFHQANDDISCAMENNKMKNSVTTTKEVVCNKDPIKPPAKAQVVGWPP  97

Query  831  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            VRS+R+N++A    QKS  E+        VKV MDGAPYLRKVDL MYKSYQ+LSDALAK
Sbjct  98   VRSFRKNVMA----QKSNTEESEKTTVAFVKVCMDGAPYLRKVDLKMYKSYQELSDALAK  153

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFT GN  +QGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV+SCK
Sbjct  154  MFSSFTNGNYGSQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCK  213

Query  471  RLRIMKGTEAIGLAPRAMEKCKNR  400
            RLRIMKG+EAIGLAPRAMEKCK+R
Sbjct  214  RLRIMKGSEAIGLAPRAMEKCKSR  237



>ref|NP_001288939.1| auxin-responsive protein IAA16 [Brassica rapa]
 gb|ABV89663.1| indoleacetic acid-induced protein 16 [Brassica rapa]
Length=231

 Score =   266 bits (680),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 155/205 (76%), Gaps = 15/205 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            F ET   VDLKL LSS  + + +       N    V KPPAKAQVVGWPPVRS+R+N+++
Sbjct  32   FSET---VDLKLNLSS--TALDSVSGVDLENMKEKVVKPPAKAQVVGWPPVRSFRKNVMS  86

Query  801  ANNHQKSGGEDGSDK----------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
                      +G++K          AA  VKVSMDGAPYLRK+DL +YK+YQDLSDAL+K
Sbjct  87   GQKPTAGDATEGTEKTSSSNGATSSAAAYVKVSMDGAPYLRKIDLKLYKTYQDLSDALSK  146

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFT+GN   QGMKDFMNES+L+++LN SDYVPTYEDKDGDWMLVGDVPW MFV+SCK
Sbjct  147  MFSSFTLGNYGPQGMKDFMNESRLIDLLNGSDYVPTYEDKDGDWMLVGDVPWGMFVDSCK  206

Query  471  RLRIMKGTEAIGLAPRAMEKCKNRS  397
            R+RIMKG+EAIGLAPRA+EKCKNRS
Sbjct  207  RIRIMKGSEAIGLAPRALEKCKNRS  231



>ref|XP_002281771.1| PREDICTED: auxin-responsive protein IAA16-like [Vitis vinifera]
Length=244

 Score =   266 bits (681),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 156/208 (75%), Gaps = 22/208 (11%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA-----------DVTKPPAKAQVVGWP  835
            F ET   VDLKL LS K++ +   D NK  +              D  +PPAKAQVVGWP
Sbjct  46   FSET---VDLKLNLSGKEAGV---DDNKVKSLQKEKSKSLLPCGNDPARPPAKAQVVGWP  99

Query  834  PVRSYRRNILAANNHQKSGGEDGSDKA--AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  661
            PVRS+R+N+LA    QK G E+G   +  A  VKVSMDGAPYLRKVDL MY SYQ+LS+A
Sbjct  100  PVRSFRKNMLAG---QKGGSEEGEKVSCNAAFVKVSMDGAPYLRKVDLKMYTSYQELSNA  156

Query  660  LAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVE  481
            L  MF SFTIGN  +QGMKDFMNESKLM++LN  D+VPTYEDKDGDWMLVGDVPWEMFV+
Sbjct  157  LGNMFSSFTIGNYGSQGMKDFMNESKLMDLLNGFDHVPTYEDKDGDWMLVGDVPWEMFVD  216

Query  480  SCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            SCKRLRIMKG EAIGLAPRAMEKCKNRS
Sbjct  217  SCKRLRIMKGKEAIGLAPRAMEKCKNRS  244



>emb|CBI35213.3| unnamed protein product [Vitis vinifera]
Length=170

 Score =   264 bits (674),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 140/161 (87%), Gaps = 2/161 (1%)
 Frame = -1

Query  879  DVTKPPAKAQVVGWPPVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVD  700
            D  KPPAKAQVVGWPPVRS+R+NIL    +     E+ +  +A  VKVSMDGAPYLRKVD
Sbjct  12   DPAKPPAKAQVVGWPPVRSFRKNILTVQKNSSE--EEKASSSAAFVKVSMDGAPYLRKVD  69

Query  699  LSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDW  520
            L MYKSYQ+LSDAL KMF SFTIGNC +QGMKDFMNESKL+++LN SDYVPTYEDKDGDW
Sbjct  70   LKMYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDW  129

Query  519  MLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            MLVGDVPWEMFVESCKRLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  130  MLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS  170



>emb|CAN63268.1| hypothetical protein VITISV_013635 [Vitis vinifera]
 emb|CBI17932.3| unnamed protein product [Vitis vinifera]
Length=235

 Score =   266 bits (680),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 156/208 (75%), Gaps = 22/208 (11%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA-----------DVTKPPAKAQVVGWP  835
            F ET   VDLKL LS K++ +   D NK  +              D  +PPAKAQVVGWP
Sbjct  37   FSET---VDLKLNLSGKEAGV---DDNKVKSLQKEKSKSLLPCGNDPARPPAKAQVVGWP  90

Query  834  PVRSYRRNILAANNHQKSGGEDGSDKA--AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  661
            PVRS+R+N+LA    QK G E+G   +  A  VKVSMDGAPYLRKVDL MY SYQ+LS+A
Sbjct  91   PVRSFRKNMLAG---QKGGSEEGEKVSCNAAFVKVSMDGAPYLRKVDLKMYTSYQELSNA  147

Query  660  LAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVE  481
            L  MF SFTIGN  +QGMKDFMNESKLM++LN  D+VPTYEDKDGDWMLVGDVPWEMFV+
Sbjct  148  LGNMFSSFTIGNYGSQGMKDFMNESKLMDLLNGFDHVPTYEDKDGDWMLVGDVPWEMFVD  207

Query  480  SCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            SCKRLRIMKG EAIGLAPRAMEKCKNRS
Sbjct  208  SCKRLRIMKGKEAIGLAPRAMEKCKNRS  235



>emb|CDY50750.1| BnaAnng10570D [Brassica napus]
Length=291

 Score =   268 bits (685),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 157/205 (77%), Gaps = 15/205 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL-  805
            F ET   VDLKL LSS  + + +       N    V KPPAKAQVVGWPPVRS+R+N++ 
Sbjct  92   FSET---VDLKLNLSS--TALDSVSGVDLENMKEKVVKPPAKAQVVGWPPVRSFRKNVMS  146

Query  804  --------AANNHQKSGGEDG-SDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
                    AA   +K+   +G +  AA  VKVSMDGAPYLRK+DL +YK+YQDLSDAL+K
Sbjct  147  GQKPTAGDAAEGTEKTSSSNGATSSAAAYVKVSMDGAPYLRKIDLKLYKTYQDLSDALSK  206

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFTIGN   QGMKDFMNES+L+++LN SDYVPTYEDKDGDWMLVGDVPW MFV+SCK
Sbjct  207  MFSSFTIGNYGPQGMKDFMNESRLIDLLNGSDYVPTYEDKDGDWMLVGDVPWGMFVDSCK  266

Query  471  RLRIMKGTEAIGLAPRAMEKCKNRS  397
            R+RIMKG+EAIGLAPRA+EKCKNRS
Sbjct  267  RIRIMKGSEAIGLAPRALEKCKNRS  291



>ref|XP_009777122.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=223

 Score =   265 bits (678),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 154/203 (76%), Gaps = 16/203 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNK---------ANNKDADVTKPPAKAQVVGWPPV  829
            F ET   VDLKL   + DS        K         A+NKD+   KPPAKAQVVGWPPV
Sbjct  27   FSET---VDLKLNFQTNDSSSAMDLKEKIKTPTTKEIASNKDS--VKPPAKAQVVGWPPV  81

Query  828  RSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKM  649
            RS+R+N++A  N+ ++  E  +  AA  VKV MDGAPYLRKVDL MYKSYQ LSDALAKM
Sbjct  82   RSFRKNVMAQKNNTEA--EKSNATAAAFVKVCMDGAPYLRKVDLKMYKSYQQLSDALAKM  139

Query  648  FGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR  469
            F SFT+GN   QGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPW MFV+SCKR
Sbjct  140  FSSFTMGNYGPQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWVMFVDSCKR  199

Query  468  LRIMKGTEAIGLAPRAMEKCKNR  400
            LRIMKG+EAIGLAPRAMEKCK R
Sbjct  200  LRIMKGSEAIGLAPRAMEKCKRR  222



>ref|XP_004172452.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis sativus]
 gb|KGN61643.1| hypothetical protein Csa_2G200420 [Cucumis sativus]
Length=256

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 161/217 (74%), Gaps = 28/217 (13%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQ----------IHASDHNKANNKDA-------DVTKPPAKA  853
            F ET   VDLKL L SKD            ++ +  N + N D        D  KPPAKA
Sbjct  46   FSET---VDLKLNLQSKDGGGGVGVGVGVDLNENIKNVSTNVDGEKSLCSKDPAKPPAKA  102

Query  852  QVVGWPPVRSYRRNILAANNHQKSGGEDGSDK-----AAVLVKVSMDGAPYLRKVDLSMY  688
            QVVGWPPVRSYR+N++A  N   SGGE G++K     +A  VKV MDGAPYLRKVDL MY
Sbjct  103  QVVGWPPVRSYRKNVMAQKNT--SGGE-GTEKGNGGSSAAFVKVCMDGAPYLRKVDLKMY  159

Query  687  KSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVG  508
            +SYQ+LSDALAKMF SFT+G    QGM DFMNE KLM++LN+S++VPTYEDKDGDWMLVG
Sbjct  160  QSYQELSDALAKMFSSFTMGEYGTQGMIDFMNERKLMDLLNSSEFVPTYEDKDGDWMLVG  219

Query  507  DVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            DVPWEMFV+SCKRLRIMKG+EAIGLAPRAMEKCK+RS
Sbjct  220  DVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  256



>ref|NP_001266070.1| IAA14 [Solanum lycopersicum]
 gb|AEX00357.1| IAA14 [Solanum lycopersicum]
Length=236

 Score =   266 bits (679),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 154/204 (75%), Gaps = 17/204 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIH-ASDHNKANNK---------DADVTKPPAKAQVVGWPP  832
            F ET   VDLKL        I  A ++NK  +          + D  KPPAKAQVVGWPP
Sbjct  39   FSET---VDLKLNFHQASDDISCAMENNKMKSSVTTTKEVVCNKDPIKPPAKAQVVGWPP  95

Query  831  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            VRS+R+N++A    QKS  E+     A  VKV MDGAPYLRKVDL MYKSYQ+LSDALAK
Sbjct  96   VRSFRKNVMA----QKSNTEESEKTTAAFVKVCMDGAPYLRKVDLKMYKSYQELSDALAK  151

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFT GN  +QGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV+SCK
Sbjct  152  MFSSFTNGNYGSQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCK  211

Query  471  RLRIMKGTEAIGLAPRAMEKCKNR  400
            RLRIMKG+EAIGLAPRAMEKCK+R
Sbjct  212  RLRIMKGSEAIGLAPRAMEKCKSR  235



>gb|AAM65301.1| indoleacetic acid (IAA)-inducible gene (IAA7) [Arabidopsis thaliana]
Length=238

 Score =   266 bits (679),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 157/209 (75%), Gaps = 17/209 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKL-SSKDSQI---HASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRR  814
            F ET   VDL L L S+K+  +   + S   K      D +KPPAKAQVVGWPPVR+YR+
Sbjct  33   FSET---VDLMLNLQSNKEGSVDLKNVSAVPKEKTTLKDPSKPPAKAQVVGWPPVRNYRK  89

Query  813  NILAANNHQKSGGEDGSDKAAV---------LVKVSMDGAPYLRKVDLSMYKSYQDLSDA  661
            N++          E  S+KA           LVKVSMDGAPYLRKVDL MYKSYQDLSDA
Sbjct  90   NMMTQQKTSSGAEEASSEKAGNFGGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDLSDA  149

Query  660  LAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVE  481
            LAKMF SFT+GN  AQGM DFMNESKLMN+LN+S+YVP+YEDKDGDWMLVGDVPWEMFVE
Sbjct  150  LAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVE  209

Query  480  SCKRLRIMKGTEAIGLAPRAMEK-CKNRS  397
            SCKRLRIMKG+EAIGLAPRAMEK CKNRS
Sbjct  210  SCKRLRIMKGSEAIGLAPRAMEKYCKNRS  238



>ref|XP_008465181.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=256

 Score =   266 bits (681),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 158/216 (73%), Gaps = 26/216 (12%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQ----------IHASDHNKANNKDA-------DVTKPPAKA  853
            F ET   VDLKL L SKD            ++ +  N + N D        D  KPPAKA
Sbjct  46   FSET---VDLKLNLQSKDGGGGGGVGVGVDLNENVKNVSTNVDGEKSLCSKDPAKPPAKA  102

Query  852  QVVGWPPVRSYRRNILAANNHQKSGGEDG----SDKAAVLVKVSMDGAPYLRKVDLSMYK  685
            QVVGWPPVRSYR+N++A  N   SGGE      S  +A  VKV MDGAPYLRKVDL MY+
Sbjct  103  QVVGWPPVRSYRKNVMAQKNT--SGGEGAEKGSSGSSAAFVKVCMDGAPYLRKVDLKMYQ  160

Query  684  SYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGD  505
            SYQ+LSDALAKMF SFT+G    QGM DFMNE KLM++LN+S++VPTYEDKDGDWMLVGD
Sbjct  161  SYQELSDALAKMFSSFTMGEYGTQGMIDFMNERKLMDLLNSSEFVPTYEDKDGDWMLVGD  220

Query  504  VPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            VPWEMFV+SCKRLRIMKG+EAIGLAPRAMEKCK+RS
Sbjct  221  VPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  256



>ref|XP_008362015.1| PREDICTED: auxin-responsive protein IAA14-like [Malus domestica]
Length=244

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 153/205 (75%), Gaps = 13/205 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKD------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  820
            F ET   VDLKLKL SKD        I + + N   +   D  KPPAKAQVVGWPPVRSY
Sbjct  43   FSET---VDLKLKLQSKDDLNDNVKNIASREKNDLLSCTKDPAKPPAKAQVVGWPPVRSY  99

Query  819  RRNILAANNHQKSGGE----DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            R+NI+A  N  +   E     G   +A  VKV MDGAPYLRKVDL MYKSYQ+LS+ALAK
Sbjct  100  RKNIMAQKNTSEENTEKATVGGGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNALAK  159

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFT G   AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPW MFV+SCK
Sbjct  160  MFSSFTTGYYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWGMFVDSCK  219

Query  471  RLRIMKGTEAIGLAPRAMEKCKNRS  397
            RLRIMKG+EAIGLAP+A EKCK RS
Sbjct  220  RLRIMKGSEAIGLAPKAXEKCKGRS  244



>ref|NP_188945.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 sp|Q38825.1|IAA7_ARATH RecName: Full=Auxin-responsive protein IAA7; AltName: Full=Auxin 
resistant 2; AltName: Full=Indoleacetic acid-induced protein 
7 [Arabidopsis thaliana]
 gb|AAG48759.1|AF332395_1 indoleacetic acid-inducible protein IAA7 [Arabidopsis thaliana]
 gb|AAC49048.1| IAA7 [Arabidopsis thaliana]
 dbj|BAB02096.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAK96842.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAL66876.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AEE76710.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
Length=243

 Score =   266 bits (679),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 157/209 (75%), Gaps = 17/209 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKL-SSKDSQI---HASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRR  814
            F ET   VDL L L S+K+  +   + S   K      D +KPPAKAQVVGWPPVR+YR+
Sbjct  38   FSET---VDLMLNLQSNKEGSVDLKNVSAVPKEKTTLKDPSKPPAKAQVVGWPPVRNYRK  94

Query  813  NILAANNHQKSGGEDGSDKAAV---------LVKVSMDGAPYLRKVDLSMYKSYQDLSDA  661
            N++          E  S+KA           LVKVSMDGAPYLRKVDL MYKSYQDLSDA
Sbjct  95   NMMTQQKTSSGAEEASSEKAGNFGGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDLSDA  154

Query  660  LAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVE  481
            LAKMF SFT+GN  AQGM DFMNESKLMN+LN+S+YVP+YEDKDGDWMLVGDVPWEMFVE
Sbjct  155  LAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVE  214

Query  480  SCKRLRIMKGTEAIGLAPRAMEK-CKNRS  397
            SCKRLRIMKG+EA+GLAPRAMEK CKNRS
Sbjct  215  SCKRLRIMKGSEAVGLAPRAMEKYCKNRS  243



>ref|XP_010038039.1| PREDICTED: auxin-induced protein AUX28-like [Eucalyptus grandis]
 gb|KCW49838.1| hypothetical protein EUGRSUZ_K03313 [Eucalyptus grandis]
Length=280

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 141/160 (88%), Gaps = 4/160 (3%)
 Frame = -1

Query  873  TKPPAKAQVVGWPPVRSYRRNILAANNHQKSGGED-GSDKAAVLVKVSMDGAPYLRKVDL  697
             KPPAKAQVVGWPPVRS+R+N++AA   QKS  ED  S  AA  VKVSMDGAPYLRKVDL
Sbjct  124  VKPPAKAQVVGWPPVRSFRKNMVAA---QKSSTEDMSSGGAASFVKVSMDGAPYLRKVDL  180

Query  696  SMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWM  517
             MYKSYQ+LS+AL KM  SFTIG CE+QG+KDFM+ESKL ++LN SDYVPTYEDKDGDWM
Sbjct  181  KMYKSYQELSEALCKMLSSFTIGRCESQGVKDFMSESKLRDLLNGSDYVPTYEDKDGDWM  240

Query  516  LVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            LVGDVPWEMFVESCKRLRIMKGTEA+GLAPRAMEKCK+RS
Sbjct  241  LVGDVPWEMFVESCKRLRIMKGTEAVGLAPRAMEKCKSRS  280



>emb|CDY41894.1| BnaC05g47100D [Brassica napus]
Length=231

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 155/205 (76%), Gaps = 15/205 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            F ET   VDLKL LSS  + + +       N    V KPPAKAQVVGWPPVRS+R+N+++
Sbjct  32   FSET---VDLKLNLSS--TAMDSVSGVDLENMKEKVVKPPAKAQVVGWPPVRSFRKNVMS  86

Query  801  ANNHQKSGGEDGSDKAAV----------LVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
                      +G++K +            VKVS+DGAPYLRK+DL +YK+YQDLSDAL+K
Sbjct  87   GQKPTAGDAAEGTEKTSSSNAATSSAAAYVKVSLDGAPYLRKIDLKLYKTYQDLSDALSK  146

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFTIGNC  QGMKDFMNES+L+++LN SDYVPTYEDKDGDWMLVGDVPW MFV+SCK
Sbjct  147  MFSSFTIGNCGPQGMKDFMNESRLIDLLNGSDYVPTYEDKDGDWMLVGDVPWGMFVDSCK  206

Query  471  RLRIMKGTEAIGLAPRAMEKCKNRS  397
            R+RIMKG+EAIGLAPRA+EKCKNRS
Sbjct  207  RIRIMKGSEAIGLAPRALEKCKNRS  231



>ref|NP_001280973.1| auxin-responsive protein IAA16 [Malus domestica]
 gb|ABI36494.1| AUX/IAA16 B [Malus domestica]
Length=251

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 153/205 (75%), Gaps = 13/205 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADV---------TKP-PAKAQVVGWPP  832
            F ET   VDLKL +SS+D      D      K+ DV         TKP  AKAQVVGWPP
Sbjct  50   FAET---VDLKLNISSEDQSAGDEDQVVDMKKEKDVAPVPRSNDPTKPHAAKAQVVGWPP  106

Query  831  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            VRS+R NILA        GE  +  +A  VKVSMDGAPYLRKVDL +YKSYQ+LS AL K
Sbjct  107  VRSFRXNILAVQKDVSDEGEKTNSXSAAFVKVSMDGAPYLRKVDLKLYKSYQELSTALGK  166

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFTIG+  +QGMKDFMNESKL+++LN S+YVPTYEDKDGDWMLVGDVPWEMFV SCK
Sbjct  167  MFSSFTIGSYGSQGMKDFMNESKLIDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVNSCK  226

Query  471  RLRIMKGTEAIGLAPRAMEKCKNRS  397
            RLRIM+G+EAIGLAPRA+EKCKNRS
Sbjct  227  RLRIMRGSEAIGLAPRAVEKCKNRS  251



>ref|XP_011030585.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 160/210 (76%), Gaps = 20/210 (10%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDS---------QIHASDHNK---ANNKDADVTKPPAKAQVVGW  838
            F ET   VDLKL L +K+           I + D N+   A  KD    KPPAKAQVVGW
Sbjct  46   FAET---VDLKLNLQAKEGVMDLNENIKNIASKDKNQLPAATIKDP--AKPPAKAQVVGW  100

Query  837  PPVRSYRRNILAANNHQKSGGEDGSD-KAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  661
            PPVRSYR+N+LA  N  + G +  +   +A  VKV MDGAPYLRKVDL MY+SYQ+LSDA
Sbjct  101  PPVRSYRKNVLAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQELSDA  160

Query  660  LAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVE  481
            LAKMF SFT+GN  AQGM DFMNESKLM++LN+S+YVP+YEDKDGDWMLVGDVPWEMFV+
Sbjct  161  LAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVD  220

Query  480  SCKRLRIMKGTEAIGL--APRAMEKCKNRS  397
            SCKRLRIMKG+EAIGL  APRAMEKCK+R+
Sbjct  221  SCKRLRIMKGSEAIGLVSAPRAMEKCKSRT  250



>ref|NP_187124.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
 sp|O24407.1|IAA16_ARATH RecName: Full=Auxin-responsive protein IAA16; AltName: Full=Indoleacetic 
acid-induced protein 16 [Arabidopsis thaliana]
 gb|AAF04899.1|AC011437_14 auxin-induced protein [Arabidopsis thaliana]
 gb|AAG48764.1|AF332400_1 auxin-induced protein IAA16 [Arabidopsis thaliana]
 gb|AAK53004.1|AF375420_1 AT3g04730/F7O18_22 [Arabidopsis thaliana]
 gb|AAB84353.1| IAA16 [Arabidopsis thaliana]
 gb|AAM64751.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AAN38694.1| At3g04730/F7O18_22 [Arabidopsis thaliana]
 dbj|BAF01307.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AEE74127.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
Length=236

 Score =   264 bits (674),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 154/210 (73%), Gaps = 20/210 (10%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            F ET   VDLKL LSS  + + +       N    V KPPAKAQVVGWPPVRS+R+N+++
Sbjct  32   FSET---VDLKLNLSS--TAMDSVSKVDLENMKEKVVKPPAKAQVVGWPPVRSFRKNVMS  86

Query  801  ANNHQKSGGEDGSDK---------------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLS  667
                      +G+DK                   VKVSMDGAPYLRK+DL +YK+YQDLS
Sbjct  87   GQKPTTGDATEGNDKTSGSSGATSSASACATVAYVKVSMDGAPYLRKIDLKLYKTYQDLS  146

Query  666  DALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMF  487
            +AL+KMF SFTIGN   QGMKDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPWEMF
Sbjct  147  NALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMF  206

Query  486  VESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            V+SCKR+RIMKG+EAIGLAPRA+EKCKNRS
Sbjct  207  VDSCKRIRIMKGSEAIGLAPRALEKCKNRS  236



>gb|KFK24541.1| hypothetical protein AALP_AAs58011U000100 [Arabis alpina]
Length=230

 Score =   263 bits (673),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 155/206 (75%), Gaps = 19/206 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSK-----DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYR  817
            F ET   VDLKL L S      D  +  +   K   KD   +KPPAKAQVVGWPPVR+YR
Sbjct  33   FSET---VDLKLNLQSNKQAPIDLNVAGTSREKTLLKDP--SKPPAKAQVVGWPPVRNYR  87

Query  816  RNILAANNHQKSGGE------DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALA  655
            +NI+A   +QKS  E       G       VKVSMDGAPYLRKVDL MY SY+DLSDALA
Sbjct  88   KNIMA---NQKSSEEAEEAMSGGGGGTVAFVKVSMDGAPYLRKVDLKMYNSYKDLSDALA  144

Query  654  KMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESC  475
            KMF SFT+G+  AQGM DFMNE+K+M++LN+S+YVP+YEDKDGDWMLVGDVPW MFVESC
Sbjct  145  KMFSSFTMGSYGAQGMIDFMNETKVMDLLNSSEYVPSYEDKDGDWMLVGDVPWPMFVESC  204

Query  474  KRLRIMKGTEAIGLAPRAMEKCKNRS  397
            KRLRIMKG+EAIGLAPRAMEKCKNRS
Sbjct  205  KRLRIMKGSEAIGLAPRAMEKCKNRS  230



>ref|XP_009337294.1| PREDICTED: auxin-responsive protein IAA14-like [Pyrus x bretschneideri]
Length=244

 Score =   264 bits (674),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 153/204 (75%), Gaps = 12/204 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKD------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  820
            F ET   VDLKL L SK+        I + D N   +   D +KPPAKAQVVGWPPVRSY
Sbjct  44   FSET---VDLKLNLQSKEDLNDNVKNIASKDKNNLLSCTKDPSKPPAKAQVVGWPPVRSY  100

Query  819  RRNILAANNHQKSGGE---DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKM  649
            R+NI++  N  +   E    G   +A  VKV MDGAPYLRKVDL MYKSYQ+LS+AL+KM
Sbjct  101  RKNIMSQKNTSEEKTEKASGGGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNALSKM  160

Query  648  FGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR  469
            F SFT G    QGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPW MFV+SCKR
Sbjct  161  FSSFTTGYYGTQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWGMFVDSCKR  220

Query  468  LRIMKGTEAIGLAPRAMEKCKNRS  397
            LRIMKG+EAIGLAP+AMEKCK RS
Sbjct  221  LRIMKGSEAIGLAPKAMEKCKGRS  244



>ref|XP_008218270.1| PREDICTED: auxin-responsive protein IAA16 [Prunus mume]
Length=256

 Score =   264 bits (675),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 157/211 (74%), Gaps = 19/211 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKD-SQIHASDHNK-------------ANNKDADVTKPPA-KAQV  847
            F ET   VDLKL +SS+D S   ++D ++                   D +KPPA KAQV
Sbjct  49   FSET---VDLKLNISSQDQSADRSADQDQQLMELKREKNAAAPAPSANDPSKPPASKAQV  105

Query  846  VGWPPVRSYRRNILAANNHQKSGGEDG-SDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDL  670
            VGWPPVRS+R+NI+          E G S+ +A  VKVSMDGAPYLRKVDL +YKSYQ+L
Sbjct  106  VGWPPVRSFRKNIVTVQKKSSEEAEKGNSNISAAFVKVSMDGAPYLRKVDLKLYKSYQEL  165

Query  669  SDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEM  490
            S AL KMF SFTIGNC + GMKDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPW M
Sbjct  166  STALGKMFSSFTIGNCGSDGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWGM  225

Query  489  FVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            FV+SCKRLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  226  FVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  256



>ref|XP_006414696.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
 gb|ESQ56149.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
Length=257

 Score =   264 bits (675),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 156/206 (76%), Gaps = 20/206 (10%)
 Frame = -1

Query  981  FEETHQHVDLKLKL-SSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL  805
            F ET   VD KL L S+K   +  +       K  D  KPPAKAQVVGWPPVR+YR++++
Sbjct  61   FSET---VDFKLNLQSNKQGHVDLNVTVAHKEKTKDPAKPPAKAQVVGWPPVRNYRKSVM  117

Query  804  AANNHQKS----------GGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALA  655
            A   HQKS          GG  G+      VKVSMDGAPYLRKVDL MYKSY+DLSDALA
Sbjct  118  A---HQKSSEVEEASSCGGGRGGT---VAFVKVSMDGAPYLRKVDLKMYKSYKDLSDALA  171

Query  654  KMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESC  475
            KMF SFT+G+  AQGM DFMNESK+M++LN+S+YVP+YEDKDGDWMLVGDVPW MFVESC
Sbjct  172  KMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKDGDWMLVGDVPWPMFVESC  231

Query  474  KRLRIMKGTEAIGLAPRAMEKCKNRS  397
            KRLRIMKG+EAIGLAPRAMEKCKNRS
Sbjct  232  KRLRIMKGSEAIGLAPRAMEKCKNRS  257



>ref|XP_008235328.1| PREDICTED: auxin-induced protein AUX28-like [Prunus mume]
Length=253

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 153/203 (75%), Gaps = 15/203 (7%)
 Frame = -1

Query  960  VDLKLKLSSKDSQ--------IHASDHNKANNKD---ADVTKPPAKAQVVGWPPVRSYRR  814
            VDLKL LS+   Q           S  NK NN D   AD  KPPAKAQVVGWPPVRS+R+
Sbjct  51   VDLKLNLSNSKEQAIITGKDVTEKSKTNKDNNLDLPAADPAKPPAKAQVVGWPPVRSFRK  110

Query  813  NILAANNHQKSGGED----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            N+  A     S  E     G   A  LVKVSMDGAPYLRKVDL MYKSY +LSDALAKMF
Sbjct  111  NMFTALQKSPSDKESEHSKGGSNAVTLVKVSMDGAPYLRKVDLKMYKSYPELSDALAKMF  170

Query  645  GSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
             SFTIGNC +QGMKDFMNESKLM+VL  SDY+PTYEDKDGDWMLVGDVPWEMFVESCKRL
Sbjct  171  SSFTIGNCGSQGMKDFMNESKLMDVLKGSDYIPTYEDKDGDWMLVGDVPWEMFVESCKRL  230

Query  465  RIMKGTEAIGLAPRAMEKCKNRS  397
            RIMKG EA+GLAPRAMEKCKNRS
Sbjct  231  RIMKGKEAVGLAPRAMEKCKNRS  253



>gb|KEH43017.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=253

 Score =   264 bits (674),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 157/211 (74%), Gaps = 19/211 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLS--------SKDSQIHASDHNKANNKDADVTKPP-AKAQVVGWPPV  829
            F ET  +VDLKL LS        S      A +  K     A V+ PP AKAQVVGWPPV
Sbjct  46   FSET-ANVDLKLNLSPINDSASSSSTIASVAENKGKDTTTSATVSPPPRAKAQVVGWPPV  104

Query  828  RSYRRNILAANNHQKSGGEDGSDKA-------AVLVKVSMDGAPYLRKVDLSMYKSYQDL  670
            RS+R+NI+  N HQKS  E   DK+          VKVSMDGAPYLRKVDL +YKSYQ+L
Sbjct  105  RSFRKNIV--NVHQKSNSETEVDKSISGGGGNGAFVKVSMDGAPYLRKVDLKLYKSYQEL  162

Query  669  SDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEM  490
            SDALAKMF SFTI NC +Q  KDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPWEM
Sbjct  163  SDALAKMFSSFTIDNCGSQVTKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEM  222

Query  489  FVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            FV+SCKRLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  223  FVQSCKRLRIMKGSEAIGLAPRAVEKCKNRS  253



>gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [Nicotiana tabacum]
Length=220

 Score =   262 bits (670),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 140/177 (79%), Gaps = 4/177 (2%)
 Frame = -1

Query  927  SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQKSGGEDGSDKAAV  748
            S++  S   K N +D   + P  KAQVVGWPPVRS+R+N+L         GE  S  AA 
Sbjct  48   SEMDNSSSGKENEQD---SAPAPKAQVVGWPPVRSFRKNVLTVQKKSTGNGESSSGGAA-  103

Query  747  LVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVL  568
             VKVS+DGAPYLRKVDL MYKSYQ LSDAL KMF SFTIGNC   G KDFMNESKL+++L
Sbjct  104  FVKVSVDGAPYLRKVDLKMYKSYQQLSDALGKMFSSFTIGNCGNHGFKDFMNESKLIDLL  163

Query  567  NTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            N SDYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  164  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  220



>gb|ADL36587.1| ARF domain class transcription factor [Malus domestica]
Length=175

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = -1

Query  879  DVTKPPA-KAQVVGWPPVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKV  703
            D TKPPA KAQVVGWPPVRS+R+NIL    +    GE+ +  +A  VKVSMDGAPYLRKV
Sbjct  14   DPTKPPAAKAQVVGWPPVRSFRKNILTVQKNSSEEGENTNSISAAFVKVSMDGAPYLRKV  73

Query  702  DLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGD  523
            DL +YKSYQ+LS AL+KMF SFTIGNC +QGMKDFMNESKL+++L+ S+YVP+YEDKDGD
Sbjct  74   DLKLYKSYQELSTALSKMFSSFTIGNCGSQGMKDFMNESKLIDLLSGSEYVPSYEDKDGD  133

Query  522  WMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            WMLVGDVPWEMFV SCKRLRIMKG+EAIGLAPRA+EK KNRS
Sbjct  134  WMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAVEKYKNRS  175



>ref|XP_010917602.1| PREDICTED: auxin-responsive protein IAA30 isoform X2 [Elaeis 
guineensis]
Length=238

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 164/207 (79%), Gaps = 17/207 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNK----ANNKDA-----DVTKPPA-KAQVVGWPP  832
            F ET   +DLKLKL + DS+   ++  K    A+ K+      D  KPPA KAQVVGWPP
Sbjct  37   FSET---IDLKLKLQTVDSKDIEAEAEKMKRSASQKNLLACSNDPEKPPAPKAQVVGWPP  93

Query  831  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            VRS+R+NI++  + +  G ++  +K+A  VKVSMDGAPYLRK+DL MY+SYQ+LS AL K
Sbjct  94   VRSFRKNIMSVQSDK--GNKEEGEKSATFVKVSMDGAPYLRKIDLKMYRSYQELSVALEK  151

Query  651  MFGSFTIGNCEAQGMK--DFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVES  478
            MF SFTIGNC +QG+K  DFMNESKLM+++N S+YVPTYEDKDGDWMLVGDVPWEMF++S
Sbjct  152  MFSSFTIGNCSSQGIKGRDFMNESKLMDLINGSEYVPTYEDKDGDWMLVGDVPWEMFIDS  211

Query  477  CKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            CKRLRIMKG+EAIGLAP+AMEKCKN+S
Sbjct  212  CKRLRIMKGSEAIGLAPKAMEKCKNKS  238



>gb|ADJ68049.1| auxin responsive protein [Catharanthus roseus]
Length=242

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 158/206 (77%), Gaps = 17/206 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDS-------QIHASDHNKANNKDADVTKPPAKAQVVGWPPVRS  823
            F ET   VDLKL L S D        ++      + N+KD    KPPAKAQVVGWPPVR+
Sbjct  41   FSET---VDLKLNLQSNDQSSVDLNEKVKNPPSKETNSKDP--VKPPAKAQVVGWPPVRA  95

Query  822  YRRNILAA-NNHQKSGGEDGSDKA---AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALA  655
            +R+NI+A  NN +   GE GS  +      VKVSMDGAPYLRKVDL +YKSYQ+L+DALA
Sbjct  96   FRKNIMAQKNNTEVEAGEKGSSSSSSSVAFVKVSMDGAPYLRKVDLKIYKSYQELADALA  155

Query  654  KMFGSFTIGNC-EAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVES  478
            KMF SFT+GN    QGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV+S
Sbjct  156  KMFSSFTMGNYGTQQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDS  215

Query  477  CKRLRIMKGTEAIGLAPRAMEKCKNR  400
            CKRLRIMKG+EAIGLAPRAMEKCK+R
Sbjct  216  CKRLRIMKGSEAIGLAPRAMEKCKSR  241



>ref|XP_010024036.1| PREDICTED: auxin-responsive protein IAA14-like [Eucalyptus grandis]
 gb|KCW60450.1| hypothetical protein EUGRSUZ_H03170 [Eucalyptus grandis]
Length=243

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 153/205 (75%), Gaps = 12/205 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKD--SQIHASDHNKANNKD--------ADVTKPPAKAQVVGWPP  832
            F ET   VDLKL L +KD  S +   +  K+N K          D  KPPAKAQVVGWPP
Sbjct  41   FSETE--VDLKLNLQAKDASSVVDLKEAMKSNEKTLLAGASPAKDPAKPPAKAQVVGWPP  98

Query  831  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            VRSYR+N++ A        E     AA  VKVSMDGAPYLRKVDL  Y SY+ LSDAL K
Sbjct  99   VRSYRKNMMVAQKSTDPEEEKEKAAAAAFVKVSMDGAPYLRKVDLKNYSSYKQLSDALGK  158

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFT+G+  AQGM DFMNESKLM++LN+SDYVPTYEDKDGDWMLVGDVPWEMFV+SCK
Sbjct  159  MFSSFTMGSYGAQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVDSCK  218

Query  471  RLRIMKGTEAIGLAPRAMEKCKNRS  397
            RLRIMKG+EAIGLAPRAMEKCK+RS
Sbjct  219  RLRIMKGSEAIGLAPRAMEKCKSRS  243



>ref|XP_002883395.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59654.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
Length=242

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 157/211 (74%), Gaps = 24/211 (11%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKD------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  820
            F ET   VDL L L S        + + A+   K   KD   +KPP KAQVVGWPPVR+Y
Sbjct  38   FSET---VDLMLNLQSNKEGSVDLNNVAAAPKEKTTLKDP--SKPPTKAQVVGWPPVRNY  92

Query  819  RRNILAANNHQKSGGEDGSDK----------AAVLVKVSMDGAPYLRKVDLSMYKSYQDL  670
            R+N++     + SG E+ S +           A LVKVSMDGAPYLRKVDL MYKSYQDL
Sbjct  93   RKNMM--TQQKTSGVEEASSEKAGSGGGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDL  150

Query  669  SDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEM  490
            SDALAKMF SFT+GN  AQGM DFMNESKLMN+LN+S+YVP+YEDKDGDWMLVGDVPWEM
Sbjct  151  SDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEM  210

Query  489  FVESCKRLRIMKGTEAIGLAPRAMEK-CKNR  400
            FVESCKRLRIMKG+EAIGLAPRAMEK CKNR
Sbjct  211  FVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  241



>ref|NP_001280875.1| auxin-responsive protein IAA14-like [Malus domestica]
 gb|ADL36585.1| ARF domain class transcription factor [Malus domestica]
Length=244

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 153/206 (74%), Gaps = 16/206 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKD------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  820
            F ET   +DLKL L SK+        I + D N   +   D +KPPAKAQVVGWPPVRSY
Sbjct  44   FSET---IDLKLNLQSKEDLNDNVKNIASKDKNNFLSCTKDPSKPPAKAQVVGWPPVRSY  100

Query  819  RRNILAANNH-----QKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALA  655
            R+NI+A  N      +K+ G  G    A  VKV MDGAPYLRKVDL MYKSYQ+LS+ALA
Sbjct  101  RKNIMAQKNTSEEKTKKASGGGGC--TAAFVKVCMDGAPYLRKVDLKMYKSYQELSNALA  158

Query  654  KMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESC  475
            KMF SFT G    QGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPW M V+SC
Sbjct  159  KMFSSFTTGYYGTQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWGMLVDSC  218

Query  474  KRLRIMKGTEAIGLAPRAMEKCKNRS  397
            KRLRIMKG+EAIGLAP+AMEKCK RS
Sbjct  219  KRLRIMKGSEAIGLAPKAMEKCKGRS  244



>ref|XP_009418923.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 159/210 (76%), Gaps = 18/210 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSK---DSQI-------HASDHNKANNKDADVTKPPA-KAQVVGWP  835
            F ET   +DLKLKL +    + QI         S  N      +D  KPPA KAQVVGWP
Sbjct  37   FAET---IDLKLKLQTPVDAEEQIIEKARGSLPSQRNLGVFCGSDPEKPPAPKAQVVGWP  93

Query  834  PVRSYRRNILAANNHQ--KSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  661
            PVRS+R+NIL+A++ +  K GGE   +  A  VKVSMDGAPYLRKVDL MY+SYQ+LS  
Sbjct  94   PVRSFRKNILSAHSEKGSKEGGEKPGNPVAAFVKVSMDGAPYLRKVDLKMYRSYQELSMG  153

Query  660  LAKMFGSFTIGNCEAQGM--KDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMF  487
            L KMFGSFT GNC +QGM  +DFMNE ++M++LN S+YVPTYEDKDGDWMLVGDVPWEMF
Sbjct  154  LQKMFGSFTSGNCGSQGMSGRDFMNEREVMDLLNGSEYVPTYEDKDGDWMLVGDVPWEMF  213

Query  486  VESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            V+SCKRLRIMKG+EAIGLAPRAMEKCKNRS
Sbjct  214  VDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  243



>ref|XP_011027545.1| PREDICTED: auxin-responsive protein IAA14 isoform X1 [Populus 
euphratica]
 ref|XP_011029890.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 160/208 (77%), Gaps = 16/208 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNK-ANNKDA---------DVTKPPAKAQVVGWPP  832
            F ET   VDLKL L +K+  +  +++ K   +KD          D  KPPAKAQVVGWPP
Sbjct  46   FAET---VDLKLNLQAKEGVMDLNENIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPP  102

Query  831  VRSYRRNILAANNHQKSGGEDGSD-KAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALA  655
            VRSYR+N++A  N  + G +  +   +A  VKV MDGAPYLRKVDL MY+SYQ+LSDALA
Sbjct  103  VRSYRKNVMAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQELSDALA  162

Query  654  KMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESC  475
            KMF SFT+GN  AQGM DFMNESKLM++LN+S+YVP+YEDKDGDWMLVGDVPWEMFV SC
Sbjct  163  KMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVNSC  222

Query  474  KRLRIMKGTEAIGL--APRAMEKCKNRS  397
            KRLR+MKG+EAIGL  APRAMEKCK+R+
Sbjct  223  KRLRLMKGSEAIGLVSAPRAMEKCKSRT  250



>ref|XP_010556884.1| PREDICTED: auxin-responsive protein IAA17 [Tarenaya hassleriana]
Length=238

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 153/196 (78%), Gaps = 10/196 (5%)
 Frame = -1

Query  975  ETHQHVDLKLKLSSKD-SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAA  799
            E   H DL    + KD S + A   + +++   D +KPPAKAQVVGWPPVRSYR+N + A
Sbjct  50   EPRDHKDLGSVTTEKDPSSLAAVPADNSSSCPKDPSKPPAKAQVVGWPPVRSYRKN-MTA  108

Query  798  NNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTI--GN  625
             + + SGG      +A  VKVSMDGAPYLRKVDL MY SY+DLS+ALAKMF SFT   GN
Sbjct  109  MSQKASGG------SATFVKVSMDGAPYLRKVDLKMYNSYEDLSNALAKMFSSFTTEKGN  162

Query  624  CEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTE  445
              AQGM DFMNESKLM++LN+SDYVPTYEDKDGDWMLVGDVPW MFVESCKRLRIMKG+E
Sbjct  163  YGAQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWLMFVESCKRLRIMKGSE  222

Query  444  AIGLAPRAMEKCKNRS  397
            AIGLAPRAMEKCKNR+
Sbjct  223  AIGLAPRAMEKCKNRA  238



>ref|XP_002884465.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60724.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score =   261 bits (668),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 152/210 (72%), Gaps = 20/210 (10%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            F ET   VDLKL LSS  + + +       N    V KPPAKAQVVGWPPVRS+R+N+++
Sbjct  32   FSET---VDLKLNLSS--TAMDSVSKVDLENMKEKVVKPPAKAQVVGWPPVRSFRKNVMS  86

Query  801  ANNHQKSGGEDGSDK---------------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLS  667
                       G+DK               A   VKVSMDGAPYLRK+DL +YK+YQDLS
Sbjct  87   GQKPTTGDATVGNDKTSGSSGATSSASVCAAVAYVKVSMDGAPYLRKIDLKLYKTYQDLS  146

Query  666  DALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMF  487
            DAL+KMF SFTIG    QGMKDFMNES L+++LN SDYVPTYEDKDGDWMLVGDVPWEMF
Sbjct  147  DALSKMFSSFTIGTYGPQGMKDFMNESILIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMF  206

Query  486  VESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            V+SCKR+RIMKG+EAIGLAPRA+EKCKNRS
Sbjct  207  VDSCKRIRIMKGSEAIGLAPRALEKCKNRS  236



>emb|CDY10349.1| BnaC05g29300D [Brassica napus]
Length=246

 Score =   261 bits (668),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 159/210 (76%), Gaps = 20/210 (10%)
 Frame = -1

Query  981  FEETHQHVDLKLKL-SSKDSQIHASDHNKANNKDA---DVTKPPAKAQVVGWPPVRSYRR  814
            F ET   VDL L L S+K+  +  ++   A+ +     D  KPPAKAQVVGWPPVR+YR+
Sbjct  42   FSET---VDLMLNLQSNKEGAVDLNNVASASKETTLLKDPAKPPAKAQVVGWPPVRNYRK  98

Query  813  NILAANNHQKSGGEDGSDK----------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSD  664
            NI+     + SG E+ S +           A LVKVSMDGAPYLRKVDL MYKSYQDLSD
Sbjct  99   NIIT--QQKTSGKEEASSEKAGNSGGGASGAALVKVSMDGAPYLRKVDLKMYKSYQDLSD  156

Query  663  ALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFV  484
            ALAKMF SFT+GN  AQGM DFMNESKLM++LN+SDYVP+YEDKD DWMLVGDVPWEMFV
Sbjct  157  ALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSDYVPSYEDKDSDWMLVGDVPWEMFV  216

Query  483  ESCKRLRIMKGTEAIGLAPRAMEK-CKNRS  397
            +SCKRLRIMKG EAIGLAPRAMEK CKNRS
Sbjct  217  DSCKRLRIMKGAEAIGLAPRAMEKYCKNRS  246



>ref|XP_002315736.1| aux/IAA family protein [Populus trichocarpa]
 gb|EEF01907.1| aux/IAA family protein [Populus trichocarpa]
Length=277

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 165/235 (70%), Gaps = 44/235 (19%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNK------ANNKDADV----TKPPAKAQVVGWPP  832
            F ET   VDLKL L +K+  +  +++ K       N+  AD      KPPAKAQVVGWPP
Sbjct  47   FAET---VDLKLNLQAKEGVMDLNENIKNIASKDKNHLPADTIKDPAKPPAKAQVVGWPP  103

Query  831  VRSYRRNILAANN------------------------HQKSGGEDGSDKA------AVLV  742
            VRSYR+N+LA  N                         QK+  E+G DKA      A  V
Sbjct  104  VRSYRKNVLAQKNASEEGFRAQVVGWPPLRSYRKNVLTQKNASEEG-DKASTGGSSAAFV  162

Query  741  KVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNT  562
            KV MDGAPYLRKVDL MYKSYQ+LSDALAKMF SFT+GN  AQGM DFMNESKLM++LN+
Sbjct  163  KVCMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNS  222

Query  561  SDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            S+YVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG+EAIGLAPRAMEKCK+R+
Sbjct  223  SEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRT  277



>ref|XP_009776553.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=244

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 149/200 (75%), Gaps = 8/200 (4%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSK-DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL  805
            F ET   VDLKL L S  D       +      + D  KPPAK QVVGWPPVRSYR+NI+
Sbjct  48   FSET---VDLKLNLQSNLDLSKEKIKNPSKETCNKDSAKPPAKTQVVGWPPVRSYRKNIM  104

Query  804  AANN----HQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSF  637
            A        +    + G   +A  VKVSMDGAPYLRKVDL MYKSYQ LSDALA MF SF
Sbjct  105  AQKGGSICEESENSKGGICSSAAFVKVSMDGAPYLRKVDLKMYKSYQQLSDALANMFSSF  164

Query  636  TIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIM  457
            T+GN  AQGM DFMNE KLM++LN+SDYVPTYEDKDGDWMLVGDVPW+MFV+SCKRLRIM
Sbjct  165  TMGNYGAQGMIDFMNERKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWQMFVDSCKRLRIM  224

Query  456  KGTEAIGLAPRAMEKCKNRS  397
            KG+EAIGLAPRAMEKCK+R+
Sbjct  225  KGSEAIGLAPRAMEKCKSRN  244



>ref|NP_001239753.1| uncharacterized protein LOC100781847 [Glycine max]
 gb|ACU21611.1| unknown [Glycine max]
Length=231

 Score =   261 bits (666),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 154/210 (73%), Gaps = 29/210 (14%)
 Frame = -1

Query  981  FEETHQHVDLKLKL---------------SSKDSQIHASDHNKANNKDADVTKPPAKAQV  847
            F ET   VDLKL L               + K +       ++AN    D  KPPAKAQV
Sbjct  36   FSETA-SVDLKLNLSSSDDSASDSPSSASTEKTTTAAPPPPSRAN----DPAKPPAKAQV  90

Query  846  VGWPPVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLS  667
            VGWPPVRS+R+NI+  N +++          A  VKVSMDGAPYLRKVD+ +YKSYQ+LS
Sbjct  91   VGWPPVRSFRKNIVQRNKNEEE---------AAFVKVSMDGAPYLRKVDIKLYKSYQELS  141

Query  666  DALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMF  487
            DALAKMF SFTI  C +QGMKDFMNE+KL+++LN SDYVPTY+DKDGDWMLVGDVPWEMF
Sbjct  142  DALAKMFSSFTIEKCGSQGMKDFMNETKLIDLLNGSDYVPTYQDKDGDWMLVGDVPWEMF  201

Query  486  VESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            VESC+RLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  202  VESCQRLRIMKGSEAIGLAPRAVEKCKNRS  231



>ref|XP_010435110.1| PREDICTED: auxin-responsive protein IAA14 [Camelina sativa]
Length=228

 Score =   261 bits (666),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 156/202 (77%), Gaps = 13/202 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRR  814
            F ET   VDLKL L S + Q H   +   + K+     D  KPPAKAQVVGWPPVR+YR+
Sbjct  33   FSET---VDLKLNLQS-NKQGHGDLNVAGSIKEKTLLKDPAKPPAKAQVVGWPPVRNYRK  88

Query  813  NILAANNHQKSGGEDGSDKAA---VLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFG  643
            N++A  NH+    ++    A      VKVSMDGAPYLRKVDL MY SY+DLSDALAKMF 
Sbjct  89   NVMA--NHKNGEPDEAMSSAGGTVAFVKVSMDGAPYLRKVDLKMYNSYKDLSDALAKMFS  146

Query  642  SFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLR  463
            SFT+G+  AQGM DFMNESK+M++LN+S+YVP+YEDKDGDWMLVGDVPW MFVESCKRLR
Sbjct  147  SFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLR  206

Query  462  IMKGTEAIGLAPRAMEKCKNRS  397
            IMKG+EA+GLAPRAMEKCKNRS
Sbjct  207  IMKGSEAVGLAPRAMEKCKNRS  228



>ref|XP_006284476.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
 gb|EOA17374.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
Length=228

 Score =   260 bits (665),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 151/199 (76%), Gaps = 7/199 (4%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKD---SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRN  811
            F ET   VDLKL L S       ++ S   K      D TKPP KAQVVGWPPVR+YR+ 
Sbjct  33   FSET---VDLKLNLQSNKQGHGDLNVSGSIKEKTLLQDPTKPPTKAQVVGWPPVRNYRKT  89

Query  810  ILAANNHQKSGGEDGSDKAAV-LVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFT  634
            ++A   + ++     S    +  VKVSMDGAPYLRKVDL MY SY+DLSDALAKMF SFT
Sbjct  90   VMATQKNGETEETMSSGGGTIAFVKVSMDGAPYLRKVDLRMYNSYKDLSDALAKMFSSFT  149

Query  633  IGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMK  454
            +G+  AQGM DFMNESK+M++LN+S+YVP+YEDKDGDWMLVGDVPW MFVESCKRLRIMK
Sbjct  150  MGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRIMK  209

Query  453  GTEAIGLAPRAMEKCKNRS  397
            G+EAIGLAPRAMEKCKNRS
Sbjct  210  GSEAIGLAPRAMEKCKNRS  228



>ref|XP_010674855.1| PREDICTED: auxin-induced protein AUX28 [Beta vulgaris subsp. 
vulgaris]
Length=297

 Score =   263 bits (671),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 143/170 (84%), Gaps = 12/170 (7%)
 Frame = -1

Query  879  DVTKP-PAKAQVVGWPPVRSYRRNILAANNHQKSGGEDGSDK--------AAVLVKVSMD  727
            D  KP  AKAQVVGWPPVR++R+NI+A    QK   E+ +D+        +A  VKVSMD
Sbjct  131  DPAKPSAAKAQVVGWPPVRAFRKNIVAV---QKKSSEEQADQKASNNTIASAAFVKVSMD  187

Query  726  GAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVP  547
            GAPYLRKVDL +YKSYQ+LSDAL KMF SFTIGNC +QGMKDFMNESKL+++LN SDYVP
Sbjct  188  GAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVP  247

Query  546  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG+EAIGLAPRA+EKCK+RS
Sbjct  248  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKSRS  297



>ref|XP_010440448.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score =   260 bits (665),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 159/203 (78%), Gaps = 15/203 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRR  814
            F ET   VDLKL L S + Q H   +   + K+     D  KPPAKAQVVGWPPVR+YR+
Sbjct  30   FSET---VDLKLNLQS-NKQGHGDLNVAGSIKEKTLLKDPAKPPAKAQVVGWPPVRNYRK  85

Query  813  NILAANNHQKSGGEDGSDKAA----VLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            N++A   +QK+G  D +  +A      VKVSMDGAPYLRKVDL MY SY++LSDALAKMF
Sbjct  86   NVMA---NQKNGETDEAMSSAGGTVAFVKVSMDGAPYLRKVDLKMYNSYKNLSDALAKMF  142

Query  645  GSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
             SFT+G+  AQGM DFMNESK+M++LN+S+YVP+YEDKDGDWMLVGDVPW MFVESCKRL
Sbjct  143  SSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRL  202

Query  465  RIMKGTEAIGLAPRAMEKCKNRS  397
            RIMKG+E+IGLAPRAMEKCKNRS
Sbjct  203  RIMKGSESIGLAPRAMEKCKNRS  225



>ref|XP_010418365.1| PREDICTED: auxin-responsive protein IAA16 [Camelina sativa]
Length=232

 Score =   260 bits (665),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 153/210 (73%), Gaps = 24/210 (11%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            F ET   VDLKL LSS  S+          N    V KPPAK QVVGWPPVRS+R+N+++
Sbjct  32   FSET---VDLKLNLSSTVSEADLE------NMKEKVVKPPAKTQVVGWPPVRSFRKNVMS  82

Query  801  ANNHQKSGGEDGSDKAAV---------------LVKVSMDGAPYLRKVDLSMYKSYQDLS  667
                      +G+DK +                 VKVSMDGAPYLRK+DL +YK+YQDLS
Sbjct  83   GQKPITGDAVEGNDKTSGSSGATSSASACAAAAYVKVSMDGAPYLRKIDLKLYKTYQDLS  142

Query  666  DALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMF  487
            +AL+KMF SFTIGN   QGMKDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPWEMF
Sbjct  143  NALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMF  202

Query  486  VESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            V+SCKR+RIMKG+EAIGLAPRA+EKCKNRS
Sbjct  203  VDSCKRIRIMKGSEAIGLAPRALEKCKNRS  232



>ref|XP_010450026.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score =   260 bits (664),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 159/203 (78%), Gaps = 15/203 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRR  814
            F ET   VDLKL L S + Q H   +   + K+     D +KPPAKAQVVGWPPVR+YR+
Sbjct  30   FSET---VDLKLNLQS-NKQGHGDLNVAGSIKEKTLLKDPSKPPAKAQVVGWPPVRNYRK  85

Query  813  NILAANNHQKSGGEDGSDKAA----VLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            N++A   +QK+G  D +  +A      VKVSMDGAPYLRKVDL MY SY+DLSDALAKMF
Sbjct  86   NVMA---NQKNGETDEAMSSAGGTVAFVKVSMDGAPYLRKVDLKMYNSYKDLSDALAKMF  142

Query  645  GSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
             SFT+ +  AQGM DFMNESK+M++LN+S+YVP+YEDKDGDWMLVGDVPW MFVESCKRL
Sbjct  143  SSFTMESYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRL  202

Query  465  RIMKGTEAIGLAPRAMEKCKNRS  397
            RIMKG+EAIGLAPRAMEKCKNRS
Sbjct  203  RIMKGSEAIGLAPRAMEKCKNRS  225



>ref|XP_007201400.1| hypothetical protein PRUPE_ppa010342mg [Prunus persica]
 gb|EMJ02599.1| hypothetical protein PRUPE_ppa010342mg [Prunus persica]
Length=253

 Score =   261 bits (667),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 152/203 (75%), Gaps = 15/203 (7%)
 Frame = -1

Query  960  VDLKLKLSSKDSQ--------IHASDHNKANNKD---ADVTKPPAKAQVVGWPPVRSYRR  814
            VDLKL LS+   Q           S  NK N  D   AD  KPPAKAQVVGWPPVRS+R+
Sbjct  51   VDLKLNLSNSKEQAITTGKDVTEKSKTNKDNKLDLPAADPAKPPAKAQVVGWPPVRSFRK  110

Query  813  NILAANNHQKSGGED----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            N+  A     S  E     GS  A  LVKVSMDGAPYLRKVDL MYKSY +LSDALAKMF
Sbjct  111  NMFTALQKSPSDKESEHNKGSSNAVTLVKVSMDGAPYLRKVDLKMYKSYPELSDALAKMF  170

Query  645  GSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
             SF IGNC +QGMKDFMNESKLM+VL  SDY+PTYEDKDGDWMLVGDVPWEMFVESCKRL
Sbjct  171  SSFAIGNCGSQGMKDFMNESKLMDVLKGSDYIPTYEDKDGDWMLVGDVPWEMFVESCKRL  230

Query  465  RIMKGTEAIGLAPRAMEKCKNRS  397
            RIMKG EA+GLAPRAMEKCKNRS
Sbjct  231  RIMKGKEAVGLAPRAMEKCKNRS  253



>ref|XP_007205640.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
 gb|EMJ06839.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
Length=299

 Score =   263 bits (671),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 152/209 (73%), Gaps = 18/209 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNK-------------ANNKDADVTKPPA-KAQVV  844
            F ET   VDLKL +SS+D      D ++                   D +KPPA KAQVV
Sbjct  93   FSET---VDLKLNISSQDETADEDDQDQQLLELKKEKNAAAPAPGANDPSKPPASKAQVV  149

Query  843  GWPPVRSYRRNILAANNHQKSGGE-DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLS  667
            GWPPVRS+R+NI          GE   S+ +A  VKVSMDGAPYLRKVDL +YKSYQ+LS
Sbjct  150  GWPPVRSFRKNIATVQKKSSDEGEKSNSNISAAFVKVSMDGAPYLRKVDLKLYKSYQELS  209

Query  666  DALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMF  487
             AL KMF SFTIGNC + GMKDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPW MF
Sbjct  210  TALGKMFSSFTIGNCGSDGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWGMF  269

Query  486  VESCKRLRIMKGTEAIGLAPRAMEKCKNR  400
            V+SCKRLRIMKG+EAIGLAPRA+EKCKNR
Sbjct  270  VDSCKRLRIMKGSEAIGLAPRAVEKCKNR  298



>gb|KHN22078.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=231

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 154/206 (75%), Gaps = 21/206 (10%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA-----------DVTKPPAKAQVVGWP  835
            F ET   VDLKL LSS D     S  + +  K             D  KPPAKAQVVGWP
Sbjct  36   FPETA-SVDLKLNLSSSDDSASDSPSSASTEKTTTAAPLPPSRANDPAKPPAKAQVVGWP  94

Query  834  PVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALA  655
            PVRS+R+NI+  N +++          A  VKVSMDGAPYLRKVD+ +YKSYQ+LSDALA
Sbjct  95   PVRSFRKNIVQRNKNEEE---------AAFVKVSMDGAPYLRKVDIKLYKSYQELSDALA  145

Query  654  KMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESC  475
            KMF SFTI  C +QGMKDFMNE+KL+++LN SDYVPTY+DKDGDWMLVGDVPWEMFVESC
Sbjct  146  KMFSSFTIEKCGSQGMKDFMNETKLIDLLNGSDYVPTYQDKDGDWMLVGDVPWEMFVESC  205

Query  474  KRLRIMKGTEAIGLAPRAMEKCKNRS  397
            +RLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  206  QRLRIMKGSEAIGLAPRAVEKCKNRS  231



>ref|XP_010485858.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 153/210 (73%), Gaps = 24/210 (11%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            F ET   VDLKL LSS  S+          N    V KPPAK QVVGWPPVRS+R+N+++
Sbjct  32   FSET---VDLKLNLSSTVSEADLE------NMKEKVVKPPAKTQVVGWPPVRSFRKNVMS  82

Query  801  ANNHQKSGGEDGSDKA---------------AVLVKVSMDGAPYLRKVDLSMYKSYQDLS  667
                      +G+DK                A  VKVSMDGAPYLRK+DL +YK+YQDLS
Sbjct  83   GQKPITGDAVEGNDKTPGSSGATSSASACAAAAYVKVSMDGAPYLRKIDLKLYKTYQDLS  142

Query  666  DALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMF  487
            +AL+KMF SFTIGN   QGMKDF+NESKL+++LN SDYVPTYEDKDGDWMLVGDVPWEMF
Sbjct  143  NALSKMFSSFTIGNYGPQGMKDFLNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMF  202

Query  486  VESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            V+SCKR+RIMKG+EAIGLAPRA+EKCKNRS
Sbjct  203  VDSCKRIRIMKGSEAIGLAPRALEKCKNRS  232



>ref|NP_001275031.1| auxin-responsive protein IAA14-like [Solanum tuberosum]
 gb|ABK41009.1| auxin/indole-3-acetic acid [Solanum tuberosum]
Length=213

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 147/190 (77%), Gaps = 6/190 (3%)
 Frame = -1

Query  966  QHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQ  787
            Q VDLKL L       + S +    + + D  KPP KAQVVGWPPVRS+R+NI++   + 
Sbjct  30   QTVDLKLNLD------NPSININNTSSNNDSLKPPTKAQVVGWPPVRSFRKNIMSQKGNN  83

Query  786  KSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGM  607
                 +  +K    VKVSMDGAPYLRKVDL MYKSYQ LSD+L KMF SFT+GN  +QGM
Sbjct  84   NVEISEKGEKTIAFVKVSMDGAPYLRKVDLKMYKSYQQLSDSLTKMFSSFTMGNYGSQGM  143

Query  606  KDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAP  427
             DFMNE KLM+VLN+SDYVPTYEDKDGDWMLVGDVPW+MFV+SCKRLRIMKG+EAIGLAP
Sbjct  144  IDFMNERKLMDVLNSSDYVPTYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAP  203

Query  426  RAMEKCKNRS  397
            RAMEKCKNRS
Sbjct  204  RAMEKCKNRS  213



>ref|XP_009124981.1| PREDICTED: auxin-responsive protein IAA16-like [Brassica rapa]
 emb|CDY21111.1| BnaA01g33420D [Brassica napus]
Length=236

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 159/209 (76%), Gaps = 20/209 (10%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL-  805
            F ET   VDLKL LSS  +    S+ +  N K+  V KPPAKAQVVGWPPVRS+R+N++ 
Sbjct  32   FSET---VDLKLNLSST-AMGSVSEVDLVNMKE-KVVKPPAKAQVVGWPPVRSFRKNVMS  86

Query  804  --------AANNHQKSGGEDGSDKAAVL------VKVSMDGAPYLRKVDLSMYKSYQDLS  667
                    A    +K+ G +G+  +A +      VKVSMDGAPYLRK+DL +YK+YQDLS
Sbjct  87   GPKPTTGDAVQATEKTSGSNGATSSASIGATAAYVKVSMDGAPYLRKIDLKLYKTYQDLS  146

Query  666  DALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMF  487
            DAL+KMF SFTIG+   QGMKD +NE KL+++LN SDYVPTYEDKDGDWMLVGDVPWEMF
Sbjct  147  DALSKMFSSFTIGSYGPQGMKDIVNEGKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMF  206

Query  486  VESCKRLRIMKGTEAIGLAPRAMEKCKNR  400
            V+SCKR+RIMKG+EAIGLAPRA+EKCKNR
Sbjct  207  VDSCKRIRIMKGSEAIGLAPRALEKCKNR  235



>ref|XP_006420094.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 ref|XP_006489503.1| PREDICTED: auxin-responsive protein IAA14-like [Citrus sinensis]
 gb|ESR33334.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 gb|KDO53918.1| hypothetical protein CISIN_1g026811mg [Citrus sinensis]
Length=232

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 153/194 (79%), Gaps = 20/194 (10%)
 Frame = -1

Query  960  VDLKLKLSSKDSQIHASDHNK---ANNK--DADVTKPPA-KAQVVGWPPVRSYRRNILAA  799
            +DLKL L SK+S +  +++ K   +NNK  D D  KP A KAQVVGWPPVRSYR+N +A 
Sbjct  53   IDLKLNLQSKESSVDLNENFKNPPSNNKNHDKDPAKPSANKAQVVGWPPVRSYRKNAMA-  111

Query  798  NNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCE  619
                         + A  VKV MDGAPYLRKVDL  YKSYQ+LSDALAKMF SFT+GN  
Sbjct  112  -------------ETAAFVKVCMDGAPYLRKVDLKTYKSYQELSDALAKMFSSFTMGNYG  158

Query  618  AQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAI  439
            +QGM DFMNESKLM++LN+SDYVPTYEDKDGDWMLVGDVPWEMFV+SCKR+RIMKG+EAI
Sbjct  159  SQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRMRIMKGSEAI  218

Query  438  GLAPRAMEKCKNRS  397
            GLAPRAMEKCK+R+
Sbjct  219  GLAPRAMEKCKSRT  232



>ref|XP_004302055.1| PREDICTED: auxin-responsive protein IAA16-like [Fragaria vesca 
subsp. vesca]
Length=254

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 157/205 (77%), Gaps = 13/205 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKA----NNKDADVTKPP-AKAQVVGWPPVRSYR  817
            F ET   VDLKL  SS++  +  S  +        KDA     P AKAQVVGWPPVRS+R
Sbjct  53   FSET---VDLKLNFSSENDDVSRSGRDGQVEIKKEKDASAAPAPRAKAQVVGWPPVRSFR  109

Query  816  RNILA----ANNHQKSGGEDGS-DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            +NI+A    + +  ++  + GS   +A  VKVSMDGAPYLRKVDL +Y+SYQ+LS AL K
Sbjct  110  KNIVAVQKKSTDQDQAAEKSGSTSTSAAFVKVSMDGAPYLRKVDLKLYQSYQELSTALGK  169

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFTIGNC +QGMKDFMNESKL+++LN S+YVP+YEDKDGDWMLVGDVPWEMFV+SCK
Sbjct  170  MFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPSYEDKDGDWMLVGDVPWEMFVDSCK  229

Query  471  RLRIMKGTEAIGLAPRAMEKCKNRS  397
            RLRIMKG+EAIGLAPRA+EK KNRS
Sbjct  230  RLRIMKGSEAIGLAPRAVEKFKNRS  254



>ref|NP_193191.2| auxin-responsive protein IAA14 [Arabidopsis thaliana]
 sp|Q38832.2|IAA14_ARATH RecName: Full=Auxin-responsive protein IAA14; AltName: Full=Indoleacetic 
acid-induced protein 14; AltName: Full=Protein SOLITARY 
ROOT [Arabidopsis thaliana]
 gb|AAG50096.1|AF334718_1 IAA14 [Arabidopsis thaliana]
 dbj|BAF00338.1| IAA14 [Arabidopsis thaliana]
 dbj|BAH30518.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83459.1| auxin-responsive protein IAA14 [Arabidopsis thaliana]
Length=228

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 155/203 (76%), Gaps = 15/203 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRR  814
            F ET   VDLKL L S + Q H   +     K+     D +KPPAKAQVVGWPPVR+YR+
Sbjct  33   FSET---VDLKLNLQS-NKQGHVDLNTNGAPKEKTFLKDPSKPPAKAQVVGWPPVRNYRK  88

Query  813  NILAANNHQKSGGED----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            N++A   +QKSG  +            VKVSMDGAPYLRKVDL MY SY+DLSDALAKMF
Sbjct  89   NVMA---NQKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKDLSDALAKMF  145

Query  645  GSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
             SFT+G+  AQGM DFMNESK+M++LN+S+YVP+YEDKDGDWMLVGDVPW MFVESCKRL
Sbjct  146  SSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRL  205

Query  465  RIMKGTEAIGLAPRAMEKCKNRS  397
            RIMKG+EAIGLAPRAMEK KNRS
Sbjct  206  RIMKGSEAIGLAPRAMEKFKNRS  228



>ref|XP_009774251.1| PREDICTED: auxin-responsive protein IAA16-like [Nicotiana sylvestris]
Length=195

 Score =   258 bits (658),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 143/190 (75%), Gaps = 30/190 (16%)
 Frame = -1

Query  966  QHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQ  787
            + VDLKL LSSK ++  A                 AKAQVVGWPPVRS+R+NIL      
Sbjct  36   EEVDLKLNLSSKLTENQA-----------------AKAQVVGWPPVRSFRKNILHV----  74

Query  786  KSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGM  607
                      AA LVKVSMDGAPYLRKVDL+MYK+YQ LSDAL+ MF SFTIGNCE QGM
Sbjct  75   ---------AAAALVKVSMDGAPYLRKVDLNMYKNYQQLSDALSNMFSSFTIGNCEVQGM  125

Query  606  KDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAP  427
            KDFMNE KLM++LN+ D+VPT+EDKDGDWMLVGDVPW MFVESCKRLRIMKGTEAIGLAP
Sbjct  126  KDFMNERKLMDLLNSCDFVPTFEDKDGDWMLVGDVPWGMFVESCKRLRIMKGTEAIGLAP  185

Query  426  RAMEKCKNRS  397
            + MEKCKNRS
Sbjct  186  KTMEKCKNRS  195



>ref|XP_011073485.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=251

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 153/204 (75%), Gaps = 16/204 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDS--------QIHASDHNKANNKDADVTKPPAKAQVVGWPPVR  826
            F ET   VDLKLKL   +          I  S H        D  KPPAKAQVVGWPPVR
Sbjct  53   FSET---VDLKLKLHQSNEPAALDLKENIKNSSHENPMLPPKDPIKPPAKAQVVGWPPVR  109

Query  825  SYRRNILAANNHQKSGGEDGS-DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKM  649
            S+R+N   A +HQKS  E+ +    A  VKVSMDGAPYLRKVDL MYKSYQ+LSDAL KM
Sbjct  110  SFRKN---AMSHQKSDKEEAACSGGAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALVKM  166

Query  648  FGSFTI-GNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            F +FT+ GN  +QGM DFMNE KLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV+SCK
Sbjct  167  FSAFTMAGNYGSQGMIDFMNEGKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCK  226

Query  471  RLRIMKGTEAIGLAPRAMEKCKNR  400
            RLRIMKG+EAIGLAPRAMEKCK+R
Sbjct  227  RLRIMKGSEAIGLAPRAMEKCKSR  250



>ref|XP_004134096.1| PREDICTED: auxin-responsive protein IAA14-like isoform 1 [Cucumis 
sativus]
 ref|XP_004162257.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA14-like 
[Cucumis sativus]
 gb|KGN56916.1| hypothetical protein Csa_3G143570 [Cucumis sativus]
Length=237

 Score =   258 bits (660),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 155/204 (76%), Gaps = 12/204 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDS-QIHASDHNKANNKDA-------DVTKPPAKAQVVGWPPVR  826
            F ET   VDLKL + SK    +  +  N   + D        D  KPPAKAQVVGWPPVR
Sbjct  37   FSET---VDLKLNIQSKPGVTVDLTPQNNDTSTDEESLIASKDPAKPPAKAQVVGWPPVR  93

Query  825  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            SYR+N ++  + +       S  +A+ VKV MDGAPYLRKVDL MYKSYQ+LS+ALAKMF
Sbjct  94   SYRKNAMSQKSSEAGEKGGSSGGSAMFVKVCMDGAPYLRKVDLKMYKSYQELSNALAKMF  153

Query  645  GSFTI-GNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR  469
             SFT+ G+  AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKR
Sbjct  154  SSFTMAGDYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKR  213

Query  468  LRIMKGTEAIGLAPRAMEKCKNRS  397
            LRIMKG+EAIGLAPRAMEKCK+RS
Sbjct  214  LRIMKGSEAIGLAPRAMEKCKSRS  237



>gb|ABD98055.1| auxin-regulated protein [Striga asiatica]
Length=248

 Score =   259 bits (661),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 154/212 (73%), Gaps = 24/212 (11%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKD-----------ADVTKPPAKAQVVGWP  835
            F ET   VDLKLKLSSK  +I   D      KD            +  +PPAKAQVVGWP
Sbjct  44   FAET---VDLKLKLSSK--EIGDLDRGGLERKDLCKEKNLMPSPTESARPPAKAQVVGWP  98

Query  834  PVRSYRRNILAANNHQKSGGEDGSD------KAAVLVKVSMDGAPYLRKVDLSMYKSYQD  673
            PVRS+R+N++A    +KS  ED           A  VKVSMDGAPYLRKVDL MYK+YQ+
Sbjct  99   PVRSFRKNVMAV--QKKSEAEDAEKVAAASGGGAAFVKVSMDGAPYLRKVDLKMYKAYQE  156

Query  672  LSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWE  493
            L DAL KMF SFT+  C+++GM DFMNESKLM++LN SDYVPTYEDKDGDWMLVGDVPW 
Sbjct  157  LYDALGKMFSSFTMVKCDSEGMMDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPWG  216

Query  492  MFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            MFVESCKRLRIMKGTEA GLAPRAMEKCK+RS
Sbjct  217  MFVESCKRLRIMKGTEAKGLAPRAMEKCKSRS  248



>dbj|BAH15071.1| indole-3-acetic acid 14 transcription factor like [Malus prunifolia]
Length=243

 Score =   258 bits (660),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 151/203 (74%), Gaps = 11/203 (5%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKD------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  820
            F ET   +DLKL L SK+        I + D N   +   D +KPPAKAQVVGWPPVRSY
Sbjct  44   FSET---IDLKLNLQSKEDLNDNVKNIASKDKNNFLSCTKDPSKPPAKAQVVGWPPVRSY  100

Query  819  RRNILAANN--HQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            R+N++A  N   +K+         A  VKV MDGAPYLRKVDL MY+SYQ+LS+ALAKMF
Sbjct  101  RKNVMAQKNTSEEKTKKASAGGCTAAFVKVCMDGAPYLRKVDLKMYRSYQELSNALAKMF  160

Query  645  GSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
             SFT G    QGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPW M V+SCKRL
Sbjct  161  SSFTTGYYGDQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWGMLVDSCKRL  220

Query  465  RIMKGTEAIGLAPRAMEKCKNRS  397
            RIMKG+EAIG+AP+AMEKCK RS
Sbjct  221  RIMKGSEAIGIAPKAMEKCKGRS  243



>ref|XP_008438588.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=237

 Score =   258 bits (659),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 155/206 (75%), Gaps = 16/206 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSK----------DSQIHASDHNKANNKDADVTKPPAKAQVVGWPP  832
            F ET   VDLKL + SK          +S     + N   +KD    KPPAKAQVVGWPP
Sbjct  37   FSET---VDLKLNIQSKTGVTVDLTPKNSDTSTDEENLITSKDP--AKPPAKAQVVGWPP  91

Query  831  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            VRSYR+N ++  +         S  +A+ VKV MDGAPYLRKVDL MYKSYQ+LS+ALAK
Sbjct  92   VRSYRKNAMSQKSPDSGEKGGSSGGSAMFVKVCMDGAPYLRKVDLKMYKSYQELSNALAK  151

Query  651  MFGSFTI-GNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESC  475
            MF SFT+ G+  AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV+SC
Sbjct  152  MFSSFTMAGDYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSC  211

Query  474  KRLRIMKGTEAIGLAPRAMEKCKNRS  397
            KRLRIMKG+EAIGLAPRAMEKCK+RS
Sbjct  212  KRLRIMKGSEAIGLAPRAMEKCKSRS  237



>ref|XP_006443920.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 gb|ESR57160.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=226

 Score =   258 bits (658),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 150/202 (74%), Gaps = 20/202 (10%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVT----KPPAKAQVVGWPPVRSYRR  814
            F ET   VDLKL LSSKD+        K  +     T    KPPAK QVVGWPPVRS+R+
Sbjct  36   FSET---VDLKLNLSSKDTSEKVKSFQKEKHPLPRATDPPAKPPAKTQVVGWPPVRSFRK  92

Query  813  NILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            N+L     QKS GE+ SD A    A  VKVSMDGAPYLRKVDL MY +Y+DL DAL KMF
Sbjct  93   NMLGV--VQKSSGEE-SDMAGGNNAAFVKVSMDGAPYLRKVDLRMYNTYKDLYDALGKMF  149

Query  645  GSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
             SFTIG      MKDFMNESKLM++LN SDYVPTYEDKDGDWMLVGDVPW MFVESCKRL
Sbjct  150  SSFTIG------MKDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPWGMFVESCKRL  203

Query  465  RIMKGTEAIGLAPRAMEKCKNR  400
            RI+KGTEAIGLAPRAMEKCKNR
Sbjct  204  RIVKGTEAIGLAPRAMEKCKNR  225



>ref|NP_001266039.1| IAA7 protein [Solanum lycopersicum]
 gb|AEX00351.1| IAA7 [Solanum lycopersicum]
Length=218

 Score =   257 bits (657),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 147/194 (76%), Gaps = 6/194 (3%)
 Frame = -1

Query  966  QHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQ  787
            Q VDLKL L   D+    + +N    KD    KPP KAQVVGWPPVRS+R+N+L+   + 
Sbjct  27   QTVDLKLNLHHNDNIPSMNINNPP--KDNSSNKPPTKAQVVGWPPVRSFRKNMLSQKGNN  84

Query  786  KSGG----EDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCE  619
             +       +  +K    VKVSMDGAPYLRKVDL MYKSYQ LS +L  MF SFT+GN  
Sbjct  85   NNNNNEEISEKDEKTIAFVKVSMDGAPYLRKVDLKMYKSYQQLSHSLTNMFSSFTMGNYG  144

Query  618  AQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAI  439
            +QGM DFMNE KLM+VLN+SDYVPTYEDKDGDWMLVGDVPW+MFV+SCKRLRIMKG+EAI
Sbjct  145  SQGMIDFMNERKLMDVLNSSDYVPTYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAI  204

Query  438  GLAPRAMEKCKNRS  397
            GLAPRAMEKCKNRS
Sbjct  205  GLAPRAMEKCKNRS  218



>ref|XP_010936171.1| PREDICTED: auxin-responsive protein IAA30-like [Elaeis guineensis]
Length=251

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 161/212 (76%), Gaps = 21/212 (10%)
 Frame = -1

Query  981  FEETHQHVDLKLKL----SSKDSQIHASD--------HNKANNKDADVTKPPA-KAQVVG  841
            F ET   +DLKLKL     SK+  + AS+         N       D  KPPA KAQVVG
Sbjct  44   FSET---IDLKLKLHTVADSKEVVMEASEKMKRSPPSQNNILTCTNDPEKPPAPKAQVVG  100

Query  840  WPPVRSYRRNILAANNHQ--KSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLS  667
            WPPVRS+R+N++A+++ +  K  GE  S+ AA  VKVSMDGAPYLRKVDL MY SY++LS
Sbjct  101  WPPVRSFRKNMMASHSDKGSKEAGEKSSNSAA-FVKVSMDGAPYLRKVDLKMYSSYKELS  159

Query  666  DALAKMFGSFTIGNCEAQGM--KDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWE  493
             AL KMF SFT GNC +QGM  +DFMNESKLM++LN S+YVPTYEDKDGDWMLVGDVPWE
Sbjct  160  MALEKMFSSFTSGNCGSQGMNGRDFMNESKLMDLLNGSEYVPTYEDKDGDWMLVGDVPWE  219

Query  492  MFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            MFV+SCKRLRIMKG+EAIGLAPRAMEKCKNRS
Sbjct  220  MFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  251



>ref|XP_008810170.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 160/204 (78%), Gaps = 15/204 (7%)
 Frame = -1

Query  966  QHVDLKLKLS---SKDSQIHASDHNKANNK------DADVTKPPA-KAQVVGWPPVRSYR  817
            + +DLKLKL    SKD++  A    ++ ++       +D  KPPA KAQVVGWPPVRS+R
Sbjct  39   KTIDLKLKLRTVDSKDAKPEAEKMKRSASQKNLLACSSDPEKPPAPKAQVVGWPPVRSFR  98

Query  816  RNILA--ANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFG  643
            +NI++  ++  +K  GE  S  +A  VKVSMDGAPYLRK+DL MY SYQ+LS AL KMF 
Sbjct  99   KNIMSIQSDKGKKDEGEK-SATSATFVKVSMDGAPYLRKIDLKMYSSYQELSVALEKMFS  157

Query  642  SFTIGNCEAQGMK--DFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR  469
            SFTIGNC +QG+K  DFMNESKLM++LN S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKR
Sbjct  158  SFTIGNCSSQGIKGRDFMNESKLMDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKR  217

Query  468  LRIMKGTEAIGLAPRAMEKCKNRS  397
            LRIMKG+EAIGLAP+ MEKCKN+S
Sbjct  218  LRIMKGSEAIGLAPKVMEKCKNQS  241



>ref|XP_002868277.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44536.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 155/204 (76%), Gaps = 17/204 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSK-----DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYR  817
            F ET   V LKL L S      D  ++ +   K   KD   +KPPAKAQVVGWPPVR+YR
Sbjct  33   FSET---VGLKLNLQSNKQGPVDLNVNGAPKEKTFLKDP--SKPPAKAQVVGWPPVRNYR  87

Query  816  RNILAANNHQKSGGED----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKM  649
            +N++A   +QKSG  +            VKVSMDGAPYLRKVDL MYKSY+DLSDALAKM
Sbjct  88   KNVMA---NQKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMYKSYKDLSDALAKM  144

Query  648  FGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR  469
            F SFT+G+  AQGM DFMNESK+M++LN+S+YVP+YEDKDGDWMLVGDVPW MFVESCKR
Sbjct  145  FSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKR  204

Query  468  LRIMKGTEAIGLAPRAMEKCKNRS  397
            +RIMKG+EAIGLAPRAMEK KNRS
Sbjct  205  MRIMKGSEAIGLAPRAMEKFKNRS  228



>ref|XP_006366663.1| PREDICTED: auxin-responsive protein IAA16-like [Solanum tuberosum]
Length=214

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 148/189 (78%), Gaps = 21/189 (11%)
 Frame = -1

Query  963  HVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQK  784
             VDLKL LSS  + I          K++ +  P  K Q+VGWPPVRS+R+NIL +   QK
Sbjct  46   FVDLKLNLSSDINNI----------KNSTLKAPAVKTQIVGWPPVRSFRKNILTS---QK  92

Query  783  SGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMK  604
             G E  +    +LVKVSMDGAPYLRKVDL+MYKSYQ+LSDALAKMF SFTI     QGMK
Sbjct  93   LGQESDN----ILVKVSMDGAPYLRKVDLNMYKSYQELSDALAKMFNSFTI----VQGMK  144

Query  603  DFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPR  424
            DFMNE KLM++LN+SDYVPTYEDKDGDWMLVGDVPW MFV+SCKRLRIMKGTEAIGLAPR
Sbjct  145  DFMNERKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGTEAIGLAPR  204

Query  423  AMEKCKNRS  397
            AMEKCKNR+
Sbjct  205  AMEKCKNRN  213



>ref|NP_001288823.1| auxin-responsive protein IAA7 [Brassica rapa]
 dbj|BAF81520.1| auxin-responsive protein IAA [Brassica rapa]
Length=242

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 156/210 (74%), Gaps = 20/210 (10%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRR  814
            F ET   VDL L L S        ++  + +KD     D  KPPAKAQVVGWPPVR+YR+
Sbjct  38   FSET---VDLMLNLQSNKEGAVDLNNVASASKDKTLLKDPAKPPAKAQVVGWPPVRNYRK  94

Query  813  NILAANNHQKSGGEDGSDK----------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSD  664
            NI+     + SG E+ S +           A LVKVSMDGAPYLRKVDL MYKSY+D SD
Sbjct  95   NIIT--QQKTSGKEEASSEKAGNSGGGASGAALVKVSMDGAPYLRKVDLKMYKSYKDFSD  152

Query  663  ALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFV  484
            ALAKMF SFT+G   AQGM DFMNESKLM++LN+S+YVP+YEDKDGDWMLVGDVPWEMFV
Sbjct  153  ALAKMFSSFTMGKYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFV  212

Query  483  ESCKRLRIMKGTEAIGLAPRAMEK-CKNRS  397
            +SCKRLRIMKG+EAIGLAPRAMEK CKNRS
Sbjct  213  DSCKRLRIMKGSEAIGLAPRAMEKYCKNRS  242



>ref|XP_006838867.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
 gb|ERN01436.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
Length=238

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 161/209 (77%), Gaps = 18/209 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKL-----------SSKDSQIHASDHNKANNKDADVTKPPA-KAQVVGW  838
            F ET   VDLKL L           + KD+ +  ++  + +N  AD  KPPA KAQVVGW
Sbjct  34   FSET---VDLKLNLMEPAPLDVPASTVKDTGVDLTEKLRGSNAVADPAKPPAHKAQVVGW  90

Query  837  PPVRSYRRNILAANNHQKSG-GEDGSDKA-AVLVKVSMDGAPYLRKVDLSMYKSYQDLSD  664
            PPVRS+RRN+LA  + + +   E+G   A A  VKVSMDGAPYLRKVDL+MYKSYQDLS+
Sbjct  91   PPVRSFRRNMLATQSSKGNNRSEEGEKNAGATYVKVSMDGAPYLRKVDLNMYKSYQDLSN  150

Query  663  ALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFV  484
            +L KMF  FT+G C +QG+ +F+NESKLM++LN S+YVPTYED+DGDWMLVGDVPWEMFV
Sbjct  151  SLEKMFSCFTMGQCGSQGI-NFLNESKLMDLLNGSEYVPTYEDRDGDWMLVGDVPWEMFV  209

Query  483  ESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            +SC+RLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  210  DSCRRLRIMKGSEAIGLAPRAVEKCKNRS  238



>ref|XP_010463960.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 152/210 (72%), Gaps = 24/210 (11%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            F ET   VDLKL LSS  S+          N    V KPPAK QVVGWPPVRS+R+N+++
Sbjct  32   FSET---VDLKLNLSSTVSEADLE------NMKEKVVKPPAKTQVVGWPPVRSFRKNVMS  82

Query  801  ANNHQKSGGEDGSDKAAV---------------LVKVSMDGAPYLRKVDLSMYKSYQDLS  667
                      +G+DK +                 VKVSMDGAPYLRK+DL +YK+YQDLS
Sbjct  83   GQKPITGDTVEGNDKTSGSSGATSSASACAAAAYVKVSMDGAPYLRKIDLKLYKTYQDLS  142

Query  666  DALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMF  487
            +AL+KMF SFTIGN   QGMKDFMNESKL+++LN SD VPTYEDKDGDWMLVGDVPWEMF
Sbjct  143  NALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDCVPTYEDKDGDWMLVGDVPWEMF  202

Query  486  VESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            V+SCKR+RIMKG+EAIGLAPRA+EKCKNRS
Sbjct  203  VDSCKRIRIMKGSEAIGLAPRALEKCKNRS  232



>gb|EYU32514.1| hypothetical protein MIMGU_mgv1a012542mg [Erythranthe guttata]
Length=247

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 153/205 (75%), Gaps = 14/205 (7%)
 Frame = -1

Query  981  FEETHQHVDLKLKL------SSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  820
            F ET   VDLKL L      SS D    +S    A     D  KPPAKAQVVGWPPVRS+
Sbjct  45   FSET---VDLKLNLQSNEPPSSSDLINISSTEINAMLPPKDPIKPPAKAQVVGWPPVRSF  101

Query  819  RRNILAANNHQKSGGEDGSDKAAV-----LVKVSMDGAPYLRKVDLSMYKSYQDLSDALA  655
            R+NI++         +  SDKAA       VKVSMDGAPYLRKVDL MY +YQ+LSDALA
Sbjct  102  RKNIISHQKSSSPADQQDSDKAAAACSAAFVKVSMDGAPYLRKVDLKMYGAYQELSDALA  161

Query  654  KMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESC  475
            KMF SFT+GN  ++GM DFMNE KLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV+SC
Sbjct  162  KMFSSFTMGNYGSEGMIDFMNEGKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSC  221

Query  474  KRLRIMKGTEAIGLAPRAMEKCKNR  400
            KR+RIMKG+EAIGLAPRAMEKCK+R
Sbjct  222  KRIRIMKGSEAIGLAPRAMEKCKSR  246



>gb|AAC49055.1| IAA14, partial [Arabidopsis thaliana]
Length=164

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 139/165 (84%), Gaps = 7/165 (4%)
 Frame = -1

Query  879  DVTKPPAKAQVVGWPPVRSYRRNILAANNHQKSGGED----GSDKAAVLVKVSMDGAPYL  712
            D +KPPAKAQVVGWPPVR+YR+N++A   +QKSG  +            VKVSMDGAPYL
Sbjct  3    DPSKPPAKAQVVGWPPVRNYRKNVMA---NQKSGEAEEAMSSGGGTVAFVKVSMDGAPYL  59

Query  711  RKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDK  532
            RKVDL MY SY+DLSDALAKMF SFT+G+  AQGM DFMNESK+M++LN+S+YVP+YEDK
Sbjct  60   RKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDK  119

Query  531  DGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            DGDWMLVGDVPW MFVESCKRLRIMKG+EAIGLAPRAMEK KNRS
Sbjct  120  DGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNRS  164



>emb|CAC84710.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=277

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 159/234 (68%), Gaps = 42/234 (18%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKD---------SQIHASDHNKANNKDA-DVTKPPAKAQVVGWPP  832
            F ET   VDLKL L +K+         + I + D N   +    D  KPPAKAQVVGWPP
Sbjct  47   FAET---VDLKLNLQAKEGVMDLNENINNIASEDKNHLPSATIKDPAKPPAKAQVVGWPP  103

Query  831  VRSYRRNILAANNH------------------------QKSGGEDGSDKA-----AVLVK  739
            VRSYR+N+LA  N                         QK+  E+G   +     A  VK
Sbjct  104  VRSYRKNVLAQKNASEEGFGAQVEGWPPVRSYRKNVLVQKNASEEGEKASTGGCSAAFVK  163

Query  738  VSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTS  559
            V MDGAPYLRKVDL MYKSYQ+LSDALAKMF S T+GN  AQGM DFMNESKLM++LN+S
Sbjct  164  VCMDGAPYLRKVDLKMYKSYQELSDALAKMFSSLTMGNYGAQGMIDFMNESKLMDLLNSS  223

Query  558  DYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            +YVP+YEDKDGDWMLVGDVPWEMFV+SCKR RIMKG+EA+GLAPRAMEKCK+R+
Sbjct  224  EYVPSYEDKDGDWMLVGDVPWEMFVDSCKRPRIMKGSEAVGLAPRAMEKCKSRT  277



>gb|ABI36487.1| AUX/IAA7 A [Malus domestica]
 gb|ABI36488.1| AUX/IAA7 B [Malus domestica]
Length=154

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 129/154 (84%), Gaps = 5/154 (3%)
 Frame = -1

Query  843  GWPPVRSYRRNILAANNHQKSGGED-----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSY  679
            GWPPVRS+R+N+        + GE      GS+  AVLVKVSMDGAPYLRKVDL MYKSY
Sbjct  1    GWPPVRSFRKNMFTVVQKSTNDGESEQMNKGSNNNAVLVKVSMDGAPYLRKVDLKMYKSY  60

Query  678  QDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVP  499
             +LSDALAKMF SFTIGNC +QGMKDFMNE KLM+VLN SDY+PTYEDKDGDWMLVGDVP
Sbjct  61   PELSDALAKMFSSFTIGNCGSQGMKDFMNERKLMDVLNGSDYIPTYEDKDGDWMLVGDVP  120

Query  498  WEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            WEMFVESCKRLRIMK  EA+GLAPRAMEKCKNRS
Sbjct  121  WEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNRS  154



>ref|XP_008788131.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 162/211 (77%), Gaps = 20/211 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLS----SKDSQIHASDHNKANNKDADVT-------KPPA-KAQVVGW  838
            F ET   +DLKLKL     SK+  +  S+  K +    ++        KPPA KAQVVGW
Sbjct  35   FSET---IDLKLKLQTVADSKEVVMEVSEKMKRSPSHKNILPCTNDPEKPPAPKAQVVGW  91

Query  837  PPVRSYRRNILAANNHQ--KSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSD  664
            PPVRS+R+N++A ++ +  K  GE  S+ AA LVKVSMDGAPYLRKVDL +Y SY++LS 
Sbjct  92   PPVRSFRKNMMATHSDKGSKEAGEKFSNSAA-LVKVSMDGAPYLRKVDLKIYSSYKELSM  150

Query  663  ALAKMFGSFTIGNCEAQGM--KDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEM  490
            AL KMF SFT GNC +QGM  +DFMNESKLM++LN S+YVPTYEDKDGDWMLVGDVPWEM
Sbjct  151  ALEKMFSSFTSGNCGSQGMNGRDFMNESKLMDLLNGSEYVPTYEDKDGDWMLVGDVPWEM  210

Query  489  FVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            FV+SCKRLR+MKG+EAIGLAPRAMEKCKNRS
Sbjct  211  FVDSCKRLRMMKGSEAIGLAPRAMEKCKNRS  241



>ref|XP_006605305.1| PREDICTED: uncharacterized protein LOC100499872 isoform X1 [Glycine 
max]
 gb|KHN04928.1| Auxin-induced protein AUX28 [Glycine soja]
Length=227

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 155/213 (73%), Gaps = 32/213 (15%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSS------------------KDSQIHASDHNKANNKDADVTKPPAK  856
            F ET   VDLKL LSS                  K+++   ++   AN    D  KPPAK
Sbjct  29   FSETA-SVDLKLNLSSCINDSASDSPSSVSTEKPKENKTTTAEPPPAN----DPAKPPAK  83

Query  855  AQVVGWPPVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQ  676
            AQVVGWPPVRS+R+NI+  N++++    + S K A  VKVSMDGAPYLRKVD+ +YKSYQ
Sbjct  84   AQVVGWPPVRSFRKNIVQRNSNEEEA--EKSTKNA-FVKVSMDGAPYLRKVDIKLYKSYQ  140

Query  675  DLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPW  496
            +LSDALAKMF SFTI  C +QGMKDFMNE+      N SDYVPTYEDKDGDWMLVGDVPW
Sbjct  141  ELSDALAKMFSSFTIEKCGSQGMKDFMNET------NGSDYVPTYEDKDGDWMLVGDVPW  194

Query  495  EMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            EMFVESCKRLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  195  EMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS  227



>ref|XP_009107777.1| PREDICTED: auxin-responsive protein IAA14 [Brassica rapa]
Length=233

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 154/195 (79%), Gaps = 11/195 (6%)
 Frame = -1

Query  960  VDLKLKL-SSKDSQI--HASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANNH  790
            V+LKL L S+K+  +  + +   K      D +KPPAKAQVVGWPPVR+YR++++    H
Sbjct  41   VELKLGLHSTKEGSVDLNVAGAPKEKTLHKDPSKPPAKAQVVGWPPVRNYRKSVM---TH  97

Query  789  QKSGG--EDGSDKAA---VLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGN  625
            QK     E  SD+       VKVSMDGAPYLRKVDL MYKSY++LSDALAKMF SFT+G+
Sbjct  98   QKCSEVEEASSDRGGGTVAFVKVSMDGAPYLRKVDLKMYKSYKELSDALAKMFSSFTMGS  157

Query  624  CEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTE  445
              AQGM DFMNESK+M+++N+SDYVP+YEDKDGDWMLVGDVPW MF+ESCKRLRIMKG+E
Sbjct  158  YGAQGMIDFMNESKVMDLVNSSDYVPSYEDKDGDWMLVGDVPWPMFIESCKRLRIMKGSE  217

Query  444  AIGLAPRAMEKCKNR  400
            AIGLAPRAM+KCKNR
Sbjct  218  AIGLAPRAMQKCKNR  232



>ref|XP_009420668.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=241

 Score =   254 bits (648),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 159/211 (75%), Gaps = 20/211 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSS-----------KDSQIHASDHNKANNKDADVTKPPA-KAQVVGW  838
            F ET   +DLKL+L +            ++   +  H    +  +D  KPPA KAQVVGW
Sbjct  35   FAET---IDLKLQLQTPADAEEAAVEAAETMKRSLSHKNVVSCGSDPEKPPAPKAQVVGW  91

Query  837  PPVRSYRRNILAANNHQKSGGEDG--SDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSD  664
            PPVRS+R+N+L+ ++  K G E+G  S  +A  VKVSMDGAPYLRKVDL MY+SY +LS 
Sbjct  92   PPVRSFRKNVLSVHS-VKGGKEEGEKSGTSAAFVKVSMDGAPYLRKVDLKMYRSYHELSM  150

Query  663  ALAKMFGSFTIGNCEAQGM--KDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEM  490
            AL KMF +FT GNC +QGM  +DFMNESK+M++LN S+YVPTYEDKDGDWMLVGDVPWEM
Sbjct  151  ALQKMFSTFTGGNCGSQGMSGRDFMNESKVMDLLNGSEYVPTYEDKDGDWMLVGDVPWEM  210

Query  489  FVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            FV+SCKRLRIMKG+EAIGLAPRAMEKCKNRS
Sbjct  211  FVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  241



>ref|XP_010917600.1| PREDICTED: auxin-responsive protein IAA30 isoform X1 [Elaeis 
guineensis]
Length=246

 Score =   254 bits (648),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 164/215 (76%), Gaps = 25/215 (12%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNK----ANNKDA-----DVTKPPA-KAQVVGWPP  832
            F ET   +DLKLKL + DS+   ++  K    A+ K+      D  KPPA KAQVVGWPP
Sbjct  37   FSET---IDLKLKLQTVDSKDIEAEAEKMKRSASQKNLLACSNDPEKPPAPKAQVVGWPP  93

Query  831  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
            VRS+R+NI++  + +  G ++  +K+A  VKVSMDGAPYLRK+DL MY+SYQ+LS AL K
Sbjct  94   VRSFRKNIMSVQSDK--GNKEEGEKSATFVKVSMDGAPYLRKIDLKMYRSYQELSVALEK  151

Query  651  MFGSFTIGNCEAQGMK--DFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWE-----  493
            MF SFTIGNC +QG+K  DFMNESKLM+++N S+YVPTYEDKDGDWMLVGDVPW+     
Sbjct  152  MFSSFTIGNCSSQGIKGRDFMNESKLMDLINGSEYVPTYEDKDGDWMLVGDVPWDDLLSI  211

Query  492  ---MFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
               MF++SCKRLRIMKG+EAIGLAP+AMEKCKN+S
Sbjct  212  KFRMFIDSCKRLRIMKGSEAIGLAPKAMEKCKNKS  246



>emb|CDY47148.1| BnaA08g05350D [Brassica napus]
Length=233

 Score =   253 bits (647),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 153/198 (77%), Gaps = 15/198 (8%)
 Frame = -1

Query  960  VDLKLKLSSK-----DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAAN  796
            V+LKL L S      D  +  +   K  +KD   +KPPAKAQVVGWPPVR+YR++++   
Sbjct  41   VELKLGLHSTKEGSVDLNVAGAPKEKTLHKDP--SKPPAKAQVVGWPPVRNYRKSVM---  95

Query  795  NHQKSGG--EDGSDKAA---VLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTI  631
             HQK     E  SD+       VKVSMDGAPYLRKVDL MY SY++LSDALAKMF SFT+
Sbjct  96   THQKCSEVEEASSDRGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKELSDALAKMFSSFTM  155

Query  630  GNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG  451
            G+  AQGM DFMNESK+M+++N+SDYVP+YEDKDGDWMLVGDVPW MF+ESCKRLRIMKG
Sbjct  156  GSYGAQGMIDFMNESKVMDLVNSSDYVPSYEDKDGDWMLVGDVPWPMFIESCKRLRIMKG  215

Query  450  TEAIGLAPRAMEKCKNRS  397
            +EAIGLAPRAM+KCKNRS
Sbjct  216  SEAIGLAPRAMQKCKNRS  233



>ref|NP_001266055.1| IAA10 protein [Solanum lycopersicum]
 gb|AEX00360.1| IAA17 [Solanum lycopersicum]
Length=208

 Score =   252 bits (643),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 146/189 (77%), Gaps = 21/189 (11%)
 Frame = -1

Query  963  HVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQK  784
             VDLKL LSS  + I  S H            P AKAQVVGWPPVRS+R+NIL +   QK
Sbjct  40   FVDLKLNLSSDINNIKNSTH----------KTPAAKAQVVGWPPVRSFRKNILTS---QK  86

Query  783  SGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMK  604
               E+ +    +LVKVSMDGAPYLRKVDL+MYKSYQ+L DAL KMF SFTI     QGMK
Sbjct  87   LDRENDN----ILVKVSMDGAPYLRKVDLNMYKSYQELFDALTKMFNSFTI----VQGMK  138

Query  603  DFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPR  424
            DFM+E KLM++LN+SDYVPTYEDKDGDWMLVGDVPW MFV+SCKRLRIMKGTEAIGLAPR
Sbjct  139  DFMHEGKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGTEAIGLAPR  198

Query  423  AMEKCKNRS  397
            AMEKCKNR+
Sbjct  199  AMEKCKNRN  207



>dbj|BAJ84870.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92398.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   253 bits (647),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 134/159 (84%), Gaps = 11/159 (7%)
 Frame = -1

Query  870  KPPA-KAQVVGWPPVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLS  694
            KP A KAQVVGWPPVRS+R+NILA         E  S  AA  VKVSMDGAPYLRKVDLS
Sbjct  104  KPRAPKAQVVGWPPVRSFRKNILA---------EKSSPAAAAFVKVSMDGAPYLRKVDLS  154

Query  693  MYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWML  514
            MYK+YQDLS AL KMF SFTIGNC  QGM + MNESKLM++LN S+YVPTYEDKDGDWML
Sbjct  155  MYKTYQDLSKALEKMFSSFTIGNCGTQGM-NGMNESKLMDLLNGSEYVPTYEDKDGDWML  213

Query  513  VGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            VGDVPWEMFVESCKRLRIMKG+EAIGLAPRAMEKCKNRS
Sbjct  214  VGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  252



>dbj|BAK01326.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   253 bits (646),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 131/154 (85%), Gaps = 10/154 (6%)
 Frame = -1

Query  858  KAQVVGWPPVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSY  679
            KAQVVGWPPVRS+R+NILA         E  S  AA  VKVSMDGAPYLRKVDLSMYK+Y
Sbjct  109  KAQVVGWPPVRSFRKNILA---------EKSSPAAAAFVKVSMDGAPYLRKVDLSMYKTY  159

Query  678  QDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVP  499
            QDLS AL KMF SFTIGNC  QGM + MNESKLM++LN S+YVPTYEDKDGDWMLVGDVP
Sbjct  160  QDLSKALEKMFSSFTIGNCGTQGM-NGMNESKLMDLLNGSEYVPTYEDKDGDWMLVGDVP  218

Query  498  WEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            WEMFVESCKRLRIMKG+EAIGLAPRAMEKCKNRS
Sbjct  219  WEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  252



>ref|XP_007034957.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
 gb|EOY05883.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
Length=204

 Score =   251 bits (642),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 151/194 (78%), Gaps = 18/194 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--------DVTKPPAKAQVVGWPPVR  826
            F ET   VDLKL L SK++ +  + + +  +K+         D  KPPAKAQVVGWPPVR
Sbjct  17   FSET---VDLKLNLQSKETGMDLNKNIENGSKEKTLLPACTKDPAKPPAKAQVVGWPPVR  73

Query  825  SYRRNILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDAL  658
            SYR+NI+A   +QK+  E+   KA    A  VKVSMDGAPYLRKVDL MYKSYQ+LSDAL
Sbjct  74   SYRKNIMA---NQKNSCEESDKKASSGGAAFVKVSMDGAPYLRKVDLKMYKSYQELSDAL  130

Query  657  AKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVES  478
            AKMF SFT+GN  AQGM DFMNESKLM++LN+SDYVPTYEDKDGDWMLVGDVPWEMFV+S
Sbjct  131  AKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVDS  190

Query  477  CKRLRIMKGTEAIG  436
            CKRLRIMKG+EAIG
Sbjct  191  CKRLRIMKGSEAIG  204



>emb|CDY63910.1| BnaC01g43640D [Brassica napus]
 emb|CDY30781.1| BnaC07g16810D [Brassica napus]
Length=240

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 157/209 (75%), Gaps = 20/209 (10%)
 Frame = -1

Query  981  FEETHQHVDLKLKL-SSKDSQIHASDHNKANNKD--ADVTKPPAKAQVVGWPPVRSYRRN  811
            F ET   VDL L L S+K+  I  ++   +  K    D  KPPAKAQVVGWPPVR+YR+N
Sbjct  38   FSET---VDLMLNLQSNKERAIDLNNATASKQKTLLKDPVKPPAKAQVVGWPPVRNYRKN  94

Query  810  ILAANNHQKSGGEDGSDK----------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  661
            I+   N + SG ++ S +           A LVKVSMDGAPYLRKV L MYKSYQDLSDA
Sbjct  95   IMT--NQKTSGADEASSEKAGNGGGGATGATLVKVSMDGAPYLRKVHLKMYKSYQDLSDA  152

Query  660  LAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVE  481
            LAKMF SFT+GN  AQGM DFMNE+KLM+ LN+S+YVP+YEDKDGDWM VGDVPWEMFVE
Sbjct  153  LAKMFSSFTMGNYGAQGMIDFMNETKLMD-LNSSEYVPSYEDKDGDWMPVGDVPWEMFVE  211

Query  480  SCKRLRIMKGTEAIGLAPRAMEK-CKNRS  397
            SCKRLRIMKG+EAIGLAPRAMEK  KNRS
Sbjct  212  SCKRLRIMKGSEAIGLAPRAMEKYSKNRS  240



>ref|XP_010923478.1| PREDICTED: auxin-responsive protein IAA30-like isoform X1 [Elaeis 
guineensis]
Length=250

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 161/211 (76%), Gaps = 20/211 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKL----SSKDSQIHASDHNK--ANNKDA-----DVTKPPA-KAQVVGW  838
            F ET   +DLKLKL     SK+ ++   D  K   + K+      D  KP A KAQVVGW
Sbjct  44   FSET---IDLKLKLHTVVDSKEVEMEVWDKMKRLPSQKNLLPCTNDPEKPSAPKAQVVGW  100

Query  837  PPVRSYRRNILAANNHQKSG--GEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSD  664
            PPVRS+R+NILA ++ + S   GE  S+  A LVKVSMDGAPYLRKVDL MY+SYQ+LS 
Sbjct  101  PPVRSFRKNILATHSDKGSKVEGEKSSNSVA-LVKVSMDGAPYLRKVDLKMYRSYQELSM  159

Query  663  ALAKMFGSFTIGNCEAQGM--KDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEM  490
            AL KMF SFT GNC +QGM  +DFMNESKLM++LN S+YVPTYEDKDGD MLVGDVPWEM
Sbjct  160  ALEKMFSSFTSGNCGSQGMSGRDFMNESKLMDLLNGSEYVPTYEDKDGDLMLVGDVPWEM  219

Query  489  FVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            FVESCKRLRIMKG+EAIGLAPRAMEKCKNRS
Sbjct  220  FVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  250



>ref|XP_002306817.1| hypothetical protein POPTR_0005s23980g [Populus trichocarpa]
 gb|EEE93813.1| hypothetical protein POPTR_0005s23980g [Populus trichocarpa]
Length=229

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 145/191 (76%), Gaps = 12/191 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQI---HASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRN  811
            F ET   VDLKL LSSK+  I   H     + N    D  KPPAKAQVVGWPPVRS+R+N
Sbjct  39   FSET---VDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  810  ILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFG  643
            +LA    + S  ++ +DK     A  VKVSMDGAPYLRKVDL MYK+Y +LSDAL KMF 
Sbjct  96   MLAV--QKSSTDQESTDKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYHELSDALGKMFS  153

Query  642  SFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLR  463
            SFTIGNC + GMKDF+NESKL+++LN +DYVPTYEDKDGDWMLVGDVPW+MFVESCKRLR
Sbjct  154  SFTIGNCGSHGMKDFLNESKLIDLLNGTDYVPTYEDKDGDWMLVGDVPWDMFVESCKRLR  213

Query  462  IMKGTEAIGLA  430
            IMKGTEA GL 
Sbjct  214  IMKGTEATGLG  224



>ref|XP_004495391.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Cicer 
arietinum]
Length=244

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 145/190 (76%), Gaps = 9/190 (5%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKD--ADVTKPPAKAQVVGWPPVRSYRRNI  808
            F ET   VDLKL L S    ++ +  N + +K    D  KPPAKAQVVGWPPVRSYR+N+
Sbjct  43   FSET---VDLKLNLQSNKEDLNDNSKNVSKDKTLLKDPAKPPAKAQVVGWPPVRSYRKNM  99

Query  807  LA--ANNHQKSGGE--DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGS  640
            +A   NN  + G E    S  A   VKVSMDGAPYLRKVDL+MY +Y+DLSDALAKMF S
Sbjct  100  MAQKVNNSDQDGNEKTTSSTTAGTFVKVSMDGAPYLRKVDLTMYNTYKDLSDALAKMFSS  159

Query  639  FTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRI  460
            FT G   AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFVESCKRLRI
Sbjct  160  FTTGKYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRI  219

Query  459  MKGTEAIGLA  430
            MKG+EAIGL 
Sbjct  220  MKGSEAIGLG  229



>emb|CAN72026.1| hypothetical protein VITISV_014421 [Vitis vinifera]
Length=285

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 146/192 (76%), Gaps = 8/192 (4%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDS---QIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRN  811
            F ET   VDLKL L SKDS   Q        A     D  KPPAKAQVVGWPPVRS+R+N
Sbjct  46   FSET---VDLKLNLLSKDSVADQAEKMKEKSALPPSNDPAKPPAKAQVVGWPPVRSFRKN  102

Query  810  ILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTI  631
            IL    +     E+ +  +A  VKVSMDGAPYLRKVDL MYKSYQ+LSDAL KMF SFTI
Sbjct  103  ILTVQKNSSE--EEKASSSAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTI  160

Query  630  GNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG  451
            GNC +QGMKDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG
Sbjct  161  GNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG  220

Query  450  TEAIGLAPRAME  415
            +EAIGLA  + E
Sbjct  221  SEAIGLAKSSGE  232



>ref|XP_008462706.1| PREDICTED: auxin-responsive protein IAA16-like isoform X1 [Cucumis 
melo]
Length=232

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 152/204 (75%), Gaps = 13/204 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHAS-DHNKAN---NKDADVTKPPAKAQVVGWPPVRSYRR  814
            F ET   VDLKL +++   Q + + D N  +   NKD     PPAK QV+GWPPV+S RR
Sbjct  33   FTET---VDLKLHIATDSDQGNKTIDKNVVSSFVNKDLP-KPPPAKTQVIGWPPVKSLRR  88

Query  813  NILAANNHQ-----KSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKM  649
            NI+    ++     KS   D S  A   +KVSM+GAPYLRKVDL MY+SYQ L DAL+KM
Sbjct  89   NIIGPKKNKLEETKKSAVGDCSVGAVAFIKVSMEGAPYLRKVDLKMYESYQQLFDALSKM  148

Query  648  FGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR  469
            FGSFT GNC AQ MKD+MNE KL +VLN SDYVPTYEDKDGDWMLVGDVPW+MFV SCKR
Sbjct  149  FGSFTTGNCGAQKMKDYMNERKLKDVLNGSDYVPTYEDKDGDWMLVGDVPWDMFVNSCKR  208

Query  468  LRIMKGTEAIGLAPRAMEKCKNRS  397
            LRIMKG+EAIGLAPRA+EKCKNR+
Sbjct  209  LRIMKGSEAIGLAPRALEKCKNRN  232



>emb|CDY30017.1| BnaC01g39910D [Brassica napus]
Length=237

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 153/210 (73%), Gaps = 21/210 (10%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL-  805
            F ET   VDLKL LSS  +    S+ +  N K+  V KPPAKAQVVGWPPVRS+R+N++ 
Sbjct  32   FSET---VDLKLNLSST-AMDSVSELDLVNMKE-KVVKPPAKAQVVGWPPVRSFRKNVMS  86

Query  804  -----------AANNHQKSGGEDGS---DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLS  667
                       A  N   S G   S      A  VK+SMDGAPYLRK+DL +YK+YQDLS
Sbjct  87   GPKPTTGDAFQATENTSSSNGATSSASIGATAAYVKISMDGAPYLRKIDLKLYKAYQDLS  146

Query  666  DALAKMFGSFTIGNCEAQGMKDFMNESKLM-NVLNTSDYVPTYEDKDGDWMLVGDVPWEM  490
            D L+KMF SFTIG+   QGMKD +NE KLM ++LN SDYVPTYEDKDGDWMLVGDVPWEM
Sbjct  147  DTLSKMFSSFTIGSYGPQGMKDIVNEGKLMIDLLNGSDYVPTYEDKDGDWMLVGDVPWEM  206

Query  489  FVESCKRLRIMKGTEAIGLAPRAMEKCKNR  400
            FV+SCKR+RIMKG+EAIGLAPRA+EKCKNR
Sbjct  207  FVDSCKRIRIMKGSEAIGLAPRALEKCKNR  236



>ref|XP_003521753.1| PREDICTED: auxin-responsive protein IAA16-like [Glycine max]
Length=243

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 134/159 (84%), Gaps = 5/159 (3%)
 Frame = -1

Query  858  KAQVVGWPPVRSYRRNILAANNHQK-----SGGEDGSDKAAVLVKVSMDGAPYLRKVDLS  694
            KAQVVGWPPVRS+R+NI+  +N+ +     +   +  +  A  VKVSMDGAPYLRKVDL 
Sbjct  85   KAQVVGWPPVRSFRKNIVQRSNNNEGEKAATSSSNNVNTGAAFVKVSMDGAPYLRKVDLK  144

Query  693  MYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWML  514
            +YKSYQ+L DALAKMF SFTI  C +QGMKDFMNESKL+++LN SDYVPTYEDKD DWML
Sbjct  145  LYKSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDADWML  204

Query  513  VGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            VGDVPWEMFVESCKRLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  205  VGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS  243



>dbj|BAI94494.1| Aux/IAA protein [Dianthus caryophyllus]
Length=238

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 136/166 (82%), Gaps = 6/166 (4%)
 Frame = -1

Query  882  ADVTKPPAKAQVVGWPPVRSYRRNILAANNHQKSGGEDGS--DKAAV--LVKVSMDGAPY  715
             D  KPPAKAQVVGWPPVRSYR+N++     + + GE+G   DK++   LVKVSMDGAPY
Sbjct  75   TDSVKPPAKAQVVGWPPVRSYRKNVMTL--QKGTAGEEGETVDKSSSGGLVKVSMDGAPY  132

Query  714  LRKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYED  535
            LRKV L MYKSYQ+LSDAL KMF  FT+GN   QGM DFMNE KLM++LN SDYVPTYED
Sbjct  133  LRKVHLKMYKSYQELSDALGKMFSFFTLGNYGEQGMIDFMNERKLMDLLNDSDYVPTYED  192

Query  534  KDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            KDGDWMLVGDVPW MFVESCKR+RIMKG EA GLAPRAMEKCKNRS
Sbjct  193  KDGDWMLVGDVPWGMFVESCKRIRIMKGKEAAGLAPRAMEKCKNRS  238



>gb|KHN31465.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=243

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 134/159 (84%), Gaps = 5/159 (3%)
 Frame = -1

Query  858  KAQVVGWPPVRSYRRNILAANNHQK-----SGGEDGSDKAAVLVKVSMDGAPYLRKVDLS  694
            KAQVVGWPPVRS+R+NI+  +N+ +     +   +  +  A  VKVSMDGAPYLRKVDL 
Sbjct  85   KAQVVGWPPVRSFRKNIVQRSNNNEGEKAATSSSNNVNTGAAFVKVSMDGAPYLRKVDLK  144

Query  693  MYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWML  514
            +YKSYQ+L DALAKMF SFTI  C +QGMKDFMNESKL+++LN SDYVPTYEDKD DWML
Sbjct  145  LYKSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDADWML  204

Query  513  VGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            VGDVPWEMFVESCKRLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  205  VGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS  243



>gb|KEH42778.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=239

 Score =   251 bits (641),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 145/186 (78%), Gaps = 6/186 (3%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            F ET   VDLKL L +K+  ++    +K      D  KPPAKAQVVGWPPVRSYR+N++A
Sbjct  44   FSET---VDLKLNLQTKE-DLNEKSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA  99

Query  801  --ANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIG  628
               NN + +     +  AA  VKVSMDGAPYLRKVDL+MYK+Y+DLSDALAKMF SFT G
Sbjct  100  QKVNNTEDTEKTTSNTTAAAFVKVSMDGAPYLRKVDLTMYKTYKDLSDALAKMFSSFTTG  159

Query  627  NCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGT  448
            N  AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKG+
Sbjct  160  NYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGS  219

Query  447  EAIGLA  430
            EAIGL 
Sbjct  220  EAIGLG  225



>ref|XP_009398568.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=248

 Score =   251 bits (640),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 151/208 (73%), Gaps = 17/208 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSK--------DSQIHASDHNKANNKDADVTKPPA-KAQVVGWPPV  829
            FEET   VDLKLKL +         +    +  H        D  +P A KAQVVGWPPV
Sbjct  45   FEET---VDLKLKLQTTVDVEEVAAEKMKRSPSHKNVAASATDPERPRAPKAQVVGWPPV  101

Query  828  RSYRRNILAANNHQKSGGEDGSD--KAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALA  655
            RSYR+NILA  + +K+  E+G      A  VKV MDGAPYLRKVDL MY+SYQ+LS AL 
Sbjct  102  RSYRKNILAVQS-EKASKEEGEKPGNTAAFVKVCMDGAPYLRKVDLKMYRSYQELSMALE  160

Query  654  KMFGSFTIGNCEAQGM--KDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVE  481
            KMF SFT  NC +QGM  +DF NE KLM+++N S+YVPTYEDKDGDWMLVGDVPWEMFV+
Sbjct  161  KMFSSFTSANCGSQGMNGRDFTNEGKLMDLINGSEYVPTYEDKDGDWMLVGDVPWEMFVD  220

Query  480  SCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            SCKRLRIMKG+EAIGLAPRAMEKCK+RS
Sbjct  221  SCKRLRIMKGSEAIGLAPRAMEKCKSRS  248



>emb|CAC84711.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=229

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 146/191 (76%), Gaps = 12/191 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQI---HASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRN  811
            F ET   VDLKL LSSK+  I   H     + N    D  KPPAKAQVVGWPPVRS+R+N
Sbjct  39   FSET---VDLKLNLSSKEGGIDPNHEKTRREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  810  ILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFG  643
            +LA    + S  ++ ++K     A  VKVSMDGAPYLRKVDL+MYK+Y +LSDAL KMF 
Sbjct  96   MLAV--QKSSTDQESTNKVPGGNATFVKVSMDGAPYLRKVDLNMYKTYHELSDALGKMFS  153

Query  642  SFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLR  463
            SFTIGNC + GMKDF+NESKL+++LN +DYVP+YEDKDGDWMLVGDVPW+MFVESCKRLR
Sbjct  154  SFTIGNCGSHGMKDFLNESKLIDLLNGTDYVPSYEDKDGDWMLVGDVPWDMFVESCKRLR  213

Query  462  IMKGTEAIGLA  430
            IMKGTEA GL 
Sbjct  214  IMKGTEATGLG  224



>gb|EPS64756.1| hypothetical protein M569_10024, partial [Genlisea aurea]
Length=214

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 150/196 (77%), Gaps = 12/196 (6%)
 Frame = -1

Query  966  QHVDLKLKLSSKDSQIHASD-----HNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            Q VDLKLKL S  S +   +      +K +     ++KPP+KAQVVGWPPVRS+R+N++ 
Sbjct  23   QTVDLKLKLQSDQSDLEEENLTTPSSDKPHLPPKHLSKPPSKAQVVGWPPVRSFRKNVIC  82

Query  801  ANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTI--G  628
              N + S  E+ +      VKVSMDGAPYLRKVDL  Y SYQ LSDALAKMF SFT+  G
Sbjct  83   --NRKSSSVEEST---GSYVKVSMDGAPYLRKVDLKTYGSYQQLSDALAKMFSSFTMNEG  137

Query  627  NCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGT  448
            N   +GM DFMNESK+M++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKG+
Sbjct  138  NYGVEGMIDFMNESKVMHLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVCSCKRLRIMKGS  197

Query  447  EAIGLAPRAMEKCKNR  400
            EAIGLAPRAMEKCK+R
Sbjct  198  EAIGLAPRAMEKCKSR  213



>gb|EYU33008.1| hypothetical protein MIMGU_mgv1a012321mg [Erythranthe guttata]
Length=254

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 156/216 (72%), Gaps = 29/216 (13%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKA-------NNKDADVTKP-----------PAK  856
            F ET   VDLKL L S DS   ++D N         NN  A+ T             PAK
Sbjct  45   FSET---VDLKLNLQSNDSA--STDLNNGGGGGAMKNNNSAEKTAANMVPPKDPVKPPAK  99

Query  855  AQVVGWPPVRSYRRNILAANNHQKSGGED----GSDKAAVLVKVSMDGAPYLRKVDLSMY  688
            AQVVGWPPVRS+R+NI+ +  HQK+   D    G   AA  VKVSMDGAPYLRKVDL MY
Sbjct  100  AQVVGWPPVRSFRKNIVMS--HQKNSSSDEEAGGGGAAAAFVKVSMDGAPYLRKVDLKMY  157

Query  687  KSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVG  508
            KSYQ+ SDALAKMF SFT+G   ++GM DFMNE KLM+VLN+++YVPTYEDKDGDWMLVG
Sbjct  158  KSYQEFSDALAKMFSSFTMGKYGSEGMIDFMNERKLMDVLNSTEYVPTYEDKDGDWMLVG  217

Query  507  DVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNR  400
            DVPWEMFV SCKRLRIMKG+EAIGLAPRAMEKCK+R
Sbjct  218  DVPWEMFVNSCKRLRIMKGSEAIGLAPRAMEKCKSR  253



>gb|ACU19136.1| unknown [Glycine max]
Length=243

 Score =   248 bits (634),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 131/159 (82%), Gaps = 5/159 (3%)
 Frame = -1

Query  858  KAQVVGWPPVRSYRRNILAANNHQK-----SGGEDGSDKAAVLVKVSMDGAPYLRKVDLS  694
            KAQVVGWPPVRS+R+NI+  +N+ +     +   +  +  A  VKVSMDGAPYLRKVDL 
Sbjct  85   KAQVVGWPPVRSFRKNIVQRSNNNEGEKAATSSSNNVNTGAAFVKVSMDGAPYLRKVDLK  144

Query  693  MYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWML  514
            +YKSYQ+L DALAKMF SFTI  C +QGMKDFMNESKL++  N SDYVPTYEDKD DWML
Sbjct  145  LYKSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDFFNGSDYVPTYEDKDADWML  204

Query  513  VGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            VGDVPWEMFVESCKRLRIMKG EAIGLAPRA+EKCKNRS
Sbjct  205  VGDVPWEMFVESCKRLRIMKGFEAIGLAPRAVEKCKNRS  243



>ref|XP_004142529.1| PREDICTED: auxin-responsive protein IAA16-like [Cucumis sativus]
 ref|XP_004170021.1| PREDICTED: auxin-responsive protein IAA16-like [Cucumis sativus]
 gb|KGN66786.1| hypothetical protein Csa_1G690240 [Cucumis sativus]
Length=236

 Score =   248 bits (633),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 152/209 (73%), Gaps = 19/209 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIH-ASDHNKAN---NKDADVTKPPAKAQVVGWPPVRSYRR  814
            F ET   VDLKL + +  +Q +  +D N  +   NKD     PPAKAQVVGWPPV+S RR
Sbjct  33   FTET---VDLKLNIVTDSNQGNKTTDKNVVSSFVNKDLP-KPPPAKAQVVGWPPVKSLRR  88

Query  813  NILAANNHQK----------SGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSD  664
            NI+      K          SGG   S  AA  +KVSMDGAPYLRKVDL MY SYQ+LSD
Sbjct  89   NIVGPPKKNKLEETEKNAVISGG-GCSVGAAAFIKVSMDGAPYLRKVDLKMYGSYQELSD  147

Query  663  ALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFV  484
            AL KMF SFT G C AQ M+D+MNE KL++V N SDYVPTYEDKDGDWMLVGDVPW+MFV
Sbjct  148  ALRKMFASFTAGQCGAQKMRDYMNERKLIDVSNGSDYVPTYEDKDGDWMLVGDVPWDMFV  207

Query  483  ESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            +SCKRLRIMKG+EAIGLAPRA+EKCKNR+
Sbjct  208  DSCKRLRIMKGSEAIGLAPRALEKCKNRN  236



>gb|ABM53874.1| IAA6 [Cestrum elegans]
Length=153

 Score =   245 bits (625),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 132/152 (87%), Gaps = 2/152 (1%)
 Frame = -1

Query  849  VVGWPPVRSYRRNILA--ANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQ  676
            VVGWPPVRS+R+N++A  +N  Q++     +  AA  VKV MDGAPYLRKVDL MYKSY+
Sbjct  1    VVGWPPVRSFRKNVMAQKSNTDQENEKNSITTAAAAFVKVCMDGAPYLRKVDLKMYKSYK  60

Query  675  DLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPW  496
             LSDALAKMF SFT+GN  AQGM DFMNESKLM++LNTS+YVP+YEDKDGDWMLVGDVPW
Sbjct  61   QLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNTSEYVPSYEDKDGDWMLVGDVPW  120

Query  495  EMFVESCKRLRIMKGTEAIGLAPRAMEKCKNR  400
            EMFV+SCKRLRIMKG+EAIGLAPRAMEKCK+R
Sbjct  121  EMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  152



>ref|XP_004963100.1| PREDICTED: auxin-responsive protein IAA30-like [Setaria italica]
Length=264

 Score =   249 bits (635),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 139/168 (83%), Gaps = 11/168 (7%)
 Frame = -1

Query  870  KPPA-KAQVVGWPPVRSYRRNILAANNHQKSGGEDGSDK---------AAVLVKVSMDGA  721
            KP A KAQVVGWPPVRS+R+NI++  + + +G +D +D           A  VKVS+DGA
Sbjct  98   KPRAPKAQVVGWPPVRSFRKNIMSVQSEKGAGSKDATDGDKSSPAASGGAAFVKVSLDGA  157

Query  720  PYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTY  541
            PYLRKVDL MYKSYQ+LS AL KMF SFTIG+C +QGM + MNESKL+++LN S+YVPTY
Sbjct  158  PYLRKVDLKMYKSYQELSKALEKMFSSFTIGSCGSQGM-NGMNESKLVDLLNGSEYVPTY  216

Query  540  EDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            EDKDGDWMLVGDVPWEMFVESCKRLRIMKG+EAIGLAPRAMEKCKNRS
Sbjct  217  EDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  264



>ref|XP_003579189.1| PREDICTED: auxin-responsive protein IAA30-like [Brachypodium 
distachyon]
Length=249

 Score =   248 bits (633),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 133/159 (84%), Gaps = 9/159 (6%)
 Frame = -1

Query  870  KPPA-KAQVVGWPPVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLS  694
            KP A KAQVVGWPPVRS+R+NIL A           S   A  VKVSMDGAPYLRKVDL+
Sbjct  99   KPRAPKAQVVGWPPVRSFRKNILQAEKSS-------SSSPAAFVKVSMDGAPYLRKVDLN  151

Query  693  MYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWML  514
            MYK+YQDLS AL KMF SFTIGNC +QGM + MNESKLM++LN S+YVPTYEDKDGDWML
Sbjct  152  MYKTYQDLSMALHKMFSSFTIGNCGSQGM-NGMNESKLMDLLNGSEYVPTYEDKDGDWML  210

Query  513  VGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            VGDVPWEMFVESCKRLRIMKG+EAIGLAPRAMEKCKNRS
Sbjct  211  VGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  249



>emb|CDY62130.1| BnaC08g47390D [Brassica napus]
Length=233

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 151/197 (77%), Gaps = 15/197 (8%)
 Frame = -1

Query  960  VDLKLKLSSK-----DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAAN  796
            V+LKL L S      D  +  +   K  +KD   +KPPAKAQVVGWPPVR+YR++++   
Sbjct  41   VELKLGLHSTKQGSVDLNVAGAPKEKTLHKDP--SKPPAKAQVVGWPPVRNYRKSVM---  95

Query  795  NHQKSGG--EDGSDKAA---VLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTI  631
             HQK     E  SD+       VKVSMDGAPYLRKVDL MY SY++LSDALAKMF SFT+
Sbjct  96   THQKCSEVEEASSDRGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKELSDALAKMFSSFTM  155

Query  630  GNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG  451
            G+  AQGM DFMNESK+M+++N+S+YVP+YEDKDGDWMLVGDVPW MF+ESCKRLRIMKG
Sbjct  156  GSYGAQGMIDFMNESKVMDLVNSSEYVPSYEDKDGDWMLVGDVPWPMFIESCKRLRIMKG  215

Query  450  TEAIGLAPRAMEKCKNR  400
            +EAIGLAPRAMEK KNR
Sbjct  216  SEAIGLAPRAMEKYKNR  232



>gb|ABM53872.1| IAA4 [Cestrum elegans]
Length=149

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 127/151 (84%), Gaps = 2/151 (1%)
 Frame = -1

Query  849  VVGWPPVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDL  670
            VVGWPPVRS+R+N+  +   + S GE     AA  VKVS+DGAPYLRKVDL MYKSYQ L
Sbjct  1    VVGWPPVRSFRKNV--STVQRSSTGEISGTGAAAFVKVSVDGAPYLRKVDLKMYKSYQQL  58

Query  669  SDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEM  490
            SDAL KMF SFTI NC  QG KDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPW M
Sbjct  59   SDALGKMFSSFTIENCGTQGFKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWGM  118

Query  489  FVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            FV+SCKRLRIMKG+EAIGLAPRA+EKCKNRS
Sbjct  119  FVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  149



>gb|ABI36493.1| AUX/IAA16 A [Malus domestica]
Length=149

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  843  GWPPVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSD  664
            GWPPVRS+R+NIL    +    GE+ +  +A  VKVSMDGAPYLRKVDL +YKSYQ+LS 
Sbjct  1    GWPPVRSFRKNILTVQKNSSEEGENTNSISAAFVKVSMDGAPYLRKVDLKLYKSYQELST  60

Query  663  ALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFV  484
            AL+KMF SFTIGNC +QGMKDFMNESKL+++L+ S+YVP+YEDKDGDWMLVGDVPWEMFV
Sbjct  61   ALSKMFSSFTIGNCGSQGMKDFMNESKLIDLLSGSEYVPSYEDKDGDWMLVGDVPWEMFV  120

Query  483  ESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
             SCKRLRIMKG+EAIGLAPRA+EK KNRS
Sbjct  121  NSCKRLRIMKGSEAIGLAPRAVEKYKNRS  149



>ref|XP_002443496.1| hypothetical protein SORBIDRAFT_08g020580 [Sorghum bicolor]
 gb|EES17334.1| hypothetical protein SORBIDRAFT_08g020580 [Sorghum bicolor]
Length=281

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 140/168 (83%), Gaps = 11/168 (7%)
 Frame = -1

Query  870  KPPA-KAQVVGWPPVRSYRRNILAANNHQKSGGEDGSDKAA---------VLVKVSMDGA  721
            KP A KAQVVGWPPVRS+R+NI++  + + +GG   +DK++           VKVS+DGA
Sbjct  115  KPRAPKAQVVGWPPVRSFRKNIMSVQSDKGAGGSKDADKSSPAAAAGGGAAFVKVSLDGA  174

Query  720  PYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTY  541
            PYLRKVDL MYKSYQ+LS AL KMF SFTIG+C +QGM + MNESKL+++LN S+YVPTY
Sbjct  175  PYLRKVDLKMYKSYQELSKALEKMFSSFTIGSCGSQGM-NGMNESKLVDLLNGSEYVPTY  233

Query  540  EDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            EDKDGDWMLVGDVPWEMFVESCKRLRIMKG+EAIGLAPRAMEKCKNRS
Sbjct  234  EDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  281



>ref|XP_008455985.1| PREDICTED: auxin-responsive protein IAA16 isoform X1 [Cucumis 
melo]
Length=236

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 147/193 (76%), Gaps = 10/193 (5%)
 Frame = -1

Query  966  QHVDLKLKLSS-----KDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            + VDLKL L+S     K+   +  +    + +  D  KPP+K QVVGWPPVRS R+N L 
Sbjct  46   ETVDLKLNLASSMASAKEEGTNLEEIKSCSQQPNDFAKPPSKTQVVGWPPVRSSRKN-LG  104

Query  801  ANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNC  622
             ++ +K G E G       VKVSMDGAPYLRKVDL +Y SY+DLS ALAKMF SFTIG C
Sbjct  105  VSSSRKGGDEGG----GSFVKVSMDGAPYLRKVDLKLYGSYKDLSHALAKMFSSFTIGKC  160

Query  621  EAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEA  442
            E++GMKDFMNESK +++LN S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMK ++A
Sbjct  161  ESEGMKDFMNESKSVDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKESDA  220

Query  441  IGLAPRAMEKCKN  403
            IGLAPR+MEK KN
Sbjct  221  IGLAPRSMEKQKN  233



>gb|KHN30563.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=233

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 147/193 (76%), Gaps = 15/193 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSK-DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL  805
            F ET   VDLKL L +K D   +  + +K      D  KPPAKAQVVGWPPVRSYR+N++
Sbjct  39   FSET---VDLKLNLQTKEDLNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMM  95

Query  804  AANNHQKSGGEDGSDK--------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKM  649
            A    QK   E+ ++K        +   VKVSMDGAPYLRKVDL+MYKSY+DLSDALAKM
Sbjct  96   AV---QKVSTEEVAEKTTSSTTANSGAFVKVSMDGAPYLRKVDLTMYKSYKDLSDALAKM  152

Query  648  FGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR  469
            F SFT+GN  AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMFV SCKR
Sbjct  153  FSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVGSCKR  212

Query  468  LRIMKGTEAIGLA  430
            LRIMKG+EAIGL 
Sbjct  213  LRIMKGSEAIGLG  225



>ref|XP_004982377.1| PREDICTED: auxin-responsive protein IAA30-like isoform X2 [Setaria 
italica]
Length=266

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 144/185 (78%), Gaps = 9/185 (5%)
 Frame = -1

Query  948  LKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQKSGGE-  772
            +K S   S +  +D       DAD  + P KAQ VGWPPVRS+R+NIL+  + QK GG+ 
Sbjct  86   MKRSPSQSSVVTTDAQP----DADKPRAP-KAQAVGWPPVRSFRKNILSVQSCQKGGGDM  140

Query  771  -DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCE-AQGMKDF  598
             DG   AA  VKVSMDGAPYLRKVDL MY SYQ+LS AL KMF SFTIG+C  +QGMK  
Sbjct  141  DDGKSGAAAFVKVSMDGAPYLRKVDLRMYGSYQELSKALEKMFSSFTIGSCGGSQGMKG-  199

Query  597  MNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAM  418
            MNE+KL ++L+ S+YVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG+EA+GLAPRAM
Sbjct  200  MNETKLADLLSGSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAM  259

Query  417  EKCKN  403
            EKCKN
Sbjct  260  EKCKN  264



>emb|CDY10694.1| BnaA05g16680D [Brassica napus]
Length=174

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 136/165 (82%), Gaps = 13/165 (8%)
 Frame = -1

Query  858  KAQVVGWPPVRSYRRNILAANNHQKSGGEDGSDK----------AAVLVKVSMDGAPYLR  709
            +AQVVGWPPVR+YR+NI+     + SG E+ S +           A LVKVSMDGAPYLR
Sbjct  12   RAQVVGWPPVRNYRKNII--TQQKTSGKEEASSEKAGNSGGGASGAALVKVSMDGAPYLR  69

Query  708  KVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKD  529
            KVDL MYKSY+D SDALAKMF SFT+G   AQGM DFMNESKLM++LN+S+YVP+YEDKD
Sbjct  70   KVDLKMYKSYKDFSDALAKMFSSFTMGKYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKD  129

Query  528  GDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEK-CKNRS  397
            GDWMLVGDVPWEMFV+SCKRLRIMKG+EAIGLAPRAMEK CKNRS
Sbjct  130  GDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKYCKNRS  174



>gb|EPS60474.1| hypothetical protein M569_14329, partial [Genlisea aurea]
Length=212

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 142/187 (76%), Gaps = 11/187 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNK-DADVTKPPAKAQVVGWPPVRSYRRNIL  805
            F ET   VDLKL L++K+  +      K N +  AD +KPP KAQVVGWPPVR++RRN +
Sbjct  33   FAET---VDLKLNLAAKEMNLDKEKEKKKNLQISADSSKPPMKAQVVGWPPVRAFRRNAI  89

Query  804  AANNHQKSGGEDGSDKAA---VLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFT  634
             +        E+ ++KA+    LVKVSMDGAPYLRK+DL MYK+YQ LSDALAKMF SFT
Sbjct  90   CSQKKSTEPAEE-TEKASPSPALVKVSMDGAPYLRKIDLKMYKTYQQLSDALAKMFSSFT  148

Query  633  IGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMK  454
            IG CE+QGM DFMNESKL   LNTSDYVPTYED+DGDWMLVGDVPWEMFVE+CKRLRIMK
Sbjct  149  IGKCESQGMLDFMNESKL---LNTSDYVPTYEDRDGDWMLVGDVPWEMFVETCKRLRIMK  205

Query  453  GTEAIGL  433
              EA GL
Sbjct  206  SVEAKGL  212



>ref|XP_007201399.1| hypothetical protein PRUPE_ppa010342mg [Prunus persica]
 gb|EMJ02598.1| hypothetical protein PRUPE_ppa010342mg [Prunus persica]
Length=247

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 147/203 (72%), Gaps = 21/203 (10%)
 Frame = -1

Query  960  VDLKLKLSSKDSQ--------IHASDHNKANNKD---ADVTKPPAKAQVVGWPPVRSYRR  814
            VDLKL LS+   Q           S  NK N  D   AD  KPPAKAQVVGWPPVRS+R+
Sbjct  51   VDLKLNLSNSKEQAITTGKDVTEKSKTNKDNKLDLPAADPAKPPAKAQVVGWPPVRSFRK  110

Query  813  NILAANNHQKSGGED----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            N+  A     S  E     GS  A  LVKVSMDGAPYLRKVDL MYKSY +LSDALAKMF
Sbjct  111  NMFTALQKSPSDKESEHNKGSSNAVTLVKVSMDGAPYLRKVDLKMYKSYPELSDALAKMF  170

Query  645  GSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  466
             SF IG      MKDFMNESKLM+VL  SDY+PTYEDKDGDWMLVGDVPWEMFVESCKRL
Sbjct  171  SSFAIG------MKDFMNESKLMDVLKGSDYIPTYEDKDGDWMLVGDVPWEMFVESCKRL  224

Query  465  RIMKGTEAIGLAPRAMEKCKNRS  397
            RIMKG EA+GLAPRAMEKCKNRS
Sbjct  225  RIMKGKEAVGLAPRAMEKCKNRS  247



>gb|ADL70671.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=167

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 132/167 (79%), Gaps = 15/167 (9%)
 Frame = -1

Query  852  QVVGWPPVRSYRRNILAANNHQKSGGEDGSDK---------------AAVLVKVSMDGAP  718
            QVVGWPPVRS+R+N+++          +G+DK                   VKVSMDGAP
Sbjct  1    QVVGWPPVRSFRKNVMSGQKPTTGDATEGNDKTSGSSGATSSASACATVAYVKVSMDGAP  60

Query  717  YLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYE  538
            YLRK+DL +YK+YQDLS+AL+KMF SFTIGN   QGMKDFMNESKL+++LN SDYVPTYE
Sbjct  61   YLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYE  120

Query  537  DKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            DKDGDWMLVGDVPWEMFV+SCKR+RIMKG+EAIGLAPRA+EKCKNRS
Sbjct  121  DKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  167



>ref|XP_009413916.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=244

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 157/211 (74%), Gaps = 19/211 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSS----KDSQIHASDHNKANNKD--------ADVTKPPA-KAQVVG  841
            F ET   VDLKL+L +    K++   A+      +          +D  KP A KAQVVG
Sbjct  37   FAET---VDLKLQLQTPVDVKEAVAEAASEKVKRSVSQKSLVSCGSDPEKPSAPKAQVVG  93

Query  840  WPPVRSYRRNILAANNHQKSGGE-DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSD  664
            WPPVRS+R+NIL+ N+ + S  E + S  +A  VKVSMDGAPYLRKVDL MY+SYQ+L  
Sbjct  94   WPPVRSFRKNILSVNSEKGSKEEGEKSSISAAFVKVSMDGAPYLRKVDLKMYRSYQELFM  153

Query  663  ALAKMFGSFTIGNCEAQGM--KDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEM  490
            AL KMF SFT GN  +QG+  +DFMNESK+M++LN S+YVPTYEDKDGDWMLVGDVPWEM
Sbjct  154  ALQKMFISFTGGNYGSQGLSGRDFMNESKVMDLLNGSEYVPTYEDKDGDWMLVGDVPWEM  213

Query  489  FVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            FV+SCKRLRIMKG+EAIGLAP+AMEKCKNRS
Sbjct  214  FVDSCKRLRIMKGSEAIGLAPKAMEKCKNRS  244



>ref|XP_003554705.1| PREDICTED: auxin-responsive protein IAA16-like isoform 1 [Glycine 
max]
 gb|KHN43187.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=230

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 149/205 (73%), Gaps = 26/205 (13%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            F +T   VDLKL LSS             +N      KPPAKAQVVGWPPVRS+R+NI+ 
Sbjct  42   FSDTS--VDLKLNLSS------------TSNNAPPPAKPPAKAQVVGWPPVRSFRKNIV-  86

Query  801  ANNHQKSGGEDGSDKA----------AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAK  652
             NN Q+S   DG   A          A  VKVSMDGAPYLRKVDL MYKS+Q+L DALAK
Sbjct  87   -NNVQRSNNNDGEKAATSSSNNVNMGAAFVKVSMDGAPYLRKVDLKMYKSHQELLDALAK  145

Query  651  MFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            MF SFTI  C +QGMKDFMNE KL+++LN SDYVPT EDKDGDWMLVGDVPWE+ VESCK
Sbjct  146  MFSSFTIDKCSSQGMKDFMNEGKLIDLLNGSDYVPTCEDKDGDWMLVGDVPWEILVESCK  205

Query  471  RLRIMKGTEAIGLAPRAMEKCKNRS  397
            RLRIMKG+ AIGLAPRA++KCKNRS
Sbjct  206  RLRIMKGSAAIGLAPRAVQKCKNRS  230



>emb|CDP06818.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 153/197 (78%), Gaps = 5/197 (3%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            F ET   VDLKL L+SK+SQ    + + A +  +  +KPPAK QVVGWPPVRS+R+NIL+
Sbjct  52   FSET---VDLKLNLASKNSQADEEEKSVAASSSSSPSKPPAKTQVVGWPPVRSFRKNILS  108

Query  801  ANNHQKSGGEDGS--DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIG  628
               +  +  E       AA  VKVS+DGAPYLRKVDL  +KSYQ+LS AL+KMF S TIG
Sbjct  109  VQKNSNTEAEKSGTGSAAAAFVKVSVDGAPYLRKVDLKNFKSYQELSQALSKMFSSSTIG  168

Query  627  NCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGT  448
            +  +Q  KDFMNE KL+++LN S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG+
Sbjct  169  SYGSQEFKDFMNERKLIDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGS  228

Query  447  EAIGLAPRAMEKCKNRS  397
            EA+GLAPRA+EKCKNRS
Sbjct  229  EAVGLAPRAVEKCKNRS  245



>ref|XP_006408158.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49611.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=223

 Score =   243 bits (619),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 145/197 (74%), Gaps = 18/197 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL-  805
            F ET   VDLKL LSS  + + +       N    V KPPAK QVVGWPPVRS+R+N++ 
Sbjct  32   FSET---VDLKLNLSS--TALDSVSEVDIQNLKEKVVKPPAKTQVVGWPPVRSFRKNVMS  86

Query  804  --------AANNHQKSGGEDGS----DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  661
                    AA   +K+ G  G+    + A   VKVSMDGAPYLRK+DL +YK+YQDLSDA
Sbjct  87   GQKQTTEVAAEGTEKTCGSSGATSSANAAVAYVKVSMDGAPYLRKIDLKLYKTYQDLSDA  146

Query  660  LAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVE  481
            L+KMF SFTIGN   QGMKDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPW+MFV+
Sbjct  147  LSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWKMFVD  206

Query  480  SCKRLRIMKGTEAIGLA  430
            SCKR+RIMKG+EAIGL 
Sbjct  207  SCKRIRIMKGSEAIGLG  223



>ref|XP_006304183.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
 gb|EOA37081.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
Length=224

 Score =   243 bits (619),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 149/199 (75%), Gaps = 12/199 (6%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHAS---DHNKANNKDADVTKPPAKAQVVGWPPVRSYRRN  811
            F ET   VDLKL L+++      S   D  + ++   D  KPPAKAQVVGWPPVRSYR+N
Sbjct  34   FSET---VDLKLNLNNEPENKEGSTTLDSKEKSSCSKDPAKPPAKAQVVGWPPVRSYRKN  90

Query  810  ILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTI  631
            ++ +     SG E     AA  VKVSMDGAPYLRKVDL MYKSY +LS AL+ MF SFT+
Sbjct  91   VMVSCQKASSGPE-----AAAFVKVSMDGAPYLRKVDLRMYKSYDELSTALSNMFSSFTM  145

Query  630  GNCEAQ-GMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMK  454
            G    + GM DFMNE KLM+++N+ DYVP+YEDKDGDWMLVGDVPW MFV++CKRLR+MK
Sbjct  146  GKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMK  205

Query  453  GTEAIGLAPRAMEKCKNRS  397
            G++AIGLAPRAMEKCK+R+
Sbjct  206  GSDAIGLAPRAMEKCKSRA  224



>emb|CDX89832.1| BnaA10g02500D [Brassica napus]
Length=224

 Score =   242 bits (617),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 153/204 (75%), Gaps = 17/204 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLS--------SKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVR  826
            F ET   VDLKL L+        SK   +  S   + N    D TKPPAKAQVVGWPPVR
Sbjct  29   FSET---VDLKLNLNNEPESKEVSKTHDVVISVSKEKNTCPKDPTKPPAKAQVVGWPPVR  85

Query  825  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            SYR+N++ +   QKS   +G  + AV VKVSMDGAPYLRKVDL MYKSY +LS+AL+ MF
Sbjct  86   SYRKNVMGS--CQKS---NGVTETAVFVKVSMDGAPYLRKVDLKMYKSYDELSNALSNMF  140

Query  645  GSFTIG-NCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR  469
            GSFT+G N   +GM DFMNE K+ +++N+ DYVP+YEDKDGDWMLVGDVPW MFV++CKR
Sbjct  141  GSFTMGKNGGEEGMIDFMNERKVRDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKR  200

Query  468  LRIMKGTEAIGLAPRAMEKCKNRS  397
            LR+MKG++AIGLAPRAM KCK+R+
Sbjct  201  LRLMKGSDAIGLAPRAMGKCKSRT  224



>gb|ADL70672.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
 gb|ADL70675.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=166

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 131/166 (79%), Gaps = 15/166 (9%)
 Frame = -1

Query  852  QVVGWPPVRSYRRNILAANNHQKSGGEDGSDK---------------AAVLVKVSMDGAP  718
            QVVGWPPVRS+R+N+++          +G+DK                   VKVSMDGAP
Sbjct  1    QVVGWPPVRSFRKNVMSGQKPTTGDATEGNDKTSGSSGATSSASACATVAYVKVSMDGAP  60

Query  717  YLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYE  538
            YLRK+DL +YK+YQDLS+AL+KMF SFTIGN   QGMKDFMNESKL+++LN SDYVPTYE
Sbjct  61   YLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYE  120

Query  537  DKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNR  400
            DKDGDWMLVGDVPWEMFV+SCKR+RIMKG+EAIGLAPRA+EKCKNR
Sbjct  121  DKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  166



>ref|NP_001237212.1| uncharacterized protein LOC100499872 [Glycine max]
 gb|ACU13989.1| unknown [Glycine max]
Length=228

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 149/207 (72%), Gaps = 32/207 (15%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSS------------------KDSQIHASDHNKANNKDADVTKPPAK  856
            F ET   VDLKL LSS                  K+++   ++   AN    D  KPPAK
Sbjct  29   FSETA-SVDLKLNLSSCINDSASDSPSSVSTEKPKENKTTTAEPPPAN----DPAKPPAK  83

Query  855  AQVVGWPPVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQ  676
            AQVVGWPPVRS+R+NI+  N++++    + S K A  VKVSMDGAPYLRKVD+ +YKSYQ
Sbjct  84   AQVVGWPPVRSFRKNIVQRNSNEEEA--EKSTKNA-FVKVSMDGAPYLRKVDIKLYKSYQ  140

Query  675  DLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPW  496
            +LSDALAKMF SFTI  C +QGMKDFMNE+      N SDYVPTYEDKDGDWMLVGDVPW
Sbjct  141  ELSDALAKMFSSFTIEKCGSQGMKDFMNET------NGSDYVPTYEDKDGDWMLVGDVPW  194

Query  495  EMFVESCKRLRIMKGTEAIGLAPRAME  415
            EMFVESCKRLRIMKG+EAIGLAPRA+E
Sbjct  195  EMFVESCKRLRIMKGSEAIGLAPRAVE  221



>ref|XP_004982376.1| PREDICTED: auxin-responsive protein IAA30-like isoform X1 [Setaria 
italica]
Length=267

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 144/186 (77%), Gaps = 10/186 (5%)
 Frame = -1

Query  948  LKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQKSGGE-  772
            +K S   S +  +D       DAD  + P KAQ VGWPPVRS+R+NIL+  + QK GG+ 
Sbjct  86   MKRSPSQSSVVTTDAQP----DADKPRAP-KAQAVGWPPVRSFRKNILSVQSCQKGGGDM  140

Query  771  -DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTI-GNCE-AQGMKD  601
             DG   AA  VKVSMDGAPYLRKVDL MY SYQ+LS AL KMF SFTI G+C  +QGMK 
Sbjct  141  DDGKSGAAAFVKVSMDGAPYLRKVDLRMYGSYQELSKALEKMFSSFTIAGSCGGSQGMKG  200

Query  600  FMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRA  421
             MNE+KL ++L+ S+YVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG+EA+GLAPRA
Sbjct  201  -MNETKLADLLSGSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRA  259

Query  420  MEKCKN  403
            MEKCKN
Sbjct  260  MEKCKN  265



>gb|ACF88333.1| unknown [Zea mays]
 tpg|DAA55066.1| TPA: IAA30-auxin-responsive Aux/IAA family member [Zea mays]
Length=271

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 133/161 (83%), Gaps = 7/161 (4%)
 Frame = -1

Query  861  AKAQVVGWPPVRSYRRNILAANNHQKSGGEDG------SDKAAVLVKVSMDGAPYLRKVD  700
            AKAQVVGWPPVRS+R+NI++  + + +   +G      +   A  VKVS+DGAPYLRKVD
Sbjct  112  AKAQVVGWPPVRSFRKNIMSVQSDKGAAAANGDKSSPAAGGGAAFVKVSLDGAPYLRKVD  171

Query  699  LSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDW  520
            L MY+SYQ LS AL  MF SFTIG+C +QGM + MNESKL+++LN S+YVPTYEDKDGDW
Sbjct  172  LKMYRSYQQLSKALENMFSSFTIGSCGSQGM-NGMNESKLVDLLNGSEYVPTYEDKDGDW  230

Query  519  MLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            MLVGDVPWEMFVESCKRLRIMKG+EAIGLAPRAMEKCKNRS
Sbjct  231  MLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  271



>ref|XP_010483317.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=229

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 149/204 (73%), Gaps = 17/204 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--------DVTKPPAKAQVVGWPPVR  826
            F ET   VDLKL L+++      S  +     D+        D  KPPAKAQVVGWPPVR
Sbjct  34   FSET---VDLKLNLNNEPENKEGSTTHGVVTFDSKDKSSCPKDPAKPPAKAQVVGWPPVR  90

Query  825  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            SYR+N++ +     SG E     AA  VKVSMDGAPYLRKVDL MYKSY +LS+AL+ MF
Sbjct  91   SYRKNVMVSCQKSSSGPE-----AAAFVKVSMDGAPYLRKVDLRMYKSYDELSNALSNMF  145

Query  645  GSFTIGNCEAQ-GMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR  469
             SFT+G    + GM DFMNE KLM+++N+ DYVP+YEDKDGDWMLVGDVPW MFV++CKR
Sbjct  146  SSFTLGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKR  205

Query  468  LRIMKGTEAIGLAPRAMEKCKNRS  397
            LR+MKG++AIGLAPRAMEKCK+R+
Sbjct  206  LRLMKGSDAIGLAPRAMEKCKSRA  229



>ref|XP_010457463.1| PREDICTED: auxin-responsive protein IAA17 [Camelina sativa]
Length=229

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 149/204 (73%), Gaps = 17/204 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--------DVTKPPAKAQVVGWPPVR  826
            F ET   VDLKL L+++      S  +     D+        D  KPPAKAQVVGWPPVR
Sbjct  34   FSET---VDLKLNLNNEPENKEGSTTHGVVTFDSKDKSSCPKDPAKPPAKAQVVGWPPVR  90

Query  825  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            SYR+N++ +     SG E     AA  VKVSMDGAPYLRKVDL MYKSY +LS+AL+ MF
Sbjct  91   SYRKNVMVSCQKSSSGPE-----AAAFVKVSMDGAPYLRKVDLRMYKSYDELSNALSNMF  145

Query  645  GSFTIGNCEAQ-GMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR  469
             SFT+G    + GM DFMNE KLM+++N+ DYVP+YEDKDGDWMLVGDVPW MFV++CKR
Sbjct  146  SSFTMGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKR  205

Query  468  LRIMKGTEAIGLAPRAMEKCKNRS  397
            LR+MKG++AIGLAPRAMEKCK+R+
Sbjct  206  LRLMKGSDAIGLAPRAMEKCKSRA  229



>ref|XP_010087762.1| Auxin-responsive protein IAA7 [Morus notabilis]
 gb|EXB29843.1| Auxin-responsive protein IAA7 [Morus notabilis]
Length=304

 Score =   243 bits (620),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 145/201 (72%), Gaps = 23/201 (11%)
 Frame = -1

Query  966  QHVDLKLKLSSKDSQIHASDHNKANNKDA--------------DVTKPPAKAQVVGWPPV  829
            + VDLKL L  +  +    D N+ N K                D  KPPAKAQVVGWPPV
Sbjct  49   ETVDLKLNLHRQSVK---EDLNEINIKSTSAPPKEKNLLPCTKDPAKPPAKAQVVGWPPV  105

Query  828  RSYRRNILA---ANNHQKSGGE---DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLS  667
            RSYR+NI+A   + N + S  E     S+ A   VKV MDGAPYLRKVDL MYKSYQ+LS
Sbjct  106  RSYRKNIMAQKMSTNEESSPHEKTSSSSNSAGAFVKVCMDGAPYLRKVDLKMYKSYQELS  165

Query  666  DALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMF  487
            DALAKMF SFT+GN  AQGM DFMNESKLM++LN+S+YVPTYEDKDGDWMLVGDVPWEMF
Sbjct  166  DALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMF  225

Query  486  VESCKRLRIMKGTEAIGLAPR  424
            V+SCKRLRIMKG+EAIGL  R
Sbjct  226  VDSCKRLRIMKGSEAIGLGLR  246



>gb|KGN60808.1| hypothetical protein Csa_2G010920 [Cucumis sativus]
Length=237

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 146/193 (76%), Gaps = 8/193 (4%)
 Frame = -1

Query  966  QHVDLKLKL-----SSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  802
            + VDLKL L     S+K+   +  +   ++ +  D  KPP+KAQVVGWPPVRS R+N+  
Sbjct  45   ETVDLKLNLASSMASTKEEATNLEEIKTSSQQPNDFAKPPSKAQVVGWPPVRSSRKNLGV  104

Query  801  ANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNC  622
             ++ +     D        VKVSMDGAPYLRKVDL +Y SY++LS ALA+MF SFTIG C
Sbjct  105  VSSRKGG---DEGGAGGSFVKVSMDGAPYLRKVDLKLYASYKELSHALAQMFSSFTIGKC  161

Query  621  EAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEA  442
            E++GMKDFMNESK +++LN S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMK ++A
Sbjct  162  ESEGMKDFMNESKSVDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKESDA  221

Query  441  IGLAPRAMEKCKN  403
            IGLAPR+MEK KN
Sbjct  222  IGLAPRSMEKQKN  234



>gb|EEE53551.1| hypothetical protein OsJ_36765 [Oryza sativa Japonica Group]
Length=183

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 135/173 (78%), Gaps = 15/173 (9%)
 Frame = -1

Query  882  ADVTKPPA-KAQVVGWPPVRSYRRNILAANNHQKSGGEDGSDKAAV----------LVKV  736
            AD  KP A KAQVVGWPPVRSYR+NILA    Q   G+D +D               VKV
Sbjct  15   ADPEKPRAPKAQVVGWPPVRSYRKNILAV---QADKGKDAADGGGDKSGAGAAAAAFVKV  71

Query  735  SMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSD  556
            SMDGAPYLRKVDL MYKSY +LS AL KMF SFTIGNC + G+ + MNESK+ ++LN S+
Sbjct  72   SMDGAPYLRKVDLKMYKSYLELSKALEKMFSSFTIGNCGSHGV-NGMNESKIADLLNGSE  130

Query  555  YVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            YVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG+EAIGLAPRAMEKCKNRS
Sbjct  131  YVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  183



>ref|XP_010475075.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=230

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 149/205 (73%), Gaps = 18/205 (9%)
 Frame = -1

Query  981  FEETHQHVDLKLKL---------SSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPV  829
            F ET   VDLKL L         S+    +     +K ++   D  KPPAKAQVVGWPPV
Sbjct  34   FSET---VDLKLNLNNEPENKEGSTTHGVVTFDSKDKISSCPKDPAKPPAKAQVVGWPPV  90

Query  828  RSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKM  649
            RSYR+N++ +     SG E     AA  VKVSMDGAPYLRKVDL MYKSY +LS+AL+ M
Sbjct  91   RSYRKNVMVSCQKPSSGPE-----AAAFVKVSMDGAPYLRKVDLRMYKSYDELSNALSNM  145

Query  648  FGSFTIGNCEAQ-GMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCK  472
            F SFT+G    + GM DFMNE KLM+++N+ DYVP+YEDKDGDWMLVGDVPW MFV++CK
Sbjct  146  FSSFTMGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCK  205

Query  471  RLRIMKGTEAIGLAPRAMEKCKNRS  397
            RLR+MKG++AIGLAPRAMEKCK+R+
Sbjct  206  RLRLMKGSDAIGLAPRAMEKCKSRA  230



>emb|CDY18214.1| BnaC05g02370D [Brassica napus]
Length=224

 Score =   239 bits (611),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 153/204 (75%), Gaps = 17/204 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLS--------SKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVR  826
            F ET   VDLKL L+        SK   +  S   + N    D TKPPAKAQVVGWPPVR
Sbjct  29   FSET---VDLKLNLNNEPESKEVSKTHDVVISVSKQKNKCPKDPTKPPAKAQVVGWPPVR  85

Query  825  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            SYR+N++ +   QKS   +   + AV VKVSMDGAPYLRKVDL MYKSY +LS+AL+ MF
Sbjct  86   SYRKNVMGS--CQKS---NDVTETAVFVKVSMDGAPYLRKVDLKMYKSYDELSNALSNMF  140

Query  645  GSFTIG-NCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR  469
            GSFT+G N   +GM DFMNE ++ +++N+ DYVP+YEDKDGDWMLVGDVPW MFV++CKR
Sbjct  141  GSFTMGKNGGEEGMIDFMNEREVRDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKR  200

Query  468  LRIMKGTEAIGLAPRAMEKCKNRS  397
            LR+MKG++AIGLAPRAMEKCK+R+
Sbjct  201  LRLMKGSDAIGLAPRAMEKCKSRT  224



>gb|ADL70673.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
 gb|ADL70674.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=165

 Score =   237 bits (605),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 130/165 (79%), Gaps = 15/165 (9%)
 Frame = -1

Query  846  VGWPPVRSYRRNILAANNHQKSGGEDGSDK---------------AAVLVKVSMDGAPYL  712
            VGWPPVRS+R+N+++          +G+DK                   VKVSMDGAPYL
Sbjct  1    VGWPPVRSFRKNVMSGQKPTTGDATEGNDKTSGSSGATSSASACATVAYVKVSMDGAPYL  60

Query  711  RKVDLSMYKSYQDLSDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDK  532
            RK+DL +YK+YQDLS+AL+KMF SFTIGN   QGMKDFMNESKL+++LN SDYVPTYEDK
Sbjct  61   RKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDK  120

Query  531  DGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  397
            DGDWMLVGDVPWEMFV+SCKR+RIMKG+EAIGLAPRA+EKCKNRS
Sbjct  121  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  165



>gb|KEH43016.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=243

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 145/200 (73%), Gaps = 19/200 (10%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKD--------SQIHASDHNKANNKDADVTKPP-AKAQVVGWPPV  829
            F ET  +VDLKL LS  +            A +  K     A V+ PP AKAQVVGWPPV
Sbjct  46   FSET-ANVDLKLNLSPINDSASSSSTIASVAENKGKDTTTSATVSPPPRAKAQVVGWPPV  104

Query  828  RSYRRNILAANNHQKSGGEDGSDKA-------AVLVKVSMDGAPYLRKVDLSMYKSYQDL  670
            RS+R+NI+  N HQKS  E   DK+          VKVSMDGAPYLRKVDL +YKSYQ+L
Sbjct  105  RSFRKNIV--NVHQKSNSETEVDKSISGGGGNGAFVKVSMDGAPYLRKVDLKLYKSYQEL  162

Query  669  SDALAKMFGSFTIGNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEM  490
            SDALAKMF SFTI NC +Q  KDFMNESKL+++LN SDYVPTYEDKDGDWMLVGDVPWEM
Sbjct  163  SDALAKMFSSFTIDNCGSQVTKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEM  222

Query  489  FVESCKRLRIMKGTEAIGLA  430
            FV+SCKRLRIMKG+EAIGL 
Sbjct  223  FVQSCKRLRIMKGSEAIGLG  242



>emb|CDY15493.1| BnaA08g27770D [Brassica napus]
Length=229

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 150/204 (74%), Gaps = 17/204 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLS--------SKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVR  826
            F ET   VDLKL L+        SK   + ++   + ++   D TKPPAKAQVVGWPPVR
Sbjct  34   FSET---VDLKLNLNNEPESKEGSKSHDVVSAISKEKSSCTKDPTKPPAKAQVVGWPPVR  90

Query  825  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            SYR+N++ +     S  +      A  VKVSMDGAPYLRK+DL MYKSY +LSDAL+ MF
Sbjct  91   SYRKNVMGSCQKSSSSAD-----TAAFVKVSMDGAPYLRKIDLKMYKSYDELSDALSNMF  145

Query  645  GSFTIG-NCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR  469
             SFT+G N   +GM DFMNE K+M+ +++ DYVP+YEDKDGDWMLVGDVPW MFV++CKR
Sbjct  146  SSFTMGKNGGEEGMIDFMNERKVMDTVSSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKR  205

Query  468  LRIMKGTEAIGLAPRAMEKCKNRS  397
            LR+MKG++AIGLAPRAMEKCK+R+
Sbjct  206  LRLMKGSDAIGLAPRAMEKCKSRA  229



>ref|XP_009119323.1| PREDICTED: auxin-responsive protein IAA17-like [Brassica rapa]
Length=224

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 152/204 (75%), Gaps = 17/204 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLS--------SKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVR  826
            F ET   VDLKL L+        SK   +  S   + N    D TKPPAKAQVVGWPPVR
Sbjct  29   FSET---VDLKLNLNNEPESKEVSKTHDVVISVSKEKNTCPKDPTKPPAKAQVVGWPPVR  85

Query  825  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            SYR+N++ +   QKS   +G  + AV VKVSMDGAPYLRKVDL MYKSY +LS+AL+ MF
Sbjct  86   SYRKNVMGS--CQKS---NGVTETAVFVKVSMDGAPYLRKVDLKMYKSYDELSNALSNMF  140

Query  645  GSFTIG-NCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR  469
            GSFT+G N   +GM DFMNE K+ +++N+ DYVP+YEDKDG WMLVGDVPW MFV++CKR
Sbjct  141  GSFTMGKNGGEEGMIDFMNERKVRDLVNSWDYVPSYEDKDGVWMLVGDVPWPMFVDTCKR  200

Query  468  LRIMKGTEAIGLAPRAMEKCKNRS  397
            LR+MKG++AIGLAPRAM KCK+R+
Sbjct  201  LRLMKGSDAIGLAPRAMGKCKSRT  224



>ref|XP_009111119.1| PREDICTED: auxin-responsive protein IAA17 [Brassica rapa]
Length=229

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 150/204 (74%), Gaps = 17/204 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLS--------SKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVR  826
            F ET   VDLKL L+        SK   + ++   + ++   D TKPPAKAQVVGWPPVR
Sbjct  34   FSET---VDLKLNLNNEPESKEGSKSHDVVSAISKEKSSCPKDPTKPPAKAQVVGWPPVR  90

Query  825  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            SYR+N++ +     S  +      A  VKVSMDGAPYLRK+DL MYKSY +LSDAL+ MF
Sbjct  91   SYRKNVMGSCQKSSSSAD-----TAAFVKVSMDGAPYLRKIDLKMYKSYDELSDALSNMF  145

Query  645  GSFTIG-NCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR  469
             SFT+G N   +GM DFMNE K+M+ +++ DYVP+YEDKDGDWMLVGDVPW MFV++CKR
Sbjct  146  SSFTMGKNGGEEGMIDFMNERKVMDTVSSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKR  205

Query  468  LRIMKGTEAIGLAPRAMEKCKNRS  397
            LR+MKG++AIGLAPRAMEKCK+R+
Sbjct  206  LRLMKGSDAIGLAPRAMEKCKSRA  229



>ref|NP_171921.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 sp|P93830.2|IAA17_ARATH RecName: Full=Auxin-responsive protein IAA17; AltName: Full=Auxin 
response 3; AltName: Full=Indoleacetic acid-induced protein 
17 [Arabidopsis thaliana]
 gb|AAG53997.1|AF336916_1 auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAB84354.1| IAA17 [Arabidopsis thaliana]
 gb|AAC39439.1| IAA17/AXR3 protein [Arabidopsis thaliana]
 gb|AAB70451.2| Identical to Arabidopsis gb|AF040632 and gb|U49073 IAA17/AXR3 
gene. ESTs gb|H36782 and gb|F14074 come from this gene [Arabidopsis 
thaliana]
 gb|AAL49831.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAM51258.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AEE27674.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 gb|AGZ13682.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17]
 gb|AGZ59820.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17-spo5DSR]
Length=229

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 150/204 (74%), Gaps = 17/204 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--------DVTKPPAKAQVVGWPPVR  826
            F ET   VDLKL L+++ +    S  +     D+        D  KPPAKAQVVGWPPVR
Sbjct  34   FSET---VDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVR  90

Query  825  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            SYR+N++ +      G E     AA  VKVSMDGAPYLRK+DL MYKSY +LS+AL+ MF
Sbjct  91   SYRKNVMVSCQKSSGGPE-----AAAFVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMF  145

Query  645  GSFTIG-NCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR  469
             SFT+G +   +GM DFMNE KLM+++N+ DYVP+YEDKDGDWMLVGDVPW MFV++CKR
Sbjct  146  SSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKR  205

Query  468  LRIMKGTEAIGLAPRAMEKCKNRS  397
            LR+MKG++AIGLAPRAMEKCK+R+
Sbjct  206  LRLMKGSDAIGLAPRAMEKCKSRA  229



>gb|ACU19616.1| unknown [Glycine max]
Length=230

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 144/198 (73%), Gaps = 24/198 (12%)
 Frame = -1

Query  960  VDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQKS  781
            VDLKL LSS             +N      KPPAKAQVVGWPPVRS+R+NI+  NN Q+S
Sbjct  47   VDLKLNLSS------------TSNNAPPPAKPPAKAQVVGWPPVRSFRKNIV--NNVQRS  92

Query  780  GGEDGSDKA----------AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMFGSFTI  631
               DG   A          A  VKVSMDGAPYLRKVDL MYKS+Q+L DALAKMF SFTI
Sbjct  93   NNNDGEKAATSSSNNVNMGAAFVKVSMDGAPYLRKVDLKMYKSHQELLDALAKMFSSFTI  152

Query  630  GNCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG  451
              C +QGMKDFMNE KL+++LN SDYVPT EDKDGDWMLVG VPWE+ VESCKRLRIMKG
Sbjct  153  DKCSSQGMKDFMNEGKLIDLLNGSDYVPTCEDKDGDWMLVGVVPWEILVESCKRLRIMKG  212

Query  450  TEAIGLAPRAMEKCKNRS  397
              AIGLAPRA++KCKNRS
Sbjct  213  FAAIGLAPRAVQKCKNRS  230



>gb|AAM64837.1| putative auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
Length=228

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 150/204 (74%), Gaps = 17/204 (8%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--------DVTKPPAKAQVVGWPPVR  826
            F ET   VDLKL L+++ +    S  +     D+        D  KPPAKAQVVGWPPVR
Sbjct  33   FSET---VDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVR  89

Query  825  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDALAKMF  646
            SYR+N++ +      G E     AA  VKVSMDGAPYLRK+DL MYKSY +LS+AL+ MF
Sbjct  90   SYRKNVMVSCQKSSGGPE-----AAAFVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMF  144

Query  645  GSFTIG-NCEAQGMKDFMNESKLMNVLNTSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR  469
             SFT+G +   +GM DFMNE KLM+++N+ DYVP+YEDKDGDWMLVGDVPW MFV++CKR
Sbjct  145  SSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKR  204

Query  468  LRIMKGTEAIGLAPRAMEKCKNRS  397
            LR+MKG++AIGLAPRAMEKCK+R+
Sbjct  205  LRLMKGSDAIGLAPRAMEKCKSRA  228



>gb|AFK43673.1| unknown [Lotus japonicus]
Length=266

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 153/222 (69%), Gaps = 33/222 (15%)
 Frame = -1

Query  981  FEETHQHVDLKLKLSSKDSQIHASDH-----NKANNKDADVT------KPPAKAQVVGWP  835
            F ET  +VDLKL LSS      +S       NK   K A  T      KPPAKAQVVGWP
Sbjct  47   FLETDANVDLKLNLSSDLGSASSSVSSTLPPNKGKEKTAATTQANDPAKPPAKAQVVGWP  106

Query  834  PVRSYRRNILAANNHQKSGGEDGSDKAAV----------------LVKVSMDGAPYLRKV  703
            PVRS+R+NI+   N QKS   +G++K                    VKVSMDGAPYLRKV
Sbjct  107  PVRSFRKNIV---NVQKSNNNEGAEKKVTTTTATTTAGNSAAAAAFVKVSMDGAPYLRKV  163

Query  702  DLSMYKSYQDLSDALAKMFGSFTI--GNCEAQGM-KDFMNESKLMNVLNTSDYVPTYEDK  532
            DL +YKSYQ+LSDAL KMF SFT   G+C +QGM KDFMNESKL+++LN SDYVPTY+DK
Sbjct  164  DLKLYKSYQELSDALGKMFSSFTTINGSCGSQGMMKDFMNESKLIDLLNGSDYVPTYQDK  223

Query  531  DGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPRAMEKCK  406
            DGDWML+GDVPWEMFVESCKRLRIMKG+EAIGLAP+   K +
Sbjct  224  DGDWMLLGDVPWEMFVESCKRLRIMKGSEAIGLAPKGSGKVQ  265



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3225594928680