BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27314_g1_i1 len=2401 path=[2379:0-2400]

Length=2401
                                                                      Score     E

ref|XP_009599111.1|  PREDICTED: subtilisin-like protease                954   0.0      
ref|XP_009776158.1|  PREDICTED: subtilisin-like protease                941   0.0      
ref|XP_009767058.1|  PREDICTED: subtilisin-like protease                939   0.0      
ref|XP_006358961.1|  PREDICTED: subtilisin-like protease-like           939   0.0      
ref|XP_006363697.1|  PREDICTED: subtilisin-like protease-like           927   0.0      
ref|XP_004244591.1|  PREDICTED: subtilisin-like protease                922   0.0      
ref|XP_009608769.1|  PREDICTED: subtilisin-like protease SDD1           916   0.0      
ref|XP_009762964.1|  PREDICTED: subtilisin-like protease SDD1           914   0.0      
ref|XP_004244590.1|  PREDICTED: subtilisin-like protease                913   0.0      
ref|XP_009614060.1|  PREDICTED: subtilisin-like protease SDD1           909   0.0      
ref|NP_001233982.1|  subtilisin-like protease precursor                 908   0.0      
ref|XP_006363698.1|  PREDICTED: subtilisin-like protease-like           907   0.0      
ref|XP_009760953.1|  PREDICTED: subtilisin-like protease                907   0.0      
ref|XP_004245680.1|  PREDICTED: subtilisin-like protease                905   0.0      
ref|XP_006358408.1|  PREDICTED: subtilisin-like protease-like           905   0.0      
ref|XP_009608768.1|  PREDICTED: subtilisin-like protease SDD1           904   0.0      
ref|XP_004244588.1|  PREDICTED: subtilisin-like protease                904   0.0      
emb|CAA07250.1|  serine protease                                        904   0.0      Solanum lycopersicum
ref|XP_009776157.1|  PREDICTED: subtilisin-like protease                903   0.0      
emb|CAA76727.1|  P69D protein                                           903   0.0      Solanum lycopersicum
ref|XP_004244716.2|  PREDICTED: subtilisin-like protease                902   0.0      
ref|XP_006358840.1|  PREDICTED: subtilisin-like protease SDD1-like      901   0.0      
ref|XP_009762965.1|  PREDICTED: subtilisin-like protease SDD1           897   0.0      
ref|XP_006358372.1|  PREDICTED: subtilisin-like protease-like           896   0.0      
ref|XP_004245675.2|  PREDICTED: subtilisin-like protease                894   0.0      
gb|EYU39033.1|  hypothetical protein MIMGU_mgv1a001909mg                894   0.0      
gb|ABG37022.1|  serine protease                                         894   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009614059.1|  PREDICTED: subtilisin-like protease                892   0.0      
ref|XP_006358405.1|  PREDICTED: subtilisin-like protease-like           885   0.0      
emb|CAA06413.1|  P69E protein                                           884   0.0      Solanum lycopersicum
ref|XP_004244715.1|  PREDICTED: subtilisin-like protease                884   0.0      
ref|XP_004245677.2|  PREDICTED: subtilisin-like protease                883   0.0      
emb|CDP09846.1|  unnamed protein product                                880   0.0      
emb|CDP10007.1|  unnamed protein product                                878   0.0      
ref|NP_001234257.1|  subtilisin-like endoprotease precursor             878   0.0      
ref|XP_006358841.1|  PREDICTED: subtilisin-like protease-like           877   0.0      
ref|XP_011071248.1|  PREDICTED: subtilisin-like protease                875   0.0      
ref|XP_006363699.1|  PREDICTED: subtilisin-like protease SDD1-like      875   0.0      
ref|XP_006358371.1|  PREDICTED: subtilisin-like protease-like           875   0.0      
gb|ADZ55305.1|  serine protease                                         871   0.0      
ref|XP_004245678.1|  PREDICTED: subtilisin-like protease SDD1           871   0.0      
gb|ABZ89187.1|  putative protein                                        869   0.0      Coffea canephora [robusta coffee]
gb|ADY38794.1|  serine protease                                         869   0.0      
ref|XP_009767059.1|  PREDICTED: subtilisin-like protease                868   0.0      
gb|EYU28956.1|  hypothetical protein MIMGU_mgv1a023117mg                867   0.0      
emb|CDP11276.1|  unnamed protein product                                865   0.0      
ref|XP_009586892.1|  PREDICTED: subtilisin-like protease SDD1           865   0.0      
emb|CDP11959.1|  unnamed protein product                                864   0.0      
ref|XP_011071267.1|  PREDICTED: subtilisin-like protease SDD1           862   0.0      
ref|XP_006358407.1|  PREDICTED: subtilisin-like protease-like           862   0.0      
ref|XP_004245674.1|  PREDICTED: subtilisin-like protease                862   0.0      
ref|XP_006477335.1|  PREDICTED: subtilisin-like protease-like           856   0.0      
ref|XP_009781097.1|  PREDICTED: subtilisin-like protease                854   0.0      
ref|XP_006440472.1|  hypothetical protein CICLE_v10018976mg             855   0.0      
ref|XP_006358406.1|  PREDICTED: subtilisin-like protease-like           853   0.0      
ref|XP_011071279.1|  PREDICTED: subtilisin-like protease                850   0.0      
gb|EYU39029.1|  hypothetical protein MIMGU_mgv1a019332mg                845   0.0      
ref|XP_009781099.1|  PREDICTED: subtilisin-like protease                853   0.0      
ref|XP_002509668.1|  Xylem serine proteinase 1 precursor, putative      845   0.0      Ricinus communis
gb|EYU39031.1|  hypothetical protein MIMGU_mgv1a025139mg                842   0.0      
gb|EYU39032.1|  hypothetical protein MIMGU_mgv1a023804mg                842   0.0      
ref|XP_009629566.1|  PREDICTED: subtilisin-like protease                843   0.0      
ref|XP_004246134.2|  PREDICTED: subtilisin-like protease                841   0.0      
ref|XP_011081166.1|  PREDICTED: subtilisin-like protease SDD1           858   0.0      
ref|XP_004244717.1|  PREDICTED: subtilisin-like protease                839   0.0      
emb|CAB67119.1|  subtilisin-like protease                               836   0.0      Solanum lycopersicum
ref|XP_006358904.1|  PREDICTED: subtilisin-like protease-like           832   0.0      
ref|XP_009781098.1|  PREDICTED: subtilisin-like protease                832   0.0      
ref|XP_009629568.1|  PREDICTED: subtilisin-like protease                831   0.0      
gb|EYU39026.1|  hypothetical protein MIMGU_mgv1a019074mg                829   0.0      
ref|XP_011081168.1|  PREDICTED: subtilisin-like protease SDD1           826   0.0      
ref|XP_009776224.1|  PREDICTED: subtilisin-like protease                825   0.0      
ref|XP_006358146.1|  PREDICTED: subtilisin-like protease SDD1-like      825   0.0      
gb|KDP25552.1|  hypothetical protein JCGZ_20708                         824   0.0      
gb|EYU39027.1|  hypothetical protein MIMGU_mgv1a019149mg                823   0.0      
ref|XP_009760563.1|  PREDICTED: subtilisin-like protease                823   0.0      
gb|EYU39037.1|  hypothetical protein MIMGU_mgv1a021904mg                822   0.0      
ref|XP_007208895.1|  hypothetical protein PRUPE_ppa026788mg             822   0.0      
ref|XP_002303550.2|  hypothetical protein POPTR_0003s11860g             822   0.0      Populus trichocarpa [western balsam poplar]
gb|EYU29563.1|  hypothetical protein MIMGU_mgv1a022413mg                818   0.0      
ref|XP_008238738.1|  PREDICTED: subtilisin-like protease                819   0.0      
ref|XP_009604592.1|  PREDICTED: subtilisin-like protease                818   0.0      
ref|XP_006440471.1|  hypothetical protein CICLE_v10024346mg             814   0.0      
emb|CAA76726.1|  P69C protein                                           809   0.0      Solanum lycopersicum
gb|KDO63675.1|  hypothetical protein CISIN_1g048043mg                   812   0.0      
gb|EYU28961.1|  hypothetical protein MIMGU_mgv1a020058mg                811   0.0      
ref|XP_008381953.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    815   0.0      
ref|XP_008238739.1|  PREDICTED: subtilisin-like protease                811   0.0      
ref|XP_002275429.1|  PREDICTED: subtilisin-like protease                809   0.0      Vitis vinifera
emb|CDO99977.1|  unnamed protein product                                808   0.0      
ref|XP_009362845.1|  PREDICTED: subtilisin-like protease                809   0.0      
ref|XP_004245672.2|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    833   0.0      
ref|XP_006477585.1|  PREDICTED: subtilisin-like protease-like           806   0.0      
ref|XP_006358147.1|  PREDICTED: subtilisin-like protease SDD1-like      805   0.0      
gb|EYU18559.1|  hypothetical protein MIMGU_mgv1a019487mg                803   0.0      
ref|XP_011034012.1|  PREDICTED: uncharacterized protein LOC105132300    831   0.0      
ref|XP_007040055.1|  Subtilase family protein                           816   0.0      
gb|KDO47505.1|  hypothetical protein CISIN_1g042259mg                   803   0.0      
ref|XP_002325705.1|  hypothetical protein POPTR_0019s00970g             801   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002299578.1|  hypothetical protein POPTR_0001s08340g             800   0.0      Populus trichocarpa [western balsam poplar]
gb|KDP25551.1|  hypothetical protein JCGZ_20707                         801   0.0      
ref|XP_002275471.2|  PREDICTED: uncharacterized protein LOC100242816    825   0.0      Vitis vinifera
ref|XP_004300734.1|  PREDICTED: subtilisin-like protease-like           800   0.0      
gb|KDP25554.1|  hypothetical protein JCGZ_20710                         798   0.0      
gb|KDP25559.1|  hypothetical protein JCGZ_20715                         797   0.0      
ref|XP_004300735.1|  PREDICTED: subtilisin-like protease-like           795   0.0      
ref|XP_003525747.1|  PREDICTED: subtilisin-like protease SDD1-like      793   0.0      
ref|XP_007208859.1|  hypothetical protein PRUPE_ppa025839mg             791   0.0      
ref|XP_006428960.1|  hypothetical protein CICLE_v10011144mg             792   0.0      
ref|XP_009629567.1|  PREDICTED: subtilisin-like protease                788   0.0      
ref|XP_006480601.1|  PREDICTED: subtilisin-like protease-like           791   0.0      
ref|XP_011029125.1|  PREDICTED: subtilisin-like protease SDD1           791   0.0      
ref|XP_004300737.1|  PREDICTED: subtilisin-like protease SDD1-like      789   0.0      
gb|EYU29562.1|  hypothetical protein MIMGU_mgv1a001898mg                790   0.0      
ref|XP_002509661.1|  Xylem serine proteinase 1 precursor, putative      790   0.0      Ricinus communis
ref|XP_006358842.1|  PREDICTED: subtilisin-like protease-like           785   0.0      
ref|XP_003550884.1|  PREDICTED: subtilisin-like protease SDD1-like      787   0.0      
emb|CDP10008.1|  unnamed protein product                                809   0.0      
ref|XP_006358905.1|  PREDICTED: subtilisin-like protease SDD1-like      781   0.0      
ref|XP_002509658.1|  Xylem serine proteinase 1 precursor, putative      784   0.0      Ricinus communis
ref|XP_004300736.1|  PREDICTED: subtilisin-like protease SDD1-like      785   0.0      
ref|XP_002303551.2|  hypothetical protein POPTR_0003s11870g             785   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010053374.1|  PREDICTED: subtilisin-like protease SDD1           783   0.0      
ref|XP_008238728.1|  PREDICTED: subtilisin-like protease SDD1           783   0.0      
ref|XP_009373361.1|  PREDICTED: subtilisin-like protease                781   0.0      
ref|XP_011033844.1|  PREDICTED: subtilisin-like protease SDD1           781   0.0      
gb|KEH31683.1|  subtilisin-like serine protease                         779   0.0      
ref|XP_007208831.1|  hypothetical protein PRUPE_ppa025337mg             778   0.0      
gb|EYU22359.1|  hypothetical protein MIMGU_mgv1a023284mg                777   0.0      
ref|XP_010053378.1|  PREDICTED: subtilisin-like protease SDD1           778   0.0      
gb|EYU39035.1|  hypothetical protein MIMGU_mgv1a001882mg                777   0.0      
ref|XP_008381935.1|  PREDICTED: subtilisin-like protease SDD1           777   0.0      
ref|XP_006477586.1|  PREDICTED: subtilisin-like protease SDD1-like      776   0.0      
ref|XP_002509656.1|  Xylem serine proteinase 1 precursor, putative      775   0.0      Ricinus communis
ref|XP_006440474.1|  hypothetical protein CICLE_v10023558mg             775   0.0      
ref|XP_011081245.1|  PREDICTED: subtilisin-like protease SDD1           771   0.0      
dbj|BAF95754.1|  subtilase                                              774   0.0      Lotus japonicus
ref|XP_010108071.1|  Subtilisin-like protease SDD1                      777   0.0      
ref|XP_002509665.1|  Xylem serine proteinase 1 precursor, putative      773   0.0      Ricinus communis
ref|XP_004147596.1|  PREDICTED: subtilisin-like protease SDD1-like      772   0.0      
gb|KDP25558.1|  hypothetical protein JCGZ_20714                         771   0.0      
ref|XP_003549875.1|  PREDICTED: subtilisin-like protease SDD1-like      772   0.0      
ref|XP_002509660.1|  Xylem serine proteinase 1 precursor, putative      771   0.0      Ricinus communis
gb|KDP25553.1|  hypothetical protein JCGZ_20709                         771   0.0      
gb|KHN34449.1|  Subtilisin-like protease SDD1                           769   0.0      
ref|XP_002303548.2|  hypothetical protein POPTR_0003s11840g             771   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003517445.1|  PREDICTED: subtilisin-like protease SDD1-like      771   0.0      
gb|KCW77653.1|  hypothetical protein EUGRSUZ_D01951                     768   0.0      
ref|XP_004515784.1|  PREDICTED: subtilisin-like protease SDD1-like      771   0.0      
gb|EPS72428.1|  serine protease                                         768   0.0      
ref|XP_007211044.1|  hypothetical protein PRUPE_ppa019040mg             768   0.0      
ref|XP_008437181.1|  PREDICTED: subtilisin-like protease                767   0.0      
ref|XP_008238737.1|  PREDICTED: subtilisin-like protease                767   0.0      
ref|XP_003611185.1|  Subtilisin-like serine protease                    767   0.0      
ref|XP_006358144.1|  PREDICTED: subtilisin-like protease SDD1-like      766   0.0      
gb|KCW77772.1|  hypothetical protein EUGRSUZ_D02072                     768   0.0      
gb|KCW77656.1|  hypothetical protein EUGRSUZ_D01954                     763   0.0      
ref|XP_007158428.1|  hypothetical protein PHAVU_002G152400g             766   0.0      
ref|XP_007155580.1|  hypothetical protein PHAVU_003G214100g             766   0.0      
gb|EYU39036.1|  hypothetical protein MIMGU_mgv1a026993mg                765   0.0      
ref|XP_004300738.1|  PREDICTED: subtilisin-like protease SDD1-like      764   0.0      
ref|XP_008238729.1|  PREDICTED: subtilisin-like protease                764   0.0      
gb|KHN09747.1|  Subtilisin-like protease SDD1                           761   0.0      
dbj|BAF95753.1|  subtilase                                              763   0.0      Lotus japonicus
ref|XP_003611201.1|  Subtilisin-like serine protease                    763   0.0      
ref|XP_002509667.1|  Xylem serine proteinase 1 precursor, putative      762   0.0      Ricinus communis
gb|EYU39028.1|  hypothetical protein MIMGU_mgv1a002635mg                758   0.0      
ref|XP_003538510.1|  PREDICTED: subtilisin-like protease-like           761   0.0      
ref|XP_011071709.1|  PREDICTED: subtilisin-like protease                778   0.0      
gb|AES94159.2|  subtilisin-like serine protease                         762   0.0      
ref|XP_004511628.1|  PREDICTED: subtilisin-like protease-like           761   0.0      
ref|XP_003538718.1|  PREDICTED: subtilisin-like protease-like           761   0.0      
ref|XP_002275410.2|  PREDICTED: subtilisin-like protease SDD1           761   0.0      Vitis vinifera
gb|KDO63673.1|  hypothetical protein CISIN_1g039265mg                   758   0.0      
ref|XP_010317341.1|  PREDICTED: subtilisin-like protease                758   0.0      
ref|XP_011081167.1|  PREDICTED: subtilisin-like protease SDD1           771   0.0      
ref|XP_007210956.1|  hypothetical protein PRUPE_ppa023717mg             758   0.0      
ref|XP_003611196.1|  Subtilisin-like serine protease                    758   0.0      
gb|KDP25555.1|  hypothetical protein JCGZ_20711                         757   0.0      
ref|XP_003611195.1|  Subtilisin-like serine protease                    756   0.0      
ref|XP_009616445.1|  PREDICTED: subtilisin-like protease                754   0.0      
gb|KHN09746.1|  Subtilisin-like protease SDD1                           752   0.0      
gb|EYU29357.1|  hypothetical protein MIMGU_mgv1a021077mg                753   0.0      
ref|XP_008381959.1|  PREDICTED: subtilisin-like protease SDD1           773   0.0      
ref|XP_004511627.1|  PREDICTED: subtilisin-like protease-like           754   0.0      
ref|XP_011081104.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    749   0.0      
ref|XP_010325680.1|  PREDICTED: subtilisin-like protease                768   0.0      
ref|XP_003611198.1|  Subtilisin-like serine protease                    751   0.0      
dbj|BAF95755.1|  subtilase                                              751   0.0      Lotus japonicus
gb|EYU28957.1|  hypothetical protein MIMGU_mgv1a020114mg                751   0.0      
ref|XP_003525749.1|  PREDICTED: subtilisin-like protease SDD1-like      749   0.0      
gb|EYU29555.1|  hypothetical protein MIMGU_mgv1a022042mg                748   0.0      
ref|XP_004308725.1|  PREDICTED: subtilisin-like protease SDD1-like      749   0.0      
ref|XP_010317342.1|  PREDICTED: subtilisin-like protease                743   0.0      
gb|EYU39034.1|  hypothetical protein MIMGU_mgv1a019276mg                745   0.0      
ref|XP_002509669.1|  Cucumisin precursor, putative                      748   0.0      Ricinus communis
gb|KDP25556.1|  hypothetical protein JCGZ_20712                         743   0.0      
ref|XP_008437722.1|  PREDICTED: subtilisin-like protease                744   0.0      
gb|KCW72062.1|  hypothetical protein EUGRSUZ_E00506                     742   0.0      
ref|XP_003611191.1|  Subtilisin-like serine protease                    743   0.0      
ref|XP_007158429.1|  hypothetical protein PHAVU_002G152500g             741   0.0      
gb|EYU29361.1|  hypothetical protein MIMGU_mgv1a026567mg                739   0.0      
ref|XP_004249616.1|  PREDICTED: subtilisin-like protease                739   0.0      
ref|XP_002275381.2|  PREDICTED: subtilisin-like protease SDD1           751   0.0      Vitis vinifera
ref|XP_010108074.1|  Subtilisin-like protease SDD1                      740   0.0      
ref|XP_007210332.1|  hypothetical protein PRUPE_ppa002068mg             735   0.0      
gb|AES94150.2|  subtilisin-like serine protease                         735   0.0      
ref|XP_003611192.1|  Subtilisin-like serine protease                    735   0.0      
ref|XP_003611190.1|  Subtilisin-like serine protease                    734   0.0      
ref|XP_006464862.1|  PREDICTED: subtilisin-like protease SDD1-like      734   0.0      
ref|XP_006427879.1|  hypothetical protein CICLE_v10027438mg             733   0.0      
gb|EYU29564.1|  hypothetical protein MIMGU_mgv1a023796mg                733   0.0      
ref|XP_006358145.1|  PREDICTED: subtilisin-like protease-like           728   0.0      
gb|KHN34450.1|  Subtilisin-like protease SDD1                           729   0.0      
gb|EYU29561.1|  hypothetical protein MIMGU_mgv1a018614mg                729   0.0      
ref|XP_006446036.1|  hypothetical protein CICLE_v10018202mg             731   0.0      
ref|XP_006493680.1|  PREDICTED: subtilisin-like protease-like           729   0.0      
gb|EYU28960.1|  hypothetical protein MIMGU_mgv1a018215mg                726   0.0      
gb|KCW87517.1|  hypothetical protein EUGRSUZ_B03965                     728   0.0      
ref|XP_006358907.1|  PREDICTED: subtilisin-like protease-like           724   0.0      
ref|XP_004147599.1|  PREDICTED: subtilisin-like protease-like           727   0.0      
gb|EYU28633.1|  hypothetical protein MIMGU_mgv1a023843mg                725   0.0      
ref|XP_010058211.1|  PREDICTED: subtilisin-like protease SDD1           726   0.0      
ref|XP_010046741.1|  PREDICTED: subtilisin-like protease SDD1           725   0.0      
ref|XP_004166925.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    723   0.0      
ref|XP_004512194.1|  PREDICTED: subtilisin-like protease-like           722   0.0      
ref|XP_006339269.1|  PREDICTED: subtilisin-like protease-like           721   0.0      
ref|XP_010910929.1|  PREDICTED: subtilisin-like protease SDD1           722   0.0      
ref|XP_011081071.1|  PREDICTED: subtilisin-like protease                718   0.0      
emb|CDP09844.1|  unnamed protein product                                720   0.0      
ref|XP_008804041.1|  PREDICTED: subtilisin-like protease SDD1           720   0.0      
ref|XP_010918673.1|  PREDICTED: subtilisin-like protease SDD1           719   0.0      
gb|EPS72026.1|  serine protease                                         715   0.0      
gb|EYU28634.1|  hypothetical protein MIMGU_mgv1a024623mg                715   0.0      
ref|XP_008437177.1|  PREDICTED: subtilisin-like protease                717   0.0      
ref|XP_006468883.1|  PREDICTED: subtilisin-like protease-like           715   0.0      
ref|XP_010058417.1|  PREDICTED: subtilisin-like protease                732   0.0      
ref|XP_006469111.1|  PREDICTED: subtilisin-like protease-like           713   0.0      
ref|XP_010918181.1|  PREDICTED: subtilisin-like protease                710   0.0      
ref|XP_010051224.1|  PREDICTED: subtilisin-like protease                710   0.0      
ref|XP_009775744.1|  PREDICTED: subtilisin-like protease                706   0.0      
ref|XP_006446947.1|  hypothetical protein CICLE_v10014389mg             709   0.0      
ref|XP_006339268.1|  PREDICTED: subtilisin-like protease-like           705   0.0      
ref|XP_006446945.1|  hypothetical protein CICLE_v10017946mg             709   0.0      
gb|KCW72066.1|  hypothetical protein EUGRSUZ_E00511                     706   0.0      
ref|XP_009768778.1|  PREDICTED: subtilisin-like protease                701   0.0      
ref|XP_010051225.1|  PREDICTED: subtilisin-like protease                707   0.0      
ref|XP_010034346.1|  PREDICTED: subtilisin-like protease SDD1           707   0.0      
ref|XP_004249825.2|  PREDICTED: subtilisin-like protease                702   0.0      
gb|EYU29364.1|  hypothetical protein MIMGU_mgv1a022867mg                702   0.0      
ref|XP_010041553.1|  PREDICTED: subtilisin-like protease SDD1           705   0.0      
ref|XP_009609835.1|  PREDICTED: subtilisin-like protease SDD1           699   0.0      
gb|KCW51741.1|  hypothetical protein EUGRSUZ_J01200                     703   0.0      
ref|XP_010058207.1|  PREDICTED: subtilisin-like protease                720   0.0      
ref|XP_006339270.1|  PREDICTED: subtilisin-like protease-like           698   0.0      
ref|XP_006339267.1|  PREDICTED: subtilisin-like protease-like           695   0.0      
gb|KCW51742.1|  hypothetical protein EUGRSUZ_J01202                     697   0.0      
gb|KCW81559.1|  hypothetical protein EUGRSUZ_C02917                     695   0.0      
gb|KCW81560.1|  hypothetical protein EUGRSUZ_C02918                     695   0.0      
ref|XP_006446946.1|  hypothetical protein CICLE_v10017639mg             693   0.0      
ref|XP_007210344.1|  hypothetical protein PRUPE_ppa001885mg             692   0.0      
ref|XP_006358906.1|  PREDICTED: subtilisin-like protease SDD1-like      687   0.0      
ref|XP_010905124.1|  PREDICTED: subtilisin-like protease                695   0.0      
gb|KCW51739.1|  hypothetical protein EUGRSUZ_J01198                     689   0.0      
ref|XP_010942947.1|  PREDICTED: subtilisin-like protease SDD1           690   0.0      
ref|XP_009382355.1|  PREDICTED: subtilisin-like protease                688   0.0      
ref|XP_009411516.1|  PREDICTED: subtilisin-like protease                687   0.0      
ref|XP_008802434.1|  PREDICTED: subtilisin-like protease SDD1           687   0.0      
gb|EYU33441.1|  hypothetical protein MIMGU_mgv1a022698mg                685   0.0      
ref|XP_010920352.1|  PREDICTED: subtilisin-like protease SDD1           681   0.0      
ref|XP_010910904.1|  PREDICTED: subtilisin-like protease                680   0.0      
gb|EYU33437.1|  hypothetical protein MIMGU_mgv1a001845mg                679   0.0      
emb|CDP17728.1|  unnamed protein product                                676   0.0      
gb|EYU33438.1|  hypothetical protein MIMGU_mgv1a026511mg                677   0.0      
gb|EYU33439.1|  hypothetical protein MIMGU_mgv1a026748mg                677   0.0      
gb|EYU37178.1|  hypothetical protein MIMGU_mgv1a001832mg                672   0.0      
gb|EYU37168.1|  hypothetical protein MIMGU_mgv1a026826mg                670   0.0      
ref|XP_006857969.1|  hypothetical protein AMTR_s00069p00177600          671   0.0      
gb|EYU39048.1|  hypothetical protein MIMGU_mgv1a002011mg                667   0.0      
ref|XP_010909887.1|  PREDICTED: subtilisin-like protease SDD1           667   0.0      
ref|XP_010920351.1|  PREDICTED: subtilisin-like protease                663   0.0      
ref|XP_006857959.1|  hypothetical protein AMTR_s00069p00172550          662   0.0      
ref|XP_008802988.1|  PREDICTED: subtilisin-like protease SDD1           659   0.0      
ref|XP_006857970.1|  hypothetical protein AMTR_s00069p00178060          659   0.0      
ref|XP_010042392.1|  PREDICTED: subtilisin-like protease SDD1           658   0.0      
gb|EYU29014.1|  hypothetical protein MIMGU_mgv1a001970mg                657   0.0      
ref|XP_006857977.1|  hypothetical protein AMTR_s00069p00178740          655   0.0      
ref|XP_009625523.1|  PREDICTED: subtilisin-like protease SDD1           648   0.0      
ref|XP_009412853.1|  PREDICTED: subtilisin-like protease SDD1           647   0.0      
gb|KHN25749.1|  Subtilisin-like protease SDD1                           641   0.0      
gb|EYU28958.1|  hypothetical protein MIMGU_mgv1a020772mg                641   0.0      
ref|XP_009385240.1|  PREDICTED: subtilisin-like protease                646   0.0      
ref|XP_009383069.1|  PREDICTED: subtilisin-like protease                646   0.0      
ref|XP_010906821.1|  PREDICTED: subtilisin-like protease SDD1           647   0.0      
emb|CDP09941.1|  unnamed protein product                                639   0.0      
ref|XP_008811118.1|  PREDICTED: subtilisin-like protease SDD1           642   0.0      
gb|KCW72825.1|  hypothetical protein EUGRSUZ_E01269                     640   0.0      
ref|XP_006347484.1|  PREDICTED: subtilisin-like protease SDD1-like      637   0.0      
ref|XP_009391775.1|  PREDICTED: subtilisin-like protease                632   0.0      
ref|XP_006358902.1|  PREDICTED: subtilisin-like protease SDD1-like      620   0.0      
ref|XP_010906822.1|  PREDICTED: subtilisin-like protease SDD1           627   0.0      
dbj|BAK05599.1|  predicted protein                                      627   0.0      
ref|XP_010919425.1|  PREDICTED: subtilisin-like protease                625   0.0      
ref|XP_010919426.1|  PREDICTED: subtilisin-like protease SDD1           624   0.0      
ref|XP_008804292.1|  PREDICTED: subtilisin-like protease SDD1           625   0.0      
ref|XP_010227224.1|  PREDICTED: subtilisin-like protease                623   0.0      
ref|XP_009781100.1|  PREDICTED: subtilisin-like protease SDD1           614   0.0      
ref|XP_009383068.1|  PREDICTED: subtilisin-like protease SDD1           622   0.0      
emb|CDP20400.1|  unnamed protein product                                618   0.0      
ref|XP_008809520.1|  PREDICTED: subtilisin-like protease                623   0.0      
ref|XP_010942946.1|  PREDICTED: subtilisin-like protease SDD1           623   0.0      
ref|XP_008669034.1|  PREDICTED: subtilisin-like protease                621   0.0      
ref|XP_008669035.1|  PREDICTED: subtilisin-like protease                620   0.0      
ref|XP_004985952.1|  PREDICTED: subtilisin-like protease SDD1-like      620   0.0      
tpg|DAA36487.1|  TPA: putative subtilase family protein                 621   0.0      
ref|XP_002448316.1|  hypothetical protein SORBIDRAFT_06g025110          619   0.0      
ref|XP_006650980.1|  PREDICTED: subtilisin-like protease SDD1-like      618   0.0      
ref|XP_009383070.1|  PREDICTED: subtilisin-like protease                630   0.0      
ref|XP_002465976.1|  hypothetical protein SORBIDRAFT_01g049280          614   0.0      
ref|XP_008780363.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    611   0.0      
ref|NP_001048778.1|  Os03g0119300                                       611   0.0      
tpg|DAA42972.1|  TPA: putative subtilase family protein                 609   0.0      
ref|XP_010919951.1|  PREDICTED: subtilisin-like protease                610   0.0      
ref|XP_010925147.1|  PREDICTED: subtilisin-like protease                610   0.0      
ref|XP_010919428.1|  PREDICTED: subtilisin-like protease                610   0.0      
ref|XP_002459999.1|  hypothetical protein SORBIDRAFT_02g020470          607   0.0      
ref|XP_010240233.1|  PREDICTED: subtilisin-like protease SDD1           606   0.0      
ref|XP_004964076.1|  PREDICTED: subtilisin-like protease-like           606   0.0      
ref|XP_003579422.1|  PREDICTED: subtilisin-like protease                606   0.0      
ref|XP_004978176.1|  PREDICTED: subtilisin-like protease-like           605   0.0      
ref|XP_010919953.1|  PREDICTED: subtilisin-like protease                606   0.0      
ref|XP_006664000.1|  PREDICTED: subtilisin-like protease SDD1-like      604   0.0      
ref|XP_002465042.1|  hypothetical protein SORBIDRAFT_01g031090          602   0.0      
ref|XP_010918054.1|  PREDICTED: subtilisin-like protease                597   0.0      
ref|XP_008652529.1|  PREDICTED: subtilisin-like protease                601   0.0      
ref|XP_004964095.1|  PREDICTED: subtilisin-like protease-like           598   0.0      
ref|XP_010943376.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    599   0.0      
ref|XP_010915125.1|  PREDICTED: subtilisin-like protease SDD1           598   0.0      
ref|XP_004983865.1|  PREDICTED: subtilisin-like protease SDD1-like      597   0.0      
gb|ACG29187.1|  subtilisin-like protease precursor                      596   0.0      
gb|EAY79268.1|  hypothetical protein OsI_34383                          595   0.0      
ref|XP_004985590.1|  PREDICTED: subtilisin-like protease-like           594   0.0      
ref|XP_006661975.1|  PREDICTED: subtilisin-like protease-like           593   0.0      
ref|NP_001065109.1|  Os10g0524600                                       593   0.0      
ref|NP_001167816.1|  putative subtilase family protein precursor        592   0.0      
ref|XP_003580717.1|  PREDICTED: subtilisin-like protease                591   0.0      
ref|XP_002441813.1|  hypothetical protein SORBIDRAFT_08g002720          590   0.0      
ref|NP_001066666.2|  Os12g0427600                                       590   0.0      
ref|XP_010919952.1|  PREDICTED: subtilisin-like protease SDD1           590   0.0      
ref|XP_008796316.1|  PREDICTED: subtilisin-like protease SDD1           588   0.0      
ref|XP_003580309.1|  PREDICTED: subtilisin-like protease SDD1           588   0.0      
ref|XP_008671366.1|  PREDICTED: subtilisin-like protease                588   0.0      
ref|XP_009383056.1|  PREDICTED: subtilisin-like protease SDD1           587   0.0      
ref|XP_003571590.1|  PREDICTED: subtilisin-like protease                585   0.0      
ref|NP_001148151.1|  xylem serine proteinase 1 precursor                585   0.0      
gb|ACN30792.1|  unknown                                                 584   0.0      
gb|AFW89785.1|  putative subtilase family protein                       584   0.0      
ref|XP_002442286.1|  hypothetical protein SORBIDRAFT_08g017490          583   0.0      
ref|XP_004962635.1|  PREDICTED: subtilisin-like protease SDD1-like      582   0.0      
ref|XP_009410172.1|  PREDICTED: subtilisin-like protease                582   0.0      
ref|NP_001053537.1|  Os04g0559000                                       582   0.0      
emb|CAH68048.1|  B0103C08-B0602B01.5                                    581   0.0      
ref|XP_006652630.1|  PREDICTED: subtilisin-like protease-like           581   0.0      
ref|XP_004977944.1|  PREDICTED: subtilisin-like protease-like           585   0.0      
gb|EAY95140.1|  hypothetical protein OsI_16958                          581   0.0      
gb|EEE53126.1|  hypothetical protein OsJ_35920                          578   0.0      
ref|XP_003572795.2|  PREDICTED: subtilisin-like protease SDD1           582   0.0      
ref|XP_009380222.1|  PREDICTED: subtilisin-like protease                579   0.0      
gb|EAY86991.1|  hypothetical protein OsI_08385                          581   0.0      
ref|NP_001047665.1|  Os02g0665300                                       580   0.0      
gb|EMT17822.1|  Subtilisin-like protease                                578   0.0      
gb|EEC69176.1|  hypothetical protein OsI_38146                          574   0.0      
ref|XP_010906967.1|  PREDICTED: subtilisin-like protease SDD1           575   0.0      
ref|XP_002443309.1|  hypothetical protein SORBIDRAFT_08g017330          573   0.0      
dbj|BAB03290.1|  subtilisin-like serine protease                        574   0.0      
ref|XP_008805738.1|  PREDICTED: subtilisin-like protease SDD1           573   0.0      
ref|XP_010937154.1|  PREDICTED: subtilisin-like protease SDD1           573   0.0      
ref|XP_010943371.1|  PREDICTED: subtilisin-like protease SDD1           570   0.0      
ref|XP_010915013.1|  PREDICTED: subtilisin-like protease                569   0.0      
ref|XP_009403478.1|  PREDICTED: subtilisin-like protease SDD1           569   0.0      
ref|XP_008787169.1|  PREDICTED: subtilisin-like protease SDD1           567   0.0      
ref|XP_010937155.1|  PREDICTED: subtilisin-like protease SDD1           566   0.0      
gb|EMT25192.1|  Subtilisin-like protease                                565   0.0      
ref|XP_004953387.1|  PREDICTED: subtilisin-like protease SDD1-like      566   0.0      
dbj|BAK08126.1|  predicted protein                                      564   0.0      
gb|AES80028.2|  subtilisin-like serine protease                         562   0.0      
ref|XP_003623810.1|  Subtilisin-like protease                           562   0.0      
ref|XP_006647650.1|  PREDICTED: subtilisin-like protease SDD1-like      561   0.0      
gb|EYU39344.1|  hypothetical protein MIMGU_mgv1a024295mg                553   0.0      
ref|XP_003566321.1|  PREDICTED: subtilisin-like protease                558   0.0      
ref|XP_009398828.1|  PREDICTED: subtilisin-like protease SDD1           557   0.0      
gb|EMS49460.1|  Subtilisin-like protease SDD1                           559   0.0      
gb|EMT24443.1|  Subtilisin-like protease                                558   0.0      
gb|KDP28707.1|  hypothetical protein JCGZ_14478                         552   0.0      
ref|XP_011035007.1|  PREDICTED: subtilisin-like protease                553   0.0      
ref|XP_009335230.1|  PREDICTED: subtilisin-like protease SDD1           552   0.0      
ref|XP_003520616.1|  PREDICTED: subtilisin-like protease SDD1-like      551   0.0      
dbj|BAK05043.1|  predicted protein                                      549   0.0      
ref|XP_008235585.1|  PREDICTED: subtilisin-like protease SDD1           550   1e-180   
gb|EYU28632.1|  hypothetical protein MIMGU_mgv1a018209mg                541   1e-180   
ref|XP_004976478.1|  PREDICTED: subtilisin-like protease SDD1-like      550   2e-180   
ref|XP_010915012.1|  PREDICTED: subtilisin-like protease                548   2e-180   
ref|XP_003554304.1|  PREDICTED: subtilisin-like protease SDD1-like      548   3e-180   
gb|KHN27220.1|  Subtilisin-like protease                                546   7e-180   
ref|XP_008356216.1|  PREDICTED: subtilisin-like protease SDD1           547   1e-179   
ref|XP_006574858.1|  PREDICTED: subtilisin-like protease-like iso...    547   2e-179   
ref|XP_002526537.1|  Cucumisin precursor, putative                      546   2e-179   
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease                546   2e-179   
ref|XP_002320086.2|  subtilase family protein                           546   3e-179   
ref|XP_009762584.1|  PREDICTED: subtilisin-like protease isoform X4     546   3e-179   
gb|KHN13887.1|  Subtilisin-like protease                                543   4e-179   
ref|XP_009762581.1|  PREDICTED: subtilisin-like protease isoform X1     546   4e-179   
ref|XP_003528890.1|  PREDICTED: subtilisin-like protease-like iso...    545   4e-179   
gb|KHN04600.1|  Subtilisin-like protease                                544   4e-179   
ref|XP_002272965.1|  PREDICTED: subtilisin-like protease                545   6e-179   
ref|XP_006352831.1|  PREDICTED: subtilisin-like protease SDD1-like      545   6e-179   
ref|XP_006653665.1|  PREDICTED: subtilisin-like protease SDD1-like      546   7e-179   
ref|XP_007040056.1|  Subtilase family protein, putative                 535   1e-178   
gb|KHN13888.1|  Subtilisin-like protease                                543   1e-178   
ref|XP_002511772.1|  Xylem serine proteinase 1 precursor, putative      543   2e-178   
ref|XP_006576383.1|  PREDICTED: subtilisin-like protease-like iso...    544   2e-178   
ref|XP_004242535.1|  PREDICTED: subtilisin-like protease SDD1           544   2e-178   
ref|XP_003551824.2|  PREDICTED: subtilisin-like protease-like           543   2e-178   
dbj|BAK05709.1|  predicted protein                                      548   3e-178   
ref|XP_007201801.1|  hypothetical protein PRUPE_ppa001773mg             543   5e-178   
ref|XP_009611962.1|  PREDICTED: subtilisin-like protease                542   8e-178   
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like           542   9e-178   
ref|XP_010652423.1|  PREDICTED: subtilisin-like protease SDD1           541   1e-177   
ref|XP_009391664.1|  PREDICTED: subtilisin-like protease SDD1           541   2e-177   
ref|XP_004493834.1|  PREDICTED: subtilisin-like protease SDD1-like      540   4e-177   
ref|XP_009370534.1|  PREDICTED: subtilisin-like protease SDD1           540   4e-177   
gb|EMT05796.1|  Subtilisin-like protease                                539   6e-177   
ref|XP_008382710.1|  PREDICTED: subtilisin-like protease SDD1           540   9e-177   
ref|XP_010255581.1|  PREDICTED: subtilisin-like protease                540   9e-177   
ref|XP_004492670.1|  PREDICTED: subtilisin-like protease-like           540   1e-176   
gb|EMT05794.1|  Subtilisin-like protease                                538   1e-176   
ref|XP_008813818.1|  PREDICTED: subtilisin-like protease SDD1           531   1e-176   
ref|XP_008663514.1|  PREDICTED: subtilisin-like protease SDD1           540   2e-176   
gb|AFW72701.1|  putative subtilase family protein                       539   3e-176   
ref|XP_006490976.1|  PREDICTED: subtilisin-like protease-like           538   5e-176   
ref|NP_001130859.1|  uncharacterized protein LOC100191963 precursor     537   6e-176   
gb|AES81608.2|  subtilisin-like serine protease                         541   8e-176   
gb|KDP26457.1|  hypothetical protein JCGZ_17615                         534   1e-175   
emb|CDP03800.1|  unnamed protein product                                537   1e-175   
ref|XP_002454511.1|  hypothetical protein SORBIDRAFT_04g032460          552   2e-175   
ref|XP_007220042.1|  hypothetical protein PRUPE_ppa027143mg             536   2e-175   
ref|XP_008646040.1|  PREDICTED: subtilisin-like protease SDD1           539   2e-175   
ref|XP_007139243.1|  hypothetical protein PHAVU_008G013300g             535   4e-175   
gb|EMS46560.1|  Subtilisin-like protease                                534   5e-175   
dbj|BAC10341.1|  putative serine protease                               535   7e-175   
ref|NP_001060680.1|  Os07g0685900                                       535   8e-175   
gb|EAZ05187.1|  hypothetical protein OsI_27385                          535   8e-175   
ref|XP_003625390.1|  Subtilisin-like protease                           540   8e-175   
ref|XP_009419476.1|  PREDICTED: subtilisin-like protease SDD1           534   9e-175   
ref|XP_007050153.1|  Subtilase family protein isoform 1                 534   1e-174   
gb|KHN10783.1|  Subtilisin-like protease SDD1                           531   2e-174   
ref|XP_010056250.1|  PREDICTED: subtilisin-like protease                533   2e-174   
ref|XP_008232840.1|  PREDICTED: subtilisin-like protease                533   4e-174   
ref|XP_010068435.1|  PREDICTED: subtilisin-like protease SDD1           531   1e-173   
ref|XP_011091250.1|  PREDICTED: subtilisin-like protease                531   1e-173   
ref|NP_001053536.1|  Os04g0558900                                       531   2e-173   
ref|XP_007051968.1|  Subtilase family protein                           530   3e-173   
ref|XP_007134944.1|  hypothetical protein PHAVU_010G088700g             530   5e-173   
ref|XP_004289987.1|  PREDICTED: subtilisin-like protease SDD1-like      530   7e-173   
gb|ABR17987.1|  unknown                                                 530   7e-173   
ref|XP_006355907.1|  PREDICTED: subtilisin-like protease SDD1-like      529   1e-172   
ref|XP_004171629.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    529   1e-172   
ref|XP_006306838.1|  hypothetical protein CARUB_v10008379mg             529   1e-172   
ref|XP_010233022.1|  PREDICTED: subtilisin-like protease                528   1e-172   
emb|CAH68047.1|  B0103C08-B0602B01.4                                    530   1e-172   
gb|EMS46561.1|  Subtilisin-like protease                                528   1e-172   
ref|XP_003575756.1|  PREDICTED: subtilisin-like protease SDD1           528   2e-172   
ref|XP_003581517.1|  PREDICTED: subtilisin-like protease                529   2e-172   
ref|XP_008462294.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    528   2e-172   
ref|XP_006365833.1|  PREDICTED: subtilisin-like protease-like           528   4e-172   
ref|XP_004963825.1|  PREDICTED: subtilisin-like protease-like           527   5e-172   
ref|XP_009803381.1|  PREDICTED: subtilisin-like protease SDD1           527   5e-172   
gb|EAY97776.1|  hypothetical protein OsI_19688                          527   8e-172   
ref|XP_008454764.1|  PREDICTED: subtilisin-like protease                526   1e-171   
gb|AAT38023.1|  putative serine protease                                527   1e-171   
ref|XP_002966443.1|  hypothetical protein SELMODRAFT_143697             526   1e-171   
ref|XP_002272999.1|  PREDICTED: subtilisin-like protease                526   2e-171   
ref|XP_004140477.1|  PREDICTED: subtilisin-like protease-like           525   2e-171   
ref|XP_002439684.1|  hypothetical protein SORBIDRAFT_09g018380          525   3e-171   
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease                525   3e-171   
gb|EMT05795.1|  Subtilisin-like protease                                523   7e-171   
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease                524   8e-171   
ref|XP_002982080.1|  hypothetical protein SELMODRAFT_233912             524   8e-171   
gb|KCW72879.1|  hypothetical protein EUGRSUZ_E01327                     522   1e-170   
ref|XP_002272824.2|  PREDICTED: subtilisin-like protease                524   1e-170   
ref|XP_004308418.1|  PREDICTED: subtilisin-like protease-like           523   1e-170   
ref|XP_010479641.1|  PREDICTED: subtilisin-like protease                525   1e-170   
ref|XP_010091819.1|  Subtilisin-like protease SDD1                      524   1e-170   
ref|XP_004141706.1|  PREDICTED: subtilisin-like protease-like           523   2e-170   
ref|XP_010933213.1|  PREDICTED: subtilisin-like protease SDD1           523   2e-170   
ref|XP_006857965.1|  hypothetical protein AMTR_s00069p00175260          523   3e-170   
ref|XP_002446927.1|  hypothetical protein SORBIDRAFT_06g025100          523   3e-170   
emb|CDP02570.1|  unnamed protein product                                522   5e-170   
gb|ABF93923.1|  subtilase family protein, putative                      522   1e-169   
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                    521   1e-169   



>ref|XP_009599111.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=742

 Score =   954 bits (2466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/749 (67%), Positives = 593/749 (79%), Gaps = 10/749 (1%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             MKFL++FL+  ++  F +  TI S LETYIV VE   S+ S   + SS +DLE WY SFL
Sbjct  1     MKFLKIFLLFCIVSCF-AWPTIQSPLETYIVHVE---SQESQILTQSSLMDLESWYNSFL  56

Query  2215  PTTVAGGGYGES-RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHS  2039
             P T+      E  R+++ YRNVMKGFAA+LSAE VKEM  K GFISA P+RIL LHTTH+
Sbjct  57    PKTITSSSSNEEPRLIYSYRNVMKGFAARLSAEHVKEMEKKPGFISAQPQRILSLHTTHT  116

Query  2038  PGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA  1859
             P FLGLQQNMG W+DS+YGKGVIIGVLD+GI  DHPSFSDEGMPPPPA+WKG CE NFT 
Sbjct  117   PSFLGLQQNMGLWKDSNYGKGVIIGVLDTGIFPDHPSFSDEGMPPPPAKWKGKCESNFTT  176

Query  1858  -CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHL  1682
              CNNK+IGARS+ + +RS  DDDGHGTHTA TAAG+FV+GANVYG+A GTA GVAPLAHL
Sbjct  177   KCNNKIIGARSYIQDDRSPIDDDGHGTHTASTAAGSFVQGANVYGNAKGTAVGVAPLAHL  236

Query  1681  AIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIF  1502
             AIYKVC+  GC+DSEILAAMD AI+DGVDILSLSLGG SS  H D IALGAYSA E+GI 
Sbjct  237   AIYKVCDSSGCADSEILAAMDAAIDDGVDILSLSLGGFSSPLHSDPIALGAYSATERGIL  296

Query  1501  VSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSS  1322
             VS SAGNEGP+N S SNEAPW+LTVGAST+DRK+ ATV LGN+++F GE+ F PK  + +
Sbjct  297   VSCSAGNEGPYNSSTSNEAPWILTVGASTLDRKIKATVKLGNKKEFEGESTFHPKASSVT  356

Query  1321  LLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGM  1142
             +  L  P +N SD   SPYC   +L +  +RGKIV+CM GG   R GKG+AVK+A G GM
Sbjct  357   VFPLFDPAKNASD-FDSPYCGRGTLTDPAIRGKIVLCMAGGGYTRIGKGQAVKDAGGVGM  415

Query  1141  ILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPT  962
             I+    EYG+TT A AHVLPA+D+TYADG KIL Y+N+T  P+A  +F+GTI GD+NAP 
Sbjct  416   IIYNGLEYGVTTLADAHVLPALDVTYADGMKILDYMNSTEKPVARITFEGTIIGDRNAPV  475

Query  961   VAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLS  782
             VA+FSSRGP+  SPGILKPDII PGVN+LA WPTSV+NK N+KSTFNIISGTSMSCPHLS
Sbjct  476   VASFSSRGPSTASPGILKPDIISPGVNVLAAWPTSVENKTNTKSTFNIISGTSMSCPHLS  535

Query  781   GVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKAN  602
             GVAALLKS+H  WSPA IKSA+MTTAD +N   NPI ++ L+TA++F+IGAGHVNPS+AN
Sbjct  536   GVAALLKSAHLTWSPAAIKSAIMTTADTVNLANNPILDERLLTANIFAIGAGHVNPSRAN  595

Query  601   DPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILEST  422
             DPGL+YDT  +DYLPYLCGLNYTNR+VG +LQ +VNCS V SIPEAQLNYPSFSI L + 
Sbjct  596   DPGLIYDTPFDDYLPYLCGLNYTNRQVGKLLQRKVNCSEVKSIPEAQLNYPSFSITLGTN  655

Query  421   AQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAAR  242
             +QTYTRTVTNVG+A S Y+VEI  P GV V V+P  L+FS++NQKLTY VTF   SK A 
Sbjct  656   SQTYTRTVTNVGDAKSSYSVEIVSPQGVSVMVKPSTLKFSELNQKLTYQVTF---SKTAN  712

Query  241   SNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
             S+   VV+G L+W S +H VRSPIA  LV
Sbjct  713   SSNSDVVEGFLKWTSNRHSVRSPIAVVLV  741



>ref|XP_009776158.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=744

 Score =   941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/751 (66%), Positives = 587/751 (78%), Gaps = 11/751 (1%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             MKFL++FL+   ++ +    TI S L+TYIV+VE         + S S  DLE WY+SFL
Sbjct  1     MKFLKIFLLF-CMVSYFPWPTIQSPLDTYIVQVE--SQESQISTQSLSDQDLESWYRSFL  57

Query  2215  PTTVAGGGYGES---RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTT  2045
             P T+A     +    R+V+ YRNVMKGFAA+LSAE VKEM  K GF+SA PERI+ LHTT
Sbjct  58    PNTIAITRSNDEEGPRLVYSYRNVMKGFAARLSAEHVKEMEKKPGFVSAWPERIMSLHTT  117

Query  2044  HSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNF  1865
             H+P FLGLQQ+MG W+DS+YG GVIIGVLD+GI+ DHPSFSDEGM PPPA+WKG CE NF
Sbjct  118   HTPSFLGLQQHMGLWKDSNYGNGVIIGVLDTGISPDHPSFSDEGMLPPPAKWKGKCESNF  177

Query  1864  TA-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLA  1688
             T  CNNK+IGARS+ + +RS  DDDGHGTHTA TAAG FV+GANVYG+A GTA GVAPLA
Sbjct  178   TTKCNNKLIGARSYIQEDRSPIDDDGHGTHTASTAAGGFVQGANVYGNAKGTAVGVAPLA  237

Query  1687  HLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKG  1508
             HLAIYKVC+  GC+DSEILAAMD AI+DGVDILSLSLGG SS  H D IALGAYSA E+G
Sbjct  238   HLAIYKVCDSSGCADSEILAAMDAAIDDGVDILSLSLGGFSSPLHSDPIALGAYSATERG  297

Query  1507  IFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFN  1328
             I VS SAGNEGP+N S SNEAPW+LTVGAST+DRK+ ATV LGN+++F GE+ F PK FN
Sbjct  298   ILVSCSAGNEGPYNSSTSNEAPWILTVGASTLDRKIKATVKLGNKKEFEGESTFHPKSFN  357

Query  1327  SSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGR  1148
              +   L  P +N SD   SPYC + +L +  +RGKIV+CM GG   R GKG+AVK+A G 
Sbjct  358   VTFFPLFDPAKNASD-FDSPYCGTGTLTDPAIRGKIVLCMAGGGYTRIGKGQAVKDAGGV  416

Query  1147  GMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNA  968
             GMI+    EYG+TT A AHVLPA+D+TYADG KIL Y+N+T  P+A  +F+GTI GD+NA
Sbjct  417   GMIIYNGLEYGVTTLADAHVLPALDVTYADGMKILDYMNSTEKPVARITFQGTIIGDRNA  476

Query  967   PTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPH  788
             P VA+FSSRGP+  SPGILKPDIIGPGVNILA WP SV+N  NSKSTFNIISGTSMSCPH
Sbjct  477   PMVASFSSRGPSMASPGILKPDIIGPGVNILAAWPASVENNTNSKSTFNIISGTSMSCPH  536

Query  787   LSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSK  608
             LSGVAALLKS+HP WSPA IKSA+MTTAD +N   NPI ++ L+ A++F++G+GHVNPS+
Sbjct  537   LSGVAALLKSAHPTWSPAAIKSAIMTTADTVNLANNPILDERLLPANIFAVGSGHVNPSR  596

Query  607   ANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILE  428
             ANDPGL+YDT  +DYLPYLCGLNYTNR+VG +LQ ++NCS V SIPEAQLNYPSFSI L 
Sbjct  597   ANDPGLIYDTPFDDYLPYLCGLNYTNRQVGNLLQRKINCSEVKSIPEAQLNYPSFSITLG  656

Query  427   STAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKA  248
             +   TYTRTVTNVG+A S Y VEI  P GV V V+P  L FS++NQKLTY VTFS ++ +
Sbjct  657   TNTHTYTRTVTNVGDAKSSYNVEIVSPRGVSVMVKPSTLTFSELNQKLTYQVTFSRTANS  716

Query  247   ARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
             + S+   VV+G L+W S +H VRSPIA  LV
Sbjct  717   SNSD---VVEGFLKWTSNRHSVRSPIAVVLV  744



>ref|XP_009767058.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=744

 Score =   939 bits (2428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/751 (66%), Positives = 588/751 (78%), Gaps = 11/751 (1%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             M FL++F +  ++  F    TI S  ETYIV+VE P S+ISTQS S    DLE WY+SFL
Sbjct  1     MNFLKIFFLFCMVSCF-PWPTIQSPFETYIVQVESPESQISTQSLSDQ--DLESWYRSFL  57

Query  2215  PTTVAGGGYGES---RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTT  2045
             P T+A     +    R+V+ YRNVMKGFAA+L+AE+VKEM  K GF+SA PE+IL LHTT
Sbjct  58    PNTIASTRSDDEEGPRLVYSYRNVMKGFAARLTAEQVKEMEKKPGFMSAWPEKILSLHTT  117

Query  2044  HSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNF  1865
             H+P FLGLQQNMG W+DS+YGKGVIIGVLD+GI+ DHPSFSDEGMPPPPA+WKG CE NF
Sbjct  118   HTPSFLGLQQNMGLWKDSNYGKGVIIGVLDTGISPDHPSFSDEGMPPPPAKWKGKCESNF  177

Query  1864  TA-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLA  1688
             T  CNNK+IGARS+ + +RS  DDDGHGTHTA TAAG FV+GANVYG+A GTA GVAPLA
Sbjct  178   TTKCNNKLIGARSYIQEDRSPIDDDGHGTHTASTAAGGFVQGANVYGNAKGTAVGVAPLA  237

Query  1687  HLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKG  1508
             HLAIYKVC+  GC+D EILAAMD AI+DGVDILSLSLGG  S  H D IALGAYSA E+G
Sbjct  238   HLAIYKVCDSSGCADGEILAAMDAAIDDGVDILSLSLGGSGSPLHSDPIALGAYSATERG  297

Query  1507  IFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFN  1328
             I VS SAGNEGP+N S SNEAPW+LTVGAST+DRK+ ATV LGN+++F GE+ F PK FN
Sbjct  298   ILVSCSAGNEGPYNSSTSNEAPWILTVGASTLDRKIKATVKLGNKKEFEGESTFHPKSFN  357

Query  1327  SSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGR  1148
              +   L  P +N SD   SPYC + +L +  +RGKIV+CM GG   R GKG+AVK+A G 
Sbjct  358   VTFFPLFDPAKNASD-FDSPYCGTGTLTDPAIRGKIVLCMAGGGYTRIGKGQAVKDAGGV  416

Query  1147  GMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNA  968
             GMI+    EYG TT A AHVLPA+D+T ADG KIL Y+N+T  P+A  +F+GTI GD+NA
Sbjct  417   GMIIYNGPEYGFTTLADAHVLPALDVTDADGMKILDYMNSTEKPVARITFQGTIIGDRNA  476

Query  967   PTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPH  788
             P VA+FSSRGP+  SPGILKPDIIGPGVNILA WP SV+N  N KSTFNIISGTSMSCPH
Sbjct  477   PMVASFSSRGPSMASPGILKPDIIGPGVNILAAWPASVENNTNLKSTFNIISGTSMSCPH  536

Query  787   LSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSK  608
             LSGVAALLKS+HP WSPA IKSA+MTTAD LN   NPI ++ L+TA++F++G+GHVNPS+
Sbjct  537   LSGVAALLKSAHPTWSPAAIKSAIMTTADTLNLANNPILDERLLTANIFAVGSGHVNPSR  596

Query  607   ANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILE  428
             ANDPGL+YDT  +DYLPYLCGLNYTNR+VG +LQ +VNCS V SI EAQLNYPSFSI L 
Sbjct  597   ANDPGLIYDTPFDDYLPYLCGLNYTNRQVGNLLQRKVNCSEVKSILEAQLNYPSFSITLG  656

Query  427   STAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKA  248
             +  QTYTRTVTNVG+A S Y+VEI  P GV V V+P  L+FSK+NQKLTY V FS  +  
Sbjct  657   TNTQTYTRTVTNVGDAKSSYSVEIISPRGVSVMVKPSTLKFSKLNQKLTYQVIFSKITNN  716

Query  247   ARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
             + S+   VV+G L+W S +H VRSPIA  LV
Sbjct  717   SNSD---VVEGFLKWTSNRHSVRSPIAVVLV  744



>ref|XP_006358961.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=745

 Score =   939 bits (2428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/746 (66%), Positives = 598/746 (80%), Gaps = 5/746 (1%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             M+FL     L  +      +T+A+ LETYIV+VE P+S+IST  +S+  +DL+ WY SFL
Sbjct  1     MEFLIRIPFLLFIFFNSLFSTMATNLETYIVQVESPNSQISTHRTST--MDLDSWYHSFL  58

Query  2215  PTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSP  2036
             PTT+A     ++RMV+ Y NV+KGFA KLS EE+KEM  K+GFISA P+R+L LHTTH+P
Sbjct  59    PTTIANS-IEDTRMVYAYHNVIKGFAVKLSDEELKEMEKKEGFISARPQRVLSLHTTHTP  117

Query  2035  GFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTAC  1856
              FLGLQQNMGFWRDS+YGKGVIIGVLD+GIA DHPSF+DEGMPPPPA+WKG CE N + C
Sbjct  118   SFLGLQQNMGFWRDSNYGKGVIIGVLDTGIAHDHPSFNDEGMPPPPAKWKGKCEFNSSIC  177

Query  1855  NNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAI  1676
             NNK+IGARSFS  + + +DDDGHGTHTA TAAG++V+ ANVYG+ANGTA GVAPLAHLAI
Sbjct  178   NNKLIGARSFSFGKGTTWDDDGHGTHTASTAAGSYVKNANVYGNANGTAVGVAPLAHLAI  237

Query  1675  YKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVS  1496
             Y+VC  +GCS+S+ILAAMD AIEDGVDILSLSLGG + SFH+D+IALGAYSAME+GIFVS
Sbjct  238   YRVCTSVGCSESDILAAMDVAIEDGVDILSLSLGGSTKSFHDDAIALGAYSAMEQGIFVS  297

Query  1495  ASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLL  1316
              SAGN GP   S++NEAPW+LTVGAST+DR + AT VLGN++ F GE+AFQPK+F+S L 
Sbjct  298   CSAGNRGPTPESVTNEAPWILTVGASTLDRNIKATAVLGNKEMFQGESAFQPKNFSSHLY  357

Query  1315  SLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMIL  1136
              LV+ G +   + + PYC + SL   D  GKIV+C  GG + R  KG+AVK A G  MIL
Sbjct  358   PLVYAGGSNQSDINDPYCSTTSLNQTDFTGKIVLCEVGGGVTRVDKGQAVKAAGGIAMIL  417

Query  1135  IEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVA  956
             +   + G TTSA AHVLPA D+TY DGQKILAYIN+TSNP+AT +F+GTI GDKN P +A
Sbjct  418   MNRMQDGFTTSADAHVLPATDVTYVDGQKILAYINSTSNPLATITFQGTIIGDKNTPVIA  477

Query  955   AFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGV  776
             +FSSRGP+R +PGILKPDIIGPGVNILA WPTSV+N    K TFNIISGTSMSCPHLSGV
Sbjct  478   SFSSRGPSRATPGILKPDIIGPGVNILAAWPTSVENNTEPKPTFNIISGTSMSCPHLSGV  537

Query  775   AALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDP  596
             AALLKSSHP+WSP+MIKSA+MTTAD +N G+  IQ+++   A++F+IG+GHVNPSKANDP
Sbjct  538   AALLKSSHPNWSPSMIKSAIMTTADTVNLGEKTIQDENHEPANLFAIGSGHVNPSKANDP  597

Query  595   GLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQ  416
             GLVYD KP DY+PYLCGLNYTNREVGVI+Q ++NCS V SI + QLNYPSFSIIL ST Q
Sbjct  598   GLVYDIKPNDYVPYLCGLNYTNREVGVIVQRKINCSEVGSIQQGQLNYPSFSIILGSTPQ  657

Query  415   TYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSN  236
             TYTRTVTNVGEA S YTV++  PPGV V VEP  L+F+++ QK++Y VTF  +    RS+
Sbjct  658   TYTRTVTNVGEAKSSYTVDVVSPPGVDVKVEPSVLKFAELKQKMSYQVTF--TQIVYRSS  715

Query  235   MPPVVQGALRWKSVKHHVRSPIAAKL  158
                 V+G L+WKS K+ VRSPIAA L
Sbjct  716   GTVDVEGFLKWKSTKYSVRSPIAALL  741



>ref|XP_006363697.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=745

 Score =   927 bits (2396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/754 (66%), Positives = 590/754 (78%), Gaps = 18/754 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTA--TIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             M FL++ LI      FCS    ++ S  ETYIV VE P S ISTQSS     DL+ +Y S
Sbjct  1     MGFLKILLIFI----FCSFPWPSVQSDFETYIVHVESPESLISTQSSL---TDLDSYYLS  53

Query  2221  FLPTTV----AGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPL  2054
             FLP T     + G    + M++ Y NVMKGF+A+L+AE+VKEM  K GF+SA  +RIL L
Sbjct  54    FLPKTTTAISSSGNEEAASMIYSYHNVMKGFSARLTAEQVKEMEKKHGFVSAQKQRILSL  113

Query  2053  HTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCE  1874
             HTTH+P FLGLQQNMG W+DS+YGKGVIIGV+D+GI  DHPSFSD GMPPPPA+WKGVCE
Sbjct  114   HTTHTPSFLGLQQNMGLWKDSNYGKGVIIGVIDTGIHPDHPSFSDVGMPPPPAKWKGVCE  173

Query  1873  LNFT-ACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVA  1697
              NFT  CNNK+IGARS+     S  DDDGHGTHTA TAAG FV+GANV+G+ANGTA GVA
Sbjct  174   SNFTNKCNNKLIGARSYQLANGSPIDDDGHGTHTASTAAGAFVKGANVFGNANGTAVGVA  233

Query  1696  PLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAM  1517
             PLAH+A+YKVC+  GCS+S+ILAAMD AI+DGVDILS+SLGG    F+EDSIALGAYSA 
Sbjct  234   PLAHIAVYKVCSSHGCSESDILAAMDAAIDDGVDILSISLGGRPIPFYEDSIALGAYSAT  293

Query  1516  EKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPK  1337
             E+GI VS SAGN GPFNGS++N APW+L+VGAST+DRK+ ATV LGN ++F GE+A++P+
Sbjct  294   ERGILVSCSAGNGGPFNGSVANSAPWILSVGASTLDRKIKATVKLGNTEEFEGESAYRPQ  353

Query  1336  DFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNA  1157
               NS+  +L   G+N SDE  +PYC   SL +  +RGK+++C+ GG +    KG+AVK+A
Sbjct  354   ISNSTFFTLFDAGKNASDEFETPYCIPGSLTDPAIRGKMIICLAGGGVLSVDKGQAVKDA  413

Query  1156  SGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGD  977
              G GMI+I    YG+T SA AHVLPA+D++ ADG KILAY+N+TSNP+AT +F+GTI GD
Sbjct  414   GGVGMIIINRPYYGVTKSADAHVLPALDVSDADGTKILAYMNSTSNPVATITFQGTIIGD  473

Query  976   KNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMS  797
             +NAP VAAFSSRGP+R SPGILKPDIIGPGVNILA WPTSVD+  N+KSTFNIISGTSMS
Sbjct  474   ENAPIVAAFSSRGPSRASPGILKPDIIGPGVNILAAWPTSVDDNKNTKSTFNIISGTSMS  533

Query  796   CPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVN  617
             CPHLSGVAALLKS+HPDWSPA IKSA+MTTAD LN   +PI ++ L+ A +F+IGAGHVN
Sbjct  534   CPHLSGVAALLKSTHPDWSPAAIKSAIMTTADTLNLASSPILDEKLLHADIFAIGAGHVN  593

Query  616   PSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSI  437
             PS+ANDPGLVYDT  EDYLPYLCGLNYTNR+VG +LQ RVNCS V SIPEAQLNYPSFS+
Sbjct  594   PSRANDPGLVYDTPFEDYLPYLCGLNYTNRQVGNLLQRRVNCSEVKSIPEAQLNYPSFSV  653

Query  436   I-LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSL  260
               L ST QTYTRTVTNVG+A+S Y VE+  P GV V VEP EL FS++NQKLTY VTF  
Sbjct  654   SELGSTPQTYTRTVTNVGDATSSYKVEVASPKGVVVEVEPSELNFSELNQKLTYQVTF--  711

Query  259   SSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
              SK   S+   V +G L+W S +H VRSPIA  L
Sbjct  712   -SKTTSSSNIEVAEGFLKWTSNRHSVRSPIAVVL  744



>ref|XP_004244591.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=743

 Score =   922 bits (2384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/751 (65%), Positives = 579/751 (77%), Gaps = 12/751 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             MK L  F + ++L G  S  +I  +LETYIV VE P ++ISTQ  S    DL+ WY+SFL
Sbjct  1     MKILNFFPVFTIL-GCFSWPSIQGELETYIVHVESPENKISTQLLSE---DLDSWYQSFL  56

Query  2215  PTTVAGGGYGES---RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTT  2045
             P TVA     E    R+V+ YRNVMKGFAA+LS E+VKEM  K GFISA P+RIL LHTT
Sbjct  57    PNTVASTNSNEEEGPRLVYSYRNVMKGFAARLSEEQVKEMEKKPGFISAQPQRILSLHTT  116

Query  2044  HSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNF  1865
             H+P FLGLQQN G W DS+YGKGVIIGVLD+GI+ DHPSFSDEGMPPPPA+WKG CE NF
Sbjct  117   HTPSFLGLQQNSGLWSDSNYGKGVIIGVLDTGISPDHPSFSDEGMPPPPAKWKGKCESNF  176

Query  1864  TA-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLA  1688
             T  CNNK+IG R+F +   S  DDDGHGTHTA TAAG+FVRGANVYG+ANGTA GVAPLA
Sbjct  177   TTMCNNKLIGVRTFPKENGSPIDDDGHGTHTASTAAGSFVRGANVYGNANGTAVGVAPLA  236

Query  1687  HLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKG  1508
             HLAIYK C  IGC+ S ILAAMD AI+DGVDILSLSLGG +  F+ D +ALGAY+A E+G
Sbjct  237   HLAIYKACESIGCASSNILAAMDAAIDDGVDILSLSLGGFTRPFYNDPVALGAYTATERG  296

Query  1507  IFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFN  1328
             I VS SAGN GP   SLSNEAPW+LTVGAST+DRK+ AT+ LGN+ +  GE+AF PK  N
Sbjct  297   ILVSCSAGNSGPAKSSLSNEAPWILTVGASTLDRKIKATLQLGNKHEIEGESAFHPKVLN  356

Query  1327  SSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGR  1148
             S+   L  PG+N  + +   YC    + N++  GKIV+C  GG + R GKG+ VKN+ G 
Sbjct  357   STFFPLNEPGKNERESTERSYCQDGLVYNSN-GGKIVLCQVGGGISRVGKGQVVKNSGGV  415

Query  1147  GMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNA  968
             GMI+I  +  GITTS +AHVLPA+DITYA+G K+LAY+N+T  P+A  +F+GTI GDKNA
Sbjct  416   GMIIINEKGDGITTSVSAHVLPALDITYANGMKVLAYMNSTKKPVARITFQGTIIGDKNA  475

Query  967   PTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPH  788
             P VAAFSSRGPN  S GILKPDIIGPGVNILA WPTS++N  N+KSTFNIISGTSMSCPH
Sbjct  476   PVVAAFSSRGPNLASRGILKPDIIGPGVNILAAWPTSMENNTNTKSTFNIISGTSMSCPH  535

Query  787   LSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSK  608
             LSGVAALLKS+HP WSPA IKSA+MTTAD +N    PI ++ L+ A++F++GAGHVNPS+
Sbjct  536   LSGVAALLKSAHPTWSPAAIKSAIMTTADTVNLANKPILDERLLPANIFAVGAGHVNPSR  595

Query  607   ANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILE  428
             ANDPGL+YDT  + YLPYLCGLNYTN+E+  +LQ +VNCS V SIPEAQLNYPSFSI L 
Sbjct  596   ANDPGLIYDTSFKSYLPYLCGLNYTNQEIQRLLQRKVNCSEVKSIPEAQLNYPSFSITLR  655

Query  427   STAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKA  248
             + +QTYTRTVTNVGEA S Y+VEI  PPGV V V+P  L+FSK+NQKLTY VTFS +  +
Sbjct  656   ANSQTYTRTVTNVGEAKSSYSVEIVSPPGVSVIVKPSTLKFSKLNQKLTYRVTFSRTENS  715

Query  247   ARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
             + S     VQG L+W S +H VRSPIA  LV
Sbjct  716   STSG---TVQGFLKWTSNRHSVRSPIAVVLV  743



>ref|XP_009608769.1| PREDICTED: subtilisin-like protease SDD1 [Nicotiana tomentosiformis]
Length=744

 Score =   916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/753 (65%), Positives = 593/753 (79%), Gaps = 15/753 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCST--ATIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             M FL++ L       FC+    +I S LETYIV+VE P S+ISTQSSS   +DLE +Y S
Sbjct  1     MGFLKILLFCI----FCTFLWPSIQSDLETYIVQVEPPESQISTQSSS---LDLESYYHS  53

Query  2221  FLP--TTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             FLP  T+++     E RM++ Y NVMKGFAA+L+A +VKEM  K GF+SA P+RILPLHT
Sbjct  54    FLPKTTSISSSENEEPRMIYSYHNVMKGFAARLTAAQVKEMEKKQGFVSAQPKRILPLHT  113

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             TH+P FLGLQQNMG W+DS+YGKGVIIGVLD+GI  DHPSFSD GMPPPPA+WKG+CE N
Sbjct  114   THTPSFLGLQQNMGLWKDSNYGKGVIIGVLDTGIFPDHPSFSDVGMPPPPAKWKGLCESN  173

Query  1867  FTA-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPL  1691
             FT  CNNK+IG RS+     S  DDDGHGTHTAGTAAG FV GANV+G+ANGTA GVAPL
Sbjct  174   FTTKCNNKLIGLRSYQLANSSPIDDDGHGTHTAGTAAGAFVNGANVFGNANGTAVGVAPL  233

Query  1690  AHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssS-FHEDSIALGAYSAME  1514
             AH+AIYKVC   GC+D +ILAAMD AI+DGVDILS+S+GG  SS FH D IALGAYSA E
Sbjct  234   AHIAIYKVCISDGCADVDILAAMDAAIDDGVDILSISIGGSRSSPFHNDPIALGAYSATE  293

Query  1513  KGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKD  1334
             +GI VS SAGN GPF+GS++N+APW+LTVGAST DRKL ATV LGN+++F GE+A++PK+
Sbjct  294   RGILVSCSAGNNGPFSGSVANDAPWILTVGASTHDRKLKATVKLGNKEEFEGESAYRPKN  353

Query  1333  FNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNAS  1154
              NS+  +L   G+N SDE  +PYC   SL +  +RGKI +C+ GG + R  KG++VK+A 
Sbjct  354   SNSTFFTLFDAGKNASDEFEAPYCKPGSLTDPAIRGKIALCLVGGGVRRVDKGQSVKDAG  413

Query  1153  GRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDK  974
             G GMI+I   + G+T SA A VLP++D++  +G KI AY+N+T NP+AT +F+GTI G+K
Sbjct  414   GVGMIIINEPDDGVTKSADALVLPSLDVSDTNGTKIQAYMNSTLNPVATITFQGTIIGEK  473

Query  973   NAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSC  794
              AP VA+FSSRGP+  SPGILKPDIIGPGVNILA WPTSVD+  N+K TFN+ISGTSMSC
Sbjct  474   IAPIVASFSSRGPSVASPGILKPDIIGPGVNILAAWPTSVDDNKNTKYTFNVISGTSMSC  533

Query  793   PHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNP  614
             PHLSGVAALLKS+HP+W+PA IKSA+MTTAD LN  +NPI ++ L+ A +F+IGAGHVNP
Sbjct  534   PHLSGVAALLKSAHPNWTPAAIKSAIMTTADTLNLAKNPILDEKLIPADIFAIGAGHVNP  593

Query  613   SKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSII  434
             S+ANDPGL+YDT  EDY+PYLCGLNYTNREVG +LQ +V+CS V  IPEAQLNYPSFSI 
Sbjct  594   SRANDPGLIYDTPFEDYVPYLCGLNYTNREVGNLLQRKVDCSKVKIIPEAQLNYPSFSIK  653

Query  433   LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSS  254
             L ST QTYTRTVTNVG+A+S Y VEI  P GV VNV P +L FSK+NQKLTY VTFS ++
Sbjct  654   LGSTPQTYTRTVTNVGDATSSYKVEIVSPKGVFVNVNPSQLNFSKLNQKLTYQVTFSKTT  713

Query  253   KAARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
                 SN   VVQG L+W S +H VRSPIAA LV
Sbjct  714   N--NSNTDDVVQGFLKWTSNRHSVRSPIAAVLV  744



>ref|XP_009762964.1| PREDICTED: subtilisin-like protease SDD1 [Nicotiana sylvestris]
Length=744

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/753 (65%), Positives = 586/753 (78%), Gaps = 15/753 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTA--TIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             M FL++ L   V    CS    +  + LETYI++VE P ++ISTQSSS   +DLE +Y S
Sbjct  1     MGFLKILLFCIV----CSFPWPSFQTDLETYIIQVEPPETQISTQSSS---LDLESYYHS  53

Query  2221  FLPTTVAGGGYG--ESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             FLP T A       E RM++ Y NVMKGFAA+L+A EVKEM  K GF SA P+RIL L T
Sbjct  54    FLPKTTAINSRNNEEPRMIYSYHNVMKGFAARLTAAEVKEMEKKQGFFSARPQRILSLQT  113

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             TH+P FLGLQQNMG W+DS+YGKGVIIGVLD+GI  DHPSFSD GMPPPPA+WKGVCE N
Sbjct  114   THTPSFLGLQQNMGLWKDSNYGKGVIIGVLDTGIFPDHPSFSDVGMPPPPAKWKGVCESN  173

Query  1867  FTA-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPL  1691
             FT  CNNK+IG RS+     S  DDDGHGTHTAGTAAG FV+GANVYG+ANGTA GVAPL
Sbjct  174   FTTKCNNKLIGLRSYQLANGSPIDDDGHGTHTAGTAAGAFVKGANVYGNANGTAVGVAPL  233

Query  1690  AHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssS-FHEDSIALGAYSAME  1514
             AH+AIYKVC   GC+D +ILAAMD AI+DGVDILS+S+GG  S  FH D IALGAYSA E
Sbjct  234   AHIAIYKVCTSDGCADVDILAAMDAAIDDGVDILSISIGGSRSRPFHTDPIALGAYSATE  293

Query  1513  KGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKD  1334
             +GI VS SAGN GPF+G ++N+APW+LTVGAST DRKL ATV LGN+++F GE+A++PK 
Sbjct  294   RGILVSCSAGNNGPFSGFVTNDAPWILTVGASTHDRKLKATVKLGNKEEFEGESAYRPKT  353

Query  1333  FNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNAS  1154
              NS+   L   G+N SDE  +PYC   SL +  +RGKIV+C+ GG + R  KG+AVK+A 
Sbjct  354   SNSTFFLLFDAGKNASDEFEAPYCKPGSLTDPAIRGKIVLCLVGGGVRRVDKGQAVKDAG  413

Query  1153  GRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDK  974
             G GMI+I   + G+T SA A VLP++D++   G KI AY+N+TSNP+AT +F+GTI GDK
Sbjct  414   GVGMIIINEPDDGVTKSADAFVLPSLDVSDVSGTKIQAYMNSTSNPVATITFQGTIIGDK  473

Query  973   NAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSC  794
             NAP VA+FS+RGP+  SPGILKPDIIGPGVNILA WPTS+D+  N+KSTFNIISGTSMSC
Sbjct  474   NAPIVASFSARGPSVASPGILKPDIIGPGVNILAAWPTSLDDNKNTKSTFNIISGTSMSC  533

Query  793   PHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNP  614
             PHLSG+AALLKS+HP+WSPA IKSA+MTTAD LN  +NPI ++ L+ A +F+IGAGHVNP
Sbjct  534   PHLSGIAALLKSAHPNWSPAAIKSAIMTTADTLNLAKNPILDERLIPADIFAIGAGHVNP  593

Query  613   SKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSII  434
             S+ANDPGL+YDT  EDY+PYLCGLNYTNREVG +LQ +++C  V SIPEAQLNYPSFSI 
Sbjct  594   SRANDPGLIYDTPFEDYVPYLCGLNYTNREVGSLLQRKLDCLKVKSIPEAQLNYPSFSIK  653

Query  433   LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSS  254
             L ST QTYTRTVTNVG+A+S Y +EI  P GV +NV P +L FSK+NQKLTY VTFS ++
Sbjct  654   LGSTPQTYTRTVTNVGDATSTYKLEIVSPKGVAINVNPSQLIFSKLNQKLTYQVTFSKTT  713

Query  253   KAARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
                 SN   VVQG L+W S +H VRSPIAA  V
Sbjct  714   N--NSNTDDVVQGFLKWTSNRHFVRSPIAAVFV  744



>ref|XP_004244590.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=738

 Score =   913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/747 (65%), Positives = 576/747 (77%), Gaps = 10/747 (1%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             MK L + L+L  ++   S  ++   L+TYIV+VE P +RISTQS S   +DLE WY SFL
Sbjct  1     MKLLNILLVL-FIVCCLSRPSMQRSLDTYIVQVESPENRISTQSMS---MDLESWYNSFL  56

Query  2215  PTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSP  2036
             P T++    G  R+V+ YRNVMKGFAA+LSAE+VKEM  K GF++A PERIL LHTT +P
Sbjct  57    PKTISNEEEGP-RLVYSYRNVMKGFAARLSAEQVKEMEKKSGFVNAWPERILSLHTTRTP  115

Query  2035  GFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA-  1859
              FLGL+QN+G W++S+YGKGVIIGVLD+GI  DHPSFSD+GMPPPPA+WKG CELNFT  
Sbjct  116   SFLGLKQNIGLWKNSNYGKGVIIGVLDTGITPDHPSFSDQGMPPPPAKWKGKCELNFTTK  175

Query  1858  CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLA  1679
             CNNK+IGAR+F +      DDDGHGTHTA TAAG FVRGANVYG+ANGTA GVAPLAHLA
Sbjct  176   CNNKIIGARTFPKENGLPIDDDGHGTHTASTAAGGFVRGANVYGNANGTAVGVAPLAHLA  235

Query  1678  IYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFV  1499
             IYK C+  GC  S +LAAMD AI+DGVDI+SLSLGG +S FH DSIALGAYSA E+GI V
Sbjct  236   IYKACDSFGCIVSNVLAAMDAAIDDGVDIISLSLGGYTSPFHSDSIALGAYSATERGILV  295

Query  1498  SASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSL  1319
             S SAGN GP   S+SNEAPW+LTVGAST+DRK+ ATV LGN++ F GE+AF PK  N+  
Sbjct  296   SCSAGNTGPSKSSVSNEAPWILTVGASTLDRKIKATVQLGNKKMFEGESAFHPKAVNTKF  355

Query  1318  LSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMI  1139
               L  P  N S+   S YC S +L + DV+GKIV+CM GG   R  KG+ V++A G GMI
Sbjct  356   FPLFVPTLNASEFRRS-YCGSGTLSDRDVKGKIVLCMIGGDYSRIEKGQTVEDAGGVGMI  414

Query  1138  LIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTV  959
             LI   E G TTSATAHVLPA+D+TYADG KI+ Y+N+T  P+A  +F+GTI GD+NAP V
Sbjct  415   LINGAEDGFTTSATAHVLPAMDVTYADGMKIIEYMNSTKKPVAQITFQGTILGDQNAPVV  474

Query  958   AAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSG  779
             AAFSSRGP+  S GILKPDIIGPGVNILA WPTS++N  N+KSTFNIISGTSMSCPHLSG
Sbjct  475   AAFSSRGPSIASRGILKPDIIGPGVNILAAWPTSMENNTNTKSTFNIISGTSMSCPHLSG  534

Query  778   VAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKAND  599
             VAALLKS+HP WSPA IKSA+MTTAD  N    PI ++ L+ AS+F++GAGHVNP +AND
Sbjct  535   VAALLKSAHPTWSPAAIKSAIMTTADTTNLANGPILDETLLPASIFAVGAGHVNPERAND  594

Query  598   PGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTA  419
             PGL+YDT  +DY+PYLCGLNYTNREVG +LQH+V+CS V SIPEAQLNYPSFSI L    
Sbjct  595   PGLIYDTPVKDYVPYLCGLNYTNREVGNLLQHKVDCSGVKSIPEAQLNYPSFSITLRENP  654

Query  418   QTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARS  239
             QTYTRTVTNVGEA S Y VEI  P GV V+V+P  L+FS  NQK TY VTFS +  ++ S
Sbjct  655   QTYTRTVTNVGEAKSSYIVEIVSPQGVSVSVKPSTLKFSNKNQKRTYRVTFSRTDNSSTS  714

Query  238   NMPPVVQGALRWKSVKHHVRSPIAAKL  158
                 VVQG L+W S +H  RSPIA  L
Sbjct  715   G---VVQGFLKWTSNRHSGRSPIAIVL  738



>ref|XP_009614060.1| PREDICTED: subtilisin-like protease SDD1 [Nicotiana tomentosiformis]
Length=748

 Score =   909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/749 (64%), Positives = 578/749 (77%), Gaps = 10/749 (1%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             MK L++ L++  ++G  S  ++ S  E YIV+VE P SRIS QS+     +LE WY SFL
Sbjct  1     MKILKILLVIFSILGCFSWPSMQSDSEIYIVQVESPESRISIQSTR---TNLESWYSSFL  57

Query  2215  PTTVAGGGYGES--RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTH  2042
             P T+A  G  E   R+++ Y NVMKGFAA+LS E+VKEM  K GFISA P+RIL LHTTH
Sbjct  58    PKTIATTGSNEDQPRLIYSYHNVMKGFAARLSVEQVKEMEKKPGFISARPQRILFLHTTH  117

Query  2041  SPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT  1862
             SP FLGLQQNMG W+DS+YGKGVIIGVLD+GI  DHPSFSD+GMPPPPA+WKG CE NFT
Sbjct  118   SPSFLGLQQNMGLWKDSNYGKGVIIGVLDTGIYPDHPSFSDKGMPPPPAKWKGKCESNFT  177

Query  1861  A-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAH  1685
               CNNK+IGAR+F++   S  DD+GHGTHTA T AG FV GANV G+ANGTA G+APLAH
Sbjct  178   TKCNNKLIGARTFAQASESPLDDNGHGTHTASTIAGRFVDGANVNGNANGTAVGIAPLAH  237

Query  1684  LAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGI  1505
             LAIYKVC+  GCSDS+ILAAMD AI+DGVDILSLSLGG S +F+ D IALGAYSA ++GI
Sbjct  238   LAIYKVCDSFGCSDSDILAAMDAAIDDGVDILSLSLGGSSKAFYNDPIALGAYSATQRGI  297

Query  1504  FVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNS  1325
              VS SA N GP++ +LSNEAPW++TVGAST+DRKL ATV LGNR++F GE+AF PK  NS
Sbjct  298   LVSCSASNNGPYDSTLSNEAPWIMTVGASTIDRKLKATVKLGNRKEFEGESAFHPKGHNS  357

Query  1324  SLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRG  1145
             +   L  P  N +D   SPYC + +L + D++GKIV+CM GG   R  KG+AVK+A G G
Sbjct  358   AFFPLFDPALNATD-FDSPYCGTGTLNDPDIKGKIVLCMAGGGYSRIEKGQAVKDAGGVG  416

Query  1144  MILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAP  965
             MI+    + G T  A AHVLPA+ ITY DG +IL Y+NATS P+A  +F+GTI GDK+AP
Sbjct  417   MIIFSSPDDGFTKFADAHVLPALYITYKDGIEILDYMNATSKPIARLAFQGTIIGDKDAP  476

Query  964   TVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHL  785
              VAAFSSRGP+  SPGILKPDIIGPGVNILA WP S +NKPN K  F + SGTSMSCPHL
Sbjct  477   VVAAFSSRGPSLASPGILKPDIIGPGVNILAAWPPSPENKPNIKPNFFLASGTSMSCPHL  536

Query  784   SGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKA  605
             SGVAALLKS+HP WSPA+IKSA+MTTA+ +N   +PI ++ L+ A++F++GAGHVNPS+A
Sbjct  537   SGVAALLKSAHPTWSPAVIKSAIMTTANTVNLANDPILDERLLPANIFAVGAGHVNPSRA  596

Query  604   NDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILES  425
             NDPGLVYDT+ +DYLPYLCGLNYTNR+VG +LQ +V+C  V SIP+AQLNYPSFSI L +
Sbjct  597   NDPGLVYDTQFKDYLPYLCGLNYTNRQVGNLLQRKVDCKQVKSIPQAQLNYPSFSITLGA  656

Query  424   TAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAA  245
              +QTYTRTVTNVG A S Y VEI  PPGV V V+P  L FSK+NQKL Y VTFS+ + ++
Sbjct  657   NSQTYTRTVTNVGVAKSSYNVEIGSPPGVSVIVKPSTLNFSKLNQKLKYQVTFSIRANSS  716

Query  244   RSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
              S    VVQG L+W   KH VRSPIA  L
Sbjct  717   NSG---VVQGFLKWTCNKHSVRSPIAVVL  742



>ref|NP_001233982.1| subtilisin-like protease precursor [Solanum lycopersicum]
 emb|CAA71234.1| subtilisin-like protease [Solanum lycopersicum]
 emb|CAA76725.1| P69B protein [Solanum lycopersicum]
Length=745

 Score =   908 bits (2346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/751 (64%), Positives = 578/751 (77%), Gaps = 18/751 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTA--TIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             M  L++ L+      FCS    TI S LETYIV VE P S ++TQS      DL  +Y S
Sbjct  1     MGLLKILLVFI----FCSFQWPTIQSNLETYIVHVESPESLVTTQSLL---TDLGSYYLS  53

Query  2221  FLP---TTVAGGGYGES-RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPL  2054
             FLP   TT++  G  E+  M++ Y NVM GFAA+L+AE+VKEM  K GF+SA  +RIL L
Sbjct  54    FLPKTATTISSSGNEEAATMIYSYHNVMTGFAARLTAEQVKEMEKKHGFVSAQKQRILSL  113

Query  2053  HTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCE  1874
             HTTH+P FLGLQQNMG W+DS+YGKGVIIGV+D+GI  DHPSFSD GMPPPPA+WKGVCE
Sbjct  114   HTTHTPSFLGLQQNMGVWKDSNYGKGVIIGVIDTGIIPDHPSFSDVGMPPPPAKWKGVCE  173

Query  1873  LNFT-ACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVA  1697
              NFT  CNNK+IGARS+     S  D  GHGTHTA TAAG FV+GANVYG+A+GTA GVA
Sbjct  174   SNFTNKCNNKLIGARSYQLGNGSPIDSIGHGTHTASTAAGAFVKGANVYGNADGTAVGVA  233

Query  1696  PLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAM  1517
             PLAH+AIYKVCN +GCS+S++LAAMD+AI+DGVDILS+SL G    FH D+IA+GAYSA 
Sbjct  234   PLAHIAIYKVCNSVGCSESDVLAAMDSAIDDGVDILSMSLSGGPIPFHRDNIAIGAYSAT  293

Query  1516  EKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPK  1337
             E+GI VS SAGN GP   +  N APW+LTVGAST+DRK+ ATV LGN ++F GE+A++PK
Sbjct  294   ERGILVSCSAGNSGPSFITAVNTAPWILTVGASTLDRKIKATVKLGNGEEFEGESAYRPK  353

Query  1336  DFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNA  1157
               N++  +L    +N  D S +PYC   SL +  +RGKIV+C   G +    KG+AVK+A
Sbjct  354   ISNATFFTLFDAAKNAKDPSETPYCRRGSLTDPAIRGKIVLCSALGHVANVDKGQAVKDA  413

Query  1156  SGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGD  977
              G GMI+I P +YG+T SA AHVLPA+ ++ ADG KILAY+N+TS+P+AT +F+GTI GD
Sbjct  414   GGVGMIIINPSQYGVTKSADAHVLPALVVSAADGTKILAYMNSTSSPVATIAFQGTIIGD  473

Query  976   KNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMS  797
             KNAP VAAFSSRGP+R SPGILKPDIIGPG NILA WPTSVD+  N+KSTFNIISGTSMS
Sbjct  474   KNAPMVAAFSSRGPSRASPGILKPDIIGPGANILAAWPTSVDDNKNTKSTFNIISGTSMS  533

Query  796   CPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVN  617
             CPHLSGVAALLK +HPDWSPA+IKSAMMTTAD LN   +PI ++ L+ A +++IGAGHVN
Sbjct  534   CPHLSGVAALLKCTHPDWSPAVIKSAMMTTADTLNLANSPILDERLLPADIYAIGAGHVN  593

Query  616   PSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSI  437
             PS+ANDPGLVYDT  EDY+PYLCGL YT+++VG ++Q RVNCS V SI EAQLNYPSFSI
Sbjct  594   PSRANDPGLVYDTPFEDYVPYLCGLKYTDQQVGNLIQRRVNCSEVKSILEAQLNYPSFSI  653

Query  436   I-LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSL  260
               L ST QTYTRTVTNVG+A+S Y VE+  P GV + VEP EL FS++NQKLTY VTF  
Sbjct  654   FGLGSTPQTYTRTVTNVGDATSSYKVEVASPEGVAIEVEPSELNFSELNQKLTYQVTF--  711

Query  259   SSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
              SK   S+ P V++G L+W S +H VRSPIA
Sbjct  712   -SKTTNSSNPEVIEGFLKWTSNRHSVRSPIA  741



>ref|XP_006363698.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=747

 Score =   907 bits (2345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/754 (64%), Positives = 588/754 (78%), Gaps = 18/754 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCS--TATIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             M FL++ LIL     FCS    +I S LETYIV VE P ++IS+QSS     DLE +Y S
Sbjct  1     MGFLKILLILI----FCSFLKPSIQSDLETYIVHVESPENQISSQSSL---TDLESYYLS  53

Query  2221  FLPTTV----AGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPL  2054
             FLP +     + G    + M++ Y NVMKGFAA+L+A +VKEM  K GF+SA  +RIL L
Sbjct  54    FLPKSTNAISSSGDEEAASMIYSYHNVMKGFAARLTAAQVKEMEKKHGFVSAQKQRILSL  113

Query  2053  HTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCE  1874
             HTTH+P FLGLQQNMG W+DS++GKGVIIGVLD+GI  DHPSFSD GMPPPPA+WKGVCE
Sbjct  114   HTTHTPSFLGLQQNMGLWKDSNFGKGVIIGVLDTGILPDHPSFSDVGMPPPPAKWKGVCE  173

Query  1873  LNFTA-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVA  1697
              NFT  CNNK+IGARS+     S  DD+GHGTHTAGTAAG FV+GANV+G+ANGTA GVA
Sbjct  174   SNFTTKCNNKLIGARSYQLGSGSPIDDNGHGTHTAGTAAGAFVKGANVFGNANGTAVGVA  233

Query  1696  PLAHLAIYKVCN-EIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSA  1520
             PLAH+A+YKVC+ + GCSDS+ILAAMD AI+DGVDILS+SLGG +  FH+D IALG YSA
Sbjct  234   PLAHIAVYKVCSSDGGCSDSDILAAMDAAIDDGVDILSISLGGSTKPFHDDGIALGTYSA  293

Query  1519  MEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQP  1340
              E+GIFVSA+AGN GP  G+++NEAPW+LTVGAST DRKL A V LGN ++F GE+A+ P
Sbjct  294   AERGIFVSAAAGNSGPSVGTVANEAPWILTVGASTHDRKLKAAVKLGNSEEFEGESAYHP  353

Query  1339  KDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKN  1160
             K  NS+  +L   G+N SD+ S+P+C   SL +  ++GKIV+C+    L +  +G++VK+
Sbjct  354   KTSNSTFFTLYDAGKNESDQFSAPFCSPGSLSDPAIKGKIVLCLRSRSLLKVDQGQSVKD  413

Query  1159  ASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITG  980
             A G GMILI  +E G+T SA AHVLPA+D++ ADG+KILAY+N++SNP+A  +F GT+ G
Sbjct  414   AGGVGMILINEQEEGVTKSAEAHVLPALDVSNADGKKILAYMNSSSNPVALITFHGTVIG  473

Query  979   DKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSM  800
             DKNAP VA+FSSRGP+  SPGILKPDIIGPGVN+LA WPTSVD+  N+KSTFNIISGTSM
Sbjct  474   DKNAPIVASFSSRGPSVASPGILKPDIIGPGVNVLAAWPTSVDDNKNTKSTFNIISGTSM  533

Query  799   SCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHV  620
             SCPHLSGVAALLKS+HPDWS A IKSA+MTTAD LN   +PI ++ L++A +F+IGAGHV
Sbjct  534   SCPHLSGVAALLKSAHPDWSAAAIKSAIMTTADTLNLANSPILDERLISADLFAIGAGHV  593

Query  619   NPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFS  440
             NPS+A+DPGL+YDT  EDY+PYLCGLNYTNREVG +LQ +VNCS V SI E QLNYPSFS
Sbjct  594   NPSRASDPGLIYDTPFEDYVPYLCGLNYTNREVGKVLQRKVNCSEVKSITEEQLNYPSFS  653

Query  439   IILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSL  260
             I L ST QTYTRTVTNVG+A S Y VEI  P GV V VEP  L FS +NQKLTY VTF+ 
Sbjct  654   IRLGSTPQTYTRTVTNVGDAKSSYKVEIVSPKGVVVKVEPSALNFSMLNQKLTYQVTFTK  713

Query  259   SSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
             +S  + ++    V+G L+W S +H VRSPIA ++
Sbjct  714   TSNISTTSD---VEGFLKWNSNRHSVRSPIAVRV  744



>ref|XP_009760953.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=748

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/749 (64%), Positives = 572/749 (76%), Gaps = 10/749 (1%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             MK L++ L++  ++G  S  ++ S  E YIV+VE P SRI  QSS     DLE WY SFL
Sbjct  1     MKMLKILLVIFSILGCFSWPSMQSDSEIYIVQVESPESRIGIQSSR---TDLESWYSSFL  57

Query  2215  PTTVAGGGYGES--RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTH  2042
             P T+A  G  E   R+++ Y NVMKGFAA+LS E VKEM  K GFISA P+RIL LHTTH
Sbjct  58    PKTIATTGSNEDQPRLIYSYHNVMKGFAARLSVEHVKEMQKKPGFISARPQRILFLHTTH  117

Query  2041  SPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT  1862
             SP FLGLQQNMG WRDS+YGKGVI+GVLD+GI  DHPSFSD+GMPPPPA+WKG CE NFT
Sbjct  118   SPSFLGLQQNMGLWRDSNYGKGVIVGVLDTGIYPDHPSFSDKGMPPPPAKWKGKCESNFT  177

Query  1861  A-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAH  1685
               CNNK+IGAR+F +   +  DD+GHGTHTA T AG FV GANV G+ANGTA G+APLAH
Sbjct  178   TKCNNKLIGARTFGQASETPLDDNGHGTHTASTIAGRFVDGANVNGNANGTAVGIAPLAH  237

Query  1684  LAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGI  1505
             LAIYKVC+  GCSDS+ILAAMD AI+DGVDILSLSLGG S +F+ D IALGAYSA ++GI
Sbjct  238   LAIYKVCDSFGCSDSDILAAMDAAIDDGVDILSLSLGGGSKAFYNDPIALGAYSATQRGI  297

Query  1504  FVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNS  1325
              VS S  N GP++ +LSNEAPW++TVGAST+DRKL ATV LGNR++F GE+AF PK  NS
Sbjct  298   LVSCSGANNGPYDSTLSNEAPWIMTVGASTIDRKLKATVKLGNRKEFEGESAFHPKGHNS  357

Query  1324  SLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRG  1145
             +   L  P  N +D   SPYC + +L + D++GKIV+CM GG   R  KG+AVK+A G G
Sbjct  358   AFFPLFDPALNATD-FDSPYCGTGTLNDPDIKGKIVLCMAGGGYSRIEKGQAVKDAGGVG  416

Query  1144  MILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAP  965
             MI+    + G T  A AHVLPA+ ITY DG +IL Y+N TS P+A  +F+GTI GDK+AP
Sbjct  417   MIIYSSPDDGFTKFADAHVLPALYITYKDGIEILDYMNTTSKPIARLAFQGTIIGDKDAP  476

Query  964   TVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHL  785
              VAAFSSRGP+  SPGILKPDIIGPGVNILA WP S DNKP  K  F + SGTSMSCPHL
Sbjct  477   VVAAFSSRGPSSASPGILKPDIIGPGVNILAAWPPSPDNKPTIKPNFFLASGTSMSCPHL  536

Query  784   SGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKA  605
             SGVAALLKS+HP WSPA+IKSA+MTTA+I+N   +PI ++ L+ A++F++GAGHVNPSKA
Sbjct  537   SGVAALLKSAHPTWSPAVIKSAIMTTANIVNLANDPILDERLLPANIFAVGAGHVNPSKA  596

Query  604   NDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILES  425
             NDPGLVYDT+ +DYLPYLCGLNYTNR+VG +LQ RV+C  V SIPEAQLNYPSFSI L +
Sbjct  597   NDPGLVYDTRFKDYLPYLCGLNYTNRQVGNLLQRRVDCKQVKSIPEAQLNYPSFSITLGA  656

Query  424   TAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAA  245
              +Q YTRTVTN G+A S Y VEI  PPGV V V+P  L+FSK+NQK  Y VTF   SK A
Sbjct  657   NSQIYTRTVTNTGDAKSSYNVEIGSPPGVSVIVKPSTLKFSKLNQKFKYQVTF---SKRA  713

Query  244   RSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
              S+   +VQG L+W S K+ VRSPIA  L
Sbjct  714   NSSNSGIVQGFLKWTSNKYSVRSPIAVVL  742



>ref|XP_004245680.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 emb|CAA06414.1| P69F protein [Solanum lycopersicum]
Length=747

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/754 (64%), Positives = 585/754 (78%), Gaps = 18/754 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCS--TATIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             M FL++ LI      FCS    +I S LETYIV VE P ++ISTQSS     DLE +Y S
Sbjct  1     MGFLKILLIFI----FCSFLRPSIQSDLETYIVHVESPENQISTQSSL---TDLESYYLS  53

Query  2221  FLPTTV----AGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPL  2054
             FLP T     + G    + M++ Y NVMKGFAA+L+A +VKEM  K GF+SA  +RI  L
Sbjct  54    FLPKTTTAISSSGDEEAASMIYSYHNVMKGFAARLTAAQVKEMEKKHGFVSAQKQRIFSL  113

Query  2053  HTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCE  1874
             HTTH+P FLGLQQNMG W+DS++G GVIIGVLD+GI  DHPSFSD GMPPPPA+WKGVCE
Sbjct  114   HTTHTPSFLGLQQNMGLWKDSNFGVGVIIGVLDTGILPDHPSFSDVGMPPPPAKWKGVCE  173

Query  1873  LNFTA-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVA  1697
              NFT  CNNK+IGARS+     S  DD+GHGTHTAGTAAG FV+GAN++G+ANGTA GVA
Sbjct  174   SNFTTKCNNKLIGARSYQLGNGSPIDDNGHGTHTAGTAAGAFVKGANIFGNANGTAVGVA  233

Query  1696  PLAHLAIYKVCN-EIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSA  1520
             PLAH+A+YKVC+ + GCSDS+ILAAMD AI+DGVDILS+SLGG +  FH+D IALG YSA
Sbjct  234   PLAHIAVYKVCSSDGGCSDSDILAAMDAAIDDGVDILSISLGGSTKPFHDDGIALGTYSA  293

Query  1519  MEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQP  1340
              E+GIFVSASAGN GP  G+++NEAPW+LTVGAST DRKL  TV LGN ++F GE+A+ P
Sbjct  294   TERGIFVSASAGNSGPSLGTVANEAPWILTVGASTHDRKLKVTVKLGNSEEFEGESAYHP  353

Query  1339  KDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKN  1160
             K  NS+   L   G+N SD+ S+P+C   SL +  ++GKIV+C+    L R  +G++VK+
Sbjct  354   KTSNSTFFPLYDAGKNESDQFSAPFCSPGSLNDPAIKGKIVLCLRSISLLRVAQGQSVKD  413

Query  1159  ASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITG  980
             A G GMILI  +E G+T SA AHVLPA+D++ ADG+KILAY+N++SNP+A+ +F GT+ G
Sbjct  414   AGGVGMILINEQEEGVTKSAEAHVLPALDVSNADGKKILAYMNSSSNPVASITFHGTVIG  473

Query  979   DKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSM  800
             DKNAP VA+FSSRGP+  SPGILKPDIIGPGVN+LA WPTSVDN  N+KSTFNI+SGTSM
Sbjct  474   DKNAPIVASFSSRGPSVASPGILKPDIIGPGVNVLAAWPTSVDNNKNTKSTFNIVSGTSM  533

Query  799   SCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHV  620
             SCPHLSGVAALLKS+HPDWSPA IKSAMMTTAD +N   +PI ++ L++A +F++GAGHV
Sbjct  534   SCPHLSGVAALLKSAHPDWSPAAIKSAMMTTADTVNLANSPILDERLISADLFAMGAGHV  593

Query  619   NPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFS  440
             NPS+A+DPGLVYDT  EDY+PYLCGLNYTNREVG +LQ +VNCS V  IPE QLNYPSFS
Sbjct  594   NPSRASDPGLVYDTPFEDYIPYLCGLNYTNREVGKVLQRKVNCSEVKRIPEGQLNYPSFS  653

Query  439   IILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSL  260
             I L ST QTYTRTVTNVG+A S Y VEI  P GV V VEP  L FS +NQKLTY V F+ 
Sbjct  654   IRLGSTPQTYTRTVTNVGDAKSSYKVEIVSPKGVVVKVEPSALNFSTLNQKLTYQVIFTK  713

Query  259   SSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
             ++  + ++    V+G L+W S +H VRSPIA ++
Sbjct  714   TTNISTTSD---VEGFLKWNSNRHSVRSPIAVRV  744



>ref|XP_006358408.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=749

 Score =   905 bits (2338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/749 (65%), Positives = 574/749 (77%), Gaps = 11/749 (1%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             MKFL + L+L  ++G  S+ ++ S LETYIV+VE P ++ISTQS S   +DLE WY SFL
Sbjct  1     MKFLNILLVL-FIVGCMSSPSMQSNLETYIVQVESPENQISTQSMS---MDLESWYNSFL  56

Query  2215  PTTVAGGGYGES--RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTH  2042
             P ++A     E   R+++ Y NVMKGFAA+LSA++VKEM  K GF++A PERIL LHTT 
Sbjct  57    PKSIASTSSNEEVPRLIYSYHNVMKGFAARLSADQVKEMKKKSGFVNAWPERILSLHTTR  116

Query  2041  SPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT  1862
             +  FLGL+QN+G WRDS+YGKGVIIGVLDSGI  DHPSFSD GMPPPPA+WKG CE NFT
Sbjct  117   TQSFLGLKQNIGLWRDSNYGKGVIIGVLDSGIFPDHPSFSDRGMPPPPAKWKGKCESNFT  176

Query  1861  A-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAH  1685
               CNNK+IGAR F +   S  DDDGHGTHTA TAAG FV+GANVYG+ANGTA GVAPLAH
Sbjct  177   TKCNNKLIGARIFPKENGSPIDDDGHGTHTASTAAGGFVKGANVYGNANGTAVGVAPLAH  236

Query  1684  LAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGI  1505
             LAIYKVC+  GCSDS ILAAMD AI+DGVDILSLSLG  +S F+ DSIALGAYSA ++GI
Sbjct  237   LAIYKVCDSFGCSDSGILAAMDVAIDDGVDILSLSLGSSTSPFYSDSIALGAYSATQRGI  296

Query  1504  FVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNS  1325
              VS SAGN GP   S++NEAPW+LTVGAST+DRK+ ATV LGN++ F GE+AF  K F++
Sbjct  297   LVSCSAGNSGPSESSVANEAPWILTVGASTLDRKIKATVQLGNKKVFEGESAFHSKFFST  356

Query  1324  SLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRG  1145
               + L  P  N S ES S YC S +L +  V+GKIV+CM GG   R  KG+AVK+A G G
Sbjct  357   KFVPLFDPSLNAS-ESDSSYCGSGTLTDRAVKGKIVLCMIGGGYTRIAKGQAVKDAGGVG  415

Query  1144  MILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAP  965
             MILI   E G TTSA AHVLPA+D+TY DG KI+ Y+N+T   +A  +F+GTI GD+NAP
Sbjct  416   MILINRIEDGFTTSADAHVLPAMDVTYEDGMKIIDYMNSTKKHVARITFQGTILGDQNAP  475

Query  964   TVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHL  785
              VA FSSRGP+  S GILKPDIIGPGVNILA WPTS++N  N+KSTFNIISGTSMSCPHL
Sbjct  476   VVAGFSSRGPSIASRGILKPDIIGPGVNILAAWPTSMENNTNTKSTFNIISGTSMSCPHL  535

Query  784   SGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKA  605
             SGVAALLKS+HP WSPA IKSA+MTTAD  N    PI ++ L+ AS+F+ GAGHVNP +A
Sbjct  536   SGVAALLKSAHPTWSPAAIKSAIMTTADTTNLANGPILDETLLPASIFAFGAGHVNPERA  595

Query  604   NDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILES  425
             NDPGL+YDT  +DY+PYLCGLNYTNREVG +LQ +V+CS V SIPEAQLNYPSFSI L  
Sbjct  596   NDPGLIYDTPVKDYVPYLCGLNYTNREVGNLLQRKVDCSEVKSIPEAQLNYPSFSITLGE  655

Query  424   TAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAA  245
               QTYTRTVTNVGEA S Y VEI    GV V V+P  L+F K+NQK TY VTF   S+ A
Sbjct  656   NPQTYTRTVTNVGEAKSSYIVEIVSSQGVSVTVKPSTLKFLKMNQKKTYQVTF---SRTA  712

Query  244   RSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
              S+   VVQG L+W S +H VRSPIA  L
Sbjct  713   NSSTSGVVQGFLKWTSNRHSVRSPIAVVL  741



>ref|XP_009608768.1| PREDICTED: subtilisin-like protease SDD1 [Nicotiana tomentosiformis]
Length=745

 Score =   904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/753 (65%), Positives = 581/753 (77%), Gaps = 16/753 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCS--TATIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             M FL++ L       FCS    +  S LETYIV+VE P S+ISTQSSS   +DLE +Y S
Sbjct  1     MGFLKILLFCI----FCSFPLPSFQSDLETYIVQVEAPESQISTQSSS---MDLESYYHS  53

Query  2221  FLP--TTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             FLP  T+++     E RMV+ Y NVMKGFAA+L+  +VKEM  K GF+SA P+RIL LHT
Sbjct  54    FLPKTTSISSRENEEPRMVYSYHNVMKGFAARLTTTQVKEMEKKQGFVSAEPQRILSLHT  113

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             TH+P FLGLQQNMG W+DS+YGKGVIIGVLD+GI  DHPSFSD GMPPPPA+WKG CE N
Sbjct  114   THTPSFLGLQQNMGLWKDSNYGKGVIIGVLDTGIFPDHPSFSDVGMPPPPAKWKGFCESN  173

Query  1867  FTA-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPL  1691
             FT  CNNK+IGARSF     S  D++GHGTHTAGTAAG FV+GANV+G+ANGTA GVAPL
Sbjct  174   FTTKCNNKLIGARSFPLTNGSPIDENGHGTHTAGTAAGAFVKGANVFGNANGTAVGVAPL  233

Query  1690  AHLAIYKVCNEIG-CSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAME  1514
             AH+AIYKVC+  G CSD EILAAMD AI+DGVDILS+SLGG S+ FH D IALGAYSA E
Sbjct  234   AHIAIYKVCDSGGSCSDVEILAAMDAAIDDGVDILSISLGGTSNPFHNDKIALGAYSATE  293

Query  1513  KGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKD  1334
             +GI VS SAGN GP   +++N+APW+LTVGAST DRKL ATV LGN+++F GE+A+ PK 
Sbjct  294   RGILVSCSAGNSGPSQRTVANDAPWILTVGASTHDRKLKATVKLGNKEEFEGESAYHPKT  353

Query  1333  FNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNAS  1154
              NS+  +L    +   ++  +P+C   SL +  +RGKIVVC+ GG + R  KG+ VK+A 
Sbjct  354   SNSTFFTLFDVEKIVHEQFDAPFCVPGSLTDPAIRGKIVVCLVGGGVRRVDKGQVVKDAG  413

Query  1153  GRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDK  974
             G GMILI   E G+T SA AHVLPA+D++  DG+KILAYIN+TSNP+A  +F GT+ GDK
Sbjct  414   GVGMILINNPEDGVTKSAEAHVLPALDVSDVDGKKILAYINSTSNPVAAITFHGTVIGDK  473

Query  973   NAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSC  794
             NAP VA+FSSRGP+  S GILKPDIIGPGVN+LA WPTSVDN  N+KSTFNIISGTSMSC
Sbjct  474   NAPIVASFSSRGPSEASRGILKPDIIGPGVNVLAAWPTSVDNNKNTKSTFNIISGTSMSC  533

Query  793   PHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNP  614
             PHLSG+AALLKS+HP+WSPA IKSA+MTT D LN  +NPI ++ L+ A +F+IGAGHVNP
Sbjct  534   PHLSGIAALLKSAHPNWSPAAIKSAIMTTTDTLNLAKNPILDERLIPADIFAIGAGHVNP  593

Query  613   SKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSII  434
             S+ANDPGL+YDT  EDY+PYLCGLNYTNREVG +LQ +VNCS V SIPEAQLNYPSFSI 
Sbjct  594   SRANDPGLIYDTPFEDYVPYLCGLNYTNREVGKLLQGKVNCSEVKSIPEAQLNYPSFSIR  653

Query  433   LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSS  254
             L ST QTYTRTVTNVG A+S Y VEI  P GV V V+P +L FS +NQKLTY VTF   S
Sbjct  654   LRSTPQTYTRTVTNVGNATSIYKVEIVSPKGVAVKVKPSKLNFSILNQKLTYQVTF---S  710

Query  253   KAARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
             K   ++   V QG L+W S +H V SPIA  L+
Sbjct  711   KTTNNSDREVGQGFLKWNSDRHSVSSPIAVVLL  743



>ref|XP_004244588.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=744

 Score =   904 bits (2336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/747 (64%), Positives = 578/747 (77%), Gaps = 13/747 (2%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTT  2207
             +++F ++  ++   S  ++ S LETYIV+VE P S+ISTQSS    VDLE WY SFLP T
Sbjct  1     MKIFFVIFAILACLSWHSMQSDLETYIVQVESPESQISTQSSR---VDLESWYNSFLPKT  57

Query  2206  VAGGGYGE-SRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGF  2030
             +A  G  E S +++ YRNV+KGFAA+LSA++VKEM  K GFISA P+RIL LHTTH+P F
Sbjct  58    IAIAGSDEKSWLIYSYRNVIKGFAARLSAKQVKEMEKKPGFISAWPQRILSLHTTHTPSF  117

Query  2029  LGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA-CN  1853
             LGLQQN+G WRDS+YGKGVIIGVLD+GI+ DHPSFSDEGM PPPA+WKG CE NFT  CN
Sbjct  118   LGLQQNVGLWRDSNYGKGVIIGVLDTGISPDHPSFSDEGMAPPPAKWKGKCESNFTTKCN  177

Query  1852  NKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIY  1673
             NK+IGAR+F     S  D+DGHGTHTA TAAG+FV+GANVYG+A GTA G+APLAHLAIY
Sbjct  178   NKLIGARTFPISSDSPIDEDGHGTHTASTAAGSFVKGANVYGNAEGTAVGIAPLAHLAIY  237

Query  1672  KVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSA  1493
             KVC+  GC+DS+ILAAMD AI+DGVDILSLSLGG S  F+ D  ALGAYSA ++GI VS 
Sbjct  238   KVCDSSGCADSDILAAMDAAIDDGVDILSLSLGGSSIPFYTDPTALGAYSAAQRGILVSC  297

Query  1492  SAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLS  1313
             SAGN GP++ +LSNEAPW+LTVGAST+DRKL ATV LGN+Q F GETAF PKD NS+   
Sbjct  298   SAGNSGPYDSTLSNEAPWILTVGASTIDRKLKATVKLGNQQLFEGETAFNPKDHNSTFSP  357

Query  1312  LVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILI  1133
             L  P  N +D    PYC  ++L   +++GKIVVC  GG + R  KG+ VK+A G GMI+I
Sbjct  358   LFDPSLNATD-FERPYCGPDTLSEPEIKGKIVVCKAGGGIPRIVKGKTVKDAGGVGMIII  416

Query  1132  EPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAA  953
                + G T  A  HVLPA+ ITY DG +IL Y+N TS P+A  +F+GTI GDK+AP V A
Sbjct  417   STADDGFTIPADPHVLPALYITYKDGMEILDYMNTTSKPIARIAFQGTIIGDKHAPVVTA  476

Query  952   FSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVA  773
             FSSRGP+  SPGILKPDIIGPG+NILA WPTS+DNK N+KSTFNIISGTSMSCPHLSGVA
Sbjct  477   FSSRGPSIASPGILKPDIIGPGLNILAAWPTSIDNKTNTKSTFNIISGTSMSCPHLSGVA  536

Query  772   ALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPG  593
             ALLKS+HP WSPA IKSA+MTTA  +N   +PI ++ L+ A++F+IGAGHVNPS+ANDPG
Sbjct  537   ALLKSTHPTWSPAAIKSAIMTTATTVNLANDPILDERLLPANIFAIGAGHVNPSRANDPG  596

Query  592   LVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQT  413
             L+YDT+ +DYLPYLCGLNYTNR+VG +LQ +V C  V  IPEAQLNYPSFSI L   +QT
Sbjct  597   LIYDTEFKDYLPYLCGLNYTNRQVGNLLQRKVECKEVKHIPEAQLNYPSFSIALGEISQT  656

Query  412   YTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNM  233
             YTRTVTNVGEA S Y+VEI  PPGV V V+P  L+FS+++QKL Y VTF+      R+N 
Sbjct  657   YTRTVTNVGEAKSSYSVEIASPPGVSVIVKPSTLEFSQLDQKLKYQVTFT-----KRNNS  711

Query  232   PP--VVQGALRWKSVKHHVRSPIAAKL  158
             P   + QG L+W S  + VRSPIA  L
Sbjct  712   PNSGIAQGFLKWSSKNYSVRSPIAVVL  738



>emb|CAA07250.1| serine protease [Solanum lycopersicum]
Length=747

 Score =   904 bits (2335),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/754 (65%), Positives = 582/754 (77%), Gaps = 15/754 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             M FL++ L+   + G     TI S LETY+V VE P S ISTQSS     DL+ +Y SFL
Sbjct  1     MGFLKILLVF--IFGSFPWPTIQSNLETYLVHVESPESLISTQSSL---TDLDSYYLSFL  55

Query  2215  PTTV----AGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             P T     + G    + M++ Y NVM GFAA+L+AE+VKEM    GF+SA  +R L L T
Sbjct  56    PKTTTAISSSGNEEAATMIYSYHNVMTGFAARLTAEQVKEMEKIHGFVSAQKQRTLSLDT  115

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             TH+  FLGLQQNMG W+DS+YGKGVIIGV+D+GI  DHPSFSD GMPPPPA+WKGVCE N
Sbjct  116   THTSSFLGLQQNMGVWKDSNYGKGVIIGVIDTGILPDHPSFSDVGMPPPPAKWKGVCESN  175

Query  1867  FT-ACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPL  1691
             FT  CNNK+IGARS+     S  DDDGHGTHTA TAAG FV GANV+G+ANGTAAGVAP 
Sbjct  176   FTNKCNNKLIGARSYQLGHGSPIDDDGHGTHTASTAAGAFVNGANVFGNANGTAAGVAPF  235

Query  1690  AHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssS-FHEDSIALGAYSAME  1514
             AH+A+YKVCN  GC+D+++LAAMD AI+DGVDILS+SLGG  SS F+ + IALGAYSA E
Sbjct  236   AHIAVYKVCNSDGCADTDVLAAMDAAIDDGVDILSISLGGGGSSDFYSNPIALGAYSATE  295

Query  1513  KGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKD  1334
             +GI VS SAGN GP  GS+ NEAPW+LTVGAST DRKL ATV LGN ++F GE+A++PK 
Sbjct  296   RGILVSCSAGNNGPSTGSVGNEAPWILTVGASTQDRKLKATVKLGNGEEFEGESAYRPKI  355

Query  1333  FNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNAS  1154
              NS+  +L   G+N SDE  +PYC S SL +  +RGKIV+C+ GG + R  KG+AVK+A 
Sbjct  356   SNSTFFALFDAGKNASDEFETPYCRSGSLTDPVIRGKIVICLAGGGVPRVDKGQAVKDAG  415

Query  1153  GRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDK  974
             G GMI+I  +  G+T SA AHVLPA+DI+ ADG KILAY+N+TSNP+AT +F+GTI GDK
Sbjct  416   GVGMIIINQQRSGVTKSADAHVLPALDISDADGTKILAYMNSTSNPVATITFQGTIIGDK  475

Query  973   NAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSC  794
             NAP VAAFSSRGP+  S GILKPDIIGPGVNILA WPTSVD+  N+KSTFNIISGTSMSC
Sbjct  476   NAPIVAAFSSRGPSGASIGILKPDIIGPGVNILAAWPTSVDDNKNTKSTFNIISGTSMSC  535

Query  793   PHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNP  614
             PHLSGVAALLKS+HPDWSPA IKSAMMTTAD LN   +PI ++ L+ A +++IGAGHVNP
Sbjct  536   PHLSGVAALLKSTHPDWSPAAIKSAMMTTADTLNLANSPILDERLLPADIYAIGAGHVNP  595

Query  613   SKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSII  434
             S+ANDPGLVYDT  EDY+PYLCGLNYTNR+VG +LQ +VNCS V SI EAQLNYPSFSI 
Sbjct  596   SRANDPGLVYDTPFEDYVPYLCGLNYTNRQVGNLLQRKVNCSEVKSILEAQLNYPSFSIY  655

Query  433   -LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLS  257
              L ST QTYTRTVTNVG+A S Y VE+  P GV + VEP EL FS++NQKLTY VTF   
Sbjct  656   DLGSTPQTYTRTVTNVGDAKSSYKVEVASPEGVAIEVEPSELNFSELNQKLTYQVTF---  712

Query  256   SKAARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
             SK A S+   V++G L+W S +H VRSPIA  L+
Sbjct  713   SKTANSSNTEVIEGFLKWTSNRHSVRSPIALLLI  746



>ref|XP_009776157.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=748

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/745 (65%), Positives = 570/745 (77%), Gaps = 14/745 (2%)
 Frame = -1

Query  2371  ILSVLIGFCSTATI-----ASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTT  2207
             +L+++I FC    I        LETYIV+VE P ++ISTQS S    DLE WY+SFLP T
Sbjct  3     LLNIIIFFCIFGCILWPSMQINLETYIVQVESPENKISTQSLSH---DLESWYQSFLPNT  59

Query  2206  VAGGGYGE-SRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGF  2030
             ++     E SR+++ Y NVMKGFAA+LSAEEVKEM  K GF+ A PERIL LHTTH+P F
Sbjct  60    ISSTSSNEESRLIYSYHNVMKGFAARLSAEEVKEMEKKPGFVYAWPERILSLHTTHTPSF  119

Query  2029  LGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNF-TACN  1853
             LGLQQNMG W+DS+YGKGVIIGVLDSGI  DHPSFSD+GMPPPP +WKG CE NF T CN
Sbjct  120   LGLQQNMGMWKDSNYGKGVIIGVLDSGIFPDHPSFSDKGMPPPPVKWKGKCESNFSTKCN  179

Query  1852  NKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIY  1673
             NK+IGAR+F +   S  DDDGHGTHTA TAAG FV GANVYG+ANGTA G+APLAHLAIY
Sbjct  180   NKLIGARTFPQANGSPIDDDGHGTHTASTAAGGFVEGANVYGNANGTAVGIAPLAHLAIY  239

Query  1672  KVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSA  1493
             K+C+  GCSDS ILAAMD AI+DGVDILSLSLG  +S FH D IALGAYSA ++GI V  
Sbjct  240   KICDSFGCSDSGILAAMDAAIDDGVDILSLSLGTSTSPFHNDPIALGAYSATQRGILVVC  299

Query  1492  SAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLS  1313
             SAGN GP   S+ NEAPW+LTVGAST+DRK+ ATV LGN++ F GE+AF PK F++    
Sbjct  300   SAGNSGPSESSVLNEAPWILTVGASTLDRKIKATVQLGNKKVFEGESAFHPKAFSTKFFP  359

Query  1312  LVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILI  1133
             L  P  + S+  SS YC + +L N  ++GKIV+CM GG   R  KG+AV++A G GMILI
Sbjct  360   LFDPALDGSEFDSS-YCGTGTLTNPAIKGKIVLCMVGGGYSRIVKGQAVQDAGGVGMILI  418

Query  1132  EPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAA  953
                + G TTSA AHVLPA+D+TY DG KI  Y+N+T   +A  + +GTI GDKNAP VA 
Sbjct  419   NSIDDGFTTSADAHVLPAMDVTYDDGMKITEYMNSTKKSIARITLQGTIIGDKNAPIVAG  478

Query  952   FSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVA  773
             FSSRGP+  + GILKPDI+GPGVNILA WPTSV+N  N+KSTFNIISGTSMSCPHLSGVA
Sbjct  479   FSSRGPSIATRGILKPDILGPGVNILAAWPTSVENNTNTKSTFNIISGTSMSCPHLSGVA  538

Query  772   ALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPG  593
             ALLKS+HP WSPA IKSA+MTTAD +N   NPI ++ L  AS+F+IGAGHVNPS+ANDPG
Sbjct  539   ALLKSAHPTWSPAAIKSAIMTTADTVNLANNPILDEMLRPASIFAIGAGHVNPSRANDPG  598

Query  592   LVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQT  413
             LVYDTK +DYLPYLCGLNYTNREVG +LQ +VNCS V +IPEAQLNYPSFSI   + +QT
Sbjct  599   LVYDTKFKDYLPYLCGLNYTNREVGNLLQRKVNCSEVKTIPEAQLNYPSFSITFGTHSQT  658

Query  412   YTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNM  233
             YTRT TNVGEA   Y VEI  PPGV V V+P  L+FSK+NQK +Y VTF   S+ A S+ 
Sbjct  659   YTRTATNVGEAKFSYNVEIVSPPGVSVTVKPSILKFSKLNQKRSYQVTF---SRTANSST  715

Query  232   PPVVQGALRWKSVKHHVRSPIAAKL  158
               VVQG L+W S +H VR+PIA  L
Sbjct  716   SGVVQGFLKWTSNRHSVRNPIAVVL  740



>emb|CAA76727.1| P69D protein [Solanum lycopersicum]
Length=747

 Score =   903 bits (2333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/754 (63%), Positives = 584/754 (77%), Gaps = 18/754 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCS--TATIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             M FL++ LI      FCS    +I S LETYIV VE P ++ISTQSS     DLE +Y S
Sbjct  1     MGFLKILLIFI----FCSFLRPSIQSDLETYIVHVESPENQISTQSSL---TDLESYYLS  53

Query  2221  FLPTTV----AGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPL  2054
             FLP T     + G    + M++ Y NVMKGFAA+L+A +VKEM  K GF+SA  +RI  L
Sbjct  54    FLPKTTTAISSSGDEEAASMIYSYHNVMKGFAARLTAAQVKEMEKKHGFVSAQKQRIFSL  113

Query  2053  HTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCE  1874
             HTTH+P FLGLQQNMG W+DS++G GVIIGVLD+GI  DHPSFSD GMPPPPA+WKGVCE
Sbjct  114   HTTHTPSFLGLQQNMGLWKDSNFGVGVIIGVLDTGILPDHPSFSDVGMPPPPAKWKGVCE  173

Query  1873  LNFTA-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVA  1697
              NFT  CNNK+IGARS+     S  DD+GHGTHTAGTAAG FV+G N++G+ANGTA GVA
Sbjct  174   SNFTTKCNNKLIGARSYQLGNGSPIDDNGHGTHTAGTAAGAFVKGVNIFGNANGTAVGVA  233

Query  1696  PLAHLAIYKVCN-EIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSA  1520
             PLAH+A+YKVC+ + GCSDS+ILAAMD AI+DGVDILS+SLGG +  FH+D IALG YSA
Sbjct  234   PLAHIAVYKVCSSDGGCSDSDILAAMDAAIDDGVDILSISLGGSTKPFHDDGIALGTYSA  293

Query  1519  MEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQP  1340
              E+GIFVSASAGN GP  G+++NEAPW+LTVGAST DRKL  TV LGN ++F GE+A+ P
Sbjct  294   TERGIFVSASAGNSGPSLGTVANEAPWILTVGASTHDRKLKVTVKLGNSEEFEGESAYHP  353

Query  1339  KDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKN  1160
             K  NS+   L   G+N SD+ S+P+C   SL +  ++GKIV+C+    L R  +G++VK+
Sbjct  354   KTSNSTFFPLYDAGKNESDQFSAPFCSPGSLNDPAIKGKIVLCLRSISLLRVAQGQSVKD  413

Query  1159  ASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITG  980
             A G GMILI  ++ G+T SA AHVLPA+D++ ADG+KILAY+N++SNP+A+ +F GT+ G
Sbjct  414   AGGVGMILINEQKRGVTKSAEAHVLPALDVSNADGKKILAYMNSSSNPVASITFHGTVIG  473

Query  979   DKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSM  800
             DKNAP VA+FSSRGP+  SPGILKPDIIGPGVN+LA WPTSVDN  N+KSTFNI+SGTSM
Sbjct  474   DKNAPIVASFSSRGPSVASPGILKPDIIGPGVNVLAAWPTSVDNNKNTKSTFNIVSGTSM  533

Query  799   SCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHV  620
             SCPHLSGVAALLKS+HPDWSPA IKSAMMTTAD +N   +PI ++ L++A +F++GAGHV
Sbjct  534   SCPHLSGVAALLKSAHPDWSPAAIKSAMMTTADTVNLANSPILDERLISADLFAMGAGHV  593

Query  619   NPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFS  440
             NPS+A+DPGLVYDT  EDY+PYLCGLNYTNREVG +LQ +VNCS V  IPE QLNYPSFS
Sbjct  594   NPSRASDPGLVYDTPFEDYIPYLCGLNYTNREVGKVLQRKVNCSEVKRIPEGQLNYPSFS  653

Query  439   IILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSL  260
             I L ST QTYTRTVTNVG+A S Y VEI  P GV V VEP  L FS +NQKLTY V F+ 
Sbjct  654   IRLGSTPQTYTRTVTNVGDAKSSYKVEIVSPKGVVVKVEPSALNFSTLNQKLTYQVIFTK  713

Query  259   SSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
             ++  + ++    V+G L+W S +H VRSPIA ++
Sbjct  714   TTNISTTSD---VEGFLKWNSNRHSVRSPIAVRV  744



>ref|XP_004244716.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=767

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/745 (63%), Positives = 579/745 (78%), Gaps = 9/745 (1%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTT  2207
             +++F ++  ++G  +  ++ S LETYIV+VE P S+ISTQSS    +DLE+WYKSFLP T
Sbjct  24    MKIFFVIFGILGCFTWPSMQSDLETYIVQVESPESQISTQSSR---MDLENWYKSFLPKT  80

Query  2206  VAGGGYGES-RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGF  2030
             +A    GE  R+++ Y NV+ GFAA+LSA++VKEM  K GFISA P+RIL LHTTH+P F
Sbjct  81    IATSSSGEKPRLIYSYHNVISGFAARLSAKQVKEMEKKPGFISAWPQRILSLHTTHTPSF  140

Query  2029  LGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA-CN  1853
             LGLQQN+G WRD++YGKGVIIGV+D+GI  DHPSFSD+GMPPPPA+WKG CE NFT  CN
Sbjct  141   LGLQQNVGLWRDANYGKGVIIGVIDTGIDPDHPSFSDKGMPPPPAKWKGKCESNFTKKCN  200

Query  1852  NKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIY  1673
             NK+IGAR+F     S  D+ GHGTHTA TAAG FV+GANV G+A GTA GVAPLAHLA+Y
Sbjct  201   NKLIGARTFPLGSDSPIDEAGHGTHTASTAAGGFVKGANVNGNAKGTAVGVAPLAHLAMY  260

Query  1672  KVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSA  1493
             KVC   GC DS++LAAMD AI+DGVDILS+SLGG S SF++D IALGAYSA ++GI VS 
Sbjct  261   KVCQSFGCDDSDVLAAMDAAIDDGVDILSISLGGSSRSFYQDPIALGAYSAAQRGILVSC  320

Query  1492  SAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLS  1313
             SA N GP+  +LSN+APW++TVGAST+DRKL ATV LGN++ F GE+AF P D NS+   
Sbjct  321   SAANNGPYESTLSNDAPWIMTVGASTLDRKLKATVTLGNQKVFEGESAFHPNDHNSAFSP  380

Query  1312  LVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILI  1133
             L  P  N +D   SPYC + +L + +++GKIV+CM GG      +G+AVK+A G GMI++
Sbjct  381   LFDPSLNATD-FDSPYCGTGTLNDPEIKGKIVICMVGGGYSMTQQGQAVKDAGGVGMIVV  439

Query  1132  EPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAA  953
                +YG+T    AHVLPA+ ITY DG +IL Y+N TS P A   F+GTI GDK+AP VAA
Sbjct  440   STADYGVTMFVDAHVLPALYITYKDGMEILDYMNKTSKPTAKILFQGTIIGDKDAPVVAA  499

Query  952   FSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVA  773
             FSSRGP+  SPGILKPDIIGPGVNILA WPTSV+NK N+KSTFNIISGTSMSCPHLSGVA
Sbjct  500   FSSRGPSLASPGILKPDIIGPGVNILAAWPTSVENKTNTKSTFNIISGTSMSCPHLSGVA  559

Query  772   ALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPG  593
             ALLKSSHP WSP+ IKSA+MTTA  +N   +PI ++ L+ A++F+IGAGHVN S+ANDPG
Sbjct  560   ALLKSSHPTWSPSAIKSAIMTTAYTVNFANDPILDERLLPANIFAIGAGHVNLSRANDPG  619

Query  592   LVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQT  413
             L+YDT  +DYLPYLCGLNYTNR+VG +LQ +V+C  V SIPEAQLNYPSFSI L   +QT
Sbjct  620   LIYDTPFKDYLPYLCGLNYTNRQVGNLLQRKVDCREVKSIPEAQLNYPSFSITLGEVSQT  679

Query  412   YTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNM  233
             YTRTVTNVGEA S Y+VE+  PPG+ V V+P  L+FSK+NQKL Y VTF  + +  R+N 
Sbjct  680   YTRTVTNVGEAKSSYSVEVASPPGISVTVKPSTLKFSKLNQKLKYKVTF--TKRVNRTNG  737

Query  232   PPVVQGALRWKSVKHHVRSPIAAKL  158
               V++G L+W S KH VRSPIA  L
Sbjct  738   -GVIEGFLKWTSEKHSVRSPIAVVL  761



>ref|XP_006358840.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=747

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/752 (64%), Positives = 579/752 (77%), Gaps = 16/752 (2%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTA--TIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLP  2213
             +  F IL V I FCS    TI S LETYIV VE P S ISTQSS     DL+ +Y SFLP
Sbjct  1     MGFFKILLVFI-FCSFPWPTIQSGLETYIVHVESPESLISTQSSL---TDLDSYYLSFLP  56

Query  2212  TTVAG----GGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTT  2045
              T       G    + M++ Y NVMKGFAA+L+AE+VKEM  K GF+SA  +RIL L TT
Sbjct  57    KTTTAISSRGNEEAATMIYSYHNVMKGFAARLTAEQVKEMEKKHGFVSAQKQRILSLDTT  116

Query  2044  HSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNF  1865
             H+P FLGLQQNMG W+DS+YGKGVIIGV+D+GI  DHPSFSD GMPPPPA+WKGVCE NF
Sbjct  117   HTPSFLGLQQNMGIWKDSNYGKGVIIGVIDTGILPDHPSFSDVGMPPPPAKWKGVCESNF  176

Query  1864  -TACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLA  1688
                CNNK+IGARS+     S  D +GHGTHTA TAAG FV+GANVYG+ANGTA GVAPLA
Sbjct  177   INKCNNKLIGARSYKRGNGSPIDGNGHGTHTASTAAGAFVKGANVYGNANGTAVGVAPLA  236

Query  1687  HLAIYKVCN-EIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEK  1511
             H+A+YKVC+ + GCSDS+ILAAMD+AI+DGVD+LS+SLGG  +SF++D IALGAYSA  +
Sbjct  237   HIAVYKVCSSDGGCSDSDILAAMDSAIDDGVDVLSISLGGSPNSFYDDPIALGAYSATAR  296

Query  1510  GIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDF  1331
             GI VS SAGN GP   S+ N APW+LTVGAST+DRK+ ATV LGNR++F GE+A+ PK  
Sbjct  297   GILVSCSAGNRGPLLASVGNAAPWILTVGASTIDRKMKATVKLGNREEFEGESAYHPKIS  356

Query  1330  NSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASG  1151
             NS+  +L    ++  D+S +PYC   SL +  +RGKIV+C+ GG +    KG+ VK+A G
Sbjct  357   NSTFFTLFDAAKHAKDQSETPYCKPGSLNDPVIRGKIVLCLAGGGVSSVAKGQVVKDAGG  416

Query  1150  RGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKN  971
              GMI+I+  +YG+T SA AHVLPA+D++ ADG +I AY N+T N +AT +F+GTI GDKN
Sbjct  417   VGMIVIKTSQYGVTKSADAHVLPALDVSDADGLRIRAYTNSTINSVATITFQGTIIGDKN  476

Query  970   APTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCP  791
             AP VAAFSSRGP+R SPGILKPDIIGPGVNILA WPTSVD+  N+KSTFNIISGTSMSCP
Sbjct  477   APIVAAFSSRGPSRASPGILKPDIIGPGVNILAAWPTSVDDNKNTKSTFNIISGTSMSCP  536

Query  790   HLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPS  611
             HLSGVAALLKSSHPDWSPA+IKSA+MTTAD LN   +PI ++ L+ A +F++GAGHVNPS
Sbjct  537   HLSGVAALLKSSHPDWSPAVIKSAIMTTADTLNLANSPILDERLLRADIFAMGAGHVNPS  596

Query  610   KANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSII-  434
             +ANDPGLVYDT  EDY+PY CGLNYTNREVG +LQ +VNC  V SIPEAQLNYPSFSI  
Sbjct  597   RANDPGLVYDTPFEDYVPYFCGLNYTNREVGKMLQRQVNCLKVKSIPEAQLNYPSFSIFR  656

Query  433   LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSS  254
             L ST QTYTRTVTNVG+A+S Y VE+  P GV V V+P EL FS++NQKLTY VTF   S
Sbjct  657   LGSTPQTYTRTVTNVGDATSSYEVEVASPKGVVVEVKPTELNFSELNQKLTYQVTF---S  713

Query  253   KAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
             K   ++   +V G L+W S +H VRSPIA  L
Sbjct  714   KTTNNSNFVIVGGFLKWTSNRHSVRSPIAIVL  745



>ref|XP_009762965.1| PREDICTED: subtilisin-like protease SDD1 [Nicotiana sylvestris]
Length=744

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/753 (65%), Positives = 581/753 (77%), Gaps = 17/753 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTA--TIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             M FL++ L   +    CS    T  + LETYIV+VE P S+ISTQSSS   +DLE +Y S
Sbjct  1     MGFLKILLFWII----CSFPWPTFQNDLETYIVQVEPPESQISTQSSS---MDLESYYHS  53

Query  2221  FLP--TTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             FLP  TT++     E RM++ Y NVMKGFAA+L+A +VKEM  K GF+SA P+RIL LHT
Sbjct  54    FLPKTTTISSRENEEPRMIYSYHNVMKGFAARLTAAQVKEMEKKQGFVSAKPQRILSLHT  113

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             TH+P FLGLQQNMG W+DS+YGKGVIIGVLD+GI  DHPSFSD GM PPPA+WKG CE N
Sbjct  114   THTPSFLGLQQNMGLWKDSNYGKGVIIGVLDTGIVPDHPSFSDVGMSPPPAKWKGFCESN  173

Query  1867  FTA-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPL  1691
             FT  CNNK+IGARSF      + D++GHGTHTAGTAAG FV+GANV+G+ANGTA GVAPL
Sbjct  174   FTTKCNNKLIGARSFPLGNGPI-DENGHGTHTAGTAAGAFVKGANVFGNANGTAVGVAPL  232

Query  1690  AHLAIYKVCNEIG-CSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAME  1514
             AH+AIYKVC+  G CSD EILAAMD AI+DGVDILS+SLGG S+ FH DSIALGAYSA E
Sbjct  233   AHIAIYKVCDSDGSCSDVEILAAMDAAIDDGVDILSISLGGTSNPFHTDSIALGAYSATE  292

Query  1513  KGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKD  1334
             +GI VS SAGN GP   +++N+APW+LTVGAST DRKL ATV LGN+++F GE+A+ PK 
Sbjct  293   RGILVSCSAGNNGPSQRTVANDAPWILTVGASTHDRKLKATVKLGNKEEFEGESAYHPKT  352

Query  1333  FNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNAS  1154
              NS+  +L    +   ++  +P+C   SL +  +RGKIVVC+ GG + R  KG+ VK+A 
Sbjct  353   SNSTFFTLFDVEKIVHEQFDAPFCVPGSLTDPSIRGKIVVCLVGGGVSRVNKGQVVKDAG  412

Query  1153  GRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDK  974
             G GMILI     G+T SA AHVLPA+D++ ADG+KILAYIN+TSNP+A  +F GT+ GDK
Sbjct  413   GVGMILINNPNDGVTKSAEAHVLPALDVSDADGKKILAYINSTSNPVAAITFHGTVLGDK  472

Query  973   NAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSC  794
             NAP VA+FSSRGP+  S GILKPDIIGPGVN+LA WPTSVDN  N+KSTFNIISGTSMSC
Sbjct  473   NAPIVASFSSRGPSEASRGILKPDIIGPGVNVLAAWPTSVDNNKNTKSTFNIISGTSMSC  532

Query  793   PHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNP  614
             PHLSG+AALLKS+HPDWSPA IKSA+MTT   LN  +NPI ++ L+ A +F+IGAGHVNP
Sbjct  533   PHLSGIAALLKSAHPDWSPAAIKSAIMTTTYTLNLAKNPILDERLIPADIFAIGAGHVNP  592

Query  613   SKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSII  434
             S+ANDPGLVYDT  EDY+PYLCGLNYTNREVG +LQ +VNCS V SIPEAQLNYPSFSI 
Sbjct  593   SRANDPGLVYDTPFEDYVPYLCGLNYTNREVGKLLQGKVNCSEVKSIPEAQLNYPSFSIR  652

Query  433   LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSS  254
             L ST QTYTRTVTNVG A+S Y VEI  P GV V V+P +L FS +NQKLTY VTF   +
Sbjct  653   LRSTPQTYTRTVTNVGNATSIYKVEIVSPKGVAVKVKPSKLNFSILNQKLTYQVTF---T  709

Query  253   KAARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
             K   ++   V QG L+W S +H V SPIA  L+
Sbjct  710   KTTNNSDREVGQGFLKWNSNRHSVSSPIAVVLL  742



>ref|XP_006358372.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=734

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/749 (64%), Positives = 564/749 (75%), Gaps = 18/749 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             MKFL    I+  L    S   + S L+TYIV+V+ P S+  +       +DLE WY SFL
Sbjct  1     MKFLLALFIVCCL----SWPRMQSNLDTYIVQVQSPESQSLS-------MDLESWYNSFL  49

Query  2215  PTTVAGGGYGES--RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTH  2042
             P ++A     +   R+++ YRNVMKGFAA+LSAE+VKEM  K GF++  PER+L LHTT 
Sbjct  50    PKSIASTISNKEAPRLIYSYRNVMKGFAARLSAEQVKEMEKKSGFVNVWPERLLSLHTTR  109

Query  2041  SPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT  1862
             +P FLGL+QN+G WRDS+YGKGVIIGVLD+GI  DHPSFSD+GMPPPPA+WKG CE NFT
Sbjct  110   TPSFLGLKQNIGLWRDSNYGKGVIIGVLDTGILPDHPSFSDKGMPPPPAKWKGKCESNFT  169

Query  1861  A-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAH  1685
               CNNK+IGAR+F +      DDDGHGTHTA TAAG FVRGANVYG+ANGTA GVAPLAH
Sbjct  170   TKCNNKLIGARTFPKENGLPIDDDGHGTHTASTAAGGFVRGANVYGNANGTAVGVAPLAH  229

Query  1684  LAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGI  1505
             LAIYK C+  GC  S +LAAMD AI+DGVDI+SLSLGG +S FH D IALGAYSA E+GI
Sbjct  230   LAIYKACDSFGCIVSNVLAAMDAAIDDGVDIISLSLGGYTSPFHSDPIALGAYSATERGI  289

Query  1504  FVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNS  1325
              VS SAGN GP   S+SNEAPW+LTVGAST+DRK+ ATV LGN++ F GE+AF PK  ++
Sbjct  290   LVSCSAGNTGPSKSSVSNEAPWILTVGASTLDRKIKATVHLGNKKWFEGESAFHPKAVST  349

Query  1324  SLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRG  1145
                 L  P  N S+   S YC S +L +  V+GKIV+CM GG   R  KG+AVK+A G G
Sbjct  350   KFFPLFVPALNASEFRRS-YCGSGTLSDRAVKGKIVLCMMGGDYSRIAKGQAVKDAGGVG  408

Query  1144  MILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAP  965
             MILI   E G TTSATAHVLPA+D+TY DG KI+ Y+N+T  P+A  +F+GTI GD+NAP
Sbjct  409   MILINRAEDGFTTSATAHVLPAMDVTYEDGMKIIDYMNSTKKPVAQITFQGTILGDQNAP  468

Query  964   TVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHL  785
              VAAFSSRGP+  S GILKPDIIGPGVNILA WPTS++N  N+KSTFNIISGTSMSCPHL
Sbjct  469   VVAAFSSRGPSIASRGILKPDIIGPGVNILAAWPTSMENSTNTKSTFNIISGTSMSCPHL  528

Query  784   SGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKA  605
             SGVAALLKS+HP WSPA IKSA+MTTAD  N    PI ++ L+ AS+F+ GAGHVNP +A
Sbjct  529   SGVAALLKSAHPTWSPAAIKSAIMTTADTTNLANGPILDETLLPASIFAFGAGHVNPERA  588

Query  604   NDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILES  425
             NDPGL+YDT  +DY+PYLCGLNYTNREVG +LQ +V+CS V SIPEAQLNYPSFSI L  
Sbjct  589   NDPGLIYDTPVKDYVPYLCGLNYTNREVGNLLQRKVDCSEVKSIPEAQLNYPSFSITLGE  648

Query  424   TAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAA  245
               QTYTRTVTNVGEA S Y VEI  P GV V V+P  L+FSK+NQK TY VTFS +  ++
Sbjct  649   NPQTYTRTVTNVGEAKSSYIVEIVSPLGVSVTVKPSTLKFSKMNQKKTYRVTFSKTDNSS  708

Query  244   RSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
              S    VVQG  +W S +H VRSPIA  L
Sbjct  709   TSG---VVQGFFKWTSNRHSVRSPIAIVL  734



>ref|XP_004245675.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=748

 Score =   894 bits (2311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/755 (64%), Positives = 576/755 (76%), Gaps = 18/755 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCS--TATIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             M FL+   IL V I FCS    TI S LETYIV VE P S I+ QSS    +DL+ +Y S
Sbjct  1     MGFLK---ILFVFI-FCSFPWPTIQSNLETYIVHVESPESLITAQSSL---MDLDSYYLS  53

Query  2221  FLPTTV----AGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPL  2054
             FLP T     + G    + M++ Y NVM GFAA+L+AE+VKEM  K GF+SA  +RIL L
Sbjct  54    FLPKTTTAISSSGNEEAATMIYSYHNVMTGFAARLTAEQVKEMEKKHGFVSAQKQRILSL  113

Query  2053  HTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCE  1874
             HTTH+P FLGLQQNMG W+DS++G+GVIIGVLD+GI  DHPSFSD GMPPPPA+WKGVCE
Sbjct  114   HTTHTPSFLGLQQNMGLWKDSNFGEGVIIGVLDTGILPDHPSFSDVGMPPPPAKWKGVCE  173

Query  1873  LNFT-ACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVA  1697
              NFT  CNNK+IGARS+     S  DDDGHGTHTA TAAG FV+GANVY +ANGTA GVA
Sbjct  174   PNFTNKCNNKLIGARSYKLGNGSPIDDDGHGTHTASTAAGAFVKGANVYENANGTAVGVA  233

Query  1696  PLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAM  1517
             PLAH+AIYKVCN +GCSDS+ILAAMD+AI+DGVDILS+S+GG     +++SIALGAYSA 
Sbjct  234   PLAHIAIYKVCNSVGCSDSDILAAMDSAIDDGVDILSISIGGSLRPLYDESIALGAYSAT  293

Query  1516  EKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPK  1337
             ++GI VS SAGN GP   S+ N APW+LTVGAST+DRK+ AT  LGN ++F GE+A++PK
Sbjct  294   QRGILVSCSAGNNGPSPASVDNSAPWILTVGASTLDRKIKATAKLGNGEEFEGESAYRPK  353

Query  1336  DFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNA  1157
               NS+  +L    +N  D S +PYC   SL +  +RGKIV+C+  G +    KG+AVK+A
Sbjct  354   ISNSTFFTLFDAAKNAKDPSETPYCRRGSLTDPAIRGKIVLCLAFGGVANVDKGQAVKDA  413

Query  1156  SGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGD  977
              G GMI+I P +YG+T SA AHVLPA+ ++ ADG KI AY N+ SNP+AT + +GT+ GD
Sbjct  414   GGVGMIVINPSQYGVTKSADAHVLPALVVSAADGSKIRAYTNSISNPVATITIQGTVIGD  473

Query  976   KNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMS  797
             KNAP VAAFSSRGP++ +PGILKPDIIGPGVNILA WPTSVD+  ++KSTFNIISGTSMS
Sbjct  474   KNAPIVAAFSSRGPSKPNPGILKPDIIGPGVNILAAWPTSVDDNKDTKSTFNIISGTSMS  533

Query  796   CPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVN  617
             CPHLSGVAALLK +HPDWSPA+IKSAMMTTAD LN   +PI +Q L  A +++IGAGHVN
Sbjct  534   CPHLSGVAALLKRTHPDWSPAVIKSAMMTTADTLNLASSPILDQRLRPADIYAIGAGHVN  593

Query  616   PSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSI  437
             PS+ANDPGLVYDT  EDY+ YLCGLNYTN +V  +LQ +VNC  V SIPEAQLNYPSFSI
Sbjct  594   PSRANDPGLVYDTPFEDYVAYLCGLNYTNPQVSKLLQRKVNCWEVESIPEAQLNYPSFSI  653

Query  436   I-LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSL  260
               L ST QTYTRTVTNVG+A S Y VEI  P GV V VEP EL FS++NQKLTY VTF  
Sbjct  654   SGLGSTPQTYTRTVTNVGDAESSYKVEIASPKGVVVEVEPSELNFSELNQKLTYQVTF--  711

Query  259   SSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
              SK   S+ P VV+G L+W S  + VRSPIA  LV
Sbjct  712   -SKTISSSQPEVVEGFLKWNSNTYSVRSPIAVVLV  745



>gb|EYU39033.1| hypothetical protein MIMGU_mgv1a001909mg [Erythranthe guttata]
Length=741

 Score =   894 bits (2311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/736 (65%), Positives = 561/736 (76%), Gaps = 23/736 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S  E YIV VE P  + +TQS      DLE WY SFLPTT       ESR+V+ YR V K
Sbjct  15    SSSEIYIVHVEGPTEQFTTQSE-----DLESWYGSFLPTTTTSSNERESRIVYSYRTVFK  69

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAA LS EEVKEM  K GFISA PE  LPLHTTHSPGFLGL +  G+W+DS+YG+GVII
Sbjct  70    GFAANLSPEEVKEMEKKVGFISARPEIKLPLHTTHSPGFLGLNRETGYWKDSNYGRGVII  129

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSER---------E  1814
             G+LD+GI  +HPSFSDEGMPPPPA+WKG CE N TACNNK+IGARSF            +
Sbjct  130   GILDTGIFPEHPSFSDEGMPPPPAKWKGRCEFNHTACNNKIIGARSFGSTAGGGGGGGGQ  189

Query  1813  RSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEI  1634
              +  DDDGHGTHTA TAAGNFV GAN++G+ANGTAAGVAPLAHLA+Y+VC    CS+S I
Sbjct  190   ITPLDDDGHGTHTASTAAGNFVNGANIFGNANGTAAGVAPLAHLAVYRVCVPF-CSESNI  248

Query  1633  LAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLS  1454
             LA MD AIEDGVD+LS+SLGG++++F ++ IALGA+SAMEKGIFVS SAGN GPFN S+S
Sbjct  249   LAGMDAAIEDGVDVLSISLGGLTNNFFKNFIALGAFSAMEKGIFVSCSAGNNGPFNFSIS  308

Query  1453  NEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESS  1274
             NEAPW+LTVGAST+DRKL AT VLGN+Q FHGE+AFQP +F  +LL LV+ G   + +  
Sbjct  309   NEAPWILTVGASTIDRKLRATTVLGNKQLFHGESAFQPDNFPPTLLPLVYAGMLNTSDPF  368

Query  1273  SPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRG-MILIEPEEYGITTSAT  1097
             +P+C  +SL  +DVRGKIVVC  GG L R  KGEAVK+A G   MIL+  E Y  TTSA 
Sbjct  369   APFC-GDSLNASDVRGKIVVCELGGGLTRIEKGEAVKSAGGTAAMILVNNERYANTTSAD  427

Query  1096  AHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPG  917
             AH LPA D+ YADG KI AYIN+TS+P A+  F+GT  GD NAP VAAFSSRGPN  S G
Sbjct  428   AHALPAADVGYADGLKIKAYINSTSSPKASILFEGTAIGDSNAPVVAAFSSRGPNFASRG  487

Query  916   ILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSP  737
             ILKPDI+GPGVNILA WPTSV+N+ ++K+TFN++SGTSMSCPHLSGVAALLKSSHPDWSP
Sbjct  488   ILKPDILGPGVNILAAWPTSVENRTDTKATFNMVSGTSMSCPHLSGVAALLKSSHPDWSP  547

Query  736   AMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLP  557
             A IKSA+MTTAD++N   NPI+++  V A +F+ G+GHVNPS+ANDPGLVYD +PEDY+P
Sbjct  548   AAIKSAIMTTADVVNLAHNPIEDERFVQAGIFATGSGHVNPSRANDPGLVYDIQPEDYIP  607

Query  556   YLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTA---QTYTRTVTNVG  386
             YLCGLNYT+REVG  LQ RVNCS   SIPEAQLNYPSF++   ST    Q YTRTVTNVG
Sbjct  608   YLCGLNYTDREVGFFLQRRVNCSVESSIPEAQLNYPSFALTFTSTKSNIQVYTRTVTNVG  667

Query  385   EASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALR  206
             E  S Y VEI  PPG+ V V P  L FS+VN+K+ Y VTF   S A  +    +VQG L+
Sbjct  668   EPKSSYNVEIVPPPGIDVRVAPTTLDFSEVNRKMQYEVTFERLSSAENNT---IVQGFLK  724

Query  205   WKSVKHHVRSPIAAKL  158
             W S+KH VRSPIA  L
Sbjct  725   WTSLKHSVRSPIAVIL  740



>gb|ABG37022.1| serine protease [Nicotiana tabacum]
Length=753

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/752 (64%), Positives = 582/752 (77%), Gaps = 13/752 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             MK L++FL+ S+L G  S  +I S L TYIV+VE P SRISTQS S    DLE WY+SFL
Sbjct  1     MKILKIFLVFSIL-GCLSWPSIQSDLTTYIVQVESPESRISTQSLSDQ--DLESWYRSFL  57

Query  2215  PTTVAG---GGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTT  2045
             P T+A        E R+V+ YRNVMKGFAA+LSAE+VKEM  K+GFISA PERIL LHTT
Sbjct  58    PNTIASTRSNDEEEPRLVYSYRNVMKGFAARLSAEQVKEMEKKEGFISAWPERILSLHTT  117

Query  2044  HSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNF  1865
             H+P FLGLQQN G WR S+YGKGVIIGVLD+GI+ DHPSFSDEGMPPPPA+WKG CELNF
Sbjct  118   HTPSFLGLQQNEGVWRHSNYGKGVIIGVLDTGISPDHPSFSDEGMPPPPAKWKGKCELNF  177

Query  1864  TA-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLA  1688
             T  CNNK+IGAR+F +   S  DD+GHGTHTAGTAAG FV+GANV+G+ANGTA G+APLA
Sbjct  178   TTKCNNKLIGARTFPQANGSPIDDNGHGTHTAGTAAGGFVKGANVFGNANGTAVGIAPLA  237

Query  1687  HLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKG  1508
             HLAIYKVC+  GCSDS IL+AMD AI+DGVDILSLSLGG ++ FH D IALGAYSA ++G
Sbjct  238   HLAIYKVCDSFGCSDSGILSAMDAAIDDGVDILSLSLGGSTNPFHSDPIALGAYSATQRG  297

Query  1507  IFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFN  1328
             I VS SAGN GPF G++ NEAPW+LTVGAST+DRK+ ATV LGN+++F GE+AF PK   
Sbjct  298   ILVSCSAGNTGPFEGAVVNEAPWILTVGASTLDRKIKATVRLGNKEEFEGESAFHPKVSK  357

Query  1327  SSLLSLVFPGQNTSDESSSPYCDS--ESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNAS  1154
             +    L  PG+N +D+S + +C      L  A ++GKIV+C+ GG  +   KG+AVKNA 
Sbjct  358   TKFFPLFNPGENLTDDSDNSFCGPGLTDLSRA-IKGKIVLCVAGGGFNSIEKGQAVKNAG  416

Query  1153  GRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDK  974
             G GMILI   + G+T SA AHVLPA+D+   DG  I+ Y+ +T  P+A  +F+GTI GDK
Sbjct  417   GVGMILINRPQDGLTKSADAHVLPALDVASFDGNNIIDYMKSTKKPVARITFQGTIIGDK  476

Query  973   NAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSC  794
             NAP +A FSSRGP+  SPGILKPDIIGPGVN+LA WPT V+NK N+KSTFNIISGTSMSC
Sbjct  477   NAPVLAGFSSRGPSTASPGILKPDIIGPGVNVLAAWPTPVENKTNTKSTFNIISGTSMSC  536

Query  793   PHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNP  614
             PHLSG+AALLKS+HP WSPA IKSA+MTTADI+N G   + ++ L  A +F+ G+GHVNP
Sbjct  537   PHLSGIAALLKSAHPTWSPAAIKSAIMTTADIVNLGNESLLDEMLAPAKIFAYGSGHVNP  596

Query  613   SKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSII  434
             S+ANDPGLVYDT+ +DY+PYLCGLNYT+R++G ILQ   +CS V SIPEAQLNYPSFSI 
Sbjct  597   SRANDPGLVYDTQFKDYIPYLCGLNYTDRQMGNILQRITSCSKVKSIPEAQLNYPSFSIS  656

Query  433   LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSS  254
             L +  QTYTRTVTNVGEA S Y VEI  P  V V V+P  L+F+K+NQKLTY VTFS ++
Sbjct  657   LGANQQTYTRTVTNVGEAKSSYRVEIVSPRSVSVVVKPSTLKFTKLNQKLTYRVTFSATT  716

Query  253   KAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
                 +NM  VV G L+W S +H VRSPIA  L
Sbjct  717   NI--TNM-EVVHGYLKWSSNRHFVRSPIAVIL  745



>ref|XP_009614059.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=753

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/752 (64%), Positives = 582/752 (77%), Gaps = 13/752 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             MK L++FL+ S+L G  S  +I S L TYIV+VE P SRISTQS S    DLE WY+SFL
Sbjct  1     MKILKIFLVFSIL-GCLSWPSIQSDLTTYIVQVESPESRISTQSLSDQ--DLESWYRSFL  57

Query  2215  PTTVAGGGYGES---RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTT  2045
             P T+A     E    R+V+ YRNVMKGFAA+LSAE+VKEM  K+GFISA PERIL LHTT
Sbjct  58    PNTIASTSSNEQEEPRLVYSYRNVMKGFAARLSAEQVKEMEKKEGFISAWPERILSLHTT  117

Query  2044  HSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNF  1865
             H+P FLGLQ N G WR S+YGKGVIIGVLD+GI+ DHPSFSDEGMPPPPA+WKG CE NF
Sbjct  118   HTPSFLGLQHNEGVWRHSNYGKGVIIGVLDTGISPDHPSFSDEGMPPPPAKWKGKCESNF  177

Query  1864  TA-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLA  1688
             T  CNNK+IGAR+F +   S  DD+GHGTHTAGTAAG FV+GANV+G+ANGTA G+APLA
Sbjct  178   TTKCNNKLIGARTFPQANGSPIDDNGHGTHTAGTAAGGFVKGANVFGNANGTAVGIAPLA  237

Query  1687  HLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKG  1508
             HLAIYKVC+  GCSDS IL+AMD AI+DGVDILSLSLGG ++ FH D IALGAYSA ++G
Sbjct  238   HLAIYKVCDSFGCSDSGILSAMDVAIDDGVDILSLSLGGSTNPFHSDPIALGAYSATQRG  297

Query  1507  IFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFN  1328
             I VS SAGN GPF G++ NEAPW+LTVGAST+DRK+ ATV LGN+++F GE+AF PK   
Sbjct  298   ILVSCSAGNTGPFEGTVVNEAPWILTVGASTLDRKIKATVRLGNKEEFEGESAFHPKVSK  357

Query  1327  SSLLSLVFPGQNTSDESSSPYCDS--ESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNAS  1154
             +    L  PG+N +D+S + +C      L  A ++GKIV+C+ GG  +   KG+AVKNA 
Sbjct  358   TKFFPLFNPGENLTDDSDNSFCGPGLTDLSRA-IKGKIVLCVAGGGFNSIEKGQAVKNAG  416

Query  1153  GRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDK  974
             G GMILI   + G+T SA AHVLPA+D+   DG  I+ Y+ +T  P+A  +F+GTI GDK
Sbjct  417   GVGMILINRPQDGLTKSADAHVLPALDVASFDGNNIIDYMKSTKKPVARITFQGTIIGDK  476

Query  973   NAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSC  794
             NAP +A FSSRGP+  SPGILKPDIIGPGVN+LA WPTSV+NK N+KSTFNIISGTSMSC
Sbjct  477   NAPVLAGFSSRGPSTASPGILKPDIIGPGVNVLAAWPTSVENKTNTKSTFNIISGTSMSC  536

Query  793   PHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNP  614
             PHLSGVAALLKS+HP WSPA IKSA+MTTADI+N G   ++++ L  A +F+ G+GHVNP
Sbjct  537   PHLSGVAALLKSAHPTWSPAAIKSAIMTTADIVNLGNESLRDEMLAPAKIFAYGSGHVNP  596

Query  613   SKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSII  434
             S+ANDPGLVYDT+ +DY+PYLCGLNYT+R++G ILQ   +CS V SIPEAQLNYPSFSI 
Sbjct  597   SRANDPGLVYDTQFKDYIPYLCGLNYTDRQMGNILQRITSCSKVKSIPEAQLNYPSFSIS  656

Query  433   LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSS  254
             L +  QTYTRTVTNVGEA S Y VEI  P  V V V+P  L+F+K+NQKLTY VTFS ++
Sbjct  657   LGANQQTYTRTVTNVGEAKSSYRVEIVSPRSVSVVVKPSTLKFTKLNQKLTYRVTFSTAT  716

Query  253   KAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
                 +NM  +V G L+W S +H VRSPIA  L
Sbjct  717   NI--TNM-EIVHGYLKWSSNRHFVRSPIAVIL  745



>ref|XP_006358405.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=743

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/745 (63%), Positives = 575/745 (77%), Gaps = 10/745 (1%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTT  2207
             +++F ++  ++   S  ++ S LETYIV+VE P S+ISTQSS    +DLE WYKSFLP T
Sbjct  1     MKIFFVIFGILACFSWPSMQSDLETYIVQVESPESQISTQSSR---MDLESWYKSFLPKT  57

Query  2206  VAGGGYGES-RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGF  2030
             +   G  E  ++++ Y NV+ GFAA+LSA++VKE+    GFISA  +RIL  HTTH+P F
Sbjct  58    IETAGLDEKPQLIYSYHNVIIGFAARLSAKQVKEIEMTPGFISAWQQRILFPHTTHTPSF  117

Query  2029  LGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA-CN  1853
             LGLQQN+G WRD++YGKGVIIGVLD+GI+ DHPSFSD+GMPPPPA+WKG CE NFT  CN
Sbjct  118   LGLQQNIGLWRDANYGKGVIIGVLDTGISPDHPSFSDKGMPPPPAKWKGKCESNFTTKCN  177

Query  1852  NKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIY  1673
             NK+IGAR+F   + S+ DD GHGTHTA TAAG FV+GANVYG+ANGTA G+APLAHLAIY
Sbjct  178   NKLIGARTFLNSD-SLIDDVGHGTHTASTAAGGFVKGANVYGNANGTAVGIAPLAHLAIY  236

Query  1672  KVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSA  1493
             KVC+  GCSDS++LAAMD AI+DGVDILS+SLGG    F+ED IALGAYSA ++GI VS 
Sbjct  237   KVCDSFGCSDSDVLAAMDAAIDDGVDILSISLGGNRKLFYEDPIALGAYSATKRGILVSC  296

Query  1492  SAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLS  1313
             SAGNEGP+  +LSNEAPW+LTVGAS++DRKL ATV LGN++   GE+AF PK  NS    
Sbjct  297   SAGNEGPYESTLSNEAPWILTVGASSIDRKLKATVKLGNQKILEGESAFHPKGHNSIFSP  356

Query  1312  LVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILI  1133
             L  P +N +D  S  YC   +L +++++GKIVVC  GG   R  KG+AVK+A G GMI+ 
Sbjct  357   LYDPSRNETDFDSL-YCGPGTLSDSEIKGKIVVCSAGGGYSRIDKGQAVKDAGGVGMIIF  415

Query  1132  EPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAA  953
                + G T  +  HVLPA+ ITY DG +IL Y+N+TS P+A  +F+GTI GDK+AP +AA
Sbjct  416   NTADDGFTKFSDPHVLPALHITYKDGLEILDYMNSTSKPIARIAFQGTIIGDKDAPVIAA  475

Query  952   FSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVA  773
             FSSRGPN  SPGILKPDIIGPG+NILA WPTS+DNK N+KSTFNIISGTSMSCPHLSGVA
Sbjct  476   FSSRGPNIASPGILKPDIIGPGLNILAAWPTSIDNKKNTKSTFNIISGTSMSCPHLSGVA  535

Query  772   ALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPG  593
             ALLK +HP WSPA IKSA+MTTA  +N   +PI ++ L+ A++F+IGAGHVNPSKANDPG
Sbjct  536   ALLKGTHPTWSPAAIKSAIMTTAYTVNFASDPILDERLLPANIFAIGAGHVNPSKANDPG  595

Query  592   LVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQT  413
             L+YDT  +DYLPYLCGLNYTNR+VG ++Q +V+C +V  IPEAQLNYPSFSI L   +QT
Sbjct  596   LIYDTHFKDYLPYLCGLNYTNRQVGNLMQRKVDCRSVKHIPEAQLNYPSFSITLGDISQT  655

Query  412   YTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNM  233
             YTRTVTNVGEA S Y+VEI  PPGV V V+P  L+FSK+NQ L Y VTF+    +  S  
Sbjct  656   YTRTVTNVGEAKSSYSVEIALPPGVSVTVKPSILKFSKLNQNLKYQVTFTRRDNSPNSG-  714

Query  232   PPVVQGALRWKSVKHHVRSPIAAKL  158
               +VQG L+W S K+ VRSPIA  L
Sbjct  715   --IVQGFLKWSSKKYSVRSPIAVVL  737



>emb|CAA06413.1| P69E protein [Solanum lycopersicum]
Length=754

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/755 (63%), Positives = 576/755 (76%), Gaps = 19/755 (3%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTA--TIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             M FL++ L+L     FCS    TI S LE YIV VE P S ISTQSS     DL+ +Y S
Sbjct  1     MGFLKILLVLI----FCSFPWPTIQSGLEIYIVHVESPESLISTQSSF---TDLDSYYLS  53

Query  2221  FLPTTVAG----GGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPL  2054
             FLP T +     G    + M++ Y NVM GFAA+L+A  VKEM  K GF+SA  +RIL L
Sbjct  54    FLPETTSAISSSGNEEAATMIYSYHNVMTGFAARLTASHVKEMEKKRGFVSAQKQRILSL  113

Query  2053  HTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCE  1874
              TTH+P FLGLQQNMG W+DS+YGKGVIIGVLD+GI  DHPSFSD GMPPPPA+WKGVCE
Sbjct  114   DTTHTPSFLGLQQNMGVWKDSNYGKGVIIGVLDTGILPDHPSFSDVGMPPPPAKWKGVCE  173

Query  1873  LNFT-ACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVA  1697
              NFT  CNNK+IGARS+     S  D DGHGTHTA TAAG FV+GANVYG+ANGTA GVA
Sbjct  174   SNFTNKCNNKLIGARSYHLGNGSPIDGDGHGTHTASTAAGAFVKGANVYGNANGTAVGVA  233

Query  1696  PLAHLAIYKVCN-EIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSA  1520
             PLAH+A+YKVC+ + GCSDS+ILAAMD+AI+DGVDILS+S+GG  +S ++D IALGAYSA
Sbjct  234   PLAHIAVYKVCSSDGGCSDSDILAAMDSAIDDGVDILSISIGGSPNSLYDDPIALGAYSA  293

Query  1519  MEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQP  1340
               +G+FVS SAGN GP   S+ N APW+LTVGAST+DRK+ ATV LGN ++F GE+A++P
Sbjct  294   TARGVFVSCSAGNRGPLLASVGNAAPWILTVGASTLDRKIKATVKLGNGEEFEGESAYRP  353

Query  1339  KDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKN  1160
             +  NS+  +L    ++  D S +PYC   SL +  +RGKIV+C+  G +    KG+ VK+
Sbjct  354   QTSNSTFFTLFDAAKHAKDPSETPYCRPGSLTDPVIRGKIVLCLACGGVSSVDKGKVVKD  413

Query  1159  ASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITG  980
             A G GMI+I P +YG+T SA AHVLPA+D++ ADG +I AY N+  NP+AT +F+GTI G
Sbjct  414   AGGVGMIVINPSQYGVTKSADAHVLPALDVSDADGTRIRAYTNSILNPVATITFQGTIIG  473

Query  979   DKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSM  800
             D+NAP VAAFSSRGPN  SPGILKPDIIGPGVNILA WPTSVD   N+KSTFNIISGTSM
Sbjct  474   DENAPIVAAFSSRGPNTASPGILKPDIIGPGVNILAAWPTSVDGNKNTKSTFNIISGTSM  533

Query  799   SCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHV  620
             SCPHLSGVAALLKSSHPDWSPA+IKSA+MTTAD LN   +PI ++ L  A +++IGAGHV
Sbjct  534   SCPHLSGVAALLKSSHPDWSPAVIKSAIMTTADTLNLASSPILDERLSPADIYAIGAGHV  593

Query  619   NPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFS  440
             NPS+ANDPGLVYDT  EDYLPYLCGLNYTN +VG +L+ +VNCS V SIPEAQLNYPSF 
Sbjct  594   NPSRANDPGLVYDTPFEDYLPYLCGLNYTNSQVGKLLKRKVNCSEVESIPEAQLNYPSFC  653

Query  439   II-LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFS  263
             I  L ST QT+TRTVTNVG+A S YTV+I  P GV V V+PR+L FS++ QKLTY VTFS
Sbjct  654   ISRLGSTPQTFTRTVTNVGDAKSSYTVQIASPKGVVVKVKPRKLIFSELKQKLTYQVTFS  713

Query  262   LSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
               + +++S    V +G L+W S K+ VRSPIA + 
Sbjct  714   KRTNSSKSG---VFEGFLKWNSNKYSVRSPIAVEF  745



>ref|XP_004244715.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=743

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/742 (63%), Positives = 573/742 (77%), Gaps = 11/742 (1%)
 Frame = -1

Query  2377  FLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAG  2198
             F++  +L  F S  ++ S LETYIV+VE P S ISTQSS    +DLE+WYKSFLP T+A 
Sbjct  5     FVVFCILACF-SWPSMQSDLETYIVQVESPESHISTQSSR---MDLENWYKSFLPNTIAT  60

Query  2197  GGYGES-RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGL  2021
              G  E  ++++ Y NV+ GFAA+LSA++VKEM  K GFISA P+RIL LHTTH+P FLGL
Sbjct  61    AGLDEKPQLIYSYHNVIIGFAARLSAKQVKEMEKKPGFISAWPQRILSLHTTHTPSFLGL  120

Query  2020  QQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA-CNNKV  1844
             QQN+G WRD++YGKGVI+GVLD+GI+ DHPSFSD+GMPPPPA+WKG CE NFT  CNNK+
Sbjct  121   QQNVGLWRDANYGKGVIVGVLDTGISPDHPSFSDKGMPPPPAKWKGKCESNFTTKCNNKL  180

Query  1843  IGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVC  1664
             IGAR+F   + S  D +GHGTHTA TAAG FV+GANVYG+A GTA G+APLAHLA+YKVC
Sbjct  181   IGARTFVNSD-SPIDGNGHGTHTASTAAGGFVKGANVYGNAKGTAVGIAPLAHLAMYKVC  239

Query  1663  NEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAG  1484
             +  GCSDS++LAAMD AI+DGVDI+SLSLGG    F+ED IALGAYSA ++GI VS S+G
Sbjct  240   DSFGCSDSDVLAAMDAAIDDGVDIMSLSLGGNRKLFYEDPIALGAYSATKRGILVSCSSG  299

Query  1483  NEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVF  1304
             NEGP+  +LSNEAPW+LTVGAS+ DRKL ATV LGN++   GE+AF PK  NS+   L  
Sbjct  300   NEGPYESTLSNEAPWILTVGASSTDRKLKATVKLGNKKILEGESAFHPKGHNSTFFPLYD  359

Query  1303  PGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPE  1124
             P +N +D  S  YC   +L   +++GKIVVC  GG   R  KG+AVK+A G GMI+    
Sbjct  360   PSRNETDFDSL-YCGPGTLSETEIKGKIVVCSAGGGYSRIDKGQAVKDAGGVGMIIFNTA  418

Query  1123  EYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSS  944
             + G T  +  HVLPA+ ITY DG +IL Y+N TS P A  +F+GTI GDK+ P VA+FSS
Sbjct  419   DDGFTKFSDPHVLPALHITYKDGMEILDYMNTTSEPNARIAFQGTIIGDKDVPVVASFSS  478

Query  943   RGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALL  764
             RGP+  SPGILKPDIIGPG+NILA WP+SVDNK N+KSTFNIISGTSMSCPHLSGVAALL
Sbjct  479   RGPSIASPGILKPDIIGPGLNILAAWPSSVDNKKNTKSTFNIISGTSMSCPHLSGVAALL  538

Query  763   KSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVY  584
             KS+HP WSPA IKSA+MTTA+ +N   +PI ++ L+ A++F+IGAGHVNPS+ANDPGL+Y
Sbjct  539   KSTHPTWSPAAIKSAIMTTANTVNFANDPILDERLLPANIFAIGAGHVNPSRANDPGLIY  598

Query  583   DTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTR  404
             DT+ +DYLPYLCGLNYTNR+VG ++Q +V+C +V  I EAQLNYPSFSI L   +QTY R
Sbjct  599   DTRFKDYLPYLCGLNYTNRQVGNLMQRKVDCRSVKHIREAQLNYPSFSITLGDISQTYAR  658

Query  403   TVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPV  224
             TVTNVGEA S Y+VEI  PP V V+V+P  L+FSK+NQKL Y+VTF+    +  S    +
Sbjct  659   TVTNVGEAKSSYSVEIALPPRVSVSVKPSILKFSKLNQKLKYHVTFTRRDNSPNSG---I  715

Query  223   VQGALRWKSVKHHVRSPIAAKL  158
             VQG L+W S K+ VRSPIA  L
Sbjct  716   VQGFLKWNSKKYSVRSPIAVVL  737



>ref|XP_004245677.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=749

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/755 (63%), Positives = 576/755 (76%), Gaps = 19/755 (3%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTA--TIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             M F ++ L+L     FCS    TI S LE YIV VE P S IST+SS     DL+ +Y S
Sbjct  1     MGFFKVLLVLI----FCSFPWPTIQSGLEIYIVHVESPESLISTKSSL---TDLDSYYHS  53

Query  2221  FLPTTV----AGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPL  2054
             FLP T     + G    + M++ Y NVMKGFAA+L+   VKEM  K GF+SA  +RIL L
Sbjct  54    FLPKTTTAISSSGNEEAATMIYSYHNVMKGFAARLTESHVKEMEKKRGFVSAQKQRILSL  113

Query  2053  HTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCE  1874
              TTH+P FLGLQQNMG W+DS+YG+GVIIGV+D+GI  DHPSFSD GMPPPPA+WKGVCE
Sbjct  114   DTTHTPSFLGLQQNMGVWKDSNYGEGVIIGVIDTGILPDHPSFSDVGMPPPPAKWKGVCE  173

Query  1873  LNF-TACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVA  1697
              NF   CNNK+IGARS+     S  D +GHGTHTA TAAG FV+GANVYG+ANGTA GVA
Sbjct  174   SNFINKCNNKLIGARSYHLGNGSPIDGNGHGTHTASTAAGAFVKGANVYGNANGTAVGVA  233

Query  1696  PLAHLAIYKVCN-EIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSA  1520
             PLAH+A+YKVC+ + GCSDS+ILAAMD+AI+DGVDILS+S+GG  +SF++D IALGAYSA
Sbjct  234   PLAHIAVYKVCSSDGGCSDSDILAAMDSAIDDGVDILSISIGGSPNSFYDDPIALGAYSA  293

Query  1519  MEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQP  1340
               +G+FVS SAGN GP   S+ N APW+LTVGAST+DRK+ ATV LGN ++F GE+A++P
Sbjct  294   TARGVFVSCSAGNRGPLLASVGNAAPWILTVGASTLDRKIKATVKLGNGEEFEGESAYRP  353

Query  1339  KDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKN  1160
             +  NS+  +L    ++  D S +PYC   SL+   +RGKIV+C+ GG +    KG+ VK+
Sbjct  354   QISNSTFFTLFDAAKHAKDPSETPYCKPGSLKGPVIRGKIVLCLAGGGVSSVAKGKVVKD  413

Query  1159  ASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITG  980
             A G GMI+I+  +YG+T +A AHVLPA+DI+ ADG +I AY N+  NP+AT +F+GT  G
Sbjct  414   AGGVGMIVIKTSQYGVTKTADAHVLPALDISDADGLRIRAYTNSILNPVATITFQGTTIG  473

Query  979   DKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSM  800
             D+NAP VAAFSSRGP+R SPGILKPDIIGPGVNILA WPT VD+  N+KSTFNIISGTSM
Sbjct  474   DENAPIVAAFSSRGPSRASPGILKPDIIGPGVNILAAWPTPVDDDKNTKSTFNIISGTSM  533

Query  799   SCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHV  620
             SCPHLSGVAALLKS+HPDWSPA+IKSA+MTTAD LN   +PI ++ L+ A +F+ GAGHV
Sbjct  534   SCPHLSGVAALLKSAHPDWSPAVIKSAIMTTADTLNLANSPILDERLLPADIFTTGAGHV  593

Query  619   NPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFS  440
             NPS+ANDPGLVYDT  EDY+PYLCGLNYTN +VG +L+ RVNCS V SIPEAQLNYPSF 
Sbjct  594   NPSRANDPGLVYDTPFEDYVPYLCGLNYTNPQVGKLLRRRVNCSEVESIPEAQLNYPSFC  653

Query  439   II-LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFS  263
             I  L ST QTYTRTVTNVG+A S YTV+I  P GV V V+P +L FS++NQKLTY VTF 
Sbjct  654   ISRLGSTPQTYTRTVTNVGDAKSSYTVQIASPKGVVVKVKPSKLNFSELNQKLTYQVTF-  712

Query  262   LSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
               SK   S+M  VV+G L+W S +H VRSPIA  L
Sbjct  713   --SKTINSSMSGVVEGFLKWNSNRHSVRSPIAVVL  745



>emb|CDP09846.1| unnamed protein product [Coffea canephora]
Length=729

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/748 (64%), Positives = 564/748 (75%), Gaps = 36/748 (5%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIA------SKLETYIVRVELP-HsristqsssssSVDLEHWY  2228
             L   LIL  ++ F S A  A      S LETYIV VELP +S I   SSS  + DL+ WY
Sbjct  3     LTEILILISVLSFHSLAVAANDFLGKSNLETYIVHVELPEYSDIQLSSSSGPNEDLDSWY  62

Query  2227  KSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             +SFLPTTVA       ++V  Y NV KGFAAKLSAE+VK M  K GFISA P+ +L LHT
Sbjct  63    RSFLPTTVASSNEAP-QIVHSYHNVFKGFAAKLSAEDVKTMEKKPGFISAQPQMLLSLHT  121

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             THSP FLGL QN+GFW +S+YGKGVIIGVLDSGIA DHPSFSDEGMPPPPA+WKG C+ N
Sbjct  122   THSPNFLGLHQNVGFWNESNYGKGVIIGVLDSGIAPDHPSFSDEGMPPPPAKWKGKCQFN  181

Query  1867  FTACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLA  1688
              +ACNNK+IGAR FS+   S  D+DGHGTHTAGTAAGN+V+GANV+G+ANGTA GVAPLA
Sbjct  182   TSACNNKLIGARFFSDGNGSPMDEDGHGTHTAGTAAGNYVKGANVFGNANGTAVGVAPLA  241

Query  1687  HLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKG  1508
             HLAIYKVC+  GCS+S+ILAAMD AI DGVDILSLSL G S  F+ D+IA+GAYSAMEKG
Sbjct  242   HLAIYKVCSP-GCSESDILAAMDAAIHDGVDILSLSLQGGSGPFYADNIAMGAYSAMEKG  300

Query  1507  IFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFN  1328
             IFVS SAGN GPFN SLSNEAPW+LTVGAST+DRK+     LGN ++F G+      DFN
Sbjct  301   IFVSCSAGNSGPFNRSLSNEAPWILTVGASTIDRKIRTIAKLGNNEEFDGD------DFN  354

Query  1327  SSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGR  1148
             S                   YC S  L +  V GKIVVC  GG + R  KG+ +K+A G 
Sbjct  355   SG------------------YCGSGLLNDTGVLGKIVVCDNGGGVSRIAKGQNIKSAGGV  396

Query  1147  GMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNA  968
             GMILI     G  TSA AHVLPA  ++Y DG K+LAYIN+T +PM++ +FKGTI GD  A
Sbjct  397   GMILINQLSQGYATSADAHVLPATHLSYTDGVKVLAYINSTKSPMSSIAFKGTIIGDHQA  456

Query  967   PTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPH  788
             P VAAFSSRGP+R SPGILKPD+IGPGVNILA W  SV+N  N+K+TFN+ISGTSMSCPH
Sbjct  457   PLVAAFSSRGPSRTSPGILKPDVIGPGVNILAAWHRSVENNSNTKATFNVISGTSMSCPH  516

Query  787   LSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSK  608
             LSGVAALLKS HPDWSPA IKSA+MTTADI+N  +NPI++Q L+ A+VF+ G+GHVNP+K
Sbjct  517   LSGVAALLKSVHPDWSPAAIKSAIMTTADIVNLAKNPIEDQTLLPANVFATGSGHVNPAK  576

Query  607   ANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILE  428
             AN+PGL+YD +P+DY+PYLCGLNYTNREV  ++Q +VNC+A  SIPEAQLNYPSFSI+  
Sbjct  577   ANNPGLIYDIEPKDYIPYLCGLNYTNREVSHLVQRKVNCTAESSIPEAQLNYPSFSIVFG  636

Query  427   STAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKA  248
             S+ Q YTRTVTNVGEA S YTV++  P GV V V+P  L FS+VNQKLTY VTFSL + +
Sbjct  637   SSIQKYTRTVTNVGEAKSVYTVKVAPPAGVNVTVKPNTLSFSEVNQKLTYEVTFSLLASS  696

Query  247   ARSNMPPVVQGALRWKSVKHHVRSPIAA  164
             A +    V QG+L W S K+ VRSPI A
Sbjct  697   ANNT---VSQGSLAWTSAKYSVRSPIVA  721



>emb|CDP10007.1| unnamed protein product [Coffea canephora]
Length=744

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/748 (62%), Positives = 573/748 (77%), Gaps = 17/748 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELP--HsristqsssssSVDLEHWYKS  2222
             M  L +F +LS+ +       I++ LETYIV VELP  ++++ST S SS + DL+ WY S
Sbjct  4     MHILNLFSVLSLQL-----LAISANLETYIVHVELPESYTQLSTSSISSPNEDLDSWYNS  58

Query  2221  FLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTH  2042
             FLPTT+A       RMV+ Y NV KGF+AKLSAE+VK M  K GF+SA P+R+L LHTTH
Sbjct  59    FLPTTIASTNEAP-RMVYCYHNVFKGFSAKLSAEDVKVMEKKPGFLSARPQRMLSLHTTH  117

Query  2041  SPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT  1862
             SP FLGL QN GFWR+S+YGKGVIIGVLD+GI  +HPSFSDEGMPPPPA+WKG CE N  
Sbjct  118   SPIFLGLHQNSGFWRESNYGKGVIIGVLDTGIEPNHPSFSDEGMPPPPAKWKGKCEFNTP  177

Query  1861  ACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHL  1682
              CN K+IGAR F +   S  D+ GHGTHTAGTAAGNFV GANV+G+ANGTA GVAP AHL
Sbjct  178   VCNKKLIGARFFQDGNGSPADESGHGTHTAGTAAGNFVMGANVFGNANGTAVGVAPHAHL  237

Query  1681  AIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIF  1502
             AIYKVC   GCS+S+ILAAMD AI+DGVDILSLSLGG S  FH D+IALGAYSAMEKGI 
Sbjct  238   AIYKVCT-TGCSESDILAAMDVAIDDGVDILSLSLGGSSVPFHNDNIALGAYSAMEKGIL  296

Query  1501  VSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSS  1322
             VS SAGN GPF  +LSN+APW+LTVGAST+DR++ AT VLGN+++  G++ +QPKDF+  
Sbjct  297   VSCSAGNNGPFGSTLSNDAPWILTVGASTIDRQIRATAVLGNKEELDGQSLYQPKDFHPR  356

Query  1321  LLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGM  1142
             L  L +PG N SD  +  YC    L    V+GKIV+C  G  +    KG  VK A G GM
Sbjct  357   LYPLFYPGLNQSDTDADRYCTEALLNITQVKGKIVICEVG-LIPPTSKGTNVKAAGGVGM  415

Query  1141  ILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPT  962
             I+I  E+ G TT A AHVLPA +I YADG K++AY+ +TS+P+ATFSFKGTI GD +AP 
Sbjct  416   IMINSEQEGYTTRADAHVLPATNINYADGLKLIAYLESTSSPVATFSFKGTIIGDSHAPA  475

Query  961   VAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLS  782
             VA+FSSRGP+  SPGILKPDIIGPGVNILA +  SV+N  N+K+ F+++SGTSMSCPHLS
Sbjct  476   VASFSSRGPSYSSPGILKPDIIGPGVNILAAYHESVENSTNTKANFHVLSGTSMSCPHLS  535

Query  781   GVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKAN  602
             GVAALLKS+HPDWSPA IKSAMMTTAD++N  QNPI+++  + A +F++G+GHVNP++AN
Sbjct  536   GVAALLKSAHPDWSPAAIKSAMMTTADLVNLAQNPIEDEKHLPADLFTMGSGHVNPARAN  595

Query  601   DPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILEST  422
             +PGL+YD +P+DY+PYLCGLNY++REVG ILQ + NC A   I E QLNYPSFSI++ ST
Sbjct  596   NPGLIYDIEPKDYIPYLCGLNYSDREVGRILQRKANCKAESRISETQLNYPSFSIVVGST  655

Query  421   AQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFS-LSSKAA  245
              Q YTRTVTNVG+A+S Y V+I +P GV V V+PR L FSKVNQKL+Y++TF+ LS    
Sbjct  656   IQKYTRTVTNVGDANSIYRVKIDQPGGVNVTVKPRILSFSKVNQKLSYDITFTPLSPYET  715

Query  244   RSNMPPVVQGALRWKSVKHHVRSPIAAK  161
              S+      G+L W S K+ VRSPIAA+
Sbjct  716   PSD------GSLTWTSAKYSVRSPIAAQ  737



>ref|NP_001234257.1| subtilisin-like endoprotease precursor [Solanum lycopersicum]
 emb|CAA64566.1| subtilisin-like endoprotease [Solanum lycopersicum]
 emb|CAA76724.1| P69A protein [Solanum lycopersicum]
Length=745

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/756 (64%), Positives = 576/756 (76%), Gaps = 21/756 (3%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTA--TIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             M FL++ L+      FCS    TI S LETY+V VE P S ISTQSS     DL+ +Y S
Sbjct  1     MGFLKILLVFI----FCSFPWPTIQSNLETYLVHVESPESLISTQSSL---TDLDSYYLS  53

Query  2221  FLPTTV----AGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPL  2054
             FLP T     + G    + M++ Y NVM GFAA+L+AE+VKEM    GF+SA  +R L L
Sbjct  54    FLPKTTTAISSSGNEEAATMIYSYHNVMTGFAARLTAEQVKEMEKIHGFVSAQKQRTLSL  113

Query  2053  HTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCE  1874
              TTH+  FLGLQQNMG W+DS+YGKGVIIGV+D+GI  DHPSFSD GMPPPPA+WKGVCE
Sbjct  114   DTTHTSSFLGLQQNMGVWKDSNYGKGVIIGVIDTGILPDHPSFSDVGMPPPPAKWKGVCE  173

Query  1873  LNFT-ACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVA  1697
              NFT  CNNK+IGARS+     S  DDDGHGTHTA TAAG FV GANV+G+ANGTAAGVA
Sbjct  174   SNFTNKCNNKLIGARSYQLGHGSPIDDDGHGTHTASTAAGAFVNGANVFGNANGTAAGVA  233

Query  1696  PLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssS-FHEDSIALGAYSA  1520
             P AH+A+YKVCN  GC+D+++LAAMD AI+DGVDILS+SLGG  SS F+ + IALGAYSA
Sbjct  234   PFAHIAVYKVCNSDGCADTDVLAAMDAAIDDGVDILSISLGGGGSSDFYSNPIALGAYSA  293

Query  1519  MEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQP  1340
              E+GI VS SAGN GP  GS+ NEAPW+LTVGAST DRKL ATV LGNR++F GE+A++P
Sbjct  294   TERGILVSCSAGNNGPSTGSVGNEAPWILTVGASTQDRKLKATVKLGNREEFEGESAYRP  353

Query  1339  KDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKN  1160
             K  NS+  +L   G+N SDE  +PYC S SL +  +RGKIV+C+ GG + R  KG+AVK+
Sbjct  354   KISNSTFFALFDAGKNASDEFETPYCRSGSLTDPVIRGKIVICLAGGGVPRVDKGQAVKD  413

Query  1159  ASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITG  980
             A G GMI+I  +  G+T SA AHV+PA+DI+ ADG KILAY+N+TSNP+AT +F+GTI G
Sbjct  414   AGGVGMIIINQQRSGVTKSADAHVIPALDISDADGTKILAYMNSTSNPVATITFQGTIIG  473

Query  979   DKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSM  800
             DKNAP VAAFSSRGP+  S GILKPDIIGPGVNILA WPTSVD+  N+KSTFNIISGTSM
Sbjct  474   DKNAPIVAAFSSRGPSGASIGILKPDIIGPGVNILAAWPTSVDDNKNTKSTFNIISGTSM  533

Query  799   SCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHV  620
             SCPHLSGV ALLKS+HPDWSPA IKSAMMTTAD LN   +PI ++ L+ A +++IGAGHV
Sbjct  534   SCPHLSGVRALLKSTHPDWSPAAIKSAMMTTADTLNLANSPILDERLLPADIYAIGAGHV  593

Query  619   NPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFS  440
             NPS+ANDPGLVYDT  EDY+PYLCGLNYTNR+VG +LQ +VNCS V SI EAQLNYPSFS
Sbjct  594   NPSRANDPGLVYDTPFEDYVPYLCGLNYTNRQVGNLLQRKVNCSEVKSILEAQLNYPSFS  653

Query  439   II-LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFS  263
             I  L ST QTYTRTVTNVG+A S Y VE+  P  +   +  R   FS  +QKLTY VTF 
Sbjct  654   IYDLGSTPQTYTRTVTNVGDAKSSYKVEVASPEALPSKLTLRA-NFSS-DQKLTYQVTF-  710

Query  262   LSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
               SK A S+   V++G L+W S +H VRSPIA  L+
Sbjct  711   --SKTANSSNTEVIEGFLKWTSNRHSVRSPIALLLI  744



>ref|XP_006358841.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=745

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/746 (62%), Positives = 560/746 (75%), Gaps = 11/746 (1%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTT  2207
             L +  ++ VL+   + AT  +  + YIV  + P    + +       DLE WY SFLPTT
Sbjct  9     LTVIGLICVLLSCTTNATKQNNSQIYIVHCQFPDGERTAKYQ-----DLESWYLSFLPTT  63

Query  2206  VAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFL  2027
              +       R+++ YRNV+ GFAAKLS E++KEM   +GF+SA P+++L LHTTHS  FL
Sbjct  64    TSDSSREAPRLIYSYRNVLTGFAAKLSQEDIKEMEKMEGFVSARPQQLLKLHTTHSVNFL  123

Query  2026  GLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNF-TACNN  1850
             GLQQNMGFW+DS+YGKGVIIGV+DSGI  DHPSFSD GMPP PA+WKGVCE +F T CNN
Sbjct  124   GLQQNMGFWKDSNYGKGVIIGVIDSGIFPDHPSFSDVGMPPIPAKWKGVCESDFATKCNN  183

Query  1849  KVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYK  1670
             K+IGARS+     S  D+DGHGTHTA T AG FV+GANVYG+ANGTA GVAPLAH+AIYK
Sbjct  184   KLIGARSYQLANGSPIDNDGHGTHTASTTAGAFVKGANVYGNANGTAVGVAPLAHIAIYK  243

Query  1669  VCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSAS  1490
             VCN   CSD++ILAAMD+AI+DGVDILS+SLGG    F+ DSIA GAY+A E+GI VS S
Sbjct  244   VCNSDSCSDTDILAAMDSAIDDGVDILSMSLGGSPVPFYADSIAFGAYAATERGILVSCS  303

Query  1489  AGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSL  1310
             AGN GP   + +N APW+LTVGAST+DRK+ ATV LGN ++F GE+A++P+  +S+  +L
Sbjct  304   AGNSGPSIITAANTAPWILTVGASTIDRKIKATVTLGNTEEFEGESAYRPQISDSTFFTL  363

Query  1309  VFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIE  1130
                 ++  D S +PYC   SL +  ++GKIV+C+ G  +    KG+AVK+A G GMI+I 
Sbjct  364   YDAAKSIGDPSETPYCKPGSLTDPSIKGKIVICLPG-VVSNIEKGQAVKDAGGVGMIVIN  422

Query  1129  PEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAF  950
             P +YG+T SA AHVLPA+ ++ ADG KIL Y N+ SNP AT + +GTI GDKNAP VAAF
Sbjct  423   PSQYGVTKSADAHVLPALVVSAADGTKILDYTNSISNPTATITIQGTIIGDKNAPIVAAF  482

Query  949   SSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAA  770
             SSRGP++ +PGILKPDIIGPGVNILA WPTSVD+  N+KSTFNIISGTSMSCPHLSGVAA
Sbjct  483   SSRGPSKPNPGILKPDIIGPGVNILAAWPTSVDDNKNTKSTFNIISGTSMSCPHLSGVAA  542

Query  769   LLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGL  590
             LLKS+HPDWSPA IKSA+MTTA  LN   +PI ++ L+ A +F+IGAGHVNPS+ANDPGL
Sbjct  543   LLKSTHPDWSPAAIKSAIMTTAYTLNLDNSPILDEKLLPADIFAIGAGHVNPSRANDPGL  602

Query  589   VYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSII-LESTAQT  413
             VYDT  EDYLPYLCGL YTN +VG +L+  VNC  V SIPEAQLNYPSFSI  L ST QT
Sbjct  603   VYDTPSEDYLPYLCGLGYTNAQVGSLLRRTVNCLEVKSIPEAQLNYPSFSIFGLGSTPQT  662

Query  412   YTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNM  233
             YTRTVTNVG+ +S Y VEI    GV V V P EL FS++NQKLTY VTF   SK   S+ 
Sbjct  663   YTRTVTNVGDVASSYKVEIASLIGVSVEVVPTELNFSELNQKLTYQVTF---SKTTSSSK  719

Query  232   PPVVQGALRWKSVKHHVRSPIAAKLV  155
               VV+G L+W S +H VRSPIA  LV
Sbjct  720   VVVVEGFLKWTSTRHSVRSPIAVVLV  745



>ref|XP_011071248.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=741

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/739 (63%), Positives = 567/739 (77%), Gaps = 11/739 (1%)
 Frame = -1

Query  2380  MFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVA  2201
             + LI ++++           LETYIV V+LP S + +  S     DLE WY+SFLPTT+A
Sbjct  7     LSLICALILQLSLVIANDVSLETYIVHVDLPGSPMLSDQSQ----DLESWYESFLPTTIA  62

Query  2200  GGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGL  2021
                    RMV+ YRNV  GFAAKL++EEVK M  K GFISA P+++LPLHTTH+P FLGL
Sbjct  63    SS-IETPRMVYSYRNVFPGFAAKLTSEEVKVMEKKKGFISARPQQVLPLHTTHTPNFLGL  121

Query  2020  QQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT-ACNNKV  1844
              QNMGFWRDS+YGKG+IIGVLD+GI  DHPSFSDEGMP PPA+WKG CE  FT ACNNK+
Sbjct  122   HQNMGFWRDSNYGKGIIIGVLDTGILPDHPSFSDEGMPSPPAKWKGTCEFGFTGACNNKL  181

Query  1843  IGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVC  1664
             IGAR F   + +  D DGHGTHTA TAAGNFVRGAN++G ANGTA GVAPLAHLA+YKVC
Sbjct  182   IGARHFRNGDGTPLDFDGHGTHTAATAAGNFVRGANLFGMANGTAVGVAPLAHLAMYKVC  241

Query  1663  NEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAG  1484
             +   CS+S+ILAAMDTAIEDGVD+LS+SLGG S  FH+D+IALGA+SAME+GIFVS SAG
Sbjct  242   SP-SCSESDILAAMDTAIEDGVDVLSISLGGPSRPFHDDNIALGAFSAMERGIFVSCSAG  300

Query  1483  NEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVF  1304
             N GP   SLSNEAPW+LTVGAST+DRKL AT VLGN+Q+ +GE+AFQP+DF +  L LV+
Sbjct  301   NFGPSYTSLSNEAPWILTVGASTIDRKLVATAVLGNKQELNGESAFQPQDFPAEQLPLVY  360

Query  1303  PGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPE  1124
             PG N SD ++  +C   SL +  V+GKIV+C  GG+     +G+AVK+A G  MILI+ E
Sbjct  361   PGLNASDFNAQ-HCSISSLNDTGVKGKIVLCNIGGWTTSVQQGQAVKDAGGAAMILIDEE  419

Query  1123  EYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSS  944
               G +TSA AHVLPA ++ Y DG KILAYIN++S+P AT  FKGT+ GDKN+P VA+FSS
Sbjct  420   RQGFSTSADAHVLPATNVNYEDGLKILAYINSSSSPTATIVFKGTVIGDKNSPMVASFSS  479

Query  943   RGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALL  764
             RGP+  SPGILKPDI+GPGVNILA WPTSV+N  N+K+ FN+ISGTSMSCPHLSGVAAL+
Sbjct  480   RGPSISSPGILKPDILGPGVNILAAWPTSVENNTNTKNNFNVISGTSMSCPHLSGVAALI  539

Query  763   KSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVY  584
             KS+HPDWSPA IKSAMMTTAD +N G  PI ++  + A V + GAGHVNP++ANDPGL+Y
Sbjct  540   KSAHPDWSPAAIKSAMMTTADTMNLGNRPILDERHLPADVLATGAGHVNPTRANDPGLIY  599

Query  583   DTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTR  404
             D + +DY  YLCGLNYT+RE+ ++LQ  +NCS+   + E QLNYPSFSI   S+ QT+TR
Sbjct  600   DIETQDYESYLCGLNYTSREIFIVLQRHLNCSSNSRVHEGQLNYPSFSIRSGSSDQTFTR  659

Query  403   TVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPV  224
             TVTNVG+ASS YTVE+  P G+ V V P+ L FS++NQKLTY +TF  S  A  S    V
Sbjct  660   TVTNVGDASSSYTVEVVSPRGINVAVSPQTLNFSELNQKLTYEITFRRSENAGTST---V  716

Query  223   VQGALRWKSVKHHVRSPIA  167
              QG + W+S KH VRSPIA
Sbjct  717   SQGYIVWQSAKHSVRSPIA  735



>ref|XP_006363699.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=742

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/754 (64%), Positives = 576/754 (76%), Gaps = 21/754 (3%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTA--TIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             M FL++FLI      FCS    +I S  ETYIV VE      S  SS SS  DLE +Y S
Sbjct  1     MGFLKIFLIFI----FCSFPWPSIQSDFETYIVHVE------SQISSQSSLTDLESYYLS  50

Query  2221  FLP---TTVAGGGYGES-RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPL  2054
             FLP   TT++  G  E+  M++ Y +VMKGFAA+L+A +VKEM  K GF+SA  +RIL L
Sbjct  51    FLPKSTTTISSSGNEEAASMIYSYHSVMKGFAARLTAAQVKEMEKKRGFVSAQKQRILSL  110

Query  2053  HTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCE  1874
             HTTH+P FLGLQQN+G W+DS+YGKGVIIG +D+GI  DHPSFSD GMPPPPA+W GVCE
Sbjct  111   HTTHTPSFLGLQQNIGVWKDSNYGKGVIIGDIDNGIFPDHPSFSDVGMPPPPAKWNGVCE  170

Query  1873  LNFT-ACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVA  1697
              NFT   NNK+IGARS+     S  DD GHGTH AGTAAG FV+GANV+G+ANGTA GVA
Sbjct  171   SNFTNKYNNKLIGARSYQLGNGSPIDDTGHGTHIAGTAAGAFVKGANVFGNANGTAVGVA  230

Query  1696  PLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssS-FHEDSIALGAYSA  1520
             PLAH+AIYKVCN  GC++ +I+AAMD AI DGVDILSLSLG  S   FH D+IALGAYSA
Sbjct  231   PLAHIAIYKVCNSDGCAEIDIIAAMDAAIADGVDILSLSLGERSRLPFHSDNIALGAYSA  290

Query  1519  MEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQP  1340
              E+GI VS SAGN GPF GS+ N APW+LTVGAST+DRK+ ATV LGNR++F GE+A+ P
Sbjct  291   TERGILVSCSAGNSGPFRGSVENTAPWILTVGASTIDRKMKATVKLGNREEFEGESAYHP  350

Query  1339  KDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKN  1160
             K  NS+  +L   G+N SD+S +PYC   SL +  VRGKIV+C+  G +    +G+AVK+
Sbjct  351   KISNSTFFTLFDAGENISDQSETPYCKPGSLNDTAVRGKIVLCLADGGVPGVDQGQAVKD  410

Query  1159  ASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITG  980
             A G GMI+I   +  +T SA AHVLPA+D++ ADG KI AY+N+TSNP+AT +F+GTI G
Sbjct  411   AGGVGMIIINSPDDRVTKSADAHVLPAMDVSAADGTKIRAYMNSTSNPVATITFQGTIIG  470

Query  979   DKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSM  800
             DKNAP VA+FSSRGP+R SPGILKPDIIGPGVNILA WPT VD+  N+KSTFNIISGTSM
Sbjct  471   DKNAPAVASFSSRGPSRVSPGILKPDIIGPGVNILAAWPTFVDDNKNTKSTFNIISGTSM  530

Query  799   SCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHV  620
             +CPHLSGVAALLKS+HPDWSPA IKSA+MTTAD LN   +PI ++ L+ A +F+IGAGHV
Sbjct  531   ACPHLSGVAALLKSAHPDWSPAAIKSAIMTTADTLNLANSPILDERLIPADIFAIGAGHV  590

Query  619   NPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFS  440
             NPS+ANDPGL+YDT  EDY+PYLCGL YT+REVG +LQ +V CS V SIPEAQLNYPSFS
Sbjct  591   NPSRANDPGLIYDTPFEDYVPYLCGLKYTSREVGYLLQRKVKCSEVKSIPEAQLNYPSFS  650

Query  439   IILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSL  260
             I L ST QTYTRTVTNVG+A S Y VEI  P GV + V+P +L FS +NQKLTY VTF  
Sbjct  651   IRLGSTPQTYTRTVTNVGDAKSSYKVEIASPKGVVMKVKPSKLNFSMLNQKLTYQVTF--  708

Query  259   SSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
              SK   S+ P V++G L+W S +H VRSPIA  L
Sbjct  709   -SKTTNSSNPGVIEGFLKWTSNRHSVRSPIAIVL  741



>ref|XP_006358371.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=757

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/759 (63%), Positives = 569/759 (75%), Gaps = 24/759 (3%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             MK    FL+ ++L G  S A+I S+L+TYIV VE P S+ISTQS S    DLE WY+SFL
Sbjct  1     MKIFNFFLVFTIL-GCLSWASIESELKTYIVHVESPESQISTQSLSG---DLESWYQSFL  56

Query  2215  PTTVA----GGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             P T+A          SR+V+ YRNVMKGFAA+L+AE+VKEM  K GFI+A PERIL LHT
Sbjct  57    PNTIARTSASSNEEASRLVYSYRNVMKGFAARLTAEQVKEMEKKPGFIAAWPERILSLHT  116

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             THSP FLGL QN+G W++S+YGKGVIIGVLD+GI+ DHPSFSDEGMPPPPA+WKG CE N
Sbjct  117   THSPSFLGLHQNIGLWKNSNYGKGVIIGVLDTGISPDHPSFSDEGMPPPPAKWKGKCESN  176

Query  1867  FTA-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPL  1691
             FT  CNNK+IGAR+F +   S  DD+GHGTHTA T AG+FV+GANV+G+A GTA G+APL
Sbjct  177   FTTKCNNKLIGARTFPQANGSPIDDNGHGTHTASTIAGSFVKGANVFGNAIGTAVGIAPL  236

Query  1690  AHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEK  1511
             AHLAIYKVC+   CSDS +L+AMD AI+DGVDILSLSLGG ++ FH D IALGAYSA ++
Sbjct  237   AHLAIYKVCDSFSCSDSGVLSAMDAAIDDGVDILSLSLGGTTNPFHSDPIALGAYSATQR  296

Query  1510  GIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDF  1331
             GI VS SAGN GPF  ++ NEAPW+LTVGAST+DRK+ AT+ LGN+++F GE+AF PK  
Sbjct  297   GILVSCSAGNNGPFESTVVNEAPWILTVGASTLDRKIKATLRLGNKEEFEGESAFHPKVS  356

Query  1330  NSSLLSLVFPGQNTSDESSSPYCDSESL--------RNADVRGKIVVCMTGGFLDRRGKG  1175
             N+    L  P +N +D    P  DS+ L         +A  +GKIV+C  GG  +R  KG
Sbjct  357   NNKFFPLFDPSENATD----PDSDSDILFCGPGLTELSAVAKGKIVLCKVGGGFNRIEKG  412

Query  1174  EAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFK  995
             +AVKNA G GMIL    + G T SA AHVLPA+D+T +D   I  Y+ +T NP+A  +F+
Sbjct  413   QAVKNAGGVGMILTNRPQDGSTKSADAHVLPALDVTSSDRNSITDYMKSTKNPVARITFQ  472

Query  994   GTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNII  815
             GTI GDK AP VAAFS+RGP+  SPGILKPDIIGPGVNILA W  SV+NK N+KSTFNII
Sbjct  473   GTIIGDKTAPVVAAFSARGPSTASPGILKPDIIGPGVNILAAWHNSVENKTNTKSTFNII  532

Query  814   SGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSI  635
             SGTSMSCPHLSGVAALLKS+HP WSP+ IKSA+MTTADI+N       ++ L  A +F+ 
Sbjct  533   SGTSMSCPHLSGVAALLKSAHPTWSPSAIKSAIMTTADIVNLNNESFLSETLTPARIFAF  592

Query  634   GAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLN  455
             GAGHVNPS+ANDPGLVYDT+ +DYLPYLCGLNY+NREVG +LQ + NCS V SIPEAQLN
Sbjct  593   GAGHVNPSRANDPGLVYDTQFKDYLPYLCGLNYSNREVGNLLQRKANCSKVKSIPEAQLN  652

Query  454   YPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYN  275
             YPSFSI L    QTYTRTVTNVGE  S Y VEI  P  V V V+P  L+FSK+NQK+TY 
Sbjct  653   YPSFSISLGEKPQTYTRTVTNVGEVKSTYRVEIVSPRMVSVVVKPSILKFSKLNQKMTYR  712

Query  274   VTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
             VTFS ++     NM  VV G ++W S KH VRSPIA  L
Sbjct  713   VTFSTTT--VIRNM-EVVHGYMKWTSNKHFVRSPIAVVL  748



>gb|ADZ55305.1| serine protease [Coffea arabica]
Length=763

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/760 (62%), Positives = 577/760 (76%), Gaps = 21/760 (3%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIA-----SKLETYIVRVELP-HsristqsssssSVDLEH  2234
             M F+++ LIL  +I F S A        S ++TYIV VELP  +++S+ S+S ++ DLE+
Sbjct  1     MGFMQI-LILLFVISFLSIAAKGLHEQESTVQTYIVHVELPTDTQLSSASASPNNDDLEN  59

Query  2233  WYKSFLPTTVAGGGYGES-RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILP  2057
             WYKSFLPTT       E+ RM++ Y NV +GFAAKLSAE+VKEM  K GF+SA+P+ +L 
Sbjct  60    WYKSFLPTTTISSSSNEAPRMLYSYHNVFRGFAAKLSAEDVKEMEKKPGFLSASPQEMLS  119

Query  2056  LHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVC  1877
             LHTTH+P FLGL   MGFW+DS+YG GVIIGV+D+GI  DHPSFSDEGMPPPPA+WKG C
Sbjct  120   LHTTHTPSFLGLHPGMGFWKDSNYGNGVIIGVMDTGIRPDHPSFSDEGMPPPPAKWKGKC  179

Query  1876  ELNFTACNNKVIGARSFS-ERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGV  1700
             E N +ACNNK+IGAR+F+ E   S  D+ GHGTHTA TAAGNFV+GANV  +ANGTAAG+
Sbjct  180   EFNSSACNNKLIGARNFNQEFSDSALDEVGHGTHTASTAAGNFVQGANVLRNANGTAAGI  239

Query  1699  APLAHLAIYKVCNEIG--------CSDSEILAAMDTAIEDGVDIlslslggmssSFHEDS  1544
             APLAHLA+YKVC  +         C +S ILAAMD AI DGVDILSLSLGG S  F+ DS
Sbjct  240   APLAHLAMYKVCIIVCQGVVCVDICPESAILAAMDAAIHDGVDILSLSLGGSSKPFYTDS  299

Query  1543  IALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQF  1364
             +ALGAY+AMEKGI VS SAGN GPFN SL NEAPW+LTVGAST+DRK+ AT +LGN+++F
Sbjct  300   VALGAYTAMEKGILVSCSAGNGGPFNQSLENEAPWILTVGASTIDRKIVATALLGNKEEF  359

Query  1363  HGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRR  1184
              GE+ + PK F S+   L + G N SD  S+ YC S +L ++ VRGKIVVC  G  +   
Sbjct  360   DGESLYNPKHFLSTPFPLYYAGWNASDILSA-YCFSSALNSSKVRGKIVVCDYGVGISDV  418

Query  1183  GKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATF  1004
              KGE VK A G GMI+I  +  G TT A AHVLPA  ++YADG K+L+YIN+T +P+A  
Sbjct  419   QKGENVKAAGGVGMIIINGQNQGYTTFADAHVLPATHLSYADGVKVLSYINSTESPVAAI  478

Query  1003  SFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTF  824
             SFKGTI GD +AP VA+FSSRGP+  SPGILKPDIIGPGVNILA WP SV+N  N+KSTF
Sbjct  479   SFKGTIIGDDHAPVVASFSSRGPSMASPGILKPDIIGPGVNILAAWPQSVENNTNTKSTF  538

Query  823   NIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASV  644
             N++SGTSMSCPHLSGVAALLKS+HPDWSPA IKSA+MTTAD++N  +NPI+++ L+ A++
Sbjct  539   NMLSGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIMTTADLVNLAKNPIEDERLLPANI  598

Query  643   FSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEA  464
             F+IG+GHVNPS+AN+PGL+YD +P+DY+PYLCGLNYT R +  ILQ RVNC+   SIPEA
Sbjct  599   FAIGSGHVNPSRANNPGLIYDIEPKDYVPYLCGLNYTRRGLLYILQRRVNCTEESSIPEA  658

Query  463   QLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKL  284
             QLNYPSFSI   S  Q YTRTVTNVGEA S YTV++  P GV+V V+P+ L+FS+V QKL
Sbjct  659   QLNYPSFSIQFGSPIQRYTRTVTNVGEAKSVYTVKVVPPEGVEVIVKPKTLRFSEVKQKL  718

Query  283   TYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAA  164
             TY V FS    AA +      QG++ W S K  VRSPIAA
Sbjct  719   TYQVIFSQLPTAANNT---ASQGSITWASTKVSVRSPIAA  755



>ref|XP_004245678.1| PREDICTED: subtilisin-like protease SDD1 [Solanum lycopersicum]
 emb|CAA06412.1| P69C protein [Solanum lycopersicum]
Length=754

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/755 (63%), Positives = 571/755 (76%), Gaps = 19/755 (3%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTA--TIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             M FL++F +      FCS    TI S  ETYIV VE P S I+TQSS    +DLE +Y S
Sbjct  1     MGFLKIFFVFI----FCSFPWPTIQSDFETYIVHVESPESLITTQSSF---MDLESYYLS  53

Query  2221  FLPTTVAG----GGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPL  2054
             FLP T++     G    + +++ Y NVM GFAA+L+AE+VKEM  K GF+SA  +RIL L
Sbjct  54    FLPETMSAISSSGNEEAASIIYSYHNVMTGFAARLTAEQVKEMEKKHGFVSAQKQRILSL  113

Query  2053  HTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCE  1874
             HTTH+P FLGLQQN G W+DS+YGKGVIIGVLD+GI  DHPSFSD GMP PPA+WKGVC+
Sbjct  114   HTTHTPSFLGLQQNKGVWKDSNYGKGVIIGVLDTGIIPDHPSFSDVGMPSPPAKWKGVCK  173

Query  1873  LNFT-ACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVA  1697
              NFT  CNNK+IGARS+     S  D+DGHGTHTA TAAG FV+GANV+G+ANGTA GVA
Sbjct  174   SNFTNKCNNKLIGARSYELGNASPIDNDGHGTHTASTAAGAFVKGANVHGNANGTAVGVA  233

Query  1696  PLAHLAIYKVCNEIG-CSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSA  1520
             PLAH+AIYKVC   G C  S+ILAAMD AI+DGVDILS+SLGG  S  ++++IALGAYS 
Sbjct  234   PLAHIAIYKVCGFDGKCPGSDILAAMDAAIDDGVDILSISLGGSLSPLYDETIALGAYST  293

Query  1519  MEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQP  1340
              ++GI VS SAGN GP   S+ N APW+LTVGAST+DRK+ ATV LGN ++F GE+A+ P
Sbjct  294   TQRGILVSCSAGNSGPSPASVDNSAPWILTVGASTLDRKIKATVKLGNGEEFEGESAYHP  353

Query  1339  KDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKN  1160
             K  N++  +L    +N  D S +PYC   SL +  +RGKIV+C+  G +    KG+AVK+
Sbjct  354   KTSNATFFTLFDAAKNAKDPSETPYCRRGSLTDPAIRGKIVLCLAFGGVANVDKGQAVKD  413

Query  1159  ASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITG  980
             A G GMI+I P +YG+T SA AHVLPA+ ++ ADG KI AY N+  NP+AT +F+GTI G
Sbjct  414   AGGVGMIVINPSQYGVTKSADAHVLPALVVSAADGTKIRAYTNSILNPVATITFQGTIIG  473

Query  979   DKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSM  800
             DKNAP VAAFSSRGPN  S GILKPDIIGPGVNILA WPTSVD   N+KSTFNIISGTSM
Sbjct  474   DKNAPIVAAFSSRGPNTASRGILKPDIIGPGVNILAAWPTSVDGNKNTKSTFNIISGTSM  533

Query  799   SCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHV  620
             SCPHLSGVAALLKSSHPDWSPA+IKSA+MTTAD LN   +PI ++ L  A +++IGAGHV
Sbjct  534   SCPHLSGVAALLKSSHPDWSPAVIKSAIMTTADTLNLASSPILDERLSPADIYAIGAGHV  593

Query  619   NPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFS  440
             NPS+ANDPGLVYDT  EDYLPYLCGLNYTN +VG +L+ +VNCS V SIPEAQLNYPSF 
Sbjct  594   NPSRANDPGLVYDTPFEDYLPYLCGLNYTNSQVGKLLKRKVNCSEVESIPEAQLNYPSFC  653

Query  439   II-LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFS  263
             I  L ST QT+TRTVTNVG+A S YTV+I  P GV V V+PR+L FS++ QKLTY VTFS
Sbjct  654   ISRLGSTPQTFTRTVTNVGDAKSSYTVQIASPKGVVVKVKPRKLIFSELKQKLTYQVTFS  713

Query  262   LSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
               + +++S    V +G L+W S K+ VRSPIA + 
Sbjct  714   KRTNSSKSG---VFEGFLKWNSNKYSVRSPIAVEF  745



>gb|ABZ89187.1| putative protein [Coffea canephora]
Length=763

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/760 (62%), Positives = 577/760 (76%), Gaps = 21/760 (3%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIA-----SKLETYIVRVELP-HsristqsssssSVDLEH  2234
             M F+++ LIL  +I F S A        S ++TYIV VELP  +++S+ S+S ++ DLE+
Sbjct  1     MGFMQI-LILLFVISFLSIAAKGLHEQESTVQTYIVHVELPTDTQLSSASASPNNDDLEN  59

Query  2233  WYKSFLPTTVAGGGYGES-RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILP  2057
             WYKSFLPTT       E+ RM++ Y NV +GFAAKLSAE+VKEM  K GF+SA+P+ +L 
Sbjct  60    WYKSFLPTTTISSSSNEAPRMLYSYHNVFRGFAAKLSAEDVKEMEKKPGFLSASPQEMLS  119

Query  2056  LHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVC  1877
             LHTTH+P FLGL   MGFW+DS+YG GVIIGV+D+GI  DHPSFSDEGMPPPPA+WKG C
Sbjct  120   LHTTHTPSFLGLHPGMGFWKDSNYGNGVIIGVMDTGIRPDHPSFSDEGMPPPPAKWKGKC  179

Query  1876  ELNFTACNNKVIGARSFS-ERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGV  1700
             E N +ACNNK+IGAR+F+ E   S  D+ GHGTHTA TAAGNFV+GANV  +ANGTAAG+
Sbjct  180   EFNSSACNNKLIGARNFNQEFSDSALDEVGHGTHTASTAAGNFVQGANVLRNANGTAAGI  239

Query  1699  APLAHLAIYKVCNEIG--------CSDSEILAAMDTAIEDGVDIlslslggmssSFHEDS  1544
             APLAHLA+YKVC  +         C +S ILAAMD AI DGVDILSLSLGG S  F+ DS
Sbjct  240   APLAHLAMYKVCIIVCQGVVCLNICPESAILAAMDAAIHDGVDILSLSLGGSSKPFYTDS  299

Query  1543  IALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQF  1364
             +ALGAY+AMEKGI VS SAGN GPFN SL NEAPW+LTVGAST+DRK+ AT +LGN+++F
Sbjct  300   VALGAYTAMEKGILVSCSAGNGGPFNQSLENEAPWILTVGASTIDRKIVATALLGNKEEF  359

Query  1363  HGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRR  1184
              GE+ + PK F S+   L + G N SD  S+ YC S +L ++ V+GKIVVC  G  +   
Sbjct  360   DGESLYNPKHFLSTPFPLYYAGWNASDILSA-YCFSSALNSSKVQGKIVVCDYGVGISDV  418

Query  1183  GKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATF  1004
              KGE VK A G GMI+I  +  G TT A AHVLPA  ++YADG K+L+YIN+T +P+A  
Sbjct  419   QKGENVKAAGGVGMIIINGQNQGYTTFADAHVLPATHLSYADGVKVLSYINSTESPVAAI  478

Query  1003  SFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTF  824
             SFKGTI GD +AP VA+FSSRGP+  SPGILKPDIIGPGVNILA WP SV+N  N+KSTF
Sbjct  479   SFKGTIIGDDHAPVVASFSSRGPSMASPGILKPDIIGPGVNILAAWPQSVENNTNTKSTF  538

Query  823   NIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASV  644
             N++SGTSMSCPHLSGVAALLKS+HPDWSPA IKSA+MTTAD++N  +NPI+++ L+ A++
Sbjct  539   NMLSGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIMTTADLVNLAKNPIEDERLLPANI  598

Query  643   FSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEA  464
             F+IG+GHVNPS+AN+PGL+YD +P+DY+PYLCGLNYT R +  ILQ RVNC+   SIPEA
Sbjct  599   FAIGSGHVNPSRANNPGLIYDIEPKDYVPYLCGLNYTRRGLLYILQRRVNCTEESSIPEA  658

Query  463   QLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKL  284
             QLNYPSFSI   S  Q YTRTVTNVGEA S YTV++  P GV+V V+P+ L+FS+V QKL
Sbjct  659   QLNYPSFSIQFGSPIQRYTRTVTNVGEAKSVYTVKVVPPEGVEVIVKPKTLRFSEVKQKL  718

Query  283   TYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAA  164
             TY V FS    AA +      QG++ W S K  VRSPIAA
Sbjct  719   TYQVIFSQLPTAANNT---ASQGSITWASAKVSVRSPIAA  755



>gb|ADY38794.1| serine protease [Coffea arabica]
Length=763

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/759 (62%), Positives = 576/759 (76%), Gaps = 21/759 (3%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIA-----SKLETYIVRVELP-HsristqsssssSVDLEH  2234
             M F+++ LIL  +I F S A        S ++TYIV VELP  + +S+ S+S ++ DLE+
Sbjct  1     MGFMQI-LILLFVISFLSIAAKGLHDQESTVQTYIVHVELPTDTPLSSASASPNNDDLEN  59

Query  2233  WYKSFLPTTVAGGGYGES-RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILP  2057
             WYKSFLPTT       E+ RM++ Y NV KGFAAKLSAE+VKEM  K GF+SA+P+ +L 
Sbjct  60    WYKSFLPTTTISSSSNEAPRMLYSYHNVFKGFAAKLSAEDVKEMEKKPGFLSASPQEMLS  119

Query  2056  LHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVC  1877
             LHTTH+P FLGL  +MGFW+DS+YG GVIIGV+D+GI  DHPSFSDEGMPPPPA+WKG C
Sbjct  120   LHTTHTPSFLGLHPDMGFWKDSNYGNGVIIGVMDTGIRPDHPSFSDEGMPPPPAKWKGKC  179

Query  1876  ELNFTACNNKVIGARSFS-ERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGV  1700
             E N +ACNNK+IGAR+F+ E   SV D+ GHGTHTA TAAGNFV+GANV  +ANGTAAG+
Sbjct  180   EFNSSACNNKLIGARNFNQEFSDSVLDEVGHGTHTASTAAGNFVQGANVLRNANGTAAGI  239

Query  1699  APLAHLAIYKVCNEIG--------CSDSEILAAMDTAIEDGVDIlslslggmssSFHEDS  1544
             APLAHLA+YKVC  +         C +S ILAAMD AI+DGVDILSLS+GG S  F+ DS
Sbjct  240   APLAHLAMYKVCIIVCQGVICIDICPESAILAAMDAAIDDGVDILSLSIGGSSKPFYTDS  299

Query  1543  IALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQF  1364
             +ALGAY+AMEKGI VS SAGN GP N SL NEAPW+LTVGAST+DRK+ AT +LGN+++F
Sbjct  300   VALGAYTAMEKGILVSCSAGNGGPSNQSLENEAPWILTVGASTIDRKIVATALLGNKEEF  359

Query  1363  HGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRR  1184
              GE+ + PK F S+   L + G N SD  S+ YC S +L ++ V+GKIVVC  GG +   
Sbjct  360   DGESLYNPKHFLSTPFPLYYAGWNASDILSA-YCFSSALNSSKVQGKIVVCDHGGGISGA  418

Query  1183  GKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATF  1004
              KGE VK A G GMI+I  +  G TT A AHVLPA  ++YADG K+L+YIN+T  PMA  
Sbjct  419   QKGEHVKAAGGVGMIIINGQNEGYTTFADAHVLPATHLSYADGVKVLSYINSTELPMAAI  478

Query  1003  SFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTF  824
             SFKGTI GD +AP VA+FSSRGP+  SPGILKPDIIGPGVNILA WP SV+N  N+KSTF
Sbjct  479   SFKGTIIGDDHAPVVASFSSRGPSMASPGILKPDIIGPGVNILAAWPQSVENNTNTKSTF  538

Query  823   NIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASV  644
             NI+SGTSMSCPHLSGVAALLKS+HPDWSPA IKSA+MTTAD++N  +NPI+++ L+ A++
Sbjct  539   NILSGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIMTTADLVNLAKNPIEDERLLPANI  598

Query  643   FSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEA  464
             F+IG+GHVNPS+AN+PGL+YD  P+DY+PYLCGLNYT R +  ILQ RVNC+   SIPEA
Sbjct  599   FAIGSGHVNPSRANNPGLIYDIVPKDYVPYLCGLNYTRRGLLYILQRRVNCAEESSIPEA  658

Query  463   QLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKL  284
             QLNYPSFSI   S  Q YTRTVTNVGEA S YTV++  P GV+V V+P+ L+FS+V QK+
Sbjct  659   QLNYPSFSIQFGSPIQRYTRTVTNVGEAKSVYTVKVVPPEGVEVIVKPKTLRFSEVKQKV  718

Query  283   TYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             TY V FS    AA +      QG++ W S K  VRSPIA
Sbjct  719   TYEVVFSQLPTAANNT---ASQGSITWTSAKVSVRSPIA  754



>ref|XP_009767059.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=752

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/752 (64%), Positives = 580/752 (77%), Gaps = 14/752 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             MK L++FL+ S+L G  S  +I   L TYIV+VE P S+ISTQS S    DLE WY+SFL
Sbjct  1     MKILKIFLVFSIL-GCLSWPSIQGDLTTYIVQVESPKSQISTQSLSDQ--DLEGWYRSFL  57

Query  2215  PTTVAGGGYGES---RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTT  2045
             P T+A     E    R+V+ YRNVMKGFAA+LSAEEVKEM  K+GFISA PERIL LHTT
Sbjct  58    PNTIASTSSNEEEEPRLVYSYRNVMKGFAARLSAEEVKEMEKKEGFISAWPERILSLHTT  117

Query  2044  HSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNF  1865
              +P FLGLQQN G WR S+YGKGVIIGVLD+GI+ DHPSFSDEGMPPPPA+WKG CE NF
Sbjct  118   RTPSFLGLQQNEGVWRHSNYGKGVIIGVLDTGISPDHPSFSDEGMPPPPAKWKGKCESNF  177

Query  1864  TA-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLA  1688
             T  CNNK+IGAR+F +   S  DD+GHGTHTAGTAAG FV+GANV+G+ANGTA G+APLA
Sbjct  178   TTKCNNKLIGARTFPQANGSPIDDNGHGTHTAGTAAGGFVKGANVFGNANGTAVGIAPLA  237

Query  1687  HLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKG  1508
             HLAIYKVC+  GCSDS IL+AMD AI+DGVDILSLSLGG ++ FH D IALGAYSA ++G
Sbjct  238   HLAIYKVCDSFGCSDSGILSAMDAAIDDGVDILSLSLGGSTNPFHSDPIALGAYSATQRG  297

Query  1507  IFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFN  1328
             I VS SAGN GPF  ++ NEAPW+LTVGAST+DRK+ ATV LGN+++F GE+AF PK   
Sbjct  298   ILVSCSAGNNGPFESTVVNEAPWILTVGASTLDRKIKATVRLGNKEEFEGESAFHPKVSK  357

Query  1327  SSLLSLVFPGQNTSDESSSPYCDS--ESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNAS  1154
             +    L  PG+N++D  +S +C      L  A ++GKIV+C+ GG  +R  KG+AVKNA 
Sbjct  358   TKFFPLFNPGENSTDSDNS-FCGPGLTDLSRA-IKGKIVLCIAGGGFNRIEKGQAVKNAG  415

Query  1153  GRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDK  974
             G GMILI   + G+T SA AHVLPA+D+   DG  I+ Y+ +T  P+A  +F+GTI GDK
Sbjct  416   GVGMILINRPQDGLTKSADAHVLPALDVASFDGNNIIEYMKSTMKPVARITFQGTIIGDK  475

Query  973   NAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSC  794
             NAP +A FSSRGP+  SPGILKPDIIGPGVNILA WPTSV+NK N+KSTFNIISGTSMSC
Sbjct  476   NAPVLAGFSSRGPSIASPGILKPDIIGPGVNILAAWPTSVENKTNTKSTFNIISGTSMSC  535

Query  793   PHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNP  614
             PHLSGVAALLKS+HP WSPA IKSA+MTTADI+N     + ++ L  A +F+ G+GHVNP
Sbjct  536   PHLSGVAALLKSAHPTWSPAAIKSAIMTTADIVNLSNESLLDEMLSPARIFAYGSGHVNP  595

Query  613   SKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSII  434
             S+ANDPGLVYDT+ +DY+PYLCGLNYT+R++G +LQ + +CS V SIPEAQLNYPSFSI 
Sbjct  596   SRANDPGLVYDTQFKDYIPYLCGLNYTDRQMGSLLQRKTSCSKVKSIPEAQLNYPSFSIS  655

Query  433   LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSS  254
             L +  QTYTRTVTNVGEA S Y VEI  P  V V V+P  L+F+K+NQKLTY VTFS ++
Sbjct  656   LGANQQTYTRTVTNVGEAKSSYRVEIVSPRSVSVVVKPSTLKFTKLNQKLTYRVTFSTTT  715

Query  253   KAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
                 +NM  VV G L+W S KH VRSPIA  L
Sbjct  716   NI--TNM-EVVHGYLKWTSNKHFVRSPIAVIL  744



>gb|EYU28956.1| hypothetical protein MIMGU_mgv1a023117mg [Erythranthe guttata]
Length=729

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/724 (63%), Positives = 551/724 (76%), Gaps = 10/724 (1%)
 Frame = -1

Query  2332  IASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNV  2153
             I   ++TYIVRV+ P   ++   S  S+  LE WY+SFLPTT+A       R+++ YRNV
Sbjct  12    ICVLVKTYIVRVDSP---VTQLLSDQSNEHLERWYRSFLPTTLATETE-TPRIIYSYRNV  67

Query  2152  MKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGV  1973
               GFA KL+A+E +EM  K GFISA P++ L LHTTH+P FLGL QN G W +S+YGKG+
Sbjct  68    FSGFAVKLTADEAQEMQKKTGFISARPQQQLSLHTTHTPNFLGLHQNSGLWNESNYGKGI  127

Query  1972  IIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT-ACNNKVIGARSFSERERSVFdd  1796
             IIGVLD+GI  DHPSFSDEGMPPPPA+WKG CE NFT ACNNK+IGAR F+E + +  D 
Sbjct  128   IIGVLDTGIVPDHPSFSDEGMPPPPAKWKGACEFNFTGACNNKLIGARHFAEGDGTPLDF  187

Query  1795  dghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNE-IGCSDSEILAAMD  1619
             +GHGTHTAGTAAGNFVRGANV+G ANGTAAG+APLAHLA+YKVC+   GCS+S+ LAAMD
Sbjct  188   NGHGTHTAGTAAGNFVRGANVFGIANGTAAGIAPLAHLAVYKVCSRGSGCSESDTLAAMD  247

Query  1618  TAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPW  1439
              AIEDGVDILSLSLG  S  F+ D IALG++SAME+GIFVSASA N GPFN SL+NEAPW
Sbjct  248   IAIEDGVDILSLSLGAPSRPFYNDYIALGSFSAMERGIFVSASADNNGPFNFSLANEAPW  307

Query  1438  MLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCD  1259
             MLTVGAST+DR+L A  +LGN ++  GE+A+ P DF  + L LV+PG NTS+ S + +C 
Sbjct  308   MLTVGASTIDRRLVANAILGNNEELEGESAYHPMDFPLTQLPLVYPGSNTSN-SGAAFCT  366

Query  1258  SESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPA  1079
               SL N DVRGKIV+C  GG +    KG+AVK+A G  MIL+  E+ G TT+A AHVLPA
Sbjct  367   QRSLNNTDVRGKIVLCRIGGGIAGVAKGQAVKDAGGVAMILVGIEQRGFTTTAEAHVLPA  426

Query  1078  IDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDI  899
              +I Y DGQK++AYIN+TS P A   FKGT+ GDKN+P VAAFSSRGP+R SPGILKPDI
Sbjct  427   TNINYRDGQKVMAYINSTSAPTAGIVFKGTVIGDKNSPAVAAFSSRGPSRASPGILKPDI  486

Query  898   IGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSA  719
             IGPGVNILA   T V+N  N+  TF  +SGTSMSCPHLSGVAALLKS HPDWSPA IKSA
Sbjct  487   IGPGVNILAAHLTYVENNTNTNITFRFVSGTSMSCPHLSGVAALLKSVHPDWSPAAIKSA  546

Query  718   MMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLN  539
             +MTTAD +N     IQ++  + A +F+ GAGHVNP +A++PGLVYD +P DY+PYLCGLN
Sbjct  547   IMTTADNVNLENRQIQDERHLPADIFATGAGHVNPVRASNPGLVYDIEPRDYVPYLCGLN  606

Query  538   YTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVE  359
             YTNRE+ +I Q +VNCSA   I E QLNYPSF+I   S+ QT+TRTVTNVGEASS Y VE
Sbjct  607   YTNREMNIITQRKVNCSAESRIVEGQLNYPSFAIRFGSSNQTFTRTVTNVGEASSSYAVE  666

Query  358   IFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVR  179
             +  PPG+ V VEPR L FS++NQK TY VTFS S   + ++   V QG + WKS  H VR
Sbjct  667   VVAPPGIDVIVEPRRLDFSQLNQKSTYEVTFSRSEITSNTS---VSQGYIVWKSANHSVR  723

Query  178   SPIA  167
             SPIA
Sbjct  724   SPIA  727



>emb|CDP11276.1| unnamed protein product [Coffea canephora]
Length=753

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/756 (60%), Positives = 560/756 (74%), Gaps = 16/756 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIA------SKLETYIVRVELPH-sristqsssssSVDLE  2237
             M+ L  FLIL  ++    +   A      S LETYIV VELP        +++ +  DLE
Sbjct  1     MESLMHFLILICVLTNSHSEIAANEFQEQSNLETYIVHVELPDPDDAEYGTNAITGEDLE  60

Query  2236  HWYKSFLPTTVAGGGYGES---RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPER  2066
               Y SFLPTT        +    +V+ Y NV KGFAAKLSAE+VKE+  K GF+SA  ++
Sbjct  61    SLYNSFLPTTATTAAISNATLPHIVYSYHNVFKGFAAKLSAEDVKEIEKKPGFVSARQQK  120

Query  2065  ILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWK  1886
             +L L TTH+P FLGL QN+G W++S+ GKG+IIG+LD+GI  DHPSFSDEGMP PPA+WK
Sbjct  121   LLSLCTTHTPSFLGLHQNLGLWKESNCGKGIIIGILDTGIVPDHPSFSDEGMPAPPAKWK  180

Query  1885  GVCELNFTACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAA  1706
             G CE N + CNNK+IGAR F +   S  D+ GHGTHTA  AAGN+V+GANV+G+ANGTA 
Sbjct  181   GRCEFNSSVCNNKLIGARYFHDGNGSPLDETGHGTHTASIAAGNYVQGANVFGNANGTAV  240

Query  1705  GVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAY  1526
             G+APLAHLA+YKVC  IGC +S+ILAAMD AIEDGVDI+S SL G    F+ +S+ LGAY
Sbjct  241   GIAPLAHLAMYKVCTAIGCFESDILAAMDAAIEDGVDIISASLVGGDYQFYANSLLLGAY  300

Query  1525  SAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAF  1346
             SAME+GIFVS SAGN+GP   SLSNEAPW+LTVGAST+DR + AT VLGN+++F GET  
Sbjct  301   SAMERGIFVSCSAGNDGPSKSSLSNEAPWVLTVGASTIDRNIRATAVLGNKEEFQGETIN  360

Query  1345  QPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAV  1166
             Q KDF  +L  L +PG+N  D   S YC S+SL N +VRGKIVVC+ GG +    KGE +
Sbjct  361   QLKDFPPTLFPLFYPGKN-QDNIKSKYCASKSLNNTEVRGKIVVCIDGGTISGIEKGENI  419

Query  1165  KNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTI  986
             K A G GMILI  +  G TT A AHVLPA D++YADG K++AYIN+T +PMA  SFKGT+
Sbjct  420   KAAGGVGMILINHKNDGYTTFADAHVLPATDLSYADGLKVIAYINSTESPMAAISFKGTV  479

Query  985   TGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGT  806
              GD +AP VA+FSSRGP+R SPGILKPDIIGPGVNILA W  S++N  N+K  FN++SGT
Sbjct  480   FGDNHAPMVASFSSRGPSRASPGILKPDIIGPGVNILAAWRHSIENNTNTK--FNVLSGT  537

Query  805   SMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAG  626
             SMSCPHLSGVAALLKS HP+WSPA IKSA++TTAD++N  +NPI++Q    A++F+ G+G
Sbjct  538   SMSCPHLSGVAALLKSVHPNWSPAAIKSAILTTADLVNCAKNPIEDQRHHPANIFATGSG  597

Query  625   HVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPS  446
             HVNPSKA +PGL+YD +P+DY+PYLCGLNYTNRE+G++L+ +VNC+  + +PEAQLNYPS
Sbjct  598   HVNPSKATNPGLIYDIEPKDYIPYLCGLNYTNREIGILLKRKVNCAVELLMPEAQLNYPS  657

Query  445   FSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTF  266
             FSII  S  Q YTR VTNV EA+S YTV+I  P GV + V+P  L FS+ NQKLTY VTF
Sbjct  658   FSIIFGSPVQRYTRMVTNVDEANSTYTVKIIPPAGVNLTVKPTTLGFSQANQKLTYEVTF  717

Query  265   SLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
             +L +  A+S    V QG+L W S K  VRSPI A +
Sbjct  718   TLVASPAKSR---VSQGSLSWTSTKFSVRSPIVATI  750



>ref|XP_009586892.1| PREDICTED: subtilisin-like protease SDD1 [Nicotiana tomentosiformis]
Length=742

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/755 (63%), Positives = 577/755 (76%), Gaps = 21/755 (3%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCS--TATIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             M FL++ L       FCS    +  S LETYIV+VE P S+ISTQSSS   +DLE +Y S
Sbjct  1     MGFLKILLFCI----FCSFPLPSFQSDLETYIVQVEPPESQISTQSSS---MDLESYYHS  53

Query  2221  FLP--TTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             FLP  T+++     E RM++ Y NVMKGFAA+L+A +VKEM  K GF SA P RIL L T
Sbjct  54    FLPKTTSISSSENEEPRMIYSYHNVMKGFAARLTAAQVKEMEKKQGFFSARPHRILSLQT  113

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             TH+P FLGLQQNMG W+DS+YGKGVIIGVLD+GI  DHPSFSD GMPPPPA+WKG CE N
Sbjct  114   THTPSFLGLQQNMGLWKDSNYGKGVIIGVLDTGIFPDHPSFSDVGMPPPPAKWKGFCESN  173

Query  1867  FTA-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPL  1691
             FT  CNNK+IG RSF   E S  DDDGHGTHTA TAAG FV+GAN +G+ANGTA GVAPL
Sbjct  174   FTTKCNNKIIGLRSFRFAEGSPIDDDGHGTHTASTAAGAFVKGANFFGNANGTAVGVAPL  233

Query  1690  AHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssS-FHEDSIALGAYSAME  1514
             AH+AIYKVC+   CSD++ LAAMD AI+DGVDI+S SLGG S+  FH+D IALGAYSA E
Sbjct  234   AHIAIYKVCSFATCSDTDFLAAMDAAIDDGVDIISASLGGFSNGPFHDDPIALGAYSATE  293

Query  1513  KGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKD  1334
             +GI VS SAGN   F+ S++N APW+LTVGAST DRKL ATV LGN+++F GE+A + K 
Sbjct  294   RGILVSCSAGNR-QFDNSVANSAPWILTVGASTHDRKLKATVKLGNKEEFEGESADEKKT  352

Query  1333  FNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNAS  1154
              NS+ ++L   G+N SD+ + P+C S +L +  ++GKIV+C          +GE+VKNA 
Sbjct  353   SNSTFIALYDAGKNASDQDA-PFCRSWALTDPAIKGKIVLCRKDCCSLTSSQGESVKNAG  411

Query  1153  GRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDK  974
             G GMILI   E G+T SATAHVLPA+D+++ +G+KI AYIN+TSNP+A  +F+GT+ GDK
Sbjct  412   GVGMILINNPEDGVTKSATAHVLPALDVSHEEGEKIKAYINSTSNPIAAITFQGTVIGDK  471

Query  973   NAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVD--NKPNSKSTFNIISGTSM  800
             NAP VA+FS+RGP+R +PGILKPDIIGPGVN+LA WPT+V+  NK N+KS FNI+SGTSM
Sbjct  472   NAPIVASFSTRGPSRANPGILKPDIIGPGVNVLAAWPTTVNIPNK-NTKSAFNILSGTSM  530

Query  799   SCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHV  620
             SC HL+G+AALLKS+HP+WS + IKSA+MTTAD LN  +NPI ++ L  A++F+ GAGHV
Sbjct  531   SCAHLTGIAALLKSAHPNWSSSAIKSAIMTTADTLNLAKNPILDETLNPANIFATGAGHV  590

Query  619   NPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFS  440
             NPS+A DPGLVYDT  EDYLPYLCGLNY+NREVG +LQ +VNC  V SIPEAQLNYPSFS
Sbjct  591   NPSRATDPGLVYDTPFEDYLPYLCGLNYSNREVGNLLQRKVNCLEVKSIPEAQLNYPSFS  650

Query  439   IILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSL  260
             I L ST QTYTR VTNVG+A S Y VEI +P GV V V+P +L FS +NQ+LTY VTF  
Sbjct  651   IRLRSTPQTYTRNVTNVGDAKSSYKVEIVQPKGVAVKVKPSKLNFSMLNQRLTYQVTF--  708

Query  259   SSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
              SK   S+   VVQG L+W S +H VRSPIA  LV
Sbjct  709   -SKTTNSSGNEVVQGFLKWTSNRHSVRSPIAVVLV  742



>emb|CDP11959.1| unnamed protein product [Coffea canephora]
Length=747

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/761 (62%), Positives = 571/761 (75%), Gaps = 28/761 (4%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIA------SKLETYIVRVELPHsristqsssssSVDLEHWYK  2225
             L +   L  L   C  ATIA      S LETYIVR+E P     T+S      DLE W++
Sbjct  3     LMVISTLFCLFSCCVLATIAREVPQKSNLETYIVRLE-PRDGPVTESE-----DLESWHR  56

Query  2224  SFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTT  2045
             SFLP T+    Y +SRMV+ YRNVM+GFAAKLS EEVKEM  K GFISA P   L LHTT
Sbjct  57    SFLPATIESTNY-DSRMVYSYRNVMQGFAAKLSPEEVKEMQKKKGFISARPPERLSLHTT  115

Query  2044  HSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN-  1868
             HSP FLGLQQN+GFW+DS+YGKGVIIG+LDSGI  DHPSFSD+G+ PPPA+WKG CEL  
Sbjct  116   HSPSFLGLQQNVGFWKDSNYGKGVIIGILDSGITPDHPSFSDDGILPPPAKWKGKCELRP  175

Query  1867  FTACNNKVIGARSFSERER--SVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAP  1694
              + CNNK+IGA+ F + ++  +  D+ GHGTHTA TAAGNFV+GANVYG+ANGTAAGVAP
Sbjct  176   ASLCNNKIIGAQHFIQDDQNGTSADETGHGTHTASTAAGNFVKGANVYGNANGTAAGVAP  235

Query  1693  LAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAME  1514
             LAHLAIYKVC+ + CS+S++LA +DTAIEDGVD++S+SLGG S  F+++ + LGAYSAME
Sbjct  236   LAHLAIYKVCSTV-CSESDVLAGIDTAIEDGVDVISISLGGTSKPFYDNYVPLGAYSAME  294

Query  1513  KGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKD  1334
             KGIFVS SAGNEGP   S+ N+APW+LTVGAST+DRK+ A+ +LGN ++  GE+AFQPKD
Sbjct  295   KGIFVSCSAGNEGPDYFSVGNDAPWILTVGASTMDRKIRASAMLGNNKKLEGESAFQPKD  354

Query  1333  FNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNAS  1154
             + S++  LV+PG N SD  ++ YC  +SL N  V+GK V+C  G  L     GE VK A 
Sbjct  355   YASTMFPLVYPGSNKSDPFAA-YCFPDSLNNTGVKGKTVLCERG--LPGVTMGELVKAAG  411

Query  1153  GRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDK  974
             G  MI+I PE+ G TT A AHVLPA  ++Y DG KI AY+N+T  P A   F GT  GD 
Sbjct  412   GAAMIIINPEDRGYTTEADAHVLPAAHLSYVDGVKIKAYMNSTKLPKAAIFFNGTAIGDD  471

Query  973   NAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSC  794
              AP VA+FSSRGP+  SPGILKPDI+GPGV+ILA WP SV+N  N+KSTFN +SGTSMSC
Sbjct  472   QAPAVASFSSRGPSEASPGILKPDIVGPGVSILAAWPVSVENNTNTKSTFNFLSGTSMSC  531

Query  793   PHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQ-HLVTASVFSIGAGHVN  617
             PHLSGVAALLKS+HPDWSPA IKSA+MTTAD +N  + PI +Q +L+ A VF+ GAGHVN
Sbjct  532   PHLSGVAALLKSAHPDWSPAAIKSAIMTTADSVNLEKKPIADQLNLLPADVFATGAGHVN  591

Query  616   PSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSI  437
             PS+AN+PGLVYD +P++Y+PYLCGLNYTNREVG++LQ  VNCS    IP++QLNYPSFSI
Sbjct  592   PSRANNPGLVYDIEPKEYIPYLCGLNYTNREVGMLLQRHVNCSVESRIPDSQLNYPSFSI  651

Query  436   ILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLS  257
             +L +TAQTYTRTVTNVGEA S YTV I +P GV VNVEP  L+FSK+++KLTY V F   
Sbjct  652   VLGATAQTYTRTVTNVGEADSVYTVNIVQPRGVSVNVEPDTLKFSKLHEKLTYEVRF---  708

Query  256   SKAARSNMPPV--VQGALRWKSVKHHVRSPIAAKLV*HQLV  140
                  +N P V   QG+L W S K+ VRSPIA   +  +L+
Sbjct  709   --IRLANAPNVSASQGSLTWTSDKYSVRSPIAVTFITSELL  747



>ref|XP_011071267.1| PREDICTED: subtilisin-like protease SDD1 [Sesamum indicum]
Length=741

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/745 (61%), Positives = 563/745 (76%), Gaps = 12/745 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIA-SKLETYIVRVELPHsristqsssssSVDLEHWYKSF  2219
             M +   FL L  ++ F +      SKLE+YIV VE+P     +  +     DLE WY+SF
Sbjct  1     MGYYMFFLTLVCVLNFHTIVRAEESKLESYIVHVEMPRGPTVSAHTD----DLEGWYQSF  56

Query  2218  LPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHS  2039
             LPTT++        +++ Y NV KGFAA+LS E+VKEM  K GF+SA P++ LPLHTTHS
Sbjct  57    LPTTLSSSSADGPHIIYSYHNVFKGFAARLSPEQVKEMEKKPGFVSARPQKTLPLHTTHS  116

Query  2038  PGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA  1859
             P FLGL QNMGFWRDS+YG+GVIIGVLDSGI  DHPSF+DEGMPPPPA+WKG C+ N T 
Sbjct  117   PNFLGLNQNMGFWRDSNYGRGVIIGVLDSGINPDHPSFNDEGMPPPPAKWKGQCQFNSTV  176

Query  1858  CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLA  1679
             CNNK+IGAR F+    +  D++GHGTHTA TAAGNFVRGANV+G+ANGTAAG+APLAH+A
Sbjct  177   CNNKLIGARYFTIGNGTPLDENGHGTHTASTAAGNFVRGANVFGNANGTAAGIAPLAHIA  236

Query  1678  IYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFV  1499
             +YKVCN  GCS+S+ILAAMD AI+DGVDI+SLSLGG + +F++D++A+GA+SA+E+GIFV
Sbjct  237   MYKVCN-TGCSESDILAAMDAAIDDGVDIISLSLGGPARNFYDDNVAVGAFSAVERGIFV  295

Query  1498  SASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSL  1319
             SASAGN GPF GS+ N APW+LTVGAS+VDRK+ AT VLGN ++  GE+ FQP DF+S+ 
Sbjct  296   SASAGNSGPFLGSIENGAPWLLTVGASSVDRKIRATAVLGNNEELEGESTFQPADFSSTP  355

Query  1318  LSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMI  1139
             L LV+P  N+SD ++  +C    LRN +V+GKIV+C  GG + R  KG AV NA G  MI
Sbjct  356   LHLVYPRLNSSDPNAQ-FCLPALLRNVNVQGKIVLCEQGGGIGRIAKGRAVGNAGGAAMI  414

Query  1138  LIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTV  959
             LI  +  G TT + +HVLPA  ++YADG KI AY+N+TS+P AT SFKGTI GD  APTV
Sbjct  415   LINQQPQGYTTYSDSHVLPATHLSYADGLKIKAYLNSTSSPTATISFKGTIIGDDRAPTV  474

Query  958   AAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSG  779
             A FS RGPN  S GILKPDIIGPG NILA W  SV+N  N+KS FNIISGTSMSCPHLSG
Sbjct  475   AYFSGRGPNLASLGILKPDIIGPGHNILAAWHISVENNTNTKSNFNIISGTSMSCPHLSG  534

Query  778   VAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKAND  599
             VAALLK++HPDWSPA IKSA+MTTAD +N   N I+++ L  A +F++G+GHVN  KA D
Sbjct  535   VAALLKNAHPDWSPAAIKSAIMTTADQVNLAGNFIEDETLRPAILFAVGSGHVNILKATD  594

Query  598   PGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILES--  425
             PGLVYD +P+DY+PYLCGLNYT+++V +I    V CS + SI EA+LNYPSF+ +L +  
Sbjct  595   PGLVYDIQPQDYVPYLCGLNYTDQQVEIIANRPVRCSEISSISEAELNYPSFTALLGTGN  654

Query  424   TAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAA  245
             T++TY RTVTNVGEA+S YTVE    PGV + VEP  LQFS VNQ+LTY VTF   ++ A
Sbjct  655   TSETYNRTVTNVGEANSVYTVETVGLPGVDMRVEPSTLQFSGVNQRLTYQVTF---NRLA  711

Query  244   RSNMPPVVQGALRWKSVKHHVRSPI  170
              ++   V QG L W S +H VRSP+
Sbjct  712   NASSNTVAQGFLTWTSARHSVRSPL  736



>ref|XP_006358407.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=743

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/745 (62%), Positives = 566/745 (76%), Gaps = 10/745 (1%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTT  2207
             +++F ++  ++   S  ++ S LETYIV+VE P S+ISTQSS    +DLE WYKSFLP T
Sbjct  1     MKIFFVIFAILACFSCPSMQSDLETYIVQVESPESQISTQSSR---MDLESWYKSFLPKT  57

Query  2206  VAGGGYGES-RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGF  2030
             +      E  R+++ Y NV+ GFAA+LSA++VKEM  K GFISA P+RIL LHTTH+P F
Sbjct  58    IETADSEEKPRLIYSYHNVIIGFAARLSAKQVKEMEKKPGFISAWPQRILSLHTTHTPSF  117

Query  2029  LGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA-CN  1853
             L LQQN+G WRD  YGKGVIIGVLD+G+  DHPSFSDEGMPPPPA+WKG C+ NFTA CN
Sbjct  118   LQLQQNVGLWRDDKYGKGVIIGVLDTGVTPDHPSFSDEGMPPPPAKWKGKCDSNFTAKCN  177

Query  1852  NKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIY  1673
             NK+IGARS+ + + S  DDDGHGTHT+ TAAGNFV+GANVYG+A GTA G+APLAHLAIY
Sbjct  178   NKLIGARSYIDDKHSPIDDDGHGTHTSSTAAGNFVKGANVYGNAKGTAVGIAPLAHLAIY  237

Query  1672  KVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSA  1493
             KVC E GC+D++ILA MD AI+DGVDILSLSLGG S SF++D IALGAYSA ++GI VS 
Sbjct  238   KVCQEFGCADADILAGMDEAIDDGVDILSLSLGGPSRSFYDDPIALGAYSAAKRGILVSC  297

Query  1492  SAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLS  1313
             SA N+GP NG +SNEAPW+LTVGAST+DR+L ATV+LGN++ F GE+AF PK        
Sbjct  298   SASNDGPSNGIISNEAPWILTVGASTIDRELKATVMLGNQKLFVGESAFSPKVPILDFFP  357

Query  1312  LVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILI  1133
             L+ P  +  +   SPYC+  +L +  ++GKIVVC  G   +   KG+AVK+A G GMIL+
Sbjct  358   LIDPSLSKLN-FYSPYCEPGTLNDPKIKGKIVVCKLGNAGNVE-KGQAVKDAGGVGMILV  415

Query  1132  EPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAA  953
                E G T  A  HVLPA+ IT+ DG +IL Y+N+TS P A   F GTI GDK AP VAA
Sbjct  416   SIPELGFTKLADPHVLPALFITFNDGTEILQYMNSTSEPTARILFHGTIIGDKEAPVVAA  475

Query  952   FSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVA  773
             +SSRGP++ +PGILKPDIIGPG NILA WPTSVD   ++KSTFNII GTSMSCPHLSGVA
Sbjct  476   YSSRGPSKATPGILKPDIIGPGNNILAAWPTSVDYVKHTKSTFNIIQGTSMSCPHLSGVA  535

Query  772   ALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPG  593
             ALLKS+HP WSP+ IKSA+MTTA+ LN    PI ++ L+ A +F+IGAGHVNPS+ANDPG
Sbjct  536   ALLKSTHPTWSPSAIKSAIMTTANTLNLANVPILDERLLPADIFAIGAGHVNPSRANDPG  595

Query  592   LVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQT  413
             L+YDT  +DYLPYLCGLNYTN++VG I++H+V+C  V  IPEAQLNYPSFSI    ++QT
Sbjct  596   LIYDTPFDDYLPYLCGLNYTNQQVGSIVKHKVDCKKVKHIPEAQLNYPSFSIEFGESSQT  655

Query  412   YTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNM  233
             YTRTVTNVGEA S YTVEI  PPGV V V+P  L+FS++NQKL Y V F+    +  S  
Sbjct  656   YTRTVTNVGEAKSSYTVEIDSPPGVTVIVKPSTLKFSQLNQKLKYQVMFTRRDNSTNSG-  714

Query  232   PPVVQGALRWKSVKHHVRSPIAAKL  158
               + QG L+W S K+ VRSPIA  L
Sbjct  715   --IAQGFLKWSSKKYSVRSPIAVVL  737



>ref|XP_004245674.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 emb|CAB67120.1| subtilisin-like protease [Solanum lycopersicum]
Length=746

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/747 (61%), Positives = 549/747 (73%), Gaps = 12/747 (2%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTT  2207
             L +  ++ VL  F + A   +  + YIV  E P    + +       DLE WY SFLPTT
Sbjct  9     LTIIGLICVLFSFTTHAAEQNNSQIYIVHCEFPSGERTAEYQ-----DLESWYLSFLPTT  63

Query  2206  VAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFL  2027
              +       R+++ YRNV+ GFAAKLS E++KEM  K+GF+SA P++ + LHTTHS  FL
Sbjct  64    TSVSSREAPRLIYSYRNVLTGFAAKLSEEDIKEMEKKEGFVSARPQQFVSLHTTHSVNFL  123

Query  2026  GLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNF-TACNN  1850
             GLQQNMGFW+DS+YGKGVIIGVLD+GI  DHPSFSD GMP PPA+WKGVCE NF   CN 
Sbjct  124   GLQQNMGFWKDSNYGKGVIIGVLDTGILPDHPSFSDVGMPTPPAKWKGVCESNFMNKCNK  183

Query  1849  KVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYK  1670
             K+IGARS+     S  D +GHGTHTA TAAG FV+GANVYG+ANGTA GVAPLAH+AIYK
Sbjct  184   KLIGARSYQLGNGSPIDGNGHGTHTASTAAGAFVKGANVYGNANGTAVGVAPLAHIAIYK  243

Query  1669  VCNEIG-CSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSA  1493
             VC   G CSDS+ILAAMD+AI+DGVDI+S+SLGG    FH D+IALGAYSA E+GI VSA
Sbjct  244   VCGSDGKCSDSDILAAMDSAIDDGVDIISMSLGGGPVPFHSDNIALGAYSATERGILVSA  303

Query  1492  SAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLS  1313
             SAGN GP   +  N APW+LTVGAST DRK+  TV LGN ++F GE +++P+  +S   +
Sbjct  304   SAGNSGPSLITAGNTAPWILTVGASTTDRKIKVTVTLGNTEEFEGEASYRPQISDSKFFT  363

Query  1312  LVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILI  1133
             L    +   D S +PYC   SL +  ++GKIV+C  G  + +  KG+AVK+A G GMI I
Sbjct  364   LYDASKGKGDPSKTPYCKPGSLTDPAIKGKIVICYPG-VVSKVVKGQAVKDAGGVGMIAI  422

Query  1132  EPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAA  953
                E G+T SA AHVLPA++++ ADG +IL Y N+ SNP A  +F+GTI GD+NAP VA+
Sbjct  423   NLPEDGVTKSADAHVLPALEVSAADGIRILTYTNSISNPTAKITFQGTIIGDENAPIVAS  482

Query  952   FSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVA  773
             FSSRGPN+ SPGILKPDIIGPGVNILA WPTSVD+   +KSTFNIISGTSMSCPHLSGVA
Sbjct  483   FSSRGPNKPSPGILKPDIIGPGVNILAAWPTSVDDNKKTKSTFNIISGTSMSCPHLSGVA  542

Query  772   ALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPG  593
             ALLKS+HPDWSPA IKSA+MTTA  LN   +PI ++ L+ A +F+IGAGHVNPS ANDPG
Sbjct  543   ALLKSTHPDWSPAAIKSAIMTTAYTLNLASSPILDERLLPADIFAIGAGHVNPSSANDPG  602

Query  592   LVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSII-LESTAQ  416
             LVYDT  EDY PYLCGL YTN +V  +LQ +VNC  V SIPEA+LNYPSFSI  L ST Q
Sbjct  603   LVYDTPSEDYFPYLCGLRYTNAQVSKLLQRKVNCLEVKSIPEAELNYPSFSIFGLGSTPQ  662

Query  415   TYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSN  236
             TYTRTVTNVG+ +S Y VEI  P GV + V P EL FSK+NQKLTY VTF   SK   S+
Sbjct  663   TYTRTVTNVGDVASSYKVEIASPIGVAIEVVPTELNFSKLNQKLTYQVTF---SKTTSSS  719

Query  235   MPPVVQGALRWKSVKHHVRSPIAAKLV  155
                VV+G L+W S +H VRSPIA  LV
Sbjct  720   EVVVVEGFLKWTSTRHSVRSPIAVVLV  746



>ref|XP_006477335.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=763

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/750 (61%), Positives = 553/750 (74%), Gaps = 24/750 (3%)
 Frame = -1

Query  2371  ILSVLIGFCSTATIA-------SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLP  2213
             ++S++  FC T TIA       S L+TYIV +E P   +ST S     V+L++WY SFLP
Sbjct  17    LISLIFTFCFTPTIAKEKESSGSNLQTYIVHIERPEGGVSTDS-----VELDNWYNSFLP  71

Query  2212  TTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPG  2033
              + A  G  + RMV  YRN++ GFAAKL+AEEVK MGNK GFISA PE+I PLHTTHS  
Sbjct  72    ASTASSGQ-KQRMVHSYRNLITGFAAKLTAEEVKIMGNKQGFISAHPEKIFPLHTTHSTQ  130

Query  2032  FLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACN  1853
             FLGL +++G W+ SSYGKGVIIGVLD+GI   HPSFSD+GMPPPPA+WKG CE N TACN
Sbjct  131   FLGLHKSLGLWKHSSYGKGVIIGVLDTGITPGHPSFSDKGMPPPPAKWKGKCEFNVTACN  190

Query  1852  NKVIGARSF-----SERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLA  1688
             NK+IGAR+F     + +    FD  GHGTHTA TAAGNFV  ANV+G ANGTA GVAP A
Sbjct  191   NKLIGARNFLPSYETGKIEPPFDLVGHGTHTASTAAGNFVEQANVFGQANGTAVGVAPWA  250

Query  1687  HLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKG  1508
             HLAIY+VC++ GCS+S ILAAMDTA+EDGVD+LSLSLGG SS F+ D IA+GA+ A++ G
Sbjct  251   HLAIYQVCSDFGCSESSILAAMDTAVEDGVDVLSLSLGGGSSPFYADGIAVGAFGAIQNG  310

Query  1507  IFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFN  1328
             +FVS SAGN GPFN SLSNEAPW+LTVGAST+DR + AT  LGN     GE+ FQPKDF 
Sbjct  311   VFVSCSAGNSGPFNASLSNEAPWILTVGASTIDRSIIATARLGNGADLEGESLFQPKDFP  370

Query  1327  SSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGR  1148
              +LL LV+ G N  +  SS +C+  SL   DV+GKIV+C  GGF+ R GKG+ VK+  G 
Sbjct  371   PTLLPLVYAGANGKE--SSAFCEPGSLNGTDVQGKIVLCERGGFVSRIGKGQTVKDVGGA  428

Query  1147  GMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNA  968
              MIL+  +  G +T A  HVLPA  ++YA G +I  YIN+TS P AT  F GT+ G  +A
Sbjct  429   AMILMNNDINGYSTLADPHVLPATHVSYAAGLRIKDYINSTSIPTATILFNGTVIGKPSA  488

Query  967   PTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPH  788
             P V +FSSRGP+  SPGILKPDIIGPGV+ILA WP SV+N  N+KSTFNIISGTSMSCPH
Sbjct  489   PEVTSFSSRGPSMASPGILKPDIIGPGVSILAAWPVSVENNTNTKSTFNIISGTSMSCPH  548

Query  787   LSGVAALLK----SSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHV  620
             LSGVAALLK    SSHPDWSPA IKSAMMTT DI+N    PI ++ L+ A +F+IGAGHV
Sbjct  549   LSGVAALLKTLLKSSHPDWSPAAIKSAMMTTTDIVNLEGKPIIDERLLPADIFAIGAGHV  608

Query  619   NPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFS  440
             NPS+ANDPGLV+D +P+DY+PYLCGLNYT+RE+ +++Q +V CS + SI EAQLNYPSFS
Sbjct  609   NPSRANDPGLVFDIQPDDYIPYLCGLNYTDREIAILVQRKVKCSEISSIKEAQLNYPSFS  668

Query  439   IILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSL  260
             + L S AQTYTRTVTNVG+ +S Y   IF P GV+V V P  LQF++ NQK ++ VTF  
Sbjct  669   LTLGSGAQTYTRTVTNVGQPNSLYKSLIFAPQGVEVEVTPSTLQFNEANQKASFAVTFKR  728

Query  259   SSKAARSNMPPVVQGALRWKSVKHHVRSPI  170
             +S        P  QG ++W S +H VR P+
Sbjct  729   TSYGGNRQDMPFAQGYIKWSSDQHSVRIPL  758



>ref|XP_009781097.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=754

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/762 (61%), Positives = 556/762 (73%), Gaps = 30/762 (4%)
 Frame = -1

Query  2392  KFLRMFLILSVLIGFCSTATIASKL-------------ETYIVRVELPHsristqsssss  2252
             ++  +  I+ +   F S  TIAS+              + YIV  E P    + +     
Sbjct  3     QYRSILTIIGITFLFSSFTTIASERPVDEKPKEKQSNSQVYIVHCEFPDGNRTARYQ---  59

Query  2251  SVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAP  2072
               DL+ WY SFLP T +       R+++ YRNV+ GFAAKLS +++KEM  KDGFISA P
Sbjct  60    --DLDSWYLSFLPATTSDSSREAPRLIYSYRNVLTGFAAKLSPDDLKEMEKKDGFISARP  117

Query  2071  ERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPAR  1892
             E+ L L+TTHS  FLGL QNMGFW DS+YGKGVIIGV+D+GI  DHPSFSD GMPPPPA+
Sbjct  118   EKQLDLYTTHSLNFLGLHQNMGFWNDSNYGKGVIIGVIDTGIFPDHPSFSDSGMPPPPAK  177

Query  1891  WKGVCELNFTACNNKVIGARSF-SERERSVFdddghgthtagtaaGNFVRGANVYGSANG  1715
             WKG CE N T CNNK+IGAR F S    S +D++GHGTHTA TAAGNFV GAN++G+ANG
Sbjct  178   WKGKCEFNVTKCNNKLIGARYFQSSGNGSPWDENGHGTHTASTAAGNFVPGANIFGNANG  237

Query  1714  TAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIAL  1535
             TAAGVAPLAH+AIYKVC+ I CS+S+ILAAMD AIEDGVD+LSLSLGG++ +F+ED IA+
Sbjct  238   TAAGVAPLAHVAIYKVCSYIFCSESDILAAMDMAIEDGVDVLSLSLGGVAYNFYEDVIAV  297

Query  1534  GAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGE  1355
             GA+SAMEKGIFVS +AGN GP+  S SNEAPW+LTVGAST+DRK+ AT VLGN +++ GE
Sbjct  298   GAFSAMEKGIFVSCAAGNSGPYRFSTSNEAPWILTVGASTIDRKIKATAVLGNNEEYDGE  357

Query  1354  TAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKG  1175
             +AFQP DF  +LL L +PG N SD  +  YC   SL N +V GKIV+C   G   R  KG
Sbjct  358   SAFQPSDFPPTLLPLAYPGSNDSDILAK-YCYPTSLNNTNVTGKIVLCEI-GITSRVSKG  415

Query  1174  EAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFK  995
             EAVK A G  MIL+  E    TT A AHV+P   ++YADG KI  YIN+T  P AT  F 
Sbjct  416   EAVKAAGGAAMILMNTELLANTTPAEAHVIPVAHVSYADGLKIKEYINSTLVPTATIVFN  475

Query  994   GTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNII  815
             GTI GD  AP VA FSSRGP+  SPGILKPDIIGPGVNILA WP S++N  N+ S FN+I
Sbjct  476   GTIIGDDRAPVVAGFSSRGPSYASPGILKPDIIGPGVNILAAWPVSLEN--NTNSMFNMI  533

Query  814   SGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSI  635
             SGTSMSCPHLSGVAALLKS HPDWSPA IKSA+MTTAD+LN G N I+++  + A VF+ 
Sbjct  534   SGTSMSCPHLSGVAALLKSVHPDWSPAAIKSAIMTTADVLNLGLNFIEDETYLPADVFAT  593

Query  634   GAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLN  455
             GAGHVNPSKANDPGL+YD +P DY+ YLCGLNYTNR+VG+ LQ +VNCS + SI E QLN
Sbjct  594   GAGHVNPSKANDPGLIYDIEPADYVSYLCGLNYTNRQVGIFLQRKVNCSEITSILEGQLN  653

Query  454   YPSFSIIL--ESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLT  281
             YPSFSI L  +S A+TY+R VTNVG+A+S Y+VEI  PPGV V VEP  L FS+VNQKL+
Sbjct  654   YPSFSIKLSTDSAAKTYSRNVTNVGQANSTYSVEIVSPPGVDVKVEPTTLVFSEVNQKLS  713

Query  280   YNVTFS-LSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
             Y VTF+ L S  +        QG+L+W S KH VRSPIA + 
Sbjct  714   YQVTFTPLPSNPSTG----YYQGSLKWISGKHIVRSPIAVRF  751



>ref|XP_006440472.1| hypothetical protein CICLE_v10018976mg [Citrus clementina]
 gb|ESR53712.1| hypothetical protein CICLE_v10018976mg [Citrus clementina]
Length=759

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/746 (61%), Positives = 550/746 (74%), Gaps = 20/746 (3%)
 Frame = -1

Query  2371  ILSVLIGFCSTATIA-------SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLP  2213
             ++S++  FC T TIA       S L+TYIV +E P   +ST S     V+L +WY SFLP
Sbjct  17    LISLIFTFCFTPTIAKEKESLGSNLQTYIVHIERPEGGVSTDS-----VELNNWYNSFLP  71

Query  2212  TTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPG  2033
              + A  G  + RMV  YRNV+ GFAAKL+AEEVK MGNK GFISA PE+I PLHTTHS  
Sbjct  72    ASTASSGQ-KQRMVHSYRNVITGFAAKLTAEEVKIMGNKQGFISAHPEKIFPLHTTHSTQ  130

Query  2032  FLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACN  1853
             FLGL +++G W+ SSYGKGVIIGVLD+GI   HPSFSD+GMPPPPA+WKG CE N TACN
Sbjct  131   FLGLHKSLGLWKHSSYGKGVIIGVLDTGITPGHPSFSDKGMPPPPAKWKGKCEFNVTACN  190

Query  1852  NKVIGARSF-----SERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLA  1688
             NK+IGAR+F     + +    FD  GHGTHTA TAAGNFV  ANV+G ANGTA GVAP A
Sbjct  191   NKLIGARNFFPSYETGKIEPPFDLVGHGTHTASTAAGNFVEQANVFGQANGTAVGVAPWA  250

Query  1687  HLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKG  1508
             HLAIY+VC++  CS+S ILAAMD A+EDGVD+LSLSLGG SS F+ D IA+GA+ A++ G
Sbjct  251   HLAIYQVCSDFRCSESSILAAMDAAVEDGVDVLSLSLGGGSSPFYADGIAVGAFGAIQNG  310

Query  1507  IFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFN  1328
             +FVS SAGN GPFN SLSNEAPW+LTVGAST+DR + AT  LGN     GE+ FQPKDF 
Sbjct  311   VFVSCSAGNTGPFNASLSNEAPWILTVGASTIDRSIIATARLGNGADLEGESLFQPKDFP  370

Query  1327  SSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGR  1148
              +LL LV+ G N  +  SS +C+  SL   DV+GKIV+C  GG + R GKG+ VK+A G 
Sbjct  371   PTLLPLVYAGANGKE--SSAFCEPASLNGTDVQGKIVLCERGGLVSRIGKGQTVKDAGGA  428

Query  1147  GMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNA  968
              MIL+  +  G +T A  HVLPA  ++YA G +I  YIN+TS P AT  F GT+ G  +A
Sbjct  429   AMILMNNDINGYSTLADPHVLPATHVSYAAGLRIKDYINSTSIPTATILFNGTVIGKPSA  488

Query  967   PTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPH  788
             P V +FSSRGP+  SPGILKPDIIGPGV+ILA WP SV+N  N+KSTFNIISGTSMSCPH
Sbjct  489   PEVTSFSSRGPSMASPGILKPDIIGPGVSILAAWPVSVENNTNTKSTFNIISGTSMSCPH  548

Query  787   LSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSK  608
             LSGVAALLKSSHPDWSPA IKSAMMTT DI+N    PI ++ L+ A +F+IGAGHVNPS+
Sbjct  549   LSGVAALLKSSHPDWSPAAIKSAMMTTTDIVNLEGKPIIDERLLPADIFAIGAGHVNPSR  608

Query  607   ANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILE  428
             ANDPGLV+D +P+DY+PYLCGLNYT+RE+ +++Q +V CS + SI EAQLNYPSFS+ L 
Sbjct  609   ANDPGLVFDIQPDDYIPYLCGLNYTDRELAILVQRKVKCSEISSIKEAQLNYPSFSLTLG  668

Query  427   STAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKA  248
             S AQTYTRTVTNVG+ +S Y   IF P GV+V + P  LQF++ NQK ++ VTF  +S  
Sbjct  669   SGAQTYTRTVTNVGQPNSLYKSLIFVPQGVEVEITPSALQFNEANQKASFAVTFRRTSYG  728

Query  247   ARSNMPPVVQGALRWKSVKHHVRSPI  170
                   P  QG ++W S +H VR P+
Sbjct  729   GNRQDMPFAQGYIKWSSDQHSVRIPL  754



>ref|XP_006358406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=742

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/745 (61%), Positives = 567/745 (76%), Gaps = 11/745 (1%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTT  2207
             +++F ++  ++   S  ++ S LETYIV+VE P S+ISTQ S    +D E WYKSF+P T
Sbjct  1     MKIFFVIFAILACFSCPSMQSDLETYIVQVESPESQISTQPSR---MDFESWYKSFMPKT  57

Query  2206  VAGGGYGES-RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGF  2030
             +   G  E  R+++ Y+NV+ GFAA+LSA++VKEM  K GFISA  +RIL LHTTH+P F
Sbjct  58    IEAAGSDEKPRLIYSYQNVIIGFAARLSAQQVKEMEKKPGFISARSQRILSLHTTHTPSF  117

Query  2029  LGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA-CN  1853
             LGLQQN+G WRD +YG+GVIIG+LDSG+  DHPSFSDEGMPPPPA+WKG CE NFTA CN
Sbjct  118   LGLQQNVGLWRDENYGEGVIIGLLDSGVTPDHPSFSDEGMPPPPAKWKGKCESNFTAKCN  177

Query  1852  NKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIY  1673
             NK+IGARS+ E + S  DDDGHGTHT+ TAAGNFV+GANVYG+A GTA G+AP AHLAIY
Sbjct  178   NKLIGARSYIEDKHSPIDDDGHGTHTSSTAAGNFVKGANVYGNAKGTAVGIAPHAHLAIY  237

Query  1672  KVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSA  1493
             KVC + GC +S++LA MD AI+DGVDI+SLSLGG S SF++D+IALGAYSA ++GI VS 
Sbjct  238   KVCTD-GCLESDVLAGMDEAIDDGVDIMSLSLGGASRSFYDDAIALGAYSAAKRGILVSC  296

Query  1492  SAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLS  1313
             SAGN GP + +LSNEAPW+LTVGAST+DR+L ATV++GN++ F GE+AF PK        
Sbjct  297   SAGNGGPSDSTLSNEAPWILTVGASTIDRELKATVMIGNQKLFEGESAFSPKVPILEFFP  356

Query  1312  LVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILI  1133
             L+ P  +  +   SPYC   +L +  ++GKIV+C  G       KG+AVK+A G GMI+ 
Sbjct  357   LIDPSLSKLN-FYSPYCKPGTLNDPKIKGKIVMCKLGNVAPVE-KGQAVKDAGGVGMIVY  414

Query  1132  EPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAA  953
               ++YG TT +  HVLPA+ ITY DG +IL Y+N+TS P A   F GTI GDK AP VAA
Sbjct  415   NIQKYGFTTFSDPHVLPALSITYQDGMEILDYMNSTSEPTARILFHGTIIGDKEAPVVAA  474

Query  952   FSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVA  773
             +SSRGP+  SPGILKPDIIGPG NILA WPTSVD   ++K+TFNII GTSMSCPHLSGVA
Sbjct  475   YSSRGPSLASPGILKPDIIGPGNNILAAWPTSVDYDKHTKATFNIIQGTSMSCPHLSGVA  534

Query  772   ALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPG  593
             ALLKS+HP WSP+ IKSA+MTTA+ LN    PI ++ L+ A +F+IGAGHVNPS+ANDPG
Sbjct  535   ALLKSAHPTWSPSAIKSAIMTTANTLNLANVPILDERLLPADIFAIGAGHVNPSRANDPG  594

Query  592   LVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQT  413
             L+YDT  +DYLPYLCGLNYTN++VG I++H+V+C+ V  IPEAQLNYPSFSI    ++QT
Sbjct  595   LIYDTPVKDYLPYLCGLNYTNQQVGSIVKHKVDCNKVKHIPEAQLNYPSFSIKFGESSQT  654

Query  412   YTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNM  233
             YTRTVTN+GEA+S Y+VEI  PPGV V V+P  L+FS++NQKL Y VTF+    +  S  
Sbjct  655   YTRTVTNIGEANSSYSVEIDSPPGVTVIVKPSTLKFSQLNQKLKYQVTFTRRDNSTNSG-  713

Query  232   PPVVQGALRWKSVKHHVRSPIAAKL  158
               + QG L+W   K+ VRSPIA  L
Sbjct  714   --IAQGFLKWSWKKYSVRSPIAVVL  736



>ref|XP_011071279.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=741

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/745 (60%), Positives = 563/745 (76%), Gaps = 12/745 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIA-SKLETYIVRVELPHsristqsssssSVDLEHWYKSF  2219
             M +   FL L  ++ F +      SKLE+YIV VE+P     +  +     DLE WY+SF
Sbjct  1     MGYYMFFLTLVCVLNFHTIVRAQESKLESYIVHVEMPRGPTVSALTD----DLEGWYQSF  56

Query  2218  LPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHS  2039
             LPTT++        +++ Y NV KGFAA+LS E VKEM  K GF+SA P++ LPLHTTHS
Sbjct  57    LPTTLSSSSVDGPHIIYSYHNVFKGFAARLSPEHVKEMEKKPGFVSARPQKTLPLHTTHS  116

Query  2038  PGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA  1859
             P FLGL QNMGFWRDS+YG+GVIIGVLDSGI  DHPSF+DEGMPPPPA+WKG C+ N T 
Sbjct  117   PNFLGLNQNMGFWRDSNYGRGVIIGVLDSGINPDHPSFNDEGMPPPPAKWKGQCQFNSTM  176

Query  1858  CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLA  1679
             CNNK+IGAR F+    +  D++GHGTHTA TAAGNFVRGANV+G+ANGTAAG+APLAH+A
Sbjct  177   CNNKLIGARYFTIGNGTPLDENGHGTHTASTAAGNFVRGANVFGNANGTAAGIAPLAHIA  236

Query  1678  IYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFV  1499
             +YKVC    CS+S+ILA MD AI+DGVDI+SLSLG  +++F++D++A+GA+SA+E+GIFV
Sbjct  237   MYKVC-ITRCSESDILAGMDAAIDDGVDIISLSLGSPATNFYDDNVAVGAFSAVERGIFV  295

Query  1498  SASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSL  1319
             S++AGN GP  GS+ N APW+LTVGAS+VDRK+ AT VLGN ++F GE+ FQP DF+S+L
Sbjct  296   SSAAGNRGPSLGSIENGAPWLLTVGASSVDRKIRATAVLGNNEEFDGESTFQPADFSSTL  355

Query  1318  LSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMI  1139
             L LV+P  N+S+ ++  +C    LRN DV+GKIV+C  GG + R  KG AV+NA G  MI
Sbjct  356   LPLVYPRLNSSNPNAQ-FCLPALLRNIDVQGKIVLCELGGGIGRIAKGSAVRNAGGAAMI  414

Query  1138  LIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTV  959
             LI  +  G TT + +HVLPA  ++YADG KI AY+N+TS+P AT SFKGTI GD  AP V
Sbjct  415   LINQQPQGYTTLSESHVLPATHLSYADGLKIKAYLNSTSSPTATISFKGTIIGDDRAPAV  474

Query  958   AAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSG  779
             A FS+RGPN  S GILKPDIIGPG NILA W  SV+   N+KS FNIISGTSMSCPHLSG
Sbjct  475   AYFSARGPNIASLGILKPDIIGPGNNILAAWHISVEKNTNTKSNFNIISGTSMSCPHLSG  534

Query  778   VAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKAND  599
             VAALLK++HPDWSPA IKSA+MTTAD +N   N I+++ L  A VF++G+GHVN  KA D
Sbjct  535   VAALLKNAHPDWSPAAIKSAIMTTADQVNLAGNFIEDETLRPAFVFAVGSGHVNILKATD  594

Query  598   PGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILES--  425
             PGLVY+ +P+DY+PYLCGLNYT+++V +I    V CS + SI EA+LNYPSF+ +L +  
Sbjct  595   PGLVYEIQPQDYVPYLCGLNYTDQQVEIIANRPVRCSEISSISEAELNYPSFTALLGTGN  654

Query  424   TAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAA  245
             T++TY RTVTNVGEA+S YTVE    PGV + VEP  LQFS VNQ+LTY VTFS  +  A
Sbjct  655   TSETYNRTVTNVGEANSVYTVETGGLPGVDMRVEPSTLQFSGVNQRLTYQVTFSRLAN-A  713

Query  244   RSNMPPVVQGALRWKSVKHHVRSPI  170
             RS++  VV+G L W S +H VRSP+
Sbjct  714   RSDI--VVRGFLTWTSARHSVRSPL  736



>gb|EYU39029.1| hypothetical protein MIMGU_mgv1a019332mg, partial [Erythranthe 
guttata]
Length=718

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/730 (64%), Positives = 545/730 (75%), Gaps = 19/730 (3%)
 Frame = -1

Query  2335  TIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRN  2156
             T +S LETYIV V++           +   DLE WY SFLPT+      G  R+V+ YR 
Sbjct  3     TNSSSLETYIVHVDV------NLGFFARFKDLESWYTSFLPTS-----NGRGRLVYSYRK  51

Query  2155  VMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKG  1976
             V KGFAA+LSA+EVK M N  GF+SA PER L  HTTHSP FLGL QNMGFW  S+YGKG
Sbjct  52    VFKGFAARLSADEVKAMENNPGFVSARPERKLEKHTTHSPNFLGLNQNMGFWEGSNYGKG  111

Query  1975  VIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVFdd  1796
             VIIGVLDSG+   HPSFSDEGMPPPPA+WKG CE N T CNNK+IGAR FS  + S  DD
Sbjct  112   VIIGVLDSGVFPSHPSFSDEGMPPPPAKWKGKCEFNPTTCNNKIIGARYFSVFDDSPLDD  171

Query  1795  dghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDT  1616
             DGHGTHTA TAAG+FV GANV+G+ANGTAAG+AP+AHLAIYKVC+ + C +S+I+AAMDT
Sbjct  172   DGHGTHTASTAAGSFVAGANVFGNANGTAAGIAPMAHLAIYKVCS-LFCFESDIIAAMDT  230

Query  1615  AIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWM  1436
             AIEDGVDILSLSLGG S SFH+DSIALGA+SAME GI VS SAGN GPFN SL NEAPW+
Sbjct  231   AIEDGVDILSLSLGGFSFSFHDDSIALGAFSAMENGILVSCSAGNSGPFNLSLENEAPWI  290

Query  1435  LTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDS  1256
             LTVGAST+DRK+ AT +LGN + F GE+AFQP DF S+LL LV+ G   + +    +C +
Sbjct  291   LTVGASTIDRKIRATALLGNNETFDGESAFQPLDFPSTLLPLVYAGSLNTSDPYIRFCTA  350

Query  1255  ESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAI  1076
             ESL   +++G IVVC   G + R  KG AVKNA G  MIL+  +    TT+A AHVLPA 
Sbjct  351   ESLNKTNLQGMIVVC-DAGVVARLSKGIAVKNAGGAAMILVNHQYSANTTAAQAHVLPAT  409

Query  1075  DITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDII  896
              + YADG KI  YIN+T  PMAT  FKGTI GD  AP VAAFSSRGPN  SPGILKPDI+
Sbjct  410   HVGYADGLKIKTYINSTITPMATILFKGTIIGDDRAPVVAAFSSRGPNYISPGILKPDIL  469

Query  895   GPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAM  716
             GPGVNILA WP S++N  N+ STFNIISGTSMSCPHLSGVAAL+KS HPDWSPA IKSA+
Sbjct  470   GPGVNILAAWPFSIENNTNTNSTFNIISGTSMSCPHLSGVAALIKSVHPDWSPASIKSAI  529

Query  715   MTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNY  536
             MTTAD++N   NPI+++  V A++F+ G+GHVNPS+A+DPGLVYD  PEDYLPYLCGLNY
Sbjct  530   MTTADVVNLALNPIEDERFVPANIFATGSGHVNPSRASDPGLVYDIHPEDYLPYLCGLNY  589

Query  535   TNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL---ESTAQTYTRTVTNVGEASSFYT  365
             TNR+VG ILQ RVNCS    IP+AQLNYPSF+I     +   QTYTRTVTNVGE  S Y 
Sbjct  590   TNRQVGTILQRRVNCSVEARIPDAQLNYPSFAITFGRSQPITQTYTRTVTNVGEPVSSYV  649

Query  364   VEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKS-VKH  188
             VEI  PPG+ V VEP  L F++VN  L Y VTF  +   + +N    +QG L+W S VK+
Sbjct  650   VEIVPPPGIGVVVEPTTLDFTEVNPILQYQVTF--TRLDSTTNNAGYIQGYLKWNSGVKY  707

Query  187   HVRSPIAAKL  158
              VR+PIA  L
Sbjct  708   SVRTPIAVIL  717



>ref|XP_009781099.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=932

 Score =   853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/727 (62%), Positives = 548/727 (75%), Gaps = 13/727 (2%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S  + YIV  E P    +++       DL+ WY SFLP T +       R+++ YRNV+ 
Sbjct  214   SNSQVYIVHCEFPDREGASRYQ-----DLDSWYLSFLPATTSDSSREAPRLIYSYRNVLT  268

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAAKLS +++KEM  K+GFISA PER L LHTTHS  FLGL QNMGFW DS+YGKGVII
Sbjct  269   GFAAKLSPDDLKEMEKKEGFISARPERQLDLHTTHSLNFLGLHQNMGFWNDSNYGKGVII  328

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-SERERSVFdddg  1790
             GV+D+G+  DHPSFSD+GMPPPPA+WKG CE +   CNNK+IGAR F S  + +  D+DG
Sbjct  329   GVIDTGVFPDHPSFSDDGMPPPPAKWKGKCEFDVPKCNNKLIGARYFQSSGDGTPLDEDG  388

Query  1789  hgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAI  1610
             HGTHTA TAAGNFV GAN++G+ANGTAAGVAPLAH+AIYKVC+ I CS+S+ LAAMD AI
Sbjct  389   HGTHTASTAAGNFVPGANIFGNANGTAAGVAPLAHVAIYKVCSPITCSESDTLAAMDMAI  448

Query  1609  EDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLT  1430
             EDGVD+LSLSLG ++S+F+ D+IA+GA+SAME+GIFVS SAGN GP+  ++SNEAPW+LT
Sbjct  449   EDGVDVLSLSLGRLTSNFYSDNIAVGAFSAMERGIFVSCSAGNSGPYRFTISNEAPWILT  508

Query  1429  VGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSES  1250
             VGAST+DRK+ AT VLGN +++ GE+AFQP DF  +LL L +PG + SD S + +C  +S
Sbjct  509   VGASTIDRKIKATAVLGNNEEYDGESAFQPSDFPPTLLPLAYPGNDASD-SYAKFCTPDS  567

Query  1249  LRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDI  1070
             L N +V GKIV+C  G    R  KG+AVK A G  MIL+  E    TTSA AHVLP   +
Sbjct  568   LNNMNVMGKIVLCEVGN-TTRVNKGKAVKAAGGVAMILMNTELQANTTSAEAHVLPVTHV  626

Query  1069  TYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGP  890
             +YADG KI  YIN+T  P AT  FKGTI GD  AP VA FSSRGPN  SPGILKPDIIGP
Sbjct  627   SYADGLKIKEYINSTLIPTATIVFKGTIIGDDRAPVVAGFSSRGPNFASPGILKPDIIGP  686

Query  889   GVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMT  710
             GVNILA W  S++N  N+ S FN+ISGTSMSCPHLSGVAALLKS HPDWSPA IKSA+MT
Sbjct  687   GVNILAAWHISLENNINTNSYFNMISGTSMSCPHLSGVAALLKSVHPDWSPAAIKSAIMT  746

Query  709   TADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTN  530
             TADILN G + I++Q    ASV + G+GHVNPSKANDPGL+YD +P DY+PYLCGLNYT+
Sbjct  747   TADILNLGLDFIEDQTYNPASVLATGSGHVNPSKANDPGLIYDIEPADYVPYLCGLNYTD  806

Query  529   REVGVILQHRVNCSAVISIPEAQLNYPSFSI--ILESTAQTYTRTVTNVGEASSFYTVEI  356
              +VG+IL  +V+CS + SI E QLNYPSFSI   + STAQTY+RTVTNVG+A+S Y+VEI
Sbjct  807   AQVGIILNRKVSCSEITSILEGQLNYPSFSIKVTVSSTAQTYSRTVTNVGQANSIYSVEI  866

Query  355   FEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRS  176
               PPGV V VEP  L FS+VNQKL Y VTF+ S     ++     QG+L+W S KH VRS
Sbjct  867   DSPPGVDVKVEPTTLAFSEVNQKLIYQVTFTPSGTIPSTSYN---QGSLKWISDKHIVRS  923

Query  175   PIAAKLV  155
             PIA + +
Sbjct  924   PIAVRFL  930


 Score = 71.2 bits (173),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  1383  STTVALSFLSTVLAPTVSIQGASLDKEPLNGPSLPAEALTKMPFSMALYAPNAI  1544
             ST VAL FLS VLAPTV IQGASLD E L GP  PA  LTK+PFS+AL AP A+
Sbjct  108   STAVALIFLSMVLAPTVKIQGASLDVENLYGPEFPAAQLTKIPFSIALNAPTAM  161



>ref|XP_002509668.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF51055.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=758

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/749 (59%), Positives = 558/749 (74%), Gaps = 20/749 (3%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTAT----IASKLETYIVRVELPHsristqsssssSVDLEHWYKSF  2219
             +   + LS  +G  + +T     +S LETYIV V  P    S +S       +E WY+SF
Sbjct  14    VTFLVCLSSFLGEGAESTKVTGASSNLETYIVFVTKPPVGASKKSQV-----IETWYQSF  68

Query  2218  LPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHS  2039
             LP   +     + R+++ YRNV+ GFAAKL+AEE K M  KDGF+SA P++I PLHTTHS
Sbjct  69    LPARKSNSNQ-QQRILYSYRNVVSGFAAKLTAEEAKFMEEKDGFVSARPQKIFPLHTTHS  127

Query  2038  PGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA  1859
             P FLGL QN+G W +S+YGKGVIIGVLD+GI  DHPSFSDEGMP PPA+WKG CE N TA
Sbjct  128   PNFLGLHQNLGLWGNSNYGKGVIIGVLDTGITPDHPSFSDEGMPSPPAKWKGKCEFNGTA  187

Query  1858  CNNKVIGARSFSERER-----SVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAP  1694
             CNNK+IGAR+F   E        FDD GHGTHTA TAAGNFV GA+V+G+ANGTA G+AP
Sbjct  188   CNNKLIGARTFQSDEHPSGDMEPFDDVGHGTHTASTAAGNFVDGASVFGNANGTAVGMAP  247

Query  1693  LAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAME  1514
             LAHLA+YKVC++ GCS+S+ILAAMDTA+E+GVDILSLSLGG S+ F  D IA+GA+ A++
Sbjct  248   LAHLAMYKVCSDFGCSESDILAAMDTAVEEGVDILSLSLGGGSAPFSADGIAVGAFGAIQ  307

Query  1513  KGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKD  1334
              GIFVS SAGN GP N +LSNEAPW+LTVGAST+DR + ATV LGN ++F GE+ FQP+ 
Sbjct  308   NGIFVSCSAGNSGPDNYTLSNEAPWILTVGASTIDRSIRATVKLGNNEEFFGESLFQPQL  367

Query  1333  FNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNAS  1154
                +   L++PG+N     S+  C  +SL +++V GKIV+C  GG + R  KG+ VK+A 
Sbjct  368   STQNFWPLIYPGKN--GNQSAAVCAEDSLESSEVEGKIVLCDRGGLVGRVEKGKVVKDAG  425

Query  1153  GRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDK  974
             G GMIL+  E  G +T A AHVLPA  ++Y+DG +I  YIN+TS+P A F F+GT+ G K
Sbjct  426   GIGMILVNEESDGYSTLADAHVLPASHVSYSDGMRIKNYINSTSSPTAMFVFEGTVIGLK  485

Query  973   NAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSC  794
              AP V++FSSRGP+  SPGILKPDIIGPGV+ILA WP SV+NK N+K+TFN+ISGTSMSC
Sbjct  486   TAPMVSSFSSRGPSFASPGILKPDIIGPGVSILAAWPISVENKTNTKATFNMISGTSMSC  545

Query  793   PHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNP  614
             PHLSG+AALLKS+HPDWSPA IKSA+MTTAD +N G  PI ++ L++A V + GAGHVNP
Sbjct  546   PHLSGIAALLKSAHPDWSPAAIKSAIMTTADTVNLGGQPIVDERLLSADVLATGAGHVNP  605

Query  613   SKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSII  434
             SKA+DPGLVYD +P+DY+PYLCGL YT+R++  I+Q++V CS V SIPEAQLNYPSFSI+
Sbjct  606   SKASDPGLVYDIQPDDYIPYLCGLGYTDRDITYIVQYKVKCSEVGSIPEAQLNYPSFSIV  665

Query  433   LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSS  254
               +  Q YTRTVTNVG A+S YTV +  PPGV V V P ++ F++V Q  TY+VTF+ + 
Sbjct  666   FGAKTQIYTRTVTNVGPATSSYTVSVAPPPGVDVTVTPSKIAFTQVKQTATYSVTFTNTG  725

Query  253   KAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             K       P VQG L+W S +H VRSPI+
Sbjct  726   KGYSD---PSVQGYLKWDSDQHSVRSPIS  751



>gb|EYU39031.1| hypothetical protein MIMGU_mgv1a025139mg, partial [Erythranthe 
guttata]
Length=693

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/699 (65%), Positives = 524/699 (75%), Gaps = 11/699 (2%)
 Frame = -1

Query  2242  LEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERI  2063
             LE WY SFLPT+++ G     R+V+ YRNV KGFAA+LSA+EVK M +  GFISA PER 
Sbjct  1     LESWYTSFLPTSISNG---RRRIVYSYRNVFKGFAARLSADEVKAMESNPGFISAEPERK  57

Query  2062  LPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKG  1883
             L +HTTHSP FLGL QNMGFW+DS+YGKGVIIGVLDSGI   HPSFSDEGMPPPPA+WKG
Sbjct  58    LDMHTTHSPNFLGLNQNMGFWQDSNYGKGVIIGVLDSGIFPSHPSFSDEGMPPPPAKWKG  117

Query  1882  VCELNFTACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAG  1703
              CE N T CNNK+IGAR F+  + S  DD GHGTHTA TAAG+FV GANV+G+ANGTA+G
Sbjct  118   KCEFNPTVCNNKIIGARYFTLFDDSPLDDGGHGTHTASTAAGSFVAGANVFGNANGTASG  177

Query  1702  VAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYS  1523
             +APLAHLAIYKVC+ I C +S ILAAMD AIEDGVDILSLSLGG S SF+ DSIALGA+S
Sbjct  178   IAPLAHLAIYKVCSFI-CFESSILAAMDAAIEDGVDILSLSLGGGSRSFYLDSIALGAFS  236

Query  1522  AMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQ  1343
             AMEKGI VS SAGN GPFN S SNEAPW+LTVGAST+DRK+ AT +LGN     GET FQ
Sbjct  237   AMEKGILVSCSAGNSGPFNFSTSNEAPWILTVGASTIDRKIRATALLGNNISVDGETLFQ  296

Query  1342  PKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVK  1163
             P DF S+LL LV+ G   + +    YC  ESL   ++RG IVVC +G   D   KG AVK
Sbjct  297   PSDFPSTLLPLVYAGSLNTSDPGIQYCTPESLTKINLRGMIVVCESGLVTDVS-KGVAVK  355

Query  1162  NASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTIT  983
              A G  +IL+        T + AHVLPA D+ YADG KI  YIN+T+ PMAT  FKGTI 
Sbjct  356   IAGGAAIILVNHRLDANMTFSDAHVLPATDVGYADGLKIKTYINSTTTPMATILFKGTII  415

Query  982   GDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTS  803
             GD  AP VAAFSSRGPN  SPGILKPDIIGPGVNILA WP SV+N  N+ ++FNIISGTS
Sbjct  416   GDDRAPIVAAFSSRGPNSASPGILKPDIIGPGVNILAAWPVSVENNTNTNASFNIISGTS  475

Query  802   MSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGH  623
             MSCPHLSGVAALLKSSHPDWSPA IKSA+MTTAD++N  QNPI+++  + AS+F+ G+GH
Sbjct  476   MSCPHLSGVAALLKSSHPDWSPAAIKSAIMTTADVVNLAQNPIEDERFIPASLFATGSGH  535

Query  622   VNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSF  443
             VNPS+ANDPGL+YD K EDY PYLCGLNYTN +V +I+Q  V+CS    IPEAQLNYPSF
Sbjct  536   VNPSRANDPGLIYDLKSEDYFPYLCGLNYTNLQVSIIVQKIVDCSVEARIPEAQLNYPSF  595

Query  442   SIIL---ESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNV  272
             +I     E   QTYTRTVTNVGE    Y VEI  PPG+ V VEP  L F++ N  L Y V
Sbjct  596   AITFGRSEQITQTYTRTVTNVGEHVLSYVVEIVPPPGISVVVEPTTLDFTEANPILQYQV  655

Query  271   TFSLSSKAARSNMPPVVQGALRWKS-VKHHVRSPIAAKL  158
             TF  +   + +N    +QG L+W S  K+ VR+PIA  L
Sbjct  656   TF--TRLDSTTNNAGYIQGYLKWNSGAKYSVRTPIAVIL  692



>gb|EYU39032.1| hypothetical protein MIMGU_mgv1a023804mg, partial [Erythranthe 
guttata]
Length=720

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/730 (61%), Positives = 541/730 (74%), Gaps = 17/730 (2%)
 Frame = -1

Query  2335  TIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRN  2156
             T +S LETYIV V++           +   +LE WY SFL T+ + G     R+V+ +R 
Sbjct  3     TNSSTLETYIVHVDV------NLGLFARFEELESWYTSFLRTSNSNG---RGRIVYSFRK  53

Query  2155  VMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKG  1976
             V +GFAA+LSA+EVK M +  GFISA PE+   +HTTHSP FLGL QNMGFW  S+YGKG
Sbjct  54    VFRGFAARLSADEVKAMESNPGFISARPEKKFDVHTTHSPNFLGLNQNMGFWEGSNYGKG  113

Query  1975  VIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVFdd  1796
             VIIGVLD GI   HPSFSDEGMPPPPA+WKG C+ N T CNNK+IGAR F+  + S  D+
Sbjct  114   VIIGVLDYGIFPSHPSFSDEGMPPPPAKWKGKCQFNQTTCNNKIIGARYFNSLDDSPLDN  173

Query  1795  dghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDT  1616
             +GHGTHTA TAAG+FV GAN++G+ANGTA G+AP+AHLAIYKVC++  C +S+ILAAMDT
Sbjct  174   NGHGTHTASTAAGSFVAGANLFGNANGTATGIAPMAHLAIYKVCSD-SCHESDILAAMDT  232

Query  1615  AIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWM  1436
             AIEDGVDILS+SLGG++ +F++D IALGA+SAME GI VS SAGN GPFN SL NEAPW+
Sbjct  233   AIEDGVDILSISLGGLNINFYDDGIALGAFSAMENGILVSCSAGNSGPFNISLENEAPWI  292

Query  1435  LTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDS  1256
             LTVGAST+DRK+ AT +LGN + F GE+ FQP DF S+LL LV+ G   + + +  YC +
Sbjct  293   LTVGASTIDRKIRATALLGNNETFDGESTFQPLDFPSTLLPLVYAGSLNTSDPNIQYCTA  352

Query  1255  ESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAI  1076
              SL   D+RG IVVC  G  + R  KG AVKNA G  MIL+       TT+A AHVLPA 
Sbjct  353   TSLNKTDLRGMIVVCEIG-VVGRLSKGIAVKNAGGAAMILVNSLYSANTTAAQAHVLPAT  411

Query  1075  DITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDII  896
              ++YADG KI  YIN+T+ PMAT  FKGTI GD  AP VA+FSSRGPN  SPGILKPDI+
Sbjct  412   HVSYADGLKIKTYINSTTTPMATILFKGTIIGDDRAPVVASFSSRGPNYISPGILKPDIL  471

Query  895   GPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAM  716
             GPGVNILA WP SV+N  N+ STFNIISGTSMSCPHLSGVAAL+KS HPDWSPA IKSA+
Sbjct  472   GPGVNILAAWPVSVENNANTNSTFNIISGTSMSCPHLSGVAALIKSGHPDWSPAAIKSAI  531

Query  715   MTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNY  536
             MTTAD++N   NPI+++  V A++F+ G+GHVNPS+ANDPGL+YD  PEDY PYLCGLNY
Sbjct  532   MTTADVVNLALNPIEDERYVPANIFATGSGHVNPSRANDPGLIYDIHPEDYFPYLCGLNY  591

Query  535   TNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL---ESTAQTYTRTVTNVGEASSFYT  365
             TNR+VG+ILQ  V+CS    IPEAQLNYPSF+I     +   QTYTRTVTNVGE  S Y 
Sbjct  592   TNRQVGIILQKIVDCSVEARIPEAQLNYPSFAITFGRSQPITQTYTRTVTNVGEPVSSYV  651

Query  364   VEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKS-VKH  188
             VEI  PPG+ V VEP  L+F++ N  L Y VTF  +   + +N    +QG L+W S  K+
Sbjct  652   VEIVPPPGIGVLVEPTTLEFTEANPILQYQVTF--TRLDSTTNNAGYIQGYLKWNSGAKY  709

Query  187   HVRSPIAAKL  158
              VR+PIA  L
Sbjct  710   SVRTPIAVIL  719



>ref|XP_009629566.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=756

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/727 (62%), Positives = 546/727 (75%), Gaps = 13/727 (2%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S  + YIV  E P    +T        DLE WY SFLP T A       R+++ YRNV+ 
Sbjct  38    SNSQVYIVHCEFPDGDRATGYQ-----DLESWYLSFLPATTADSSREAPRLIYSYRNVLT  92

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAAKLS +++KEM  K+GFISA PE+ L L+TTHS  FLGL QNMGFW DS+YGKGVII
Sbjct  93    GFAAKLSPDDLKEMEKKEGFISARPEKQLDLYTTHSLNFLGLHQNMGFWNDSNYGKGVII  152

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-SERERSVFdddg  1790
             GV+D+GI  DHPSFSD GMPPPPA+WKG CE N T CNNK+IGAR F S    S +D++G
Sbjct  153   GVIDTGIFPDHPSFSDGGMPPPPAKWKGKCEFNVTKCNNKLIGARYFQSSGNGSPWDENG  212

Query  1789  hgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAI  1610
             HGTHTA TAAGNFV GAN++G+ANGTAAGVAPLAH+AIYKVC+   CS+S+ILAAMD AI
Sbjct  213   HGTHTASTAAGNFVPGANIFGNANGTAAGVAPLAHVAIYKVCSPTTCSESDILAAMDMAI  272

Query  1609  EDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLT  1430
             +DGVD+LSLSLGG++ +F+ED +A+GA+SAME+GIFVS +AGN GP + SLSNEAPW+LT
Sbjct  273   QDGVDVLSLSLGGITYNFYEDVVAVGAFSAMERGIFVSCAAGNSGPSSFSLSNEAPWILT  332

Query  1429  VGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSES  1250
             VGAST+DRK+ AT VLGN +++ GE+AFQP DF S+LL L +PG + SD S + +C  +S
Sbjct  333   VGASTIDRKIKATAVLGNNEEYDGESAFQPSDFPSTLLPLAYPGNDASD-SYAKFCTPDS  391

Query  1249  LRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDI  1070
             L+N +V GKIV+C  G  + R  KG+AVK A G  MIL+  E    TTSA AHVLP   +
Sbjct  392   LKNINVMGKIVLCEVGN-ITRVNKGKAVKAAGGVAMILMNTELLANTTSAEAHVLPVTHV  450

Query  1069  TYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGP  890
             +YADG KI  YIN+T  P AT  FKGT+ GD  AP VA FSSRGPN  SPGILKPDIIGP
Sbjct  451   SYADGLKIKEYINSTLIPTATIVFKGTVIGDDRAPVVAGFSSRGPNYASPGILKPDIIGP  510

Query  889   GVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMT  710
             GVNILA W  S++N  N+ S FN+ISGTSMSCPHLSGVAALLKS HPDWSPA IKSA+MT
Sbjct  511   GVNILAAWHISLENNINTNSYFNMISGTSMSCPHLSGVAALLKSVHPDWSPAAIKSAIMT  570

Query  709   TADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTN  530
             TADILN G + I++Q    ASV + G+GHVNPSKANDPGL+YD +P DY+PYLCGLNYT+
Sbjct  571   TADILNLGLDFIEDQTYNPASVLATGSGHVNPSKANDPGLIYDIEPADYVPYLCGLNYTD  630

Query  529   REVGVILQHRVNCSAVISIPEAQLNYPSFSII--LESTAQTYTRTVTNVGEASSFYTVEI  356
              +VG+IL  +V CS + SI E +LNYPSFSI   + STAQ Y+RTVTNVG+A+S Y+VEI
Sbjct  631   VQVGIILNRKVRCSEITSILEGELNYPSFSIQVSVSSTAQIYSRTVTNVGQANSIYSVEI  690

Query  355   FEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRS  176
               P G+ V VEP  L FS+VNQKL Y VTF+ S     ++     QG+L+W S K  VRS
Sbjct  691   DSPLGLDVKVEPTTLVFSEVNQKLNYQVTFTPSGTIPSTSYN---QGSLKWISDKRIVRS  747

Query  175   PIAAKLV  155
             PIA + +
Sbjct  748   PIAVRFL  754



>ref|XP_004246134.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=746

 Score =   841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/744 (61%), Positives = 547/744 (74%), Gaps = 13/744 (2%)
 Frame = -1

Query  2389  FLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPT  2210
              L +  ++ VL  F + AT     + YIV  E P  + ST +      DLE +Y SFLP 
Sbjct  8     ILSIIGLICVLFPFTTNATEQDNSQIYIVHCEFPDGKRSTNNQ-----DLESYYLSFLPA  62

Query  2209  TVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGF  2030
             T +       R+++ YRNV+ GFAAKLS E++KEM   +GF+SA PE +L LHTTHS  F
Sbjct  63    TTSDSSREAPRLIYSYRNVITGFAAKLSLEDLKEMEKMEGFVSARPEGLLDLHTTHSVNF  122

Query  2029  LGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNN  1850
             +GL QNMGFW DS+YGKGVIIGV+D+GI  DHPSFSD+GMPPPPA+WKG+C+ N T CNN
Sbjct  123   MGLNQNMGFWNDSNYGKGVIIGVIDTGIFPDHPSFSDDGMPPPPAKWKGICQFNTTKCNN  182

Query  1849  KVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYK  1670
             K+IGAR FS      +D++GHGTHTA TA+G FV GAN+ G+ANGTA GVAPLAH+AIYK
Sbjct  183   KLIGARYFSYTGNDPWDENGHGTHTASTASGRFVPGANILGNANGTAMGVAPLAHVAIYK  242

Query  1669  VCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSAS  1490
              C+ IGC  S+ILAAMD AIEDGVDILS+SLG  S  F+ED IALGA+SAME+GIFVS S
Sbjct  243   TCSAIGCFGSDILAAMDMAIEDGVDILSISLGSRSRQFYEDVIALGAFSAMERGIFVSCS  302

Query  1489  AGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSL  1310
             AGN GP+  S+SN+APW+LTVGAST+DRK+ AT VLGN Q+F GE+AFQP DF S+LL L
Sbjct  303   AGNSGPYTFSVSNDAPWILTVGASTIDRKIKATAVLGNNQEFDGESAFQPSDFPSTLLPL  362

Query  1309  VFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIE  1130
             ++PG N SD  +  YC   SL N +V GKIV+C   G      KG AVK A G  MI++ 
Sbjct  363   IYPGSNDSDILAQ-YCYPSSLNNTNVMGKIVLC-EAGITRAVDKGIAVKAAGGAAMIIMN  420

Query  1129  PEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAF  950
             P+ +  TT A AHVLP   +TYADG KI AYIN+T+ P AT +FKGT  GD  AP VA F
Sbjct  421   PKSWANTTFAEAHVLPVTHVTYADGLKIQAYINSTTTPTATIAFKGTTIGDNRAPVVAGF  480

Query  949   SSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAA  770
             SSRGP+  SP ILKPDIIGPGVNILA WP S++N  N+ STFN+ISGTSMSCPHLSGVAA
Sbjct  481   SSRGPSYVSPRILKPDIIGPGVNILAAWPVSLENNTNTNSTFNMISGTSMSCPHLSGVAA  540

Query  769   LLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGL  590
             LLKS HPDWSPA IKSA+MTTAD+LN G N I+++  + A VF+ GAGHVNPSKAN PGL
Sbjct  541   LLKSVHPDWSPAAIKSAIMTTADVLNLGSNLIEDETYLPADVFATGAGHVNPSKANAPGL  600

Query  589   VYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTA--Q  416
             +YD KP DYLPYLCGLNYTNR++ VILQ +VNCS V SI E QLNYPSF+I ++S +  Q
Sbjct  601   IYDIKPSDYLPYLCGLNYTNRQIAVILQRKVNCSEVTSILEGQLNYPSFAIQVKSNSGVQ  660

Query  415   TYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSN  236
              Y+RTVTNVG+A+S Y V+I  P G+ V VEP  L FS V QKL+Y VTF+  +  + + 
Sbjct  661   VYSRTVTNVGQANSTYRVDIDSPQGLDVKVEPTTLVFSDVKQKLSYQVTFTPFAAPSTT-  719

Query  235   MPPVVQGALRWKSVKHHVRSPIAA  164
                  QG+LRW S  H VRS IAA
Sbjct  720   ---YTQGSLRWISENHIVRSQIAA  740



>ref|XP_011081166.1| PREDICTED: subtilisin-like protease SDD1 [Sesamum indicum]
Length=1245

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/729 (64%), Positives = 554/729 (76%), Gaps = 20/729 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPT-TVAGGGYGESRMVFMYRNVM  2150
             S LETYIV V+ P   ++         DL+ WY +FL T TVA G    +R ++ YRNV 
Sbjct  530   SPLETYIVHVDGPDGVLNRLD------DLDSWYNTFLSTITVASGE--RNRRIYSYRNVF  581

Query  2149  KGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVI  1970
             KGFAA+LSA+EVK M +  GFISA PER L LHTTHSP FLGL QNMGFW +S+YGKGVI
Sbjct  582   KGFAARLSADEVKAMEDMPGFISARPERKLSLHTTHSPNFLGLNQNMGFWNESNYGKGVI  641

Query  1969  IGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA-CNNKVIGARSFSERERSVFddd  1793
             IGVLD+GI  DHPSFSDEGMPPPPA+WKG C+ N T  CNNK+IGAR F+  + S  DDD
Sbjct  642   IGVLDTGIFPDHPSFSDEGMPPPPAKWKGKCDFNLTTKCNNKIIGARYFNSFDDSPLDDD  701

Query  1792  ghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTA  1613
             GHGTHTA TAAGNFVRGANV+G+ANGTA G+APLAHLAIYKVC+ + CS+S+ILAAMDTA
Sbjct  702   GHGTHTASTAAGNFVRGANVFGNANGTAVGIAPLAHLAIYKVCS-LFCSESDILAAMDTA  760

Query  1612  IEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWML  1433
             I+DGVD+LSLSLGG ++S ++DSIALGAYSAME+GI VS SAGN GP+N SLSNEAPW+L
Sbjct  761   IDDGVDVLSLSLGGFANSLYDDSIALGAYSAMEQGILVSCSAGNAGPYNFSLSNEAPWIL  820

Query  1432  TVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSE  1253
             TVGAST+DRK+ AT +LG+ Q F GE+ FQP DF  +LL LV+ G   + +    +C +E
Sbjct  821   TVGASTIDRKIRATALLGDNQTFDGESTFQPMDFPPTLLPLVYAGMLNTSDPDIQFCTAE  880

Query  1252  SLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAID  1073
             SL   D+RGKIVVC  G    R  KG AVK A G  MIL+ P  +   T + +HVLPA  
Sbjct  881   SLNGTDLRGKIVVCEVG-ITTRISKGIAVKEAGGAAMILVNPARFANLTLSESHVLPATH  939

Query  1072  ITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIG  893
             ++YADG KI AYIN+TS P AT  F+GTI GD  AP VAAFSSRGPN  S  ILKPDI+G
Sbjct  940   VSYADGLKIKAYINSTSTPTATIVFRGTIIGDDRAPVVAAFSSRGPNWVSRNILKPDILG  999

Query  892   PGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMM  713
             PGVNILA WP SV+N  N+ +TFNIISGTSMSCPHLSG+AALLKSSHPDWSPA IKSA+M
Sbjct  1000  PGVNILAAWPVSVENNTNTNATFNIISGTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIM  1059

Query  712   TTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYT  533
             TTAD++N  QNPI+++  + A+VF+ G+GHVNPS+ANDPGL+YD + EDY+PYLCGLNYT
Sbjct  1060  TTADVVNLAQNPIEDERFLPANVFATGSGHVNPSRANDPGLIYDLQAEDYIPYLCGLNYT  1119

Query  532   NREVGVILQHRVNCSAVISIPEAQLNYPSFSI---ILESTAQTYTRTVTNVGEASSFYTV  362
             NREVG ILQ RVNCSA   IPE QLNYPSF++   + + T QTYTRTVTNVGE +S Y V
Sbjct  1120  NREVGSILQRRVNCSAESRIPETQLNYPSFALTFGVFQPTVQTYTRTVTNVGEPNSSYVV  1179

Query  361   EIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFS-LSSKAARSNMPPVVQGALRWKSVKHH  185
             EI  PPG+ V VEP +L F +VNQKL Y VTFS L+S  +       VQG L+W S K  
Sbjct  1180  EIVPPPGIDVLVEPTKLDFLEVNQKLQYQVTFSRLNSTTSIG----FVQGYLKWNSSKRS  1235

Query  184   VRSPIAAKL  158
             VRSPIA  L
Sbjct  1236  VRSPIAVIL  1244


 Score =   254 bits (648),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 152/198 (77%), Gaps = 5/198 (3%)
 Frame = -1

Query  745  WSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPED  566
            WSPA IKSA+MTTAD++N  ++PI+++  V AS+F+ GAGHVNPS+ANDPGLVYD +P+D
Sbjct  331  WSPAAIKSAIMTTADVVNLARHPIEDEQFVPASIFATGAGHVNPSRANDPGLVYDIQPKD  390

Query  565  YLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL--ESTAQTYTRTVTN  392
            Y+PYLCGLNYTNREVG  LQ RVNCS   SIPE QLNYP+F++    +ST+QTYTRTVTN
Sbjct  391  YIPYLCGLNYTNREVGFFLQRRVNCSLESSIPEGQLNYPAFALTFSSQSTSQTYTRTVTN  450

Query  391  VGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGA  212
            VG+ +S Y V++  PPG+ + VEP  L F++ NQK+ Y VTFS S+ AA +    VVQG 
Sbjct  451  VGDPNSSYIVDVVPPPGIDMLVEPDTLSFTETNQKMQYQVTFSRSASAANNT---VVQGF  507

Query  211  LRWKSVKHHVRSPIAAKL  158
            L W S +H VRSPIA  L
Sbjct  508  LAWNSSRHSVRSPIAVIL  525


 Score =   249 bits (636),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 155/292 (53%), Positives = 191/292 (65%), Gaps = 46/292 (16%)
 Frame = -1

Query  2401  PNMKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             P +  + MF + S    F +     S L+TYIV +E P   ++TQS      DLE WY+S
Sbjct  5     PFIILVCMFCV-SPWPAFAADGPERSSLQTYIVLLEGPDGEVTTQSE-----DLESWYQS  58

Query  2221  FLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTH  2042
             FLP + A    GE+R+V+ YRNV KGFAAKL+A++VK M  KDGF+SA PE++L LHTTH
Sbjct  59    FLPASTASSNDGEARIVYSYRNVFKGFAAKLTADDVKNMEKKDGFVSARPEKVLSLHTTH  118

Query  2041  SPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT  1862
             +P FLGL QNMG WRDS+YGKGVIIGVLD+G+  +HPSFSDEGMPPPPA+WKG CE N T
Sbjct  119   TPNFLGLNQNMGLWRDSNYGKGVIIGVLDTGVFPEHPSFSDEGMPPPPAKWKGKCEFNHT  178

Query  1861  ACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHL  1682
              CNNK+IGAR F   + S  DDDGHGTHTA TAAGNFVRGANV+                
Sbjct  179   TCNNKIIGARYFETEDISPLDDDGHGTHTASTAAGNFVRGANVF----------------  222

Query  1681  AIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAY  1526
                                     EDGVD+LSLSLG ++++F++D IALGA+
Sbjct  223   ------------------------EDGVDVLSLSLGSLTNNFYQDFIALGAF  250


 Score = 92.0 bits (227),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = -1

Query  1225  KIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKI  1046
             KIVVC  GG + R GKGEAVK+A G GMIL+  E    TTSA  HVLPA  ++YA G KI
Sbjct  252   KIVVCELGGGMTRVGKGEAVKSAGGAGMILLNNERSANTTSAEVHVLPATHVSYAAGLKI  311

Query  1045  LAYINATSNPMATFSFKGT  989
              AYIN+TS P AT  F+GT
Sbjct  312   KAYINSTSTPTATIRFEGT  330



>ref|XP_004244717.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=744

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/746 (60%), Positives = 556/746 (75%), Gaps = 11/746 (1%)
 Frame = -1

Query  2386  LRMFLILSVLIGFC-STATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPT  2210
             +++F +L   I  C S  ++ S LETYIV+VE P S+ISTQ S    +DLE WYKSF+P 
Sbjct  1     MKIFFVLFFSILACFSCHSMQSDLETYIVQVESPESQISTQPSR---MDLESWYKSFMPK  57

Query  2209  TVAGGGYGES-RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPG  2033
             T+      E  ++++ Y NV+ GFAA+LSA++VKEM  K GFI A P+RIL LHTTHSP 
Sbjct  58    TIETASSDEKPQLIYSYHNVIIGFAARLSAKQVKEMEKKPGFIFAWPQRILSLHTTHSPS  117

Query  2032  FLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA-C  1856
             FL LQQN+G W D +YG+GVIIG+ D+GI  DHPSFSDEGMPPPPA+WKG C+ NFT  C
Sbjct  118   FLELQQNVGLWSDDNYGEGVIIGLFDTGITPDHPSFSDEGMPPPPAKWKGKCDSNFTGKC  177

Query  1855  NNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAI  1676
             NNK+IGA+++     S  D+ GHGTHT+ TAAGNFV+GANVYG+A GTA G+APLAHLA+
Sbjct  178   NNKLIGAKTYPLNSESPKDEAGHGTHTSSTAAGNFVKGANVYGNAKGTAVGIAPLAHLAM  237

Query  1675  YKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVS  1496
             YKVC+   CS+S ILA MD AI+DGVDI+SLSLGG S  F+ D IALGAYSA ++GI VS
Sbjct  238   YKVCDN-DCSESAILAGMDEAIDDGVDIMSLSLGGSSRPFYYDVIALGAYSAAKRGILVS  296

Query  1495  ASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLL  1316
              SAGN GP + +LSNEAPW+LTVGAST+DR+L ATV+LG+++ F GE+ F PK  +SS  
Sbjct  297   CSAGNGGPSHSTLSNEAPWILTVGASTIDRELKATVMLGDQKLFEGESVFSPKVPDSSFY  356

Query  1315  SLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMIL  1136
              L+ P  N +    S +C+  +L +   +GKIVVCM GG++   GKG+ VK+A G GMIL
Sbjct  357   PLIDPSLNAT-HIGSRFCEPGTLSDPKFKGKIVVCMAGGYVSTIGKGQVVKDAGGVGMIL  415

Query  1135  IEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVA  956
             +   EYG +  A  HVLPA+ IT+ DG +IL YIN+TS P A   F GTI GDK AP VA
Sbjct  416   VSIPEYGFSKFADPHVLPALYITFNDGMEILQYINSTSEPTARIMFHGTIIGDKEAPVVA  475

Query  955   AFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGV  776
             AFSSRGP+  SPGILKPDIIGPG NILA W TSVD + ++KS FNII GTSMSCPHLSGV
Sbjct  476   AFSSRGPSYASPGILKPDIIGPGNNILAAWHTSVDYEKHTKSAFNIIQGTSMSCPHLSGV  535

Query  775   AALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDP  596
             AALLKSSH +WSP+ IKSA+MTTA+ LN    PI ++ L+ A +F+IGAGHVNP +ANDP
Sbjct  536   AALLKSSHRNWSPSAIKSAIMTTANTLNLANVPILDERLLPADIFAIGAGHVNPLRANDP  595

Query  595   GLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQ  416
             GL+YD   EDYLPYLCGLNYTN++VG I++H+V+C+ V  IPEAQLNYPSFSI L   +Q
Sbjct  596   GLIYDISIEDYLPYLCGLNYTNQQVGSIVKHKVDCNKVKHIPEAQLNYPSFSITLGDISQ  655

Query  415   TYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSN  236
             TYTRTVTNVGEA S YTVEI  PP V V V+P  L+FS+++QKL Y VTF+    +  S 
Sbjct  656   TYTRTVTNVGEAKSSYTVEIDSPPRVTVIVKPSTLKFSQLDQKLKYQVTFTRRDDSTSSG  715

Query  235   MPPVVQGALRWKSVKHHVRSPIAAKL  158
                + QG L+W S K+ VRSPIA  L
Sbjct  716   ---IAQGFLKWSSKKYSVRSPIAVVL  738



>emb|CAB67119.1| subtilisin-like protease [Solanum lycopersicum]
Length=743

 Score =   836 bits (2159),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/748 (61%), Positives = 551/748 (74%), Gaps = 15/748 (2%)
 Frame = -1

Query  2389  FLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPT  2210
              L +F ++ VL  F + AT  +  + YIV  E P    +++       DLE WY SFLP 
Sbjct  8     ILTIFGLICVLFLFSTNATEQNNSQIYIVHCEFPSGERTSKYQ-----DLESWYLSFLPA  62

Query  2209  TVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGF  2030
             T +       R+++ YRNV+ GFAAKLS E++KEM   +GF+SA P+R+L LHTTHS  F
Sbjct  63    TTSDSSREAPRLIYSYRNVLTGFAAKLSQEDIKEMEKMEGFVSARPQRLLKLHTTHSVDF  122

Query  2029  LGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNF-TACN  1853
             LGLQQNMGFW+DS+YGKGVIIGV+DSG+  DHPSFSD GMPP PA+WKGVCE +F T CN
Sbjct  123   LGLQQNMGFWKDSNYGKGVIIGVIDSGVFPDHPSFSDVGMPPIPAKWKGVCESDFATKCN  182

Query  1852  NKVIGARSFSERERSVFdddghgthtagtaaGNFVRGAN-VYGSANGTAAGVAPLAHLAI  1676
             NK+IGARS+     S  D+DGHGTHTAGT AG FV GAN   G+ANGTA GVAPLAH+AI
Sbjct  183   NKLIGARSYQIANGSPIDNDGHGTHTAGTTAGAFVEGANGSSGNANGTAVGVAPLAHIAI  242

Query  1675  YKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVS  1496
             YKVCN   CSDS+ILAAMD+AIE GVDILS+SLGG    F+EDSIA GAY+A E+GI VS
Sbjct  243   YKVCNSNSCSDSDILAAMDSAIEYGVDILSMSLGGSPVPFYEDSIAFGAYAATERGILVS  302

Query  1495  ASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLL  1316
              SAGN GP   + SN APW+LTVGAST+DRK+ ATV LGN ++F GE+A++P+  +S+  
Sbjct  303   CSAGNSGPSYITASNTAPWILTVGASTIDRKIKATVTLGNTEEFEGESAYRPQISDSTYF  362

Query  1315  SLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMIL  1136
             +L    ++  D S  PYC + SL +  ++ KI +C  G   +   K +AVK+A G GMI+
Sbjct  363   TLYDAAKSIGDPSE-PYC-TRSLTDPAIK-KIAICQAGDVSNIE-KRQAVKDAGGVGMIV  418

Query  1135  IEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVA  956
             I    YG+T SA AHVLP + ++ ADG KIL Y N+ SNP+AT + +GTI GDKNAP VA
Sbjct  419   INHHIYGVTKSADAHVLPGLVVSAADGSKILDYTNSISNPIATITIQGTIIGDKNAPIVA  478

Query  955   AFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGV  776
             AFSSRGP++ +PGILKPDIIGPGVNILA WPTSVD+  ++KSTFNIISGTSMSCPHLSG+
Sbjct  479   AFSSRGPSKPNPGILKPDIIGPGVNILAAWPTSVDDNKDTKSTFNIISGTSMSCPHLSGI  538

Query  775   AALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDP  596
             AALLKS+HPDWSPA IKSA+MTTA  LN   +PI ++ L+ A +F+IGAGHVNPS ANDP
Sbjct  539   AALLKSTHPDWSPAAIKSAIMTTAYTLNLDSSPILDERLLPADIFAIGAGHVNPSSANDP  598

Query  595   GLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSII-LESTA  419
             GLVYDT  EDY PYLCGL YTN +V  +L+  VNC  V SIPEAQLNYPSFSI  L ST 
Sbjct  599   GLVYDTPSEDYFPYLCGLGYTNAQVSSLLRRTVNCLEVNSIPEAQLNYPSFSIYGLGSTP  658

Query  418   QTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARS  239
             QTYTRTVTNVG+A+S Y V+I    GV V V P EL FS++NQKLTY VTF   SK   S
Sbjct  659   QTYTRTVTNVGDATSSYKVKIASLIGVAVEVVPTELNFSELNQKLTYQVTF---SKTTSS  715

Query  238   NMPPVVQGALRWKSVKHHVRSPIAAKLV  155
             +   VV+G L+W S +H VRSPIA  LV
Sbjct  716   SEVVVVEGFLKWTSTRHSVRSPIAVVLV  743



>ref|XP_006358904.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=757

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/742 (60%), Positives = 539/742 (73%), Gaps = 12/742 (2%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTT  2207
             L + +++ VL  F + AT  +  + YIV  + P   +ST+       DLE WY SFLP T
Sbjct  9     LTIIVLICVLFSFTTNATKQNNSQIYIVHCQFPDGEMSTRYQ-----DLESWYLSFLPAT  63

Query  2206  VAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFL  2027
              +       R+++ YRNV+ GFAAKLS E++KEM   +GF+SA P+ IL LHTTHS  F+
Sbjct  64    TSDSSREAPRLIYSYRNVLTGFAAKLSPEDIKEMEKMEGFVSARPDEILNLHTTHSVNFM  123

Query  2026  GLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNK  1847
             GLQQNMGFW DS+YGKGVIIGV+D GI  DHPSFSD+GMPPPPA+WKG CE N T CNNK
Sbjct  124   GLQQNMGFWNDSNYGKGVIIGVIDGGIFPDHPSFSDDGMPPPPAKWKGKCEFNVTKCNNK  183

Query  1846  VIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKV  1667
             +IGAR F       +D+DGHGTHTA TAAG FV GAN++G+ANGTAAGVAPL+H+A+YK 
Sbjct  184   LIGARVFPNSGIDPWDEDGHGTHTASTAAGCFVPGANIFGNANGTAAGVAPLSHVAVYKA  243

Query  1666  CNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASA  1487
             C+   CS S+ILAAMD AIEDGVDILS+SLG +S++F+ +S+ALGA+SA +KGIFVS S 
Sbjct  244   CSAGFCSGSDILAAMDMAIEDGVDILSISLGSLSNAFYRNSVALGAFSATKKGIFVSCSG  303

Query  1486  GNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLV  1307
             GN GP++ S+SNEAPW+LTVGAST+DRK+ ATVVLGN Q+F GE+A QP DF  +LL L 
Sbjct  304   GNSGPYSFSMSNEAPWILTVGASTIDRKIKATVVLGNNQEFDGESALQPHDFPPTLLPLA  363

Query  1306  FPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEP  1127
             +PG N SD S + YC   SL N +V GKIV C +G  + R  KG AVK A G  MI +  
Sbjct  364   YPGSNASD-SDAKYCTPASLNNTNVMGKIVFCESGK-ITRADKGIAVKAAGGAAMIFMNR  421

Query  1126  EEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFS  947
             E    TT A A+VLP   + YADG KI  YI++T  P AT  FKGTI GD  AP VAAFS
Sbjct  422   EAMANTTLAEAYVLPTTYVGYADGLKIKEYIDSTPTPTATIVFKGTIIGDDRAPVVAAFS  481

Query  946   SRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAAL  767
             SRGP+  SPGILKPDIIGPGVNILA W  S+DN  N+ S FN+ISGTSMSCPHLSGVAAL
Sbjct  482   SRGPSYASPGILKPDIIGPGVNILAAWHISLDNNTNTNSRFNMISGTSMSCPHLSGVAAL  541

Query  766   LKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLV  587
             LKS HPDWSPA IKSA+MTTAD+LN   N I+++  + A+VF+ GAGHVNPSKANDPGL+
Sbjct  542   LKSVHPDWSPAAIKSAIMTTADVLNLRSNLIEDETYLPANVFATGAGHVNPSKANDPGLI  601

Query  586   YDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILE--STAQT  413
             YD  P  YLPYLCGLNYT+ +VG     +VNCS V SI + QLNYPSFSI +   S+AQ 
Sbjct  602   YDIDPAVYLPYLCGLNYTDTQVGFFFPGKVNCSEVTSISDGQLNYPSFSIQVRVNSSAQV  661

Query  412   YTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNM  233
             Y+RTV NVG+A+S Y VEI  PPG+ V VEP  L FS+V Q L+Y VTF+       +  
Sbjct  662   YSRTVMNVGQANSTYRVEIDSPPGLDVKVEPTTLVFSEVKQALSYQVTFTPLDTIPNTTF  721

Query  232   PPVVQGALRWKSVKHHVRSPIA  167
                 QG+LRW S KH VRSPIA
Sbjct  722   N---QGSLRWISEKHIVRSPIA  740



>ref|XP_009781098.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=756

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/727 (62%), Positives = 543/727 (75%), Gaps = 15/727 (2%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S  + YI+  E P     ++       DL+ WY SFLP T + G     R+++ YRNV+ 
Sbjct  38    SNSQVYIIHCEFPDREGDSRYQ-----DLDSWYLSFLPATTSDGSREAPRLIYSYRNVLT  92

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAAKL  +++KEM  + GFISA PER L L+TTHS  FLGL QNMGFW DS+YGKGVII
Sbjct  93    GFAAKLYPDDLKEMQKRKGFISARPERQLDLYTTHSLNFLGLHQNMGFWNDSNYGKGVII  152

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-SERERSVFdddg  1790
             GV+D+GI  DHPSFSD+GMPPPPA+WKG CE N T CNNK+IGAR F S    S +D++G
Sbjct  153   GVIDTGIFPDHPSFSDDGMPPPPAKWKGKCEFNVTKCNNKLIGARYFQSSGNGSPWDENG  212

Query  1789  hgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAI  1610
             HGTHTA TAAGNFV GAN++G+ANGTAAGVAPLAH+AIYKVC+ I CS+S+ LAAMD AI
Sbjct  213   HGTHTASTAAGNFVPGANIFGNANGTAAGVAPLAHVAIYKVCSGITCSESDTLAAMDMAI  272

Query  1609  EDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLT  1430
             EDGVD+LSLSLG ++++F+ D+IALGA+SAMEKGIFVS +AGN GP + S +NEAPW+LT
Sbjct  273   EDGVDVLSLSLGRLTNNFYSDNIALGAFSAMEKGIFVSCAAGNSGPSSFSTANEAPWILT  332

Query  1429  VGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSES  1250
             VGAST+DRK+  T VLGN ++F GE+AFQP +F  +LL L +PG N SD S + YC   S
Sbjct  333   VGASTIDRKIKTTAVLGNNEEFDGESAFQPSEFPPTLLHLAYPGSNASD-SDAKYCTPAS  391

Query  1249  LRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDI  1070
             L N +V GKIV+C  G    R  KG+AVK A G  MIL+  E    TT A AHVLP   +
Sbjct  392   LNNTNVMGKIVLCEVGR-TTRVDKGKAVKVAGGAAMILMNTENLANTTLAEAHVLPVTHV  450

Query  1069  TYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGP  890
             +YADG KI  YIN+T  P AT  FKGTI GD  AP VA FSSRGPN  SPGILKPDI GP
Sbjct  451   SYADGLKIKEYINSTLIPTATIVFKGTIIGDDRAPVVAGFSSRGPNFASPGILKPDITGP  510

Query  889   GVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMT  710
             GVNILA W  S++N  N+ S FN+ISGTSMSCPHLSGVAALLKSSHPDWSPA IKSA+MT
Sbjct  511   GVNILAAWHVSLENNTNTNSNFNMISGTSMSCPHLSGVAALLKSSHPDWSPAAIKSAIMT  570

Query  709   TADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTN  530
             TAD+LN G + I+++  + ASVF+ GAGHVNPSKANDPGL+YD +P DY+ YLCGLNYT+
Sbjct  571   TADVLNLGLSSIEDETYLPASVFATGAGHVNPSKANDPGLIYDIEPADYVAYLCGLNYTD  630

Query  529   REVGVILQHRVNCSAVISIPEAQLNYPSFSIILE--STAQTYTRTVTNVGEASSFYTVEI  356
             R+VG+ LQ +V CS + SI E QLNYPSFSI +   STAQTY+R  TN+G+A+S Y +EI
Sbjct  631   RQVGIFLQRKVKCSEITSILEGQLNYPSFSIQVRSNSTAQTYSRNATNIGQANSTYNIEI  690

Query  355   FEPPGVKVNVEPRELQFSKVNQKLTYNVTFS-LSSKAARSNMPPVVQGALRWKSVKHHVR  179
               PPGV V VEP  L FS++NQKL+Y VTF+ L+++ + S      QG+LRW S KH VR
Sbjct  691   DSPPGVDVKVEPTTLVFSEMNQKLSYQVTFTPLATRPSTS----FNQGSLRWISKKHIVR  746

Query  178   SPIAAKL  158
             SPI  + 
Sbjct  747   SPIVVRF  753



>ref|XP_009629568.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=761

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/732 (62%), Positives = 544/732 (74%), Gaps = 20/732 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S  + YIV  E P    +T+       DL+ WY SFLP T +       R+++ YRNV+ 
Sbjct  38    SNSQVYIVHCEFPDGDKTTRYQ-----DLDSWYLSFLPATTSDSSREAPRLIYSYRNVLT  92

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAAKLS +++KEM  K+GFISA PE+ L L+TTHS  FLGL QNMGFW DS+YGKGVII
Sbjct  93    GFAAKLSPDDLKEMEKKEGFISARPEKQLDLYTTHSLNFLGLHQNMGFWNDSNYGKGVII  152

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-SERERSVFdddg  1790
             GV+D+GI  DHPSFSD GMPPPPA+WKG CE N T CNNK+IGAR F S    S +D++G
Sbjct  153   GVIDTGIFPDHPSFSDGGMPPPPAKWKGKCEFNVTKCNNKLIGARYFQSSGNGSPWDENG  212

Query  1789  hgthtagtaaGNFVRGANVYGSANGTAAG-----VAPLAHLAIYKVCNEIGCSDSEILAA  1625
             HGTHTA TAAGNFV GAN++G+ANG  A      VAPLAH+AIYKVC+ I CS+S+ILAA
Sbjct  213   HGTHTASTAAGNFVPGANIFGNANGXNANGTAAGVAPLAHVAIYKVCSYIYCSESDILAA  272

Query  1624  MDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEA  1445
             MD AIEDGVD+LSLSLGG++ +F+ED IA+GA+SAMEKGIFVS +AGN GPF+ S SNEA
Sbjct  273   MDMAIEDGVDVLSLSLGGVAYNFYEDVIAVGAFSAMEKGIFVSCAAGNSGPFSFSTSNEA  332

Query  1444  PWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPY  1265
             PW+LTVGAST+DRK+ AT VLGN +++ GE+AFQP DF  +LL LV+PG N SD  +  Y
Sbjct  333   PWILTVGASTIDRKIKATAVLGNNEEYDGESAFQPSDFPPTLLPLVYPGSNDSDIWAK-Y  391

Query  1264  CDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVL  1085
             C   SL N +V GKIV+C  G    R  KGEAVK A G  MI++  E    TT A AHVL
Sbjct  392   CYPTSLNNTNVTGKIVLCEVG-ITSRVSKGEAVKAAGGAAMIIMNTESLANTTLAEAHVL  450

Query  1084  PAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKP  905
             PA  ++YADG KI  YIN+T  P AT  F GTI GD  AP VA FSSRGP+  SPGILKP
Sbjct  451   PATHVSYADGLKIKEYINSTLVPTATIVFNGTIIGDDRAPVVAGFSSRGPSYASPGILKP  510

Query  904   DIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIK  725
             DIIGPGVNILA W  S++N  N+ S FN+ISGTSMSCPHLSGVAALLKS HPDWSPA IK
Sbjct  511   DIIGPGVNILAAWRVSLENNTNTNSMFNMISGTSMSCPHLSGVAALLKSVHPDWSPAAIK  570

Query  724   SAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCG  545
             SA+MTTAD+LN G N I+++  + A VF+ GAGHVNPSKANDPGL+YD +P DY+ YLCG
Sbjct  571   SAIMTTADVLNLGLNFIEDETYLPAGVFATGAGHVNPSKANDPGLIYDIEPADYVSYLCG  630

Query  544   LNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL--ESTAQTYTRTVTNVGEASSF  371
             LNYTNR+VG+ LQ +VNCS + SI E QLNYPSFSI L  +S AQTY+R VTNVG+A+S 
Sbjct  631   LNYTNRQVGIFLQRKVNCSEITSILEGQLNYPSFSIKLSADSAAQTYSRNVTNVGQANST  690

Query  370   YTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFS-LSSKAARSNMPPVVQGALRWKSV  194
             Y+VEI  PPGV V VEP  L FS+VNQKL+Y VTF+ L S  +        QG+L+W S 
Sbjct  691   YSVEIDSPPGVDVKVEPITLAFSEVNQKLSYQVTFTPLPSNPSFG----YYQGSLKWISD  746

Query  193   KHHVRSPIAAKL  158
             KH VRSPI+ + 
Sbjct  747   KHIVRSPISVRF  758



>gb|EYU39026.1| hypothetical protein MIMGU_mgv1a019074mg, partial [Erythranthe 
guttata]
Length=725

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/694 (65%), Positives = 528/694 (76%), Gaps = 14/694 (2%)
 Frame = -1

Query  2335  TIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRN  2156
             T +S LETYI+ V+                +LE WY SFLPT+ +       R+V+ YR 
Sbjct  3     TNSSTLETYIIHVD------GNLGLFDRFENLESWYTSFLPTSNSNS---RGRIVYSYRK  53

Query  2155  VMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKG  1976
             V KGFAA+LSA+EVK M N   FISA PER L  HTTHSP FLGL QNMGFW+ S+YGKG
Sbjct  54    VFKGFAARLSADEVKAMENHPAFISARPERKLDKHTTHSPNFLGLNQNMGFWQGSNYGKG  113

Query  1975  VIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVFdd  1796
             VIIGVLD+G+   HPSFSDEGMPPPPA+WKG CE N TACNNK+IGAR F+  + S  DD
Sbjct  114   VIIGVLDTGVLPSHPSFSDEGMPPPPAKWKGKCEFNQTACNNKIIGARYFNSFDDSPLDD  173

Query  1795  dghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDT  1616
             DGHGTHTA TAAG+FVRGANV+G+ANGTAAG+AP+AHLAIYKVC+ + CS+S+ILAAMDT
Sbjct  174   DGHGTHTASTAAGSFVRGANVFGNANGTAAGIAPMAHLAIYKVCS-LFCSESDILAAMDT  232

Query  1615  AIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWM  1436
             AIEDGVDILSLSLGG+S SF++DSIALGA+SAME GI VS SAGN+GPFN SLSNEAPW+
Sbjct  233   AIEDGVDILSLSLGGLSFSFYDDSIALGAFSAMENGILVSCSAGNDGPFNISLSNEAPWI  292

Query  1435  LTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDS  1256
             LTVGAST+DRK+ AT++LGN +   GE+ FQP DF  +L+ LV+ G   + + +  +C  
Sbjct  293   LTVGASTIDRKIRATILLGNNETLDGESTFQPSDFPPTLMPLVYAGSLNTSDPNIQFCTP  352

Query  1255  ESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAI  1076
              SL  +D+RG +VVC  G  + R  KG AVKNA G  MIL+ P  Y   T A AHVLPA 
Sbjct  353   TSLNKSDLRGMVVVCEIG-VVARVSKGIAVKNAGGSAMILVNPRIYANMTLAEAHVLPAA  411

Query  1075  DITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDII  896
              ++YADG KI  YIN+T  P AT  FKGTI GD  AP VA FSSRGPN  SPGILKPDI+
Sbjct  412   HVSYADGLKIKTYINSTITPTATILFKGTIIGDDRAPVVAGFSSRGPNYISPGILKPDIL  471

Query  895   GPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAM  716
             GPGVNILA WP SV+N  N+ STFNIISGTSMSCPHLSGVAALLKSSHP+WSPA IKSA+
Sbjct  472   GPGVNILAAWPVSVENNTNTNSTFNIISGTSMSCPHLSGVAALLKSSHPNWSPAAIKSAI  531

Query  715   MTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNY  536
             MTTAD++N   NPI+++  V A++F+ G+GHVNPS+ANDPGLVYD KPEDY+PYLCGLNY
Sbjct  532   MTTADVVNLALNPIEDERYVPANIFATGSGHVNPSRANDPGLVYDIKPEDYIPYLCGLNY  591

Query  535   TNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL---ESTAQTYTRTVTNVGEASSFYT  365
             TNR+VG ILQ +V+CS    IPEAQLNYPSF+I     +  +QTYTR+VTNVGE  S Y 
Sbjct  592   TNRQVGFILQRKVDCSVESKIPEAQLNYPSFAIRFGRSQPISQTYTRSVTNVGEPVSSYV  651

Query  364   VEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFS  263
             VEI  PPG+ V VEP  L FS+ NQ L Y VTF+
Sbjct  652   VEIVPPPGIGVLVEPSNLDFSEANQTLQYQVTFT  685



>ref|XP_011081168.1| PREDICTED: subtilisin-like protease SDD1, partial [Sesamum indicum]
Length=740

 Score =   826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/747 (59%), Positives = 546/747 (73%), Gaps = 14/747 (2%)
 Frame = -1

Query  2398  NMKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSF  2219
             ++ FL + + L   + F   A   S LETYIV VE      S      +S +LE WY SF
Sbjct  7     SLAFLALLISLHSSLAF---ANEESDLETYIVHVE-----ASDGKVFENSEELESWYHSF  58

Query  2218  LPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHS  2039
             L T+ +       RMV+ Y+NV+KGFAA+LS +EV+ +   +GF+ A P+R LPLH THS
Sbjct  59    LTTSTSSSDR-SPRMVYTYKNVIKGFAARLSPDEVELIQEYEGFVHARPQRKLPLHMTHS  117

Query  2038  PGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA  1859
             P FLGL QN GFW+DS+YGKGV+IGV+D+G+   HPSFSDEGMPPPPA+WKG CE NFTA
Sbjct  118   PDFLGLHQNFGFWKDSNYGKGVVIGVIDTGVFPSHPSFSDEGMPPPPAKWKGKCEFNFTA  177

Query  1858  CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLA  1679
             CNNK+IGAR F+    +  D+DGHGT TA  AAGNFV GAN +G ANGTA GVAPLAHLA
Sbjct  178   CNNKLIGARYFTFGNGTPLDEDGHGTSTASAAAGNFVPGANFFGQANGTAVGVAPLAHLA  237

Query  1678  IYKVCN-EIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIF  1502
             +YKVC+    CS+S++LAAMD AIEDGVD+LSLSLG  S+SF  DSIALGAYSA++KGIF
Sbjct  238   VYKVCSGSRRCSESDVLAAMDVAIEDGVDVLSLSLGRPSTSFTFDSIALGAYSAVQKGIF  297

Query  1501  VSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSS  1322
             VS SA N GP  G+LSNEAPW+LTVGAST+DRKL ATV+LGN+++  GE   QP +F+ +
Sbjct  298   VSCSATNRGPEYGTLSNEAPWILTVGASTIDRKLKATVILGNKEEIEGEAIIQPNNFSQT  357

Query  1321  LLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGM  1142
             LL LVFPG++T++ ++  +C S SL + +V+GK+VVC     +      + V+ A G  +
Sbjct  358   LLPLVFPGKSTTNPNAR-FCTSGSLTSINVKGKVVVCELDVAISLSETVKEVEEAGGSAI  416

Query  1141  ILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPT  962
             I +  E  G+T      +LP   + +ADG +I  YIN+TS PMAT SFKGT+ GD +APT
Sbjct  417   IFMNQESAGVTKMLVPILLPTAQVGFADGLRIKRYINSTSKPMATLSFKGTVIGDDHAPT  476

Query  961   VAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLS  782
             VA+FSSRGP+ +SPGILKPDIIGPGVNIL  WP SV++  N+K  F I SGTS SCPHLS
Sbjct  477   VASFSSRGPSLQSPGILKPDIIGPGVNILVAWPVSVESSKNTKLGFLIGSGTSASCPHLS  536

Query  781   GVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKAN  602
             GVAALLKS+HPDWSPA IKSA+MTTAD++N   NPI++Q+L  A VF+ GAGHVNPS+AN
Sbjct  537   GVAALLKSAHPDWSPAAIKSAIMTTADVVNLAHNPIEDQNLQPADVFATGAGHVNPSRAN  596

Query  601   DPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILEST  422
             DPGLVYD +P DY+PYLCGL YT+REVG+I Q +VNCS +  IPE+QLNYPSFS++  S 
Sbjct  597   DPGLVYDIQPNDYIPYLCGLEYTDREVGIITQQKVNCSKISWIPESQLNYPSFSVLFGSR  656

Query  421   AQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAAR  242
              QTYTRTVTNVGEA+S Y VEI  PPGV V V+P +L+F +  QK TY VTFS    A  
Sbjct  657   VQTYTRTVTNVGEANSSYVVEISPPPGVHVAVKPEKLEFMEQKQKATYEVTFSRLPSAGN  716

Query  241   SNMPPVVQGALRWKSVKHHVRSPIAAK  161
             SN     QG L W S K  VRSPI+ K
Sbjct  717   SNFS---QGFLMWTSEKCFVRSPISIK  740



>ref|XP_009776224.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=742

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/751 (60%), Positives = 548/751 (73%), Gaps = 35/751 (5%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIA------SKLETYIVRVELPHsristqsssssSVDLEH  2234
             M F  +F ++ +LI   S+AT+A      + LETYIV +E P          S S DL  
Sbjct  14    MDFRSVFTLVCILI-LHSSATLAGHFTNQNDLETYIVHLEFP-----DDIFFSDSDDLYL  67

Query  2233  WYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPL  2054
             W++SFLPTT     +  SR+++ YR+V  GFAA LS+EEVK M  K GF+SA P+R+L +
Sbjct  68    WHQSFLPTTSTNSDH-LSRIIYSYRHVFNGFAALLSSEEVKTMEKKPGFVSARPQRVLQM  126

Query  2053  HTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCE  1874
             HTTHSP FLGL QN+G W  S+ G+GVIIG+LDSGIA  HPSF+D GMPPPP++WKG CE
Sbjct  127   HTTHSPDFLGLNQNVGLWNTSNSGEGVIIGLLDSGIAPRHPSFNDNGMPPPPSKWKGKCE  186

Query  1873  LNFTACNNKVIGARSFSER-ERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVA  1697
              N TACNNK+IGAR+F+     S  D++GHGTHT+ TAAGNFV GAN+ GSANGTA+G+A
Sbjct  187   FNLTACNNKLIGARNFARSINLSPLDEEGHGTHTSSTAAGNFVEGANLLGSANGTASGIA  246

Query  1696  PLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAM  1517
             P AH+A+YKVC   GC +S+I+A +D AI DGVD+LS+SLG     F+ED+IA+GAYSA+
Sbjct  247   PRAHVAMYKVCTSEGCQESDIVAGIDAAIGDGVDVLSISLGASPVPFYEDNIAIGAYSAI  306

Query  1516  EKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPK  1337
             EKGIFVS SAGN GPFN ++SN APW+LTVGAST DRK+SA  VLGN QQ+ GE+ FQP+
Sbjct  307   EKGIFVSCSAGNSGPFNATVSNSAPWLLTVGASTTDRKISAVAVLGNGQQYEGESVFQPR  366

Query  1336  DFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFL-DRRGKGEAVKN  1160
             +F+  LL L+  G              E L   DV+GKIV+C T G +  R  KGE VK 
Sbjct  367   NFSRKLLPLIDGGS------------CELLAPIDVKGKIVLCDTSGVMYTRVQKGEQVKK  414

Query  1159  ASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITG  980
             A G  MIL+  +  G TT A  HVLPA  I+Y DGQKIL Y  +TS P+AT SFKGT  G
Sbjct  415   AGGAAMILMNIKARGYTTFADVHVLPATLISYNDGQKILNYTKSTSAPVATISFKGTRIG  474

Query  979   DKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSM  800
             DKNAPTVA FSSRGP+  S GILKPDIIGPG+NILA WPTSV  K +SKSTFNIISGTSM
Sbjct  475   DKNAPTVAFFSSRGPSLVSQGILKPDIIGPGLNILAAWPTSVGQKTSSKSTFNIISGTSM  534

Query  799   SCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHV  620
             SCPHL+GVAALLKS+HPDWSPA IKSA+MTTAD +N   NPI ++ L  A +FSIG+GHV
Sbjct  535   SCPHLAGVAALLKSAHPDWSPAAIKSAIMTTADFVNLANNPIPDETLNPADLFSIGSGHV  594

Query  619   NPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFS  440
             NPSKANDPGLVYD +PE Y+PYLCGLNYT+ +V  I++  V C++  SI EA+LNYPSF+
Sbjct  595   NPSKANDPGLVYDIQPEAYVPYLCGLNYTDDQVSAIVRRNVRCTS--SIAEAELNYPSFA  652

Query  439   IILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSL  260
             I L STAQTYTRTVTNVGEA+S YTV++F   GVK++++P  L FS +NQKL+YN+TF  
Sbjct  653   INLGSTAQTYTRTVTNVGEANSTYTVQVFGVKGVKLSIKPTTLTFSALNQKLSYNITFKR  712

Query  259   SSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             S     S      QG + W S K+ VRSPIA
Sbjct  713   SVSVDSS------QGYITWSSTKYSVRSPIA  737



>ref|XP_006358146.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=741

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/748 (58%), Positives = 546/748 (73%), Gaps = 17/748 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             +  + +F + S++I     A+     E YIV ++LP       +      DL  W+ SFL
Sbjct  8     LSVVSIFFLQSLVI----FASYEKNKEIYIVHLDLPDESQFFSNFE----DLHDWHHSFL  59

Query  2215  PTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSP  2036
             P+         SRMV+ YRNV+ GFAA L+ EEV  + +K+G IS    ++L   TTHS 
Sbjct  60    PSNTDNSS--SSRMVYSYRNVLNGFAAMLTPEEVTLLQDKEGIISVRSRQLLDAQTTHST  117

Query  2035  GFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTAC  1856
              FLGL QN+GFW  S+YGKG+IIGVLDSGI  DHPSF DEG+ PPPARWKG CE NFT C
Sbjct  118   NFLGLHQNLGFWEKSNYGKGMIIGVLDSGITPDHPSFHDEGVAPPPARWKGKCEFNFTVC  177

Query  1855  NNKVIGARSFSERERSV-FdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLA  1679
             NNK+IGAR F E       D++GHGTHT+ TAAGNFV GAN  G A+GTA+G+APLAH+A
Sbjct  178   NNKLIGARYFHEFGNGTPLDENGHGTHTSSTAAGNFVDGANFLGLASGTASGMAPLAHVA  237

Query  1678  IYKVCN-EIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIF  1502
             +YKVCN  + CS+S+ILAA+D AIEDGVD+LS S+G  S++F  + +ALG ++AM+KGI 
Sbjct  238   MYKVCNASLICSESDILAAIDAAIEDGVDVLSFSIGKNSTNFWSEVVALGGFTAMQKGIL  297

Query  1501  VSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSS  1322
             VS SAGN GP  GS+ N APW+LTVGAST DRKL AT+ LG+ ++ +GE+AFQPKDF+ +
Sbjct  298   VSCSAGNAGPIPGSVFNGAPWLLTVGASTTDRKLRATIRLGDGKEINGESAFQPKDFSET  357

Query  1321  LLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGM  1142
              L L+FPG N SD +++ +C++ESL+N DV+GK+V+C++GG + R GKG  VK+A G GM
Sbjct  358   PLPLIFPGTNISDPTAA-FCNAESLKNIDVKGKVVLCISGGKITRIGKGSFVKDAGGAGM  416

Query  1141  ILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPT  962
             IL+  E  G T  A  HVLPA  ++YADG KI AYIN+TS P ATF FKGTI GD +AP 
Sbjct  417   ILMNSEPLGFTILADPHVLPAAHVSYADGLKIKAYINSTSKPQATFLFKGTIFGDDHAPA  476

Query  961   VAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLS  782
             VA FS RGPN  SPGILKPDIIGPGVNILA WP S++N  ++KSTFN++SGTSMSCPH+S
Sbjct  477   VAGFSGRGPNLASPGILKPDIIGPGVNILAAWPKSIENNNDTKSTFNLLSGTSMSCPHVS  536

Query  781   GVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKAN  602
             G+A L+KS+HPDWSPA IKSA+MTTAD++N G+ PI+++  V    F+ GAGHVNP +A+
Sbjct  537   GIATLVKSAHPDWSPAAIKSAIMTTADLVNLGEKPIEDERGVPDDFFATGAGHVNPLRAS  596

Query  601   DPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILEST  422
             DPGL+YD +PEDY+PYLCGLNY+NR V + +  +VNCS+  +IPEA+LNYPSFSI L   
Sbjct  597   DPGLIYDIQPEDYVPYLCGLNYSNRAVSMFVLRKVNCSS--AIPEAELNYPSFSIALGLE  654

Query  421   AQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAAR  242
             AQTYTRTVTNVGEA   Y VEI  P GV V V+P  L FS++NQK TY VTFS SS +  
Sbjct  655   AQTYTRTVTNVGEAVLSYVVEIVPPQGVDVRVDPPLLNFSELNQKKTYQVTFSRSSTSTI  714

Query  241   SNMPPVVQGALRWKSVKHHVRSPIAAKL  158
             +     VQG LRW S KH VRSPI   L
Sbjct  715   NAT--FVQGYLRWTSSKHFVRSPIVVTL  740



>gb|KDP25552.1| hypothetical protein JCGZ_20708 [Jatropha curcas]
Length=758

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/725 (59%), Positives = 543/725 (75%), Gaps = 20/725 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S L+TYIV V  P   +S  +      DL  WY++FLP T++     + R+++ Y++V  
Sbjct  40    SNLDTYIVFVTKPEGGVSEIAQ-----DLHSWYQTFLPATISNT---QHRIIYSYQHVAS  91

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAAKL+AEE K M  KDGF+SA P++ILPLHTTHSP FLGL QN+G WRDS+YGKGVII
Sbjct  92    GFAAKLTAEEAKGMEQKDGFVSARPQKILPLHTTHSPNFLGLHQNLGLWRDSNYGKGVII  151

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA-CNNKVIGARSFSERER-----SV  1805
             GVLD+GI  DHPSFSDEG+P PPA+WKG CE N TA CNNK+IGAR+F   E+       
Sbjct  152   GVLDTGILPDHPSFSDEGIPSPPAKWKGKCEFNGTAACNNKLIGARTFQSFEQPSGPAGP  211

Query  1804  FdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAA  1625
             FDD GHGTHTA TAAGN V+GANV+G+ANGTA G+APLAHLAIYKVC++ GCS+S+ILAA
Sbjct  212   FDDVGHGTHTASTAAGNLVKGANVFGNANGTAVGMAPLAHLAIYKVCSDFGCSESDILAA  271

Query  1624  MDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEA  1445
             MDTA+EDGVD+LSLSLGG S+ F  D IA+GA+ AM+ G+FVS SAGN GP N SLSNEA
Sbjct  272   MDTAVEDGVDVLSLSLGGGSAPFFADGIAVGAFGAMQNGVFVSCSAGNSGPENSSLSNEA  331

Query  1444  PWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPY  1265
             PW+LTVGAST+DR + ATV LGN  +  GE+ FQP+    +   L++PG++ ++  ++  
Sbjct  332   PWILTVGASTIDRSIRATVKLGNNLEVFGESLFQPQLSTQNFWPLIYPGKDGNESLAA--  389

Query  1264  CDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVL  1085
             C    L + DV+GKIV+C   G + R  KG+ VK A G GMIL+  E  G +T A AHVL
Sbjct  390   CTPGFLEDVDVKGKIVLCDRDGVVGRIEKGQVVKEAGGVGMILVNQEFDGYSTLADAHVL  449

Query  1084  PAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKP  905
             PA  ++Y+DG KI +YIN+T+ P A   F+GT+ G K AP VA+FSSRGP+  SPGILKP
Sbjct  450   PASHVSYSDGLKIKSYINSTATPTAMLLFEGTVIGVKTAPMVASFSSRGPSLASPGILKP  509

Query  904   DIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIK  725
             DIIGPGV+ILA WP SV+NK N+K+TFN+ISGTSMSCPHLSG+AALLKS+HPDWSPA IK
Sbjct  510   DIIGPGVSILAAWPVSVENKTNTKATFNMISGTSMSCPHLSGIAALLKSAHPDWSPAAIK  569

Query  724   SAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCG  545
             SA+MTTAD++N G  PI ++ L+ A + ++GAGHV PS+A+DPGLVYD +P+DY+PYLCG
Sbjct  570   SAIMTTADLINVGGQPIVDERLLPADILALGAGHVAPSRASDPGLVYDIQPDDYIPYLCG  629

Query  544   LNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYT  365
             L Y++RE+  I+Q +V CS V SIP+ QLNYPSFS +     QTYTRT+TNVG A+S YT
Sbjct  630   LGYSDREITYIVQKKVKCSEVQSIPDTQLNYPSFSFVFGLKTQTYTRTLTNVGPANSSYT  689

Query  364   VEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHH  185
             + +F PPGV++ V P ++ FSKV Q  TY VTF+ +     S    + QG L+W S ++ 
Sbjct  690   LSVFPPPGVEIAVSPSKIVFSKVKQTATYTVTFTNTVGTTES----LAQGYLKWVSDQYS  745

Query  184   VRSPI  170
             VRSPI
Sbjct  746   VRSPI  750



>gb|EYU39027.1| hypothetical protein MIMGU_mgv1a019149mg, partial [Erythranthe 
guttata]
Length=720

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/698 (64%), Positives = 525/698 (75%), Gaps = 15/698 (2%)
 Frame = -1

Query  2338  ATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYR  2159
             +T  S LETYI+ V++     +         DLE WY SFLPT+++   +G  R+V+ YR
Sbjct  2     STNTSTLETYIIHVDVNFGFFARFK------DLESWYTSFLPTSIS---HGRRRIVYSYR  52

Query  2158  NVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGK  1979
             NV KGFAA+LSA+E K M N  GFISA PER L  HTTHSP FLGL QNMGFW  S+YGK
Sbjct  53    NVFKGFAARLSADEAKAMENNPGFISAEPERKLDKHTTHSPNFLGLNQNMGFWEGSNYGK  112

Query  1978  GVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVFd  1799
             GVIIGVLD GI   HPSFSDEGMPPPPA+WKG C+ N TACNNK+IGAR F   + S  D
Sbjct  113   GVIIGVLDYGIFPSHPSFSDEGMPPPPAKWKGKCQFNQTACNNKIIGARYFDSFDNSPLD  172

Query  1798  ddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMD  1619
             +DGHGTHTA TAAG+FV GANV+G+ANGTA+G+AP+AHLAIYKVC+ + C +S+ILA MD
Sbjct  173   EDGHGTHTASTAAGSFVAGANVFGNANGTASGIAPMAHLAIYKVCS-LFCFESDILAGMD  231

Query  1618  TAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPW  1439
              AI+DGVDILS+SLGG S  F+ DSIALGA+SAMEKGI VS SAGN GPFN S  NEAPW
Sbjct  232   AAIDDGVDILSISLGGRSRDFYRDSIALGAFSAMEKGILVSCSAGNRGPFNFSTQNEAPW  291

Query  1438  MLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCD  1259
             +LTVGAST+DRK+ AT +LGN     GET FQP DF S+LL LV+ G   + ++   YC 
Sbjct  292   ILTVGASTIDRKIRATALLGNNVSVDGETLFQPSDFPSTLLPLVYVGSLNTSDTDIQYCT  351

Query  1258  SESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPA  1079
              ESL   ++RG IVVC +G  +    KGEAVK A G  MIL+    Y   T + AHVLPA
Sbjct  352   PESLTKINLRGMIVVCESG-LVTEVSKGEAVKTAGGAAMILVNHRLYANMTFSDAHVLPA  410

Query  1078  IDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDI  899
              D+ YADG KI  YIN+T+ PMAT  FKGTI GD+ AP VAAFSSRGPN  SPGILKPDI
Sbjct  411   TDVGYADGLKIKTYINSTTTPMATILFKGTIIGDERAPVVAAFSSRGPNSASPGILKPDI  470

Query  898   IGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSA  719
             IGPGVNILA WP S++N  N+ +TFNIISGTSMSCPHLSGVAALLKS HPDWSPA IKSA
Sbjct  471   IGPGVNILAAWPISIENNTNTNATFNIISGTSMSCPHLSGVAALLKSVHPDWSPAAIKSA  530

Query  718   MMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLN  539
             +MTTAD++N  QNPI+++  V A++F+ G+GHVNPS+A+DPGL+YD K EDY+PYLCGLN
Sbjct  531   IMTTADVVNLAQNPIEDERFVPATIFATGSGHVNPSRASDPGLIYDLKSEDYVPYLCGLN  590

Query  538   YTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILES---TAQTYTRTVTNVGEASSFY  368
             YTNR+VG ILQ RVNCS    I EAQLNYPSFSI  +S    +QTYTR+VTNVG   S Y
Sbjct  591   YTNRQVGSILQRRVNCSVESIIAEAQLNYPSFSISYDSWQPISQTYTRSVTNVGVPVSSY  650

Query  367   TVEIFEPPGVKVNVEPRELQFSKVNQKLTY-NVTFSLS  257
              VEI  PPG+ V VEP  L F++VNQ L Y ++ FSLS
Sbjct  651   VVEIVPPPGIGVLVEPTTLDFTEVNQILQYQSLVFSLS  688



>ref|XP_009760563.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=727

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/752 (59%), Positives = 551/752 (73%), Gaps = 35/752 (5%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTA---TIASKLETYIVRVELPHsristqsssssSVDLEHWYK  2225
             M FL  ++I+S  +   S +   +  S  E YIV VE P                E+ ++
Sbjct  4     MVFLTFYVIVSSQLSIISASDHLSQQSNSEIYIVHVESP----------------ENLHE  47

Query  2224  SFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTT  2045
               L + V+      SR+++ YRNV  GFAA+LS EEVK +  KDGFIS  P+R+L + TT
Sbjct  48    YSLLSVVS------SRIIYSYRNVFSGFAARLSPEEVKLLETKDGFISIRPQRVLRVQTT  101

Query  2044  HSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNF  1865
             H+P FLGL QN+GFW  S+YG+GVIIG+LD+GI  +HPSF DEGMPPPPA+WKG CE NF
Sbjct  102   HTPSFLGLHQNLGFWNTSNYGEGVIIGLLDTGIYPEHPSFDDEGMPPPPAKWKGKCEFNF  161

Query  1864  TACNNKVIGARSFSERERSV-FdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLA  1688
             TACNNK+IGAR FS  E     D++GHGTHT+ TAAGNFV GANV+GSANGTA G+AP A
Sbjct  162   TACNNKIIGARDFSVFEGGTPLDENGHGTHTSSTAAGNFVDGANVFGSANGTAVGIAPRA  221

Query  1687  HLAIYKVCNEIG-CSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEK  1511
             HLA+YKVCN  G CS+S++LAAMD AI+DGVD++S+S+GG+S  F +D+IALGA+S+M K
Sbjct  222   HLAMYKVCNPSGLCSESDMLAAMDAAIDDGVDVISISIGGISGPFWDDNIALGAFSSMAK  281

Query  1510  GIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDF  1331
             GI VS SAGNEGP+NG+LSNEAPW+LTVGAST+DR++ ATV LGN  +F GE+ +QP DF
Sbjct  282   GILVSCSAGNEGPYNGTLSNEAPWILTVGASTIDRQMKATVALGNGVEFDGESTYQPNDF  341

Query  1330  NSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASG  1151
               +L+ +V+P  N+S   +   C  ESL N  V GK+V+C TGG      KG+ VK+A  
Sbjct  342   PPTLVPIVYPALNSSYFGAFA-CSPESLTN--VEGKLVLCGTGG-ATAIAKGKPVKDAGA  397

Query  1150  RGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGT-ITGDK  974
              GMIL+  +  G T  A  +VLPA  I+YAD Q ++AYIN+TS PMA+  FKGT I GDK
Sbjct  398   AGMILMNEDIEGYTIPAHDYVLPATRISYADAQNLIAYINSTSTPMASILFKGTVINGDK  457

Query  973   NAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSC  794
             +APTVA FSSRGPNR SPGILKPDIIGPG NILA WPTS++N  ++  TFNIISGTSM+C
Sbjct  458   HAPTVAFFSSRGPNRASPGILKPDIIGPGFNILAAWPTSIENNTHTNLTFNIISGTSMAC  517

Query  793   PHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNP  614
             PHL+G+AALLKS+HPDWSPA IKSA+MTTAD++N G NPI+++  + A+VF IGAGHVNP
Sbjct  518   PHLAGIAALLKSAHPDWSPAAIKSAIMTTADLVNLGNNPIEDELHLPANVFEIGAGHVNP  577

Query  613   SKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSII  434
             SKANDPGL+YD +P+DY+PYLCGLNYT ++V  I Q++VNC+   SIPEA+LNYPSFSI 
Sbjct  578   SKANDPGLIYDIQPQDYVPYLCGLNYTEQQVSAIFQNKVNCTK--SIPEAELNYPSFSIK  635

Query  433   LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSS  254
             L S  Q YTR VTNVGEA S Y VEI  P GV+V V P  L FS   +++TY VTF+ S+
Sbjct  636   LGSETQEYTRAVTNVGEADSTYNVEILPPEGVEVTVSPSSLNFSAAKERMTYQVTFTRSA  695

Query  253   KAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
                  N    VQG L+W S KH VRSPIA  L
Sbjct  696   SGTGRNT-NFVQGYLKWSSDKHVVRSPIAVIL  726



>gb|EYU39037.1| hypothetical protein MIMGU_mgv1a021904mg [Erythranthe guttata]
Length=724

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/733 (60%), Positives = 532/733 (73%), Gaps = 12/733 (2%)
 Frame = -1

Query  2350  FCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMV  2171
             F S    A  LET+IV + LP  R+          + + WY SFLPTT    G   SR+V
Sbjct  3     FSSALVRADNLETFIVHLSLPEGRVFVDPD-----EQKSWYGSFLPTTATAAGDVSSRLV  57

Query  2170  FMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDS  1991
               YRNV  GFAAKLS EEVKEM  KDGFI A P++ L LHTTH+P FLGL QN+G WR S
Sbjct  58    HSYRNVATGFAAKLSPEEVKEMEKKDGFIFARPQKKLALHTTHTPNFLGLHQNLGVWRGS  117

Query  1990  SYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-SERE  1814
              YG+GVI+G+LD+GIA  HPSF DEGMPPPPA+WKG CE N T+CNNK+IGAR+F     
Sbjct  118   HYGEGVIVGLLDTGIAPGHPSFDDEGMPPPPAKWKGKCEFNGTSCNNKLIGARNFVGGST  177

Query  1813  RSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEI  1634
                 DD+GHGTHTA TAAGNFV  ANV+G ANGTA G+AP AH+A+YKVC+E GCSD++I
Sbjct  178   GPPVDDEGHGTHTASTAAGNFVPSANVFGMANGTAVGMAPRAHIAMYKVCSEDGCSDADI  237

Query  1633  LAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLS  1454
             LAAMD A+EDGVD+LSLSLGG S  F  D IA+GA++A++KGIFVS SAGN GPFN SLS
Sbjct  238   LAAMDAAVEDGVDVLSLSLGGGSVDFFNDGIAIGAFAAIQKGIFVSCSAGNSGPFNASLS  297

Query  1453  NEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESS  1274
             NEAPW+LTVGAST+DRK+ A  VLGN+  + GE+ FQP DF    + L+  G       +
Sbjct  298   NEAPWILTVGASTIDRKIVAAAVLGNKDFYTGESLFQPSDFPYEYMPLIDAG--AGGNVT  355

Query  1273  SPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATA  1094
             +  C   SL N DV+GKIV+C  GG + R  KG+ VK+A G  MIL   E     T A +
Sbjct  356   AGLCGPGSLDNIDVKGKIVLCQRGGGIARIAKGQTVKDAGGAAMILTNDEPNAYDTIADS  415

Query  1093  HVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGI  914
             HVLPA  ++Y  G KI AYIN+TS P A   F+GT+ G  +APTVA+FSSRGP+  SPGI
Sbjct  416   HVLPATHVSYDAGVKIRAYINSTSTPWAAIYFEGTVIGSPSAPTVASFSSRGPSLASPGI  475

Query  913   LKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPA  734
             LKPDIIGPGV+ILA WP SV+NK N K+TFN+ISGTSMSCPHL G+AALLKS+HPDWSPA
Sbjct  476   LKPDIIGPGVSILAAWPVSVENKTNDKATFNMISGTSMSCPHLGGIAALLKSAHPDWSPA  535

Query  733   MIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPY  554
              IKSA+MTTA  L+    PI+++  + A +F++GAGHVNPS ANDPGLVYD +PEDY+PY
Sbjct  536   AIKSAIMTTAGQLDLEGGPIEDERHLPADIFALGAGHVNPSSANDPGLVYDLQPEDYIPY  595

Query  553   LCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASS  374
             LCGL YT++E+ VI+   V+CS   SIPEAQLNYPSFS+ L    +TYTRTVTNVGEA+S
Sbjct  596   LCGLGYTDQEIQVIVGQHVSCSNTTSIPEAQLNYPSFSVELGPATKTYTRTVTNVGEANS  655

Query  373   FYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSV  194
              Y VEI +  GV V V P  L F++VNQK+TY ++FS S+     +     QGA+ W+S 
Sbjct  656   TYAVEI-KTQGVHVEVTPTTLSFTEVNQKMTYQISFSKSTTPVNGSY---AQGAIVWRSA  711

Query  193   KHHVRSPIAAKLV  155
             KH VRSPI+AKLV
Sbjct  712   KHAVRSPISAKLV  724



>ref|XP_007208895.1| hypothetical protein PRUPE_ppa026788mg [Prunus persica]
 gb|EMJ10094.1| hypothetical protein PRUPE_ppa026788mg [Prunus persica]
Length=770

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/741 (59%), Positives = 546/741 (74%), Gaps = 16/741 (2%)
 Frame = -1

Query  2365  SVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGG-Y  2189
             +VL     T    + ++TYIV V+ P   +     S S  DLE WY +FLPTT+A     
Sbjct  32    AVLEPLAETNEEQNNMQTYIVWVKKP---VQKYFFSKSHEDLESWYHTFLPTTIASSNQL  88

Query  2188  GESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNM  2009
              + RMV  YRNV  GFAAKL+ EEVK M NK+GF+SA PE+ILPLHTTHSP FLGL Q +
Sbjct  89    KKPRMVHAYRNVATGFAAKLTPEEVKAMENKEGFLSAHPEQILPLHTTHSPNFLGLHQGL  148

Query  2008  GFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARS  1829
             G W+ S+YG+GVIIGVLD+GI+ DHPSFSDEG+ PPPA+WKG C+ N T CNNK+IGAR+
Sbjct  149   GVWKGSNYGEGVIIGVLDTGISPDHPSFSDEGVAPPPAKWKGKCDFNGTVCNNKLIGARN  208

Query  1828  FSERERS---VFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNE  1658
             F   + +     DD+GHGTHT+ TAAGNFV+GANV+G ANGTA+G+AP AHLAIYKVC+E
Sbjct  209   FQGGQTTGGPPVDDEGHGTHTSSTAAGNFVKGANVFGMANGTASGMAPYAHLAIYKVCSE  268

Query  1657  IGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNE  1478
              GC++ +ILAA+DTA+EDGVD+LSLSLGG S  F+ D IA+GA+ A++KGIFVS SAGN 
Sbjct  269   EGCAEGDILAALDTAVEDGVDVLSLSLGGASVPFYADGIAIGAFGAIQKGIFVSCSAGNS  328

Query  1477  GPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPG  1298
             GPF  SL+NEAPW+LTVGAST+DR + AT +LGN  ++ GE+ FQPKDF+S LL LV+ G
Sbjct  329   GPFYASLANEAPWILTVGASTIDRSIKATALLGNGAEYDGESLFQPKDFSSKLLPLVYAG  388

Query  1297  QNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEY  1118
              N   + SS +CD+ SL N  V G IV+C  GG + R  KG  VK A G  MIL+  E  
Sbjct  389   AN--GKQSSAFCDAGSLGN--VEGAIVLCERGGGVARIDKGAEVKRAGGAAMILVNAETD  444

Query  1117  GITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRG  938
             G +T A  HVLPA  + Y  G KI AY+N+TS+P AT  FKGT+ GD  AP + +FSSRG
Sbjct  445   GDSTLADPHVLPATHVGYVAGVKIKAYLNSTSSPAATILFKGTVIGDGLAPKITSFSSRG  504

Query  937   PNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKS  758
             P+  S GILKPDIIGPGV+ILA WP SVDN    K+TFN++SGTSMSCPHLSG+AALLKS
Sbjct  505   PSIASTGILKPDIIGPGVSILAAWPVSVDNGTEGKATFNMVSGTSMSCPHLSGIAALLKS  564

Query  757   SHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDT  578
             SHPDWSPA IKSA+MTTA++ N    PI ++ L  A +F+ GAGHVNPSKANDPGL+YDT
Sbjct  565   SHPDWSPAAIKSAIMTTAEVHNLEGKPIVDETLKPADIFATGAGHVNPSKANDPGLIYDT  624

Query  577   KPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL----ESTAQTY  410
             KPEDY+PYLCGLNYT+ ++ VI Q RVNCS V +IPEAQLNYPSFSII+    +S +Q Y
Sbjct  625   KPEDYIPYLCGLNYTDEQIQVITQQRVNCSQVEAIPEAQLNYPSFSIIVGSSEDSKSQYY  684

Query  409   TRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMP  230
             TRTV NVG A+S Y +++F P  + ++V P  L+F++VNQ++T+   F     A +  + 
Sbjct  685   TRTVKNVGPANSTYNLDLFVPRNMGMSVNPEVLKFTEVNQEITFEAEFFAEDSAGKDGV-  743

Query  229   PVVQGALRWKSVKHHVRSPIA  167
             P  QG LRW S +H V SPI+
Sbjct  744   PFAQGYLRWVSDQHSVTSPIS  764



>ref|XP_002303550.2| hypothetical protein POPTR_0003s11860g [Populus trichocarpa]
 gb|EEE78529.2| hypothetical protein POPTR_0003s11860g [Populus trichocarpa]
Length=755

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/721 (60%), Positives = 541/721 (75%), Gaps = 18/721 (2%)
 Frame = -1

Query  2323  KLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKG  2144
             K ETYIV V+ P   +S         DL+ WYKSFLP T+    + E RMV+ YR+V  G
Sbjct  46    KFETYIVFVQKPEEGVSAD-------DLDSWYKSFLPVTIPSSNHQE-RMVYSYRHVATG  97

Query  2143  FAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIG  1964
             FAAKL+AEE K M +KDGF+SA P++IL LHTTHSP FLGLQ N+GFWR+S+YGKGVIIG
Sbjct  98    FAAKLTAEEAKAMEDKDGFLSAKPQKILSLHTTHSPNFLGLQTNLGFWRNSTYGKGVIIG  157

Query  1963  VLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-SERERSVFdddgh  1787
             VLD+GI+ DHPSFSDEG+PPPP +WKG C  N T CNNK+IGAR F S +    FD++GH
Sbjct  158   VLDTGISPDHPSFSDEGVPPPPTKWKGKCNFNGTVCNNKLIGARDFTSSKAAPPFDEEGH  217

Query  1786  gthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIE  1607
             GTHTA TAAGNFV  A+V+G+ANGTA G+APLAHLAIYKVC++ GC+DS+ILAAMD A+E
Sbjct  218   GTHTASTAAGNFVNDASVFGNANGTAVGMAPLAHLAIYKVCSDFGCADSDILAAMDAAVE  277

Query  1606  DGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTV  1427
             DGVD+LSLSLGG S+ F EDSIA+GA+ A +KGIFVS SAGNEGP+NGSLSNEAPW+LTV
Sbjct  278   DGVDVLSLSLGGGSAPFFEDSIAVGAFGATQKGIFVSCSAGNEGPYNGSLSNEAPWILTV  337

Query  1426  GASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESL  1247
             GAST+DR + A V+LGN   F GE+ FQ    +   +SLV+ G + S   S+ +C  ESL
Sbjct  338   GASTIDRSIRADVLLGNSNHFFGESLFQSN--SPPYMSLVYAGAHGSQ--SAAFCAPESL  393

Query  1246  RNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDIT  1067
              + DV+GKIV+C  GG + R  KG+AVK+A G  MIL+  ++ G +T A AHVLPA  ++
Sbjct  394   TDIDVKGKIVLCERGGGIARIDKGQAVKDAGGAAMILMNDKDSGYSTLADAHVLPASHVS  453

Query  1066  YADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPG  887
             Y+ G  I AYIN+T  P AT  F GT  GDK APTVA+FSSRGP+  SPGILKPDIIGPG
Sbjct  454   YSAGLSIKAYINSTQVPTATIMFLGTKIGDKTAPTVASFSSRGPSLASPGILKPDIIGPG  513

Query  886   VNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTT  707
             V+ILA WP SV+NK ++KSTFNIISGTSMSCPHLSG+AALLKS+HPDWSPA IKSA+MTT
Sbjct  514   VSILAAWPVSVENKTDTKSTFNIISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIMTT  573

Query  706   ADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNR  527
             AD++N G  PI ++ L+ A + + GAG VNPSKA+DPGLVYD +P+DY+PYLCGL Y ++
Sbjct  574   ADLVNLGNQPILDERLLPADILATGAGQVNPSKASDPGLVYDIQPDDYIPYLCGLGYPDK  633

Query  526   EVGVILQHRVNCSAVISIPEAQLNYPSFSIIL--ESTAQTYTRTVTNVGEASSFYTVEIF  353
             ++  I+Q +VNCS   SI EAQLNYPSFSI+       QTYTRTVTNVG  +S YT  + 
Sbjct  634   DISYIVQRQVNCSEESSILEAQLNYPSFSIVYGPNPATQTYTRTVTNVGPPNSSYTAFVD  693

Query  352   EPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSP  173
              PPGV V V P+ + F+   Q  TY+VTF+ +S+   SN  P+ QG +   ++   + +P
Sbjct  694   PPPGVNVTVTPKNIIFTNTEQTATYSVTFTATSE---SNNDPIGQGYISPNNLCTRLGTP  750

Query  172   I  170
             I
Sbjct  751   I  751



>gb|EYU29563.1| hypothetical protein MIMGU_mgv1a022413mg [Erythranthe guttata]
Length=737

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/752 (59%), Positives = 542/752 (72%), Gaps = 28/752 (4%)
 Frame = -1

Query  2395  MKFLRMFLILSVL--IGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             M F     I+ +L  I F      A  L+ YIV V+   S            +LE  Y S
Sbjct  1     MGFTSFLCIICILNFIQFLK----AENLDVYIVHVDPAQSD-----------NLETSYDS  45

Query  2221  FLPTTV---AGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLH  2051
             F+PTT    A     + R++  YRNV  GFAAKLS  +V+ M   +GF+SA PE++ PLH
Sbjct  46    FMPTTTNLAANSNNNQPRILHRYRNVFSGFAAKLSIADVEAMRQMEGFVSARPEKVFPLH  105

Query  2050  TTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCEL  1871
             TTH+P FLGL QN GFW+DS+YGKGVI+G+LDSGI+ DHPSFSDEGMPPPP +W+G C+ 
Sbjct  106   TTHTPNFLGLIQNSGFWKDSNYGKGVIVGLLDSGISPDHPSFSDEGMPPPPPKWRGECQF  165

Query  1870  -NFTACNNKVIGARSFSERERSV-FdddghgthtagtaaGNFVRGANVYGSANGTAAGVA  1697
              +  ACNNK+IGA+ F+    +  FD++GHGTHTA TAAG+FV GAN+YG+A GTAAG+A
Sbjct  166   GSKNACNNKLIGAKYFTNGNATTPFDEEGHGTHTAATAAGSFVGGANIYGNAAGTAAGMA  225

Query  1696  PLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVD-IlslslggmssSFHEDSIALGAYSA  1520
             PLAH+A+Y+VC+  GCS+S+I+A MD AIEDGVD I     GG  ++F +D+IA+GA+ A
Sbjct  226   PLAHVAMYRVCSPSGCSESDIMAGMDAAIEDGVDVISISLGGGTPTAFDKDNIAIGAFRA  285

Query  1519  MEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQP  1340
             MEKGI VS SAGN GP   SLSNEAPW+LTVGAST+DRK+ AT VLGN +++ GETAFQP
Sbjct  286   MEKGILVSCSAGNNGPALVSLSNEAPWILTVGASTIDRKIKATAVLGNNEEYDGETAFQP  345

Query  1339  KDFNSSL-LSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVK  1163
              DF S+  L LVFPGQ ++    S YC   +L    VRGKIV+C  GG   R  KG+AVK
Sbjct  346   NDFPSATKLGLVFPGQISN---MSLYCGEGALDENVVRGKIVLCEIGGTGTRVDKGKAVK  402

Query  1162  NASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTIT  983
             NA G  MIL+  E  G TT A AHVLPAI + Y D  KI AY+++  NP+AT  FKGT+ 
Sbjct  403   NAGGAAMILMNQEAQGDTTRAEAHVLPAIHVNYGDALKIKAYVSSNPNPIATIVFKGTVI  462

Query  982   GDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTS  803
             GD  AP VAAFSSRGP+  SPGILKPDIIGPGVNILA WP SV+NK ++KSTFN++SGTS
Sbjct  463   GDDRAPVVAAFSSRGPSLLSPGILKPDIIGPGVNILAAWPVSVENKTDTKSTFNMVSGTS  522

Query  802   MSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGH  623
             MSCPHLSGVAALLKS+HPDWSPA+IKSA+MTTAD +N G NPI+ + L  A VF+IGAGH
Sbjct  523   MSCPHLSGVAALLKSAHPDWSPAVIKSAIMTTADQVNLGGNPIETEALKPADVFAIGAGH  582

Query  622   VNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSF  443
             VNPS+ANDPGLVYD +P +Y+ YLCG+N+T  +VGVI Q +V+CS    I E+QLNYPSF
Sbjct  583   VNPSRANDPGLVYDIQPHEYVSYLCGMNFTESQVGVIAQRKVDCSKESRIAESQLNYPSF  642

Query  442   SIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFS  263
             SI+L ST QTYTRTVTNVGE  S Y VEI  P GV V VEP +L F+K+ Q L+Y VTF+
Sbjct  643   SIVLGSTPQTYTRTVTNVGECESSYNVEIGSPEGVTVVVEPVKLDFTKLGQALSYKVTFT  702

Query  262   LSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
              S     +     VQG + W S K+ VRSPIA
Sbjct  703   RSDGGTLTT-DDYVQGFVTWHSGKYSVRSPIA  733



>ref|XP_008238738.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=770

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/741 (59%), Positives = 543/741 (73%), Gaps = 16/741 (2%)
 Frame = -1

Query  2365  SVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGG-Y  2189
             +VL     T    + ++TYIV V+ P   +     S S  DLE WY +FLPTT+A     
Sbjct  32    AVLEPLAETHEEQNNMQTYIVWVKKP---VQKYFFSKSHEDLESWYHTFLPTTIASSNQL  88

Query  2188  GESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNM  2009
              + RMV  YRNV  GFAAKL  EEVK M  K+GF+SA PE+ILPLHTTHSP FLGL Q +
Sbjct  89    KKPRMVHAYRNVATGFAAKLMPEEVKAMEKKEGFLSAHPEQILPLHTTHSPNFLGLHQGL  148

Query  2008  GFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARS  1829
             G W+ S+YG+GVIIGVLD+GI+ DHPSFSDEG+ PPPA+WKG C  N T CNNK+IGAR+
Sbjct  149   GVWKGSNYGEGVIIGVLDTGISPDHPSFSDEGVAPPPAKWKGKCNFNGTVCNNKLIGARN  208

Query  1828  FSERERS---VFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNE  1658
             F   + +     D++GHGTHT+ TAAGNFV+GANV+G ANGTA+G+AP AHLAIYKVC+E
Sbjct  209   FQGGQTTGGPPVDNEGHGTHTSSTAAGNFVKGANVFGMANGTASGMAPYAHLAIYKVCSE  268

Query  1657  IGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNE  1478
              GC++ +ILAA+DTA+EDGVD+LSLSLGG S  F+ D IA+GA+ A++KGIFVS SAGN 
Sbjct  269   AGCAEGDILAALDTAVEDGVDVLSLSLGGASVPFYADGIAIGAFGAIQKGIFVSCSAGNS  328

Query  1477  GPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPG  1298
             GPF  SL+NEAPW+LTVGAST+DR + AT +LGN  ++ GE+ FQPKDF+S  L LV+ G
Sbjct  329   GPFYASLANEAPWILTVGASTIDRSIKATALLGNGAEYDGESLFQPKDFSSKFLPLVYAG  388

Query  1297  QNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEY  1118
              N   + SS +CD+ SL N  V G IV+C  GG + R  KG  VK A G  MIL+  E  
Sbjct  389   AN--GKQSSAFCDAGSLGN--VEGAIVLCERGGGVARIDKGAEVKRAGGAAMILVNAETD  444

Query  1117  GITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRG  938
             G +T A  HVLPA  + Y  G KI AY+N+TSNP AT  FKGT+ GD  AP + +FSSRG
Sbjct  445   GDSTLADPHVLPATHVGYVAGVKIKAYLNSTSNPAATILFKGTVIGDGLAPKITSFSSRG  504

Query  937   PNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKS  758
             P+  S GILKPDIIGPGV+ILA WP SVDN    K+TFN++SGTSMSCPHLSG+AALLKS
Sbjct  505   PSIASTGILKPDIIGPGVSILAAWPVSVDNGTEGKATFNMVSGTSMSCPHLSGIAALLKS  564

Query  757   SHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDT  578
             SHPDWSPA IKSA+MTTA++ N    PI ++ L  A +F+ GAGHVNPSKANDPGL+YDT
Sbjct  565   SHPDWSPAAIKSAIMTTAEVHNLEGKPIVDETLKPADIFATGAGHVNPSKANDPGLIYDT  624

Query  577   KPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL----ESTAQTY  410
             KPEDY+PYLCGLNYT+ ++ VI Q RVNCS V +IPEAQLNYPSFSII+    +S +Q Y
Sbjct  625   KPEDYIPYLCGLNYTDEQIQVITQQRVNCSQVEAIPEAQLNYPSFSIIVGSSEDSRSQYY  684

Query  409   TRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMP  230
             TRTV NVG A+S Y +++F P  + ++V P+ L+F++VNQ++T+   F     A +  + 
Sbjct  685   TRTVKNVGPANSTYNLDLFVPQNMGMSVNPQVLKFTEVNQEITFEAEFFAQDSAGKDGV-  743

Query  229   PVVQGALRWKSVKHHVRSPIA  167
             P  QG LRW S +H V SPI+
Sbjct  744   PFAQGYLRWVSDQHSVTSPIS  764



>ref|XP_009604592.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=742

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/748 (59%), Positives = 543/748 (73%), Gaps = 34/748 (5%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIA------SKLETYIVRVELPHsristqsssssSVDLEHWYK  2225
             LR    L  ++   S+ATIA      + LETYIV +E P     + S+     DL  W++
Sbjct  16    LRFVFTLVCILILHSSATIAGHFTNQNDLETYIVHLEFPDDIFFSDSN-----DLYLWHQ  70

Query  2224  SFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTT  2045
             SFLPTT     +  SR+++ YR+V  GFAA LS+EEVK M  K GF+SA P+R+L +HTT
Sbjct  71    SFLPTTSTNSDH-SSRIIYSYRHVFNGFAALLSSEEVKMMEKKPGFVSARPQRVLQMHTT  129

Query  2044  HSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNF  1865
             HSP FLGL QN+G W  S+ GKGV+IG+LDSGIA  HPSF+D GMP PPA+WKG CE N 
Sbjct  130   HSPDFLGLHQNVGLWNASNSGKGVVIGLLDSGIAPRHPSFNDNGMPSPPAKWKGKCEFNL  189

Query  1864  TACNNKVIGARSFSER-ERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLA  1688
               CNNK+IGAR+F+     S FD++GHGTHT+ TAAGNFV GAN+ G+ANGTA+G+AP A
Sbjct  190   IICNNKLIGARNFARSINLSPFDEEGHGTHTSSTAAGNFVEGANLLGNANGTASGIAPRA  249

Query  1687  HLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKG  1508
             H+A+YKVC   GC +S+I+A +D AI DGVD+LS+SLG      +ED+IA+GAYSA+EKG
Sbjct  250   HVAMYKVCTSDGCQESDIVAGIDAAIGDGVDVLSISLGTAPVPLYEDNIAIGAYSAIEKG  309

Query  1507  IFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFN  1328
             IFVS SAGN GPFN ++SN APW+LTVGAST DRK+SA  VLGN QQ+ GE+ FQP++F+
Sbjct  310   IFVSCSAGNSGPFNATVSNAAPWLLTVGASTTDRKISAVAVLGNGQQYEGESVFQPRNFS  369

Query  1327  SSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFL-DRRGKGEAVKNASG  1151
               LL L+  G              E     DV+GKIV+C T G +  R  KGE VK A G
Sbjct  370   RKLLPLIDGGS------------CELFAPIDVKGKIVLCDTSGLMYSRVQKGEQVKKAGG  417

Query  1150  RGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKN  971
               MIL+  +  G TT A  HVLPA  I+Y DGQ+IL Y  +TS P+AT SFKGT  GDK+
Sbjct  418   AAMILMNIKARGDTTFADVHVLPATLISYNDGQQILNYTKSTSAPVATISFKGTRIGDKH  477

Query  970   APTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCP  791
             APTVA FSSRGP+  S GILKPDIIGPG+NILA WPTSV  K +SKSTFNIISGTSMSCP
Sbjct  478   APTVAFFSSRGPSMVSQGILKPDIIGPGLNILAAWPTSVGEKTSSKSTFNIISGTSMSCP  537

Query  790   HLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPS  611
             HL+GVAALLKS+HPDWSPA IKSA+MTTAD ++   NPI ++ L  A +FSIG+GHVNPS
Sbjct  538   HLAGVAALLKSAHPDWSPAAIKSAIMTTADFVSLANNPIPDETLNPADLFSIGSGHVNPS  597

Query  610   KANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL  431
             KANDPGLVYD +PEDY+PYLCGLNYTN +V  I++  V+C++  SI EA+LNYPSF+I L
Sbjct  598   KANDPGLVYDIQPEDYVPYLCGLNYTNDQVSAIVRRNVHCTS--SIAEAELNYPSFAINL  655

Query  430   ESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSK  251
              ST QTYTRTVTNVGEA+S YTVE+F   GVK++++P  L+FS +NQKL+Y VTF  S  
Sbjct  656   GSTVQTYTRTVTNVGEANSTYTVEVFGVKGVKLSIKPTTLKFSALNQKLSYKVTFKRSVS  715

Query  250   AARSNMPPVVQGALRWKSVKHHVRSPIA  167
             A  S      QG + W S K+ VRSP+A
Sbjct  716   ADSS------QGYITWSSTKYSVRSPVA  737



>ref|XP_006440471.1| hypothetical protein CICLE_v10024346mg [Citrus clementina]
 gb|ESR53711.1| hypothetical protein CICLE_v10024346mg [Citrus clementina]
Length=742

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/745 (58%), Positives = 539/745 (72%), Gaps = 13/745 (2%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTT  2207
             L   L  S      S  +    LETYIV V  P    +T S     +DL+ WY SFLP +
Sbjct  8     LIFSLTFSPAFALTSNGSDTDSLETYIVYVRKPDQDQATTSIK---LDLDSWYHSFLPVS  64

Query  2206  VAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFL  2027
             ++     + RM++ Y+NV+ GFAAKL+AE+ K M  K+GFISA  E+ L LHTTH+P FL
Sbjct  65    ISSSINNQPRMLYCYKNVITGFAAKLTAEQAKAMETKEGFISAHVEKTLQLHTTHTPNFL  124

Query  2026  GLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNK  1847
             GL QN GFW+DS+ GKGVIIGV+D+GI   HPSFSDEGMPPPPA+WKG CE    ACNNK
Sbjct  125   GLHQNSGFWKDSNLGKGVIIGVMDTGITPGHPSFSDEGMPPPPAKWKGKCEFKGAACNNK  184

Query  1846  VIGARSFSERERSV--FdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIY  1673
             +IGAR+F +        DD+GHGTHTA TAAGNFV GANV+G ANGTA G+APLAHLAIY
Sbjct  185   LIGARNFLQGSTGEPPLDDEGHGTHTATTAAGNFVNGANVFGQANGTAVGIAPLAHLAIY  244

Query  1672  KVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSA  1493
             KVC+  GCS+S + AAMDTAI+DGVD+LSLSLG  S  F ED +A+G++SA++K IFVS 
Sbjct  245   KVCDFDGCSESRVYAAMDTAIDDGVDVLSLSLGAASVPFFEDPLAIGSFSAIQKEIFVSC  304

Query  1492  SAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLS  1313
             SAGNEGP   + SNEAPW+L+VGAST DR + A+V LGN+  + GE  FQPKDF S    
Sbjct  305   SAGNEGPNPSTSSNEAPWILSVGASTTDRSIVASVELGNQAVYDGEALFQPKDFPSKQFP  364

Query  1312  LVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILI  1133
             L++PG N     SS  C   SL ++++RGK+V+C  GG  +R  KG+ VK+A G GMIL+
Sbjct  365   LIYPGAN--GNVSSAQCSPGSL-SSNIRGKLVLCERGGG-ERTKKGQVVKDAGGIGMILM  420

Query  1132  EPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAA  953
               +  G +T A  H+LPA+ ++YA G+ I AYIN+TS+P AT  FKGT+ G K+ P VA+
Sbjct  421   NDKLNGYSTLADPHLLPAVHVSYAAGESIKAYINSTSSPNATIVFKGTVIGKKSTPEVAS  480

Query  952   FSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVA  773
             FSSRGP+  SPGILKPDIIGPGV+ILA WP SV+NK N+KSTFN++SGTSMSCPHLSGVA
Sbjct  481   FSSRGPSIASPGILKPDIIGPGVSILAAWPFSVENKTNTKSTFNMVSGTSMSCPHLSGVA  540

Query  772   ALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPG  593
             ALLKS+HPDWSPA IKSA+MTTADI++    PI +Q L+ A +F++GAGHVNPS ANDPG
Sbjct  541   ALLKSAHPDWSPAAIKSAIMTTADIVSLDGKPIVDQRLLPADMFAVGAGHVNPSSANDPG  600

Query  592   LVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQT  413
             L+YD +P+DY+PYLCGLNY+++ V  I+   V CS V  I E +LNYPSFS+IL ST+QT
Sbjct  601   LIYDIQPDDYIPYLCGLNYSDQHVQDIVMINVQCSKVSGIAETELNYPSFSVILGSTSQT  660

Query  412   YTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNM  233
             Y RTVTNVG+A S YT +I  P GV V VEP  + F+K NQK  Y++TF+ S K +    
Sbjct  661   YNRTVTNVGQAESSYTHKIVAPEGVTVTVEPENISFTKKNQKAIYSITFTRSQKTSAL--  718

Query  232   PPVVQGALRWKSVKHHVRSPIAAKL  158
                 QG L W S KH VRSPIA + 
Sbjct  719   --FAQGYLSWVSTKHTVRSPIAVRF  741



>emb|CAA76726.1| P69C protein [Solanum lycopersicum]
Length=666

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/670 (65%), Positives = 522/670 (78%), Gaps = 12/670 (2%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCS--TATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLP  2213
             +  F IL V I FCS    TI S LETYIV VE P S I+TQSS     DL+ +Y SFLP
Sbjct  1     MGFFKILFVFI-FCSFPWPTIQSDLETYIVHVESPESLITTQSSL---TDLDSYYLSFLP  56

Query  2212  ---TTVAGGGYGES-RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTT  2045
                TT++  G  E+  M++ Y NVM GFAA+L+AE+VKEM  K GF+SA  +RIL LHTT
Sbjct  57    KTTTTISSSGNEEAATMIYSYHNVMTGFAARLTAEQVKEMEKKHGFVSAQKQRILSLHTT  116

Query  2044  HSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNF  1865
             H+P FLGLQQNMG W+DS+YGKGVIIGV+D+GI  DHPS SD GMP PPA+WKGVCE NF
Sbjct  117   HTPSFLGLQQNMGLWKDSNYGKGVIIGVIDTGIVPDHPSLSDVGMPSPPAKWKGVCESNF  176

Query  1864  T-ACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLA  1688
             T  CNNK+IGARS+     S  DDDGHGTHTA TAAG FV GANV+G+ANGTA GVAPLA
Sbjct  177   TNKCNNKLIGARSYQLANGSPIDDDGHGTHTASTAAGAFVNGANVFGNANGTAVGVAPLA  236

Query  1687  HLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKG  1508
             H+AIYKVC+  GCSDS+ILAAMD AI+DGVDILS+SLGG     +EDSIA+GAYSA E+G
Sbjct  237   HIAIYKVCSSDGCSDSDILAAMDAAIDDGVDILSISLGGSPIPLYEDSIAMGAYSATERG  296

Query  1507  IFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFN  1328
             I VS SAGN+G   GS+ N APW+LTVGAST+DRK+ ATV LGNR++F GE+A++P+  N
Sbjct  297   ILVSCSAGNDGHSMGSVDNSAPWILTVGASTLDRKIKATVKLGNREEFQGESAYRPQISN  356

Query  1327  SSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGR  1148
             S+  +L    +N SDE  +PYC   SL +  +RGKIV+C+  G +    KG+AVK+A G 
Sbjct  357   STFFTLFDAAKNASDEFKTPYCRPGSLTDPAIRGKIVLCLAFGGVTIVDKGQAVKDAGGV  416

Query  1147  GMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNA  968
             GMI+I   + G+T SA AHVLPA+D++ ADG KILAY+N+TSNP+AT +F+GTI GDKNA
Sbjct  417   GMIIINSPDDGVTKSADAHVLPALDVSDADGTKILAYMNSTSNPVATIAFQGTIIGDKNA  476

Query  967   PTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPH  788
             P VAAFSSRGP+R SPGILKPDIIGPGVNILA WPTSVD+  ++KSTFNIISGTSMSCPH
Sbjct  477   PMVAAFSSRGPSRASPGILKPDIIGPGVNILAAWPTSVDDNKDTKSTFNIISGTSMSCPH  536

Query  787   LSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSK  608
             LSGVAALLKS+HPDWSPA IKSA+MTTAD LN   +PI ++ L+ A +F+ GAGHVNPS+
Sbjct  537   LSGVAALLKSTHPDWSPAAIKSAIMTTADTLNLANSPILDERLLPADIFATGAGHVNPSR  596

Query  607   ANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILE  428
             ANDPGLVYD   EDYLPYLCGLNYTNR+VG +LQ RVNCS V  I EAQLNYPSF I  E
Sbjct  597   ANDPGLVYDIPFEDYLPYLCGLNYTNRQVGNLLQRRVNCSEVKIILEAQLNYPSFCIT-E  655

Query  427   STAQTYTRTV  398
               ++ + RT+
Sbjct  656   LGSRLFERTL  665



>gb|KDO63675.1| hypothetical protein CISIN_1g048043mg [Citrus sinensis]
Length=742

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/745 (58%), Positives = 539/745 (72%), Gaps = 13/745 (2%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTT  2207
             L   L  S      S  +    LETYIV V  P    +T S     +DL+ WY SFLP +
Sbjct  8     LIFSLTFSPAFALTSNGSDTDSLETYIVYVRKPDQDQATTSIK---LDLDSWYHSFLPVS  64

Query  2206  VAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFL  2027
             ++     + RM++ Y+NV+ GFAAKL+AE+ K M  K+GFISA  E+ L LHTTH+P FL
Sbjct  65    ISSSINNQPRMLYCYKNVITGFAAKLTAEQAKAMETKEGFISAHVEKTLQLHTTHTPNFL  124

Query  2026  GLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNK  1847
             GL QN GFW+DS+ GKGVIIGV+D+GI   HPSFSDEGMPPPPA+WKG CE    ACNNK
Sbjct  125   GLHQNSGFWKDSNLGKGVIIGVMDTGITPGHPSFSDEGMPPPPAKWKGKCEFKGAACNNK  184

Query  1846  VIGARSFSERERSV--FdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIY  1673
             +IGAR+F +        DD+GHGTHTA TAAGNFV GANV+G A+GTA G+APLAHLAIY
Sbjct  185   LIGARNFLQGSTGEPPLDDEGHGTHTATTAAGNFVNGANVFGQADGTAVGIAPLAHLAIY  244

Query  1672  KVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSA  1493
             KVC+  GCS+S + AAMDTAI+DGVD+LSLSLG  S  F ED +A+G++SA++K IFVS 
Sbjct  245   KVCDFDGCSESRVYAAMDTAIDDGVDVLSLSLGAASVPFFEDPLAIGSFSAIQKEIFVSC  304

Query  1492  SAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLS  1313
             SAGNEGP   + SNEAPW+L+VGAST DR + A+V LGN+  + GE  FQPKDF S    
Sbjct  305   SAGNEGPNPSTSSNEAPWILSVGASTTDRSIVASVELGNQAVYDGEALFQPKDFPSKQFP  364

Query  1312  LVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILI  1133
             L++PG N     SS  C   SL ++++RGK+V+C  GG  +R  KG+ VK+A G GMIL+
Sbjct  365   LIYPGAN--GNVSSAQCSPGSL-SSNIRGKLVLCERGGG-ERTKKGQVVKDAGGIGMILM  420

Query  1132  EPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAA  953
               +  G +T A  H+LPA+ ++YA G+ I AYIN+TS+P AT  FKGT+ G K+ P +A+
Sbjct  421   NDKLNGYSTLADPHLLPAVHVSYAAGESIKAYINSTSSPNATIVFKGTVIGKKSTPELAS  480

Query  952   FSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVA  773
             FSSRGP+  SPGILKPDIIGPGVNILA WP SV+NK N+KSTFN+++GTSMSCPHLSGVA
Sbjct  481   FSSRGPSIASPGILKPDIIGPGVNILAAWPFSVENKTNTKSTFNMVAGTSMSCPHLSGVA  540

Query  772   ALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPG  593
             ALLKS+HPDWSPA IKSA+MTTADI++    PI +Q L+ A +F++GAGHVNPS ANDPG
Sbjct  541   ALLKSAHPDWSPAAIKSAIMTTADIVSLDGKPIVDQRLLPADMFAVGAGHVNPSSANDPG  600

Query  592   LVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQT  413
             L+YD +P+DY+PYLCGLNY+++ V  I+   V CS V  I E +LNYPSFS+IL ST+QT
Sbjct  601   LIYDIQPDDYIPYLCGLNYSDQHVQDIVMINVQCSKVSGIAETELNYPSFSVILGSTSQT  660

Query  412   YTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNM  233
             Y RTVTNVG+A S YT +I  P GV V VEP  + F+K NQK  Y++TF+ S K +    
Sbjct  661   YNRTVTNVGQAESSYTHKIVAPEGVTVTVEPENISFTKKNQKAIYSITFTRSQKTSAL--  718

Query  232   PPVVQGALRWKSVKHHVRSPIAAKL  158
                 QG L W S KH VRSPIA + 
Sbjct  719   --FAQGYLSWVSTKHTVRSPIAVRF  741



>gb|EYU28961.1| hypothetical protein MIMGU_mgv1a020058mg [Erythranthe guttata]
Length=740

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/753 (58%), Positives = 541/753 (72%), Gaps = 27/753 (4%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             M F     I+ +L    +    A  L+ YIV V+   S            +LE  Y SFL
Sbjct  1     MGFTSFLCIICIL--NLNQILNAENLDVYIVHVDPSQSE-----------NLETSYDSFL  47

Query  2215  PTTVAGGGYGES------RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPL  2054
             PTT        +      R++  YRNV  GFAAKLS  +V+ M   +GF+SA PE++ PL
Sbjct  48    PTTTNPAAASANDNNNRPRILHRYRNVFSGFAAKLSIADVEAMRQMNGFVSARPEKVFPL  107

Query  2053  HTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCE  1874
             HTTH+P FLGL QN GFW+DS+YGKGVI+G+LDSGI+ DHPSFSDEGMPPPP +W+G C+
Sbjct  108   HTTHTPNFLGLIQNSGFWKDSNYGKGVIVGLLDSGISPDHPSFSDEGMPPPPPKWRGECQ  167

Query  1873  L-NFTACNNKVIGARSFSERERSV-FdddghgthtagtaaGNFVRGANVYGSANGTAAGV  1700
               +  ACNNK+IGA+ F+    +  FD++GHGTHTA TAAG+FV GAN+YG+A GTAAG+
Sbjct  168   FGSKNACNNKLIGAKYFTNGNATTPFDEEGHGTHTAATAAGSFVGGANIYGNAAGTAAGM  227

Query  1699  APLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVD-IlslslggmssSFHEDSIALGAYS  1523
             APLAH+A+Y+VC+  GCS+S+I+A MD AIEDGVD I     GG  ++F +D+IA+GA+ 
Sbjct  228   APLAHVAMYRVCSPSGCSESDIMAGMDAAIEDGVDVISISLGGGSPTAFDKDNIAIGAFR  287

Query  1522  AMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQ  1343
             AMEKGI VS SAGN GP   SLSNEAPW+LTVGAST+DRK+ AT VLGN +++ GETAFQ
Sbjct  288   AMEKGIVVSCSAGNNGPALVSLSNEAPWILTVGASTIDRKIKATAVLGNNEEYDGETAFQ  347

Query  1342  PKDFNSSL-LSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAV  1166
             P DF S+  L LVFPGQ ++    S YC   +L    VRGKIV+C  GG   R  KG+AV
Sbjct  348   PNDFPSTTKLGLVFPGQISN---MSLYCGEGALDENIVRGKIVLCEIGGTGTRVDKGKAV  404

Query  1165  KNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTI  986
             KNA G  MIL+  +  G TT A AHVLPAI + Y D  KI AY+++  NP+AT  FKGT+
Sbjct  405   KNAGGAAMILMNQQAQGDTTRAEAHVLPAIHVNYVDALKIKAYVSSNPNPIATIVFKGTV  464

Query  985   TGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGT  806
              GD  AP VAAFSSRGP+  SPGILKPDIIGPGVNILA WP SV+NK ++KSTFN++SGT
Sbjct  465   IGDNRAPVVAAFSSRGPSLLSPGILKPDIIGPGVNILAAWPVSVENKTDTKSTFNMVSGT  524

Query  805   SMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAG  626
             SMSCPHLSGVAALLKS+HPDW PA+IKSA+MTTAD +N G NPI+ + L  A VF+IGAG
Sbjct  525   SMSCPHLSGVAALLKSAHPDWLPAVIKSAIMTTADQVNLGGNPIETELLKPADVFAIGAG  584

Query  625   HVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPS  446
             HVNPS+ANDPGLVYD +P +Y+ YLCG+N+T  +VGVI+Q +V+CS    I E+QLNYPS
Sbjct  585   HVNPSRANDPGLVYDIQPHEYVSYLCGMNFTESQVGVIVQRKVDCSKETRIAESQLNYPS  644

Query  445   FSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTF  266
             FSI+L ST QTY+RTVTNVGE  S Y VEI  P GV V VEP +L F+K+ Q L+YNVTF
Sbjct  645   FSIVLGSTPQTYSRTVTNVGECESSYDVEIGSPEGVTVVVEPVKLDFTKLGQTLSYNVTF  704

Query  265   SLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             + S     +     VQG + W S K+ VRSPIA
Sbjct  705   TRSDGGTLTT-DDYVQGFVTWHSGKYSVRSPIA  736



>ref|XP_008381953.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Malus 
domestica]
Length=852

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/726 (61%), Positives = 531/726 (73%), Gaps = 16/726 (2%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGG-YGESRMVFMYRNVMKG  2144
             ++TYIV V  P   +     S S  DLE WY +FLPTT++        RMV +YRNV  G
Sbjct  125   MQTYIVWVNQP---VQKFLFSKSHQDLESWYHTFLPTTISSSNKMVNPRMVHVYRNVATG  181

Query  2143  FAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIG  1964
             FAAKL+ EEVK M  K+GF+SA PERILPLHTTHSP FLGL Q +G W+ ++YGKGVIIG
Sbjct  182   FAAKLTPEEVKAMEKKEGFVSAHPERILPLHTTHSPNFLGLNQGLGVWKGANYGKGVIIG  241

Query  1963  VLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERS---VFddd  1793
             VLD+GI  DHPSFSDEGMPPPPA+WKG C+ N T CNNK+IGAR+F   + +     DD+
Sbjct  242   VLDTGITPDHPSFSDEGMPPPPAKWKGKCDFNGTVCNNKLIGARNFQGGKSTGAPPVDDE  301

Query  1792  ghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTA  1613
             GHGTHT+ TA GNFV+G +V+G A GTA+G+AP AH+A+YKVC E GCS+S ILAAMDTA
Sbjct  302   GHGTHTSSTAGGNFVKGVSVFGQAYGTASGMAPYAHVAMYKVCGEEGCSESNILAAMDTA  361

Query  1612  IEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWML  1433
             +EDGVD+LSLSLGG S  F+ D IA+GA+ A++KGIFVS SAGN GPF GSLSNEAPW+L
Sbjct  362   VEDGVDVLSLSLGGPSFPFYADGIAIGAFGAIQKGIFVSCSAGNSGPFYGSLSNEAPWIL  421

Query  1432  TVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSE  1253
             TVGAST+DR + A   LGN  ++ GE+ FQPKDF S LL +V+ G N  +  SS +C S 
Sbjct  422   TVGASTIDRSIRAVAKLGNGGEYDGESLFQPKDFGSELLPMVYAGANGKE--SSRFCSSG  479

Query  1252  SLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAID  1073
             SL N  V G IVVC  GG + R  KG  VK A G  MIL+     G +T A  HVLPA  
Sbjct  480   SLEN--VEGAIVVCERGGGIGRIDKGAEVKRAGGAAMILVNAVTDGDSTLADPHVLPATH  537

Query  1072  ITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIG  893
             + YA G +I  Y+N+TS+P AT  FKGTI GDK AP + +FSSRGPN ESPGILKPDI+G
Sbjct  538   VGYAAGVRIKXYLNSTSSPAATILFKGTIIGDKLAPKITSFSSRGPNMESPGILKPDIVG  597

Query  892   PGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMM  713
             PGV+ILA WP SVDN  +S +TFN+ISGTSMSCPHLSG+AALLKSSHPDWSPA IKSA+M
Sbjct  598   PGVSILAAWPVSVDNATDSNATFNMISGTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIM  657

Query  712   TTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYT  533
             TTA + N G  PI ++ L  A +F+ GAGHVNP KANDPGL+YDTKP DY+PYLCGLNYT
Sbjct  658   TTAGVNNLGGKPIVDETLKPADIFATGAGHVNPYKANDPGLIYDTKPADYIPYLCGLNYT  717

Query  532   NREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL----ESTAQTYTRTVTNVGEASSFYT  365
             N ++ VI Q  VNCS V +IPEAQLNYPSFSII+    ES +Q YTRTV NVG A+S Y 
Sbjct  718   NEQIQVITQQTVNCSEVENIPEAQLNYPSFSIIVGSSDESKSQYYTRTVKNVGLANSTYK  777

Query  364   VEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHH  185
             +++  P  + ++V P  L F+ VNQ++T+ V F L+   A  +  P  QG LRW S KH 
Sbjct  778   LDLNVPXQMGMSVNPEVLTFTXVNQEITFYVEF-LAEDGAGKDGVPFAQGYLRWVSDKHS  836

Query  184   VRSPIA  167
             V SPI+
Sbjct  837   VSSPIS  842



>ref|XP_008238739.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=751

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/753 (58%), Positives = 545/753 (72%), Gaps = 19/753 (3%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             + F  MF  LSV +    T    S ++TYIV V+ P   +     + S  DLE WY++FL
Sbjct  8     LGFSVMFY-LSVAVA-AETDEDKSSMQTYIVWVKRP---VQNLFFAKSHEDLESWYQTFL  62

Query  2215  PTTVAGGG-YGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHS  2039
             P T+A      + RMV  YRNV  GFAAKL+ EEVK M  K+GF+SA PERILPLHTTHS
Sbjct  63    PDTIANSNELTKPRMVHTYRNVATGFAAKLTPEEVKAMEQKEGFVSAHPERILPLHTTHS  122

Query  2038  PGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA  1859
             P FLGLQQ +G W+ ++YG+GVIIGVLD+GI  DHPSFSDEG+PPPPA+WKG C+ N T 
Sbjct  123   PNFLGLQQGLGVWKGANYGEGVIIGVLDTGIGPDHPSFSDEGVPPPPAKWKGKCDFNGTV  182

Query  1858  CNNKVIGARSFSERERS---VFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLA  1688
             CNNK+IGAR+F   + +     DD+GHGTHT+ TAAGNFV+GAN +G ANGTAAG+AP A
Sbjct  183   CNNKLIGARNFQSGKTTGGPPVDDEGHGTHTSSTAAGNFVKGANAFGMANGTAAGMAPYA  242

Query  1687  HLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKG  1508
             HLA+YK+C+E GC++ +I+AA+DTA+EDGVD+LSLSLGG S  F+ED IA+GA+ A++KG
Sbjct  243   HLAMYKICSEDGCTEGDIVAALDTAVEDGVDVLSLSLGGPSFPFYEDGIAVGAFGAIQKG  302

Query  1507  IFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFN  1328
             IFVS SAGN GP   SLSNEAPW+LTVG ST+DR + AT +LG+  +F G + FQPKDFN
Sbjct  303   IFVSCSAGNSGPSYESLSNEAPWILTVGGSTIDRSIRATALLGDHGEFDGVSLFQPKDFN  362

Query  1327  SSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGR  1148
             S+LL LV+PG N +   SS  C   SL N  + GKIVVC  G    R  KGE VK A G 
Sbjct  363   SALLPLVYPGANGN--PSSALCSPGSLEN--LEGKIVVCEGG--RGRVAKGEEVKRAGGA  416

Query  1147  GMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNA  968
              MIL+     G +  A AHVLPA  ++Y  G  I A+IN+TS P AT  FKGT+ GD  A
Sbjct  417   AMILVNQAIDGYSVLADAHVLPATHVSYQAGLNIKAFINSTSTPTATILFKGTVIGDPLA  476

Query  967   PTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPH  788
             P VA+FSSRGP+  SPGILKPDIIGPGV+ILA WP SVDN    K+TFN++SGTSMSCPH
Sbjct  477   PKVASFSSRGPSIRSPGILKPDIIGPGVSILAAWPVSVDNGTEGKATFNMVSGTSMSCPH  536

Query  787   LSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSK  608
             LSG+AALLKSSHPDWSPA IKSA+MTTA++ N   + I +Q L  A +F++GAGHVNPSK
Sbjct  537   LSGIAALLKSSHPDWSPAAIKSAIMTTAEVENLAGSAIVDQTLFPADIFALGAGHVNPSK  596

Query  607   ANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL-  431
             ANDPGL+YD +PEDY+PYLCGLNYT+ ++ VI Q  VNCS V ++PEAQLNYP+FSI   
Sbjct  597   ANDPGLIYDIQPEDYIPYLCGLNYTDEQIQVITQQTVNCSQVGAVPEAQLNYPTFSIKTG  656

Query  430   --ESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLS  257
               E+  Q YTRTVTNVG A+S Y + +  PP V ++V P+ L F++VNQK+TY+V F+  
Sbjct  657   SSETQTQYYTRTVTNVGPANSTYELALVVPPKVGMSVNPQVLTFTEVNQKITYHVEFNAH  716

Query  256   SKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
               A +  + P  +G LRW S KH V + I A  
Sbjct  717   DDAGKDGV-PFAEGYLRWVSDKHSVTTRIVATF  748



>ref|XP_002275429.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=740

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/746 (57%), Positives = 537/746 (72%), Gaps = 13/746 (2%)
 Frame = -1

Query  2389  FLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPT  2210
             FL  F+ +S   GF       ++ +TY++ V+ P++    ++      +LE WYKSF+PT
Sbjct  5     FLLAFICMS---GFSPAIADKTQFKTYVIHVKHPNNEEVAEAQ-----NLESWYKSFMPT  56

Query  2209  TVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGF  2030
             ++      + R+V  Y++VM GFAA+L+ +EV  M  KDGF+SA PE+I  LHTTH+PGF
Sbjct  57    SMTADSDQQPRIVHSYQHVMTGFAARLTEDEVNAMKEKDGFVSARPEKIFHLHTTHTPGF  116

Query  2029  LGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNN  1850
             LGL +  GFW+ S+ GKGVIIGVLD+G+  DH SFSD GMPPPPA+WKG CE   T+CNN
Sbjct  117   LGLHKGSGFWKGSNLGKGVIIGVLDTGVLPDHVSFSDAGMPPPPAKWKGKCEFKGTSCNN  176

Query  1849  KVIGARSFSERERSV--FdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAI  1676
             K+IGAR+F          D++GHGTHTA TAAGNFV+ A+V+G+A GTA G+AP AHLAI
Sbjct  177   KLIGARNFDSESTGTPPSDEEGHGTHTASTAAGNFVKHASVFGNAKGTAVGMAPHAHLAI  236

Query  1675  YKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVS  1496
             YKVC+E GC+ S+ILAA+D AIEDGVD+LSLSLGG S  FHED IALGA++A  KGIFVS
Sbjct  237   YKVCSESGCAGSDILAALDAAIEDGVDVLSLSLGGQSFPFHEDPIALGAFAATRKGIFVS  296

Query  1495  ASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLL  1316
              SAGNEGP N +LSNEAPW+LTV AST+DR + A V LGN + F GE+ FQP+DF S  L
Sbjct  297   CSAGNEGPTNSTLSNEAPWILTVAASTMDRSIKAMVKLGNGKNFDGESLFQPRDFPSEQL  356

Query  1315  SLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMIL  1136
              LV+ G  ++  +SS +C   SL++ DV+GK+VVC  GG + R  KG+ VKNA G  MIL
Sbjct  357   PLVYAGAGSN--ASSAFCGEGSLKDLDVKGKVVVCDRGGGISRIDKGKEVKNAGGAAMIL  414

Query  1135  IEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVA  956
                +  G +T A  H LPA  + Y+ G  I AYIN+++ P AT  FKGTI G   AP + 
Sbjct  415   TNGKPDGFSTLADPHSLPAAHVGYSAGLSIKAYINSSNKPTATLLFKGTIIGKSAAPEIT  474

Query  955   AFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGV  776
             +FSSRGP+  SPGILKPDI GPGV++LA WP+SVDN+ +SK  FN+ISGTSMSCPHLSG+
Sbjct  475   SFSSRGPSLASPGILKPDITGPGVSVLAAWPSSVDNRTDSKVAFNMISGTSMSCPHLSGI  534

Query  775   AALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDP  596
             AALLKSSHP+WSPA IKSA+MTTAD+LN   +PI ++    A VF++GAGHVNPS+ANDP
Sbjct  535   AALLKSSHPEWSPAAIKSAIMTTADVLNLKGDPILDETHEPADVFAVGAGHVNPSRANDP  594

Query  595   GLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQ  416
             GL+YD +P DY+PYLCGL Y + +V  I++H+V CS   SIPEAQLNYPSFS+ + S+A 
Sbjct  595   GLIYDIQPNDYIPYLCGLGYNDTQVRAIIRHKVQCSKESSIPEAQLNYPSFSVAMGSSAL  654

Query  415   TYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSN  236
                RTVTNVGEA + Y V+I  P GV V+V+PR+L F++ NQK TY VTF       ++ 
Sbjct  655   KLQRTVTNVGEAKASYIVKISAPQGVDVSVKPRKLDFTQTNQKKTYTVTFERKDD-GKTG  713

Query  235   MPPVVQGALRWKSVKHHVRSPIAAKL  158
               P  QG L W S KH VRSPI+ K 
Sbjct  714   SKPFAQGFLEWVSAKHSVRSPISVKF  739



>emb|CDO99977.1| unnamed protein product [Coffea canephora]
Length=733

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/754 (59%), Positives = 547/754 (73%), Gaps = 50/754 (7%)
 Frame = -1

Query  2377  FLILSVLIGFCSTATIA-----SKLETYIVRVELP-HsristqsssssSVDLEHWYKSFL  2216
              LIL  +I F S A        S ++TYIV VELP  +++S+ S+S ++ DLE+WYKSFL
Sbjct  6     ILILLFVISFLSIAAKGLHEQESTVQTYIVHVELPTDTQLSSASASPNNDDLENWYKSFL  65

Query  2215  PTTVAGGGYGES-RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHS  2039
             PTT       E+ RM++ Y NV +GFAAKLSAE+VKEM  K GF+SA+P+ +L LHTTH+
Sbjct  66    PTTTISSSSNEAPRMLYSYHNVFRGFAAKLSAEDVKEMEKKPGFLSASPQEMLSLHTTHT  125

Query  2038  PGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA  1859
             P FLGL   MGFW+DS+YG GVIIGV+D+GI  DHPSFSDEGMPPPPA+WKG CE N +A
Sbjct  126   PSFLGLHPGMGFWKDSNYGNGVIIGVMDTGIRPDHPSFSDEGMPPPPAKWKGKCEFNSSA  185

Query  1858  CNNKVIGARSFS-ERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHL  1682
             CNNK+IGAR+F+ E   S  D+ GHGTHTA TAAGNFV+GANV  +ANGTAAG+APLAHL
Sbjct  186   CNNKLIGARNFNQEFSDSALDEVGHGTHTASTAAGNFVQGANVLRNANGTAAGIAPLAHL  245

Query  1681  AIYKVCNEIG--------CSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAY  1526
             A+YKVC  +         C +S ILAAMD AI DGVDILSLSLGG S  F+ DS+ALGAY
Sbjct  246   AMYKVCIIVCQGVVCLNICPESAILAAMDAAIHDGVDILSLSLGGSSKPFYTDSVALGAY  305

Query  1525  SAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAF  1346
             +AMEKGI VS SAGN GPFN SL NEAPW+LTVGAST+DRK+ AT +LGN+++F GE+ +
Sbjct  306   TAMEKGILVSCSAGNGGPFNQSLENEAPWILTVGASTIDRKIVATALLGNKEEFDGESLY  365

Query  1345  QPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAV  1166
              PK F S+   L + G N SD  S+ YC S +L ++ V+GKIVVC  G  +    KGE V
Sbjct  366   NPKHFLSTPFPLYYAGWNASDILSA-YCFSSALNSSKVQGKIVVCDYGVGISDVQKGENV  424

Query  1165  KNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTI  986
             K A G GMI+I  +  G TT A AHVLPA  +                            
Sbjct  425   KAAGGVGMIIINGQNQGYTTFADAHVLPATHL----------------------------  456

Query  985   TGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGT  806
               + +AP VA+FSSRGP+  SPGILKPDIIGPGVNILA WP SV+N  N+KSTFN++SGT
Sbjct  457   --NDHAPVVASFSSRGPSMASPGILKPDIIGPGVNILAAWPQSVENNTNTKSTFNMLSGT  514

Query  805   SMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAG  626
             SMSCPHLSGVAALLKS+HPDWSPA IKSA+MTTAD++N  +NPI+++ L+ A++F+IG+G
Sbjct  515   SMSCPHLSGVAALLKSAHPDWSPAAIKSAIMTTADLVNLAKNPIEDERLLPANIFAIGSG  574

Query  625   HVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPS  446
             HVNPS+AN+PGL+YD +P+DY+PYLCGLNYT R +  ILQ RVNC+   SIPEAQLNYPS
Sbjct  575   HVNPSRANNPGLIYDIEPKDYVPYLCGLNYTRRGLLYILQRRVNCTEESSIPEAQLNYPS  634

Query  445   FSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTF  266
             FSI   S  Q YTRTVTNVGEA S YTV++  P GV+V V+P+ L+FS+V QKLTY V F
Sbjct  635   FSIQFGSPIQRYTRTVTNVGEAKSVYTVKVVPPEGVEVIVKPKTLRFSEVKQKLTYQVIF  694

Query  265   SLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAA  164
             S    AA +      QG++ W S K  VRSPIAA
Sbjct  695   SQLPTAANNT---ASQGSITWASAKVSVRSPIAA  725



>ref|XP_009362845.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=754

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/751 (59%), Positives = 548/751 (73%), Gaps = 20/751 (3%)
 Frame = -1

Query  2389  FLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPT  2210
              L++  +L ++  FC +   A+  +TY+V V+ P   +  +  S S  DLE WY++FLP 
Sbjct  9     LLQIVCLLGLIFLFCLSVAAAADTQTYVVWVKKP---VQGELFSKSHQDLESWYQTFLPE  65

Query  2209  TVAGGG-YGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPG  2033
             TVA      + RMV  YRNV  GFAAKL+AEEV+ M NK+GF+SA PERILPLHTTHSP 
Sbjct  66    TVADSNEVTKPRMVHTYRNVATGFAAKLTAEEVRAMENKEGFVSARPERILPLHTTHSPN  125

Query  2032  FLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACN  1853
             FLGLQQ +G W+ ++YG GVIIGVLD+GI  DHPSFSDEG+PPPPA+WKG C+ N   CN
Sbjct  126   FLGLQQGLGAWKGANYGAGVIIGVLDTGIGPDHPSFSDEGVPPPPAKWKGKCDFNGPVCN  185

Query  1852  NKVIGARSFSERERS---VFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHL  1682
             NK+IGAR+F   + +     DD+GHGTHT+ TAAGNFV+GAN +G ANGTA G+AP AH+
Sbjct  186   NKLIGARNFQSGQSTGGPPVDDEGHGTHTSSTAAGNFVKGANAFGMANGTAVGMAPYAHV  245

Query  1681  AIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIF  1502
             A+YKVC E GCSD++ILAAMDTA+EDGVD+LSLSLGG S  F++D+IA+GA++A++KGIF
Sbjct  246   AMYKVCGEAGCSDADILAAMDTAVEDGVDVLSLSLGGASFPFYDDAIAIGAFTAIQKGIF  305

Query  1501  VSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSS  1322
             VS +AGN GP   SLSNEAPW+LTVGAST+DR + AT +LGN  +F G +  QPKDFNS+
Sbjct  306   VSCAAGNSGPDYESLSNEAPWILTVGASTIDRSIRATALLGNHGEFDGVSLNQPKDFNST  365

Query  1321  LLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGM  1142
             LL LV+PG N  D+S S  C   SL N  V GKIV+C   G   R  KGE VK A G  M
Sbjct  366   LLPLVYPGAN-GDQSLS-LCAPGSLGN--VEGKIVLCE--GERGRVAKGEEVKRAGGAAM  419

Query  1141  ILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPT  962
             IL   E+ G T  A AHVLPA  ++YA G  I AYIN+T+ P AT  FKGT+ GD  AP 
Sbjct  420   ILANLEDGGYTVLADAHVLPATHVSYAAGLMIKAYINSTTTPQATILFKGTVIGDPLAPQ  479

Query  961   VAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNK--PNSKSTFNIISGTSMSCPH  788
             VA FSSRGP+  SPGILKPDIIGPGV+ILA WP SVDN   PN K+TFN++SGTSMSCPH
Sbjct  480   VAFFSSRGPSIASPGILKPDIIGPGVSILAAWPVSVDNATLPNPKATFNMVSGTSMSCPH  539

Query  787   LSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSK  608
             LSG+AALLKSSHPDWSPA IKSA+MTTA++ N G  PI ++ L  A +F+ GAGHVNPS 
Sbjct  540   LSGIAALLKSSHPDWSPAAIKSAIMTTAEVNNLGGQPIVDETLKPADIFATGAGHVNPSN  599

Query  607   ANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL-  431
             A DPGL+YD  P +Y+PY+CGLNYTN ++ V+ Q  VNCS V +IPEAQLNYPSFSII+ 
Sbjct  600   AIDPGLIYDINPAEYIPYMCGLNYTNEQIQVVTQQTVNCSEVGTIPEAQLNYPSFSIIIG  659

Query  430   ---ESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSL  260
                ES +Q YTRTV NVG ASS Y +++  P  + ++V P  L F++VNQ++T++V F  
Sbjct  660   SSDESKSQDYTRTVKNVGPASSTYKLDLNVPHKMGMSVNPEVLTFTEVNQEITFSVEFIA  719

Query  259   SSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
                A +  +    +G LRW S KH V SPI+
Sbjct  720   EDGAGKDGV-LFDRGYLRWISDKHSVTSPIS  749



>ref|XP_004245672.2| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SDD1 
[Solanum lycopersicum]
Length=1453

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/724 (60%), Positives = 536/724 (74%), Gaps = 13/724 (2%)
 Frame = -1

Query  2317  ETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFA  2138
             E YIV  E P     T+      +DL+ WY SFLP T +       R+++ YRNV+ GFA
Sbjct  740   EVYIVHCEFPEGERGTRY-----LDLDSWYLSFLPATTSDSSREAPRLIYSYRNVLTGFA  794

Query  2137  AKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVL  1958
              KLS +++KEM   +GFISA PER+L L+TTHS  FLGL QN G W DS+YGKGVIIGV+
Sbjct  795   VKLSPDDLKEMEKMEGFISARPERLLDLYTTHSVDFLGLHQNTGLWNDSNYGKGVIIGVI  854

Query  1957  DSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-SERERSVFdddghgt  1781
             D+GI  DHPSF+D+GMPPPPA+WKG CE N T CNNK+IGAR F S    + +D+ GHGT
Sbjct  855   DTGIFPDHPSFNDDGMPPPPAKWKGKCEFNVTKCNNKLIGARYFQSSGNETSWDEIGHGT  914

Query  1780  htagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDG  1601
             HTA TAAG FV GAN++G+ANGTA GVAPLAH+A+YKVC+ + CS+S +LAAMD AI+DG
Sbjct  915   HTASTAAGRFVPGANIFGNANGTAVGVAPLAHIAMYKVCSGLTCSESHVLAAMDMAIDDG  974

Query  1600  VDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGA  1421
             VD+LSLSLG ++++F+ED++ALGA+SAM+KGIFVS +AGN GP + S SNEAPW+LTVGA
Sbjct  975   VDVLSLSLGTLTNNFYEDNVALGAFSAMQKGIFVSCAAGNSGPSSFSTSNEAPWILTVGA  1034

Query  1420  STVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRN  1241
             ST+DRK+ AT VLGN Q+F GE+AFQP DF  ++L L++PG N S+ ++  YC  +SL N
Sbjct  1035  STIDRKIKATAVLGNNQEFDGESAFQPSDFPPTVLPLIYPGSNVSNFNAK-YCTPDSLNN  1093

Query  1240  ADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYA  1061
              +V GKIV+C  G    R  KG AV+ A G GMIL+ PE+   TT A  HVLP   ++YA
Sbjct  1094  TNVVGKIVLCEVG-ITTRANKGIAVEAAGGAGMILMNPEDMANTTLAEVHVLPVTHVSYA  1152

Query  1060  DGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVN  881
              G KI  YIN+T  P AT  FKGTI GD  AP VA FSSRGPN  SPGILKPDIIGPGVN
Sbjct  1153  AGVKIKEYINSTLIPTATIVFKGTIIGDDRAPVVAGFSSRGPNFASPGILKPDIIGPGVN  1212

Query  880   ILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTAD  701
             ILA W  S++NK N+ S FN+ISGTSMSCPHLSGVAALLKS HPDWSPA IKSA+MTTAD
Sbjct  1213  ILAAWHISLENKTNTNSRFNMISGTSMSCPHLSGVAALLKSVHPDWSPAAIKSAIMTTAD  1272

Query  700   ILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREV  521
              +N   N I+++  + A VF+ GAGHVNPSKANDPGL+YD +P DYL YLCGLNYT+R+V
Sbjct  1273  DVNLRSNLIEDETYLPADVFATGAGHVNPSKANDPGLIYDIEPSDYLSYLCGLNYTDRQV  1332

Query  520   GVILQHRVNCSAVISIPEAQLNYPSFSIILE--STAQTYTRTVTNVGEASSFYTVEIFEP  347
             G+ LQ + NCS + SI E QLNYPSFSI++   STAQ Y+RTVTNVG+A S Y VEI  P
Sbjct  1333  GIFLQRKANCSEITSILEVQLNYPSFSILVRVNSTAQVYSRTVTNVGQAYSTYRVEIGSP  1392

Query  346   PGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             PG+ V +EP  L FS+V QKL+Y VTF+  +    +      QG+ RW S KH VRS IA
Sbjct  1393  PGIDVKIEPTTLVFSEVKQKLSYQVTFTPLATLPNTTFS---QGSFRWISEKHIVRSQIA  1449

Query  166   AKLV  155
              + +
Sbjct  1450  VRFL  1453


 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/715 (61%), Positives = 528/715 (74%), Gaps = 9/715 (1%)
 Frame = -1

Query  2389  FLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPT  2210
              L M  ++ VL  F + AT     + YIV  + P    +T++      DLE +Y SFLP 
Sbjct  7     ILTMIGLICVLFPFTTNATEQDNSQIYIVHCQFPDGERTTRNQ-----DLESYYLSFLPA  61

Query  2209  TVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGF  2030
             T +       R+++ YRNV+ GFAAKLS E++KEM   +GF+SA PE +L LHTTHS  F
Sbjct  62    TTSDSSREAPRLIYSYRNVITGFAAKLSLEDLKEMEKMEGFVSARPEGLLDLHTTHSVNF  121

Query  2029  LGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNN  1850
             +GL QN+GFW DS+YGKGVIIGV+D+GI  DHPSFSD+GMPPPPA+WKG C+ N T CNN
Sbjct  122   MGLNQNIGFWNDSNYGKGVIIGVIDTGIFPDHPSFSDDGMPPPPAKWKGKCQFNTTKCNN  181

Query  1849  KVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYK  1670
             K+IGAR FS      +D++GHGTHTA TAAG FV GAN+ G+ANGTA GVAPLAH+AIYK
Sbjct  182   KLIGARYFSYTGNDPWDENGHGTHTASTAAGRFVPGANILGNANGTAMGVAPLAHVAIYK  241

Query  1669  VCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSAS  1490
              C+ IGC  S+ILAAMD AIEDGVD+LS+SLG  S  F+ED IALGA+SA+E+GIFVS S
Sbjct  242   TCSAIGCFGSDILAAMDMAIEDGVDVLSISLGNRSRQFYEDVIALGAFSAIERGIFVSCS  301

Query  1489  AGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSL  1310
             AGN GP+  S+SN+APW+LTVGAST+DR++ AT VLGN Q+F GE+AFQP  F S+LL L
Sbjct  302   AGNSGPYTFSVSNDAPWILTVGASTIDRRIKATAVLGNNQKFDGESAFQPSHFPSTLLPL  361

Query  1309  VFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIE  1130
             ++PG NTSD + + YC   SL N +V GKIV+C+  G      KG AVK A G  MI++ 
Sbjct  362   IYPGMNTSD-TLAQYCYPSSLNNTNVMGKIVLCV-AGITAGVDKGIAVKAAGGAAMIIMN  419

Query  1129  PEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAF  950
             PE +  TT A AHVLP   +TY DG KI  YIN+T+ P AT +FKGT  GD  AP VA F
Sbjct  420   PESWANTTLAEAHVLPVTHVTYGDGLKIQEYINSTTTPTATIAFKGTXIGDNRAPVVAGF  479

Query  949   SSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAA  770
             SS GP+  SP ILKPDIIGPGVNILA WP S++N  N+ STFN+I+GTSMSCPHLSGVAA
Sbjct  480   SSXGPSYASPRILKPDIIGPGVNILAAWPISLENNTNTNSTFNMIAGTSMSCPHLSGVAA  539

Query  769   LLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGL  590
             LLKS HPDWSPA IKSA+MTTAD+ N G   I+++  + A VF+ GAGHVNPSKANDPGL
Sbjct  540   LLKSVHPDWSPAAIKSAIMTTADVFNLGSKLIEDETYLPADVFATGAGHVNPSKANDPGL  599

Query  589   VYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILE--STAQ  416
             VYD +P DY+PYLCGLNYTNR+V VI+Q +VNCS + SI E QLNYPSF+I +   S AQ
Sbjct  600   VYDIEPSDYIPYLCGLNYTNRQVTVIVQRKVNCSEITSILEGQLNYPSFAIQVRNNSEAQ  659

Query  415   TYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSK  251
              Y+RTVTNVG A+S Y V+I  P G+ V VEP  L FSKV QKL+Y VTF+  S+
Sbjct  660   VYSRTVTNVGTANSTYRVDIDSPRGLDVKVEPTTLVFSKVKQKLSYQVTFTPFSR  714



>ref|XP_006477585.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=742

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/741 (58%), Positives = 537/741 (72%), Gaps = 13/741 (2%)
 Frame = -1

Query  2374  LILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGG  2195
             L  S      S  +    LETYIV V  P    +T S     +DL+ WY SFLP +++  
Sbjct  12    LTFSPAFALTSNGSDTDSLETYIVYVRKPDHDQATTSIK---LDLDSWYHSFLPVSISSS  68

Query  2194  GYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQ  2015
                + RM++ Y+NV+ GFAA+L+AE+ K M  K+GF+SA  E+ L LHTTH+P FLGL Q
Sbjct  69    INNQPRMLYCYKNVITGFAARLTAEQAKAMETKEGFLSAHVEKTLQLHTTHTPNFLGLHQ  128

Query  2014  NMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGA  1835
               GFW+DS+ GKGVIIGV+D+GI   HPSFSDEGMPPPPA+WKG CE    ACNNK+IGA
Sbjct  129   KSGFWKDSNLGKGVIIGVMDTGITPGHPSFSDEGMPPPPAKWKGKCEFKGAACNNKLIGA  188

Query  1834  RSFSERERSV--FdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCN  1661
             R+F +        DD+GHGTHTA TAAGNFV GANV+G A+GTA G+APLAHLAIYKVC+
Sbjct  189   RNFLQGSTGEPPLDDEGHGTHTATTAAGNFVNGANVFGQADGTAVGIAPLAHLAIYKVCD  248

Query  1660  EIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGN  1481
               GCS+S + AAMDTAI+DGVD+LSLSLG  S  F ED +A+G++SA++K IFVS SAGN
Sbjct  249   FDGCSESRVYAAMDTAIDDGVDVLSLSLGAASVPFFEDPLAIGSFSAIQKEIFVSCSAGN  308

Query  1480  EGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFP  1301
             EGP   + SNEAPW+L+VGAST DR + A+V LGN+  + GE  FQP+DF S    L++P
Sbjct  309   EGPNPSTSSNEAPWILSVGASTTDRSIVASVELGNQAVYDGEALFQPEDFPSKQFPLIYP  368

Query  1300  GQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEE  1121
             G N     SS  C   SL ++D+RGK+V+C  GG  +R  KG+ VK+A G GMIL+  + 
Sbjct  369   GAN--GNVSSAQCSPGSL-SSDIRGKLVLCERGGG-ERTKKGQVVKDAGGIGMILMNDKL  424

Query  1120  YGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSR  941
              G +T A  H+LPA+ ++YA G+ I AYIN+TS+P AT  FKGT+ G K+ P +A+FSSR
Sbjct  425   NGYSTLADPHLLPAVHVSYAAGESIKAYINSTSSPNATIVFKGTVIGKKSTPELASFSSR  484

Query  940   GPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLK  761
             GP+  SPGILKPDIIGPGVNILA WP SV+NK N+KSTFN+++GTSMSCPHLSGVAALLK
Sbjct  485   GPSIASPGILKPDIIGPGVNILAAWPFSVENKTNTKSTFNMVAGTSMSCPHLSGVAALLK  544

Query  760   SSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYD  581
             S+HPDWSPA IKSA+MTTADI++    PI +Q L+ A +F++GAGHVNPS ANDPGL+YD
Sbjct  545   SAHPDWSPAAIKSAIMTTADIVSLDGKPIVDQRLLPADLFAVGAGHVNPSSANDPGLIYD  604

Query  580   TKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRT  401
              +P+DY+PYLCGLNY+++ V  I+   V CS V  I E +LNYPSFS+IL ST+QTY RT
Sbjct  605   IQPDDYIPYLCGLNYSDQHVQDIVMINVQCSKVSGIAETELNYPSFSVILGSTSQTYNRT  664

Query  400   VTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVV  221
             VTNVG+A S YT +I  P GV V VEP  + F+K NQK  Y++TF+ S K +        
Sbjct  665   VTNVGQAESSYTHKIVAPEGVIVTVEPENISFTKKNQKAIYSITFTRSQKTSAL----FA  720

Query  220   QGALRWKSVKHHVRSPIAAKL  158
             QG L W S KH VRSPIA + 
Sbjct  721   QGYLSWVSTKHTVRSPIAVRF  741



>ref|XP_006358147.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=730

 Score =   805 bits (2079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/752 (59%), Positives = 554/752 (74%), Gaps = 32/752 (4%)
 Frame = -1

Query  2395  MKFL--RMFLILSVLIGFCSTATIA--SKLETYIVRVELPHsristqsssssSVDLEHWY  2228
             M FL   +F++ S L    +T  ++  S  E YIVRVE           SS ++   H Y
Sbjct  4     MVFLITLLFVVSSHLSIILATDHLSQQSNSEIYIVRVE-----------SSDNLHASHQY  52

Query  2227  KSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
                L + V+      SR+++ YRNV  GFAA+LS +EVK +  KDGFIS  P+R+L + T
Sbjct  53    S--LLSNVS------SRVIYSYRNVFNGFAARLSPDEVKGLETKDGFISIRPQRVLRVQT  104

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             THSP FLGL QN+GFW  S+YG+GVIIG+LD+GI  +HPSF DEGMPPPPA+WKG CE N
Sbjct  105   THSPSFLGLHQNLGFWNTSNYGEGVIIGLLDTGIYPEHPSFDDEGMPPPPAKWKGKCEFN  164

Query  1867  FTACNNKVIGARSF-SERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPL  1691
             FTACNNK+IGAR F S  + +  D++GHGTHT+ TAAGNFV GANV+G+ANGTAAG+AP 
Sbjct  165   FTACNNKLIGARDFLSVEDGTPLDENGHGTHTSSTAAGNFVDGANVFGNANGTAAGIAPR  224

Query  1690  AHLAIYKVCNEIG-CSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAME  1514
             AHLA+YKVCN  G CS+S++LAAMD AIEDGVD++S+S+GG+S+ F +D+IALGA+S+M 
Sbjct  225   AHLAMYKVCNPSGLCSESDMLAAMDAAIEDGVDVISISIGGISTPFWDDNIALGAFSSMA  284

Query  1513  KGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKD  1334
             KGIFVS SAGN GP N +LSNEAPW+LTVGAST+DR++ ATV LGN  ++ GE+  QP D
Sbjct  285   KGIFVSCSAGNGGPDNATLSNEAPWILTVGASTIDRQIKATVALGNGVEYDGESTSQPND  344

Query  1333  FNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNAS  1154
             F  +LL +V+P  N S    +  C  ESL N  V GK+V+C  GG      KG+ VK+A 
Sbjct  345   FPPTLLPIVYPALN-STYFGAFVCSPESLTN--VEGKLVLCGVGG-ATAIAKGQPVKDAG  400

Query  1153  GRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDK  974
               GMIL+  +  G T  A  +VLPA  I+YAD Q ++AYIN+TS PMA+  FKGT+ G+K
Sbjct  401   AAGMILMNGDIEGYTIPAHDYVLPATRISYADAQDLIAYINSTSTPMASILFKGTVIGNK  460

Query  973   NAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSC  794
             +AP+VA FSSRGP+R SPGILKPDIIGPG NILA WPTS++N  ++  TFN+ISGTSM+C
Sbjct  461   HAPSVAFFSSRGPSRTSPGILKPDIIGPGFNILAAWPTSIENNTHTNLTFNMISGTSMAC  520

Query  793   PHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNP  614
             PHL+GVAALLKS+HPDWSPA IKSA+MTTA ++N G NPI+++  + A++F+IGAGHVNP
Sbjct  521   PHLAGVAALLKSAHPDWSPAAIKSAIMTTAGLVNLGNNPIEDERHLPANIFAIGAGHVNP  580

Query  613   SKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSII  434
               ANDPGL+YD +P DY+PYLCGLNYT+++V  ILQ +VNC+  I IPEA+LNYPSFSI 
Sbjct  581   LSANDPGLIYDIQPHDYVPYLCGLNYTDQQVSAILQKKVNCT--IRIPEAELNYPSFSIK  638

Query  433   LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSS  254
             L S  Q YTR VTNVGEA+S YTVEI  P GV++ V P  L FS+V +++TY VTF  S+
Sbjct  639   LGSETQEYTRAVTNVGEANSTYTVEISPPEGVEITVSPSSLHFSEVKERITYQVTFKRSA  698

Query  253   KAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
                 SN    VQG L+W S KH VRSPIA  L
Sbjct  699   PGTVSNA-KFVQGYLKWSSDKHSVRSPIAVIL  729



>gb|EYU18559.1| hypothetical protein MIMGU_mgv1a019487mg [Erythranthe guttata]
Length=696

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/720 (61%), Positives = 522/720 (73%), Gaps = 30/720 (4%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGF  2141
             LETYIV V+LPHS+I    S      LE WY SFLPTT+A       RMV+ YRNV  GF
Sbjct  3     LETYIVHVDLPHSQILYDQSQDY---LETWYISFLPTTLASETDQTPRMVYSYRNVFSGF  59

Query  2140  AAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGV  1961
             AAKL+ +E K M NK+GFISA P+ I PLHTTHSP FLGL Q+ GFW +S+YG+G     
Sbjct  60    AAKLTRDEAKAMHNKNGFISARPQEIFPLHTTHSPNFLGLHQDTGFWNNSNYGRG-----  114

Query  1960  LDSGIARDHPSFSDEGMPPPPARWKGVCELNFT-ACNNKVIGARSFSERERSVFdddghg  1784
                              PPPPA+WKGVCE NFT ACNNK+I AR F     +  D +GHG
Sbjct  115   ----------------GPPPPAKWKGVCEFNFTGACNNKLIRARHFRNGNGTPLDSNGHG  158

Query  1783  thtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIED  1604
             THTAGTAAGNFV GAN++G ANGTAAG+APLAH+A YKVC+  G S+S+ILAAMD AIED
Sbjct  159   THTAGTAAGNFVGGANIFGMANGTAAGIAPLAHIAAYKVCSSSGSSESDILAAMDIAIED  218

Query  1603  GVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVG  1424
             GVD+LS+SLGG S  FH D+IA+GA++A E+GI VS SAGN GP + +LSNEAPWMLTVG
Sbjct  219   GVDVLSVSLGGPSRPFHSDNIAVGAFAATERGILVSISAGNNGPASATLSNEAPWMLTVG  278

Query  1423  ASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLR  1244
             AST DRKL+AT VLGN  +  GE+ FQPK F +  L LVFPG NTSD  S  +C   SL 
Sbjct  279   ASTTDRKLTATAVLGNALELTGESGFQPKHFPAKQLPLVFPGSNTSDFDSR-HCGESSLI  337

Query  1243  NADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITY  1064
             N  V+GKIV+C  GG    R KG+AVK+A G GMI++    YG +T   AHVLPA +I Y
Sbjct  338   NTGVKGKIVICEVGGGTTSRRKGQAVKDAGGAGMIIVNTRRYGYSTLVDAHVLPATNINY  397

Query  1063  ADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGV  884
              DG KILAY+N++++P A+  FKGTI GD  +P VA FSSRGP+  SPGILKPDIIGPGV
Sbjct  398   EDGIKILAYLNSSTSPTASIVFKGTIIGDNTSPMVAWFSSRGPSTSSPGILKPDIIGPGV  457

Query  883   NILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTA  704
             NILA W  SV+N  N+KS FN+ISGTSMSCPHLSGVAALLKS+HPDWSPA IKSA+MTTA
Sbjct  458   NILAAWHNSVENNTNTKSNFNVISGTSMSCPHLSGVAALLKSAHPDWSPATIKSAIMTTA  517

Query  703   DILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNRE  524
             D  N G  PI +Q  + A V+S GAGHVNP++ NDPGLVYD +P+DY+ YLCGLNYT+RE
Sbjct  518   DQTNLGNQPILDQSHLAADVYSTGAGHVNPARVNDPGLVYDIEPQDYVHYLCGLNYTHRE  577

Query  523   VGVILQHRVNCSAVISIPEAQLNYPSFSIIL-ESTAQTYTRTVTNVGEASSFYTVEIFEP  347
             + +ILQ +VNCSA   I E QLNYPSFS+   ES  QTYTRTVTNVGEAS  Y VE+  P
Sbjct  578   IFIILQRKVNCSAESRISEGQLNYPSFSVRSNESADQTYTRTVTNVGEASWRYNVEVVAP  637

Query  346   PGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
              G+ V VEPR L F+++N+KLTY +TF    ++A +    V  G + WKS K+ VRSPIA
Sbjct  638   QGIDVIVEPRTLHFTELNRKLTYKITF---RRSANNGNTSVSHGYVLWKSGKYSVRSPIA  694



>ref|XP_011034012.1| PREDICTED: uncharacterized protein LOC105132300 [Populus euphratica]
Length=1500

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/721 (61%), Positives = 542/721 (75%), Gaps = 18/721 (2%)
 Frame = -1

Query  2323  KLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKG  2144
             K ETYIV V+ P   +S         DL+ WYKSFLP T+    + E RMV+ YR+V  G
Sbjct  787   KFETYIVFVQKPEGGVSAD-------DLDGWYKSFLPVTIPSSNHQE-RMVYSYRHVATG  838

Query  2143  FAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIG  1964
             FAAKL+AEE K M +KDGF+SA P++IL L TTHSP FLGLQ+N+GFWR+S+YGKGVIIG
Sbjct  839   FAAKLTAEEAKAMEDKDGFLSAKPQKILSLQTTHSPNFLGLQKNLGFWRNSTYGKGVIIG  898

Query  1963  VLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-SERERSVFdddgh  1787
             VLD+GI+ DHPSFSDEG+PPPP +WKG C  N T CNNK+IGAR F S +    FD+ GH
Sbjct  899   VLDTGISPDHPSFSDEGVPPPPTKWKGKCNFNGTVCNNKLIGARDFTSSKAAPPFDEVGH  958

Query  1786  gthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIE  1607
             GTHTA TAAGNFV  A+V+G+ANGTA G+APLAHLAIYKVC++ GC++S+ILAAMD A+E
Sbjct  959   GTHTASTAAGNFVNDASVFGNANGTAVGMAPLAHLAIYKVCSDFGCTESDILAAMDAAVE  1018

Query  1606  DGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTV  1427
             DGVD+LSLSLGG S+ F EDSIA+GA+ A +KGIFVS SAGNEGP++GSLSNEAPW+LTV
Sbjct  1019  DGVDVLSLSLGGGSAPFFEDSIAVGAFGATQKGIFVSCSAGNEGPYSGSLSNEAPWILTV  1078

Query  1426  GASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESL  1247
             GASTVDR + A V+LGN   F GE+ FQ    +   +SLV+ G + S   S+ +C  ESL
Sbjct  1079  GASTVDRSIRAHVLLGNSNHFFGESLFQSN--SPPYMSLVYAGAHGSQ--SAAFCAPESL  1134

Query  1246  RNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDIT  1067
              + DV+GKIV+C  GG + R  KG+AVK+A G  MIL+  ++ G +T A AHVLPA  ++
Sbjct  1135  TDIDVKGKIVLCERGGGIARIDKGQAVKDAGGAAMILMNDKDSGYSTLADAHVLPASHVS  1194

Query  1066  YADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPG  887
             Y+ G  I AYIN+T  P AT  F GT  GDK APTVA+FSSRGP+  SPGILKPDIIGPG
Sbjct  1195  YSAGLSIKAYINSTQVPTATIMFLGTKIGDKTAPTVASFSSRGPSMASPGILKPDIIGPG  1254

Query  886   VNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTT  707
             V+ILA WP SV+N+ + KSTFNIISGTSMSCPHLSG+AALLKS+HPDWSPA IKSA+MTT
Sbjct  1255  VSILAAWPVSVENRTDKKSTFNIISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIMTT  1314

Query  706   ADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNR  527
             AD++N G  PI ++ L+ A + + GAGHVNPSKA+DPGLVYD +P+DY+PYLCGL Y +R
Sbjct  1315  ADLVNLGNQPILDERLLPADILATGAGHVNPSKASDPGLVYDIQPDDYVPYLCGLGYPDR  1374

Query  526   EVGVILQHRVNCSAVISIPEAQLNYPSFSIIL--ESTAQTYTRTVTNVGEASSFYTVEIF  353
             ++  I+Q +V CS   SI EAQLNYPSFSI+       QTYTRTVTNVG  +SFYT  + 
Sbjct  1375  DISYIVQRQVKCSEKSSILEAQLNYPSFSIVYGPNPATQTYTRTVTNVGPPNSFYTAFVD  1434

Query  352   EPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSP  173
              PPGV V V P  + F+   Q  TY+VTF+ +S+   SN  P+ QG +RW S KH +RS 
Sbjct  1435  PPPGVNVTVTPNNIIFTNTEQTATYSVTFTATSE---SNNDPIGQGYIRWVSDKHSIRSQ  1491

Query  172   I  170
             I
Sbjct  1492  I  1492


 Score =   226 bits (577),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 137/201 (68%), Gaps = 4/201 (2%)
 Frame = -1

Query  757  SHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDT  578
            SHPDWSPA IKSA+MTTA++ N G  PI +Q  V   VF IG+GHVNP+KA+DPGLVYD 
Sbjct  178  SHPDWSPAAIKSAIMTTANLTNLGGMPITDQFFVPVDVFGIGSGHVNPTKADDPGLVYDI  237

Query  577  KPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTV  398
            +P+DY+PYLCGL Y +  VG+I+Q  V CS   SIPEAQLNYPSFSI L S  Q YTRTV
Sbjct  238  QPDDYIPYLCGLGYNDTAVGIIVQRPVTCSNSSSIPEAQLNYPSFSIKLGSGPQAYTRTV  297

Query  397  TNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQ  218
            TNVG   S Y  EI  P GV V V P  ++F   + K TY+VTF   ++AA   + P  Q
Sbjct  298  TNVGPLKSSYIAEIISPQGVDVKVTPSAIEFGGGSSKATYSVTF---TRAANVKV-PFAQ  353

Query  217  GALRWKSVKHHVRSPIAAKLV  155
            G L W S  H VRSPIA+  V
Sbjct  354  GYLNWVSADHVVRSPIASSSV  374


 Score = 79.7 bits (195),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -1

Query  1204  GGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINAT  1025
             G F+    KG  VK+A G  MI++  E YG  T+A+ HVLPA  +TYADG  I AYIN+T
Sbjct  101   GIFVRLINKGREVKDAGGAAMIVMNDEIYGNVTTASLHVLPASHVTYADGLSIKAYINST  160

Query  1024  SNPMATFSFKGTITGDKNAP  965
             S+PMAT  FKGT+ G  + P
Sbjct  161   SSPMATILFKGTVFGVPSHP  180


 Score = 66.2 bits (160),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 75/132 (57%), Gaps = 34/132 (26%)
 Frame = -1

Query  1894  RWKGVCELNFTACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANG  1715
             +WKG CE N T CNNK+IGAR+F    +   D +GHGTHTA TAAGN V GA+ +   NG
Sbjct  7     KWKGKCEFNGTLCNNKLIGARNFYSDGKPPIDGNGHGTHTASTAAGNPVPGASFFDQYNG  66

Query  1714  TAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIAL  1535
             TA                                  DGVD+LSLSLGG S  F+EDSIA+
Sbjct  67    TA----------------------------------DGVDVLSLSLGGPSVPFYEDSIAI  92

Query  1534  GAYSAMEKGIFV  1499
             GA+ A++KGIFV
Sbjct  93    GAFGAIQKGIFV  104



>ref|XP_007040055.1| Subtilase family protein [Theobroma cacao]
 gb|EOY24556.1| Subtilase family protein [Theobroma cacao]
Length=1087

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/723 (60%), Positives = 535/723 (74%), Gaps = 20/723 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S L TYIV ++ P    +        VDL+ WY+SFL  T +       R+V+ YRNV+ 
Sbjct  380   SSLSTYIVHLKKPEGVFTQV------VDLDGWYQSFLSFTSSQ----HRRIVYSYRNVIT  429

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAAKL+AEE + M  K+G ISA PE++  LHTTHSP FLGL QN G W  S+YGKGVII
Sbjct  430   GFAAKLTAEEAEAMKRKEGIISARPEKVYSLHTTHSPNFLGLHQNSGVWNQSNYGKGVII  489

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERS-VFdddg  1790
             G+LD+GI   HPSFSDEGMPPPPA+WKG CE   T CNNK+IGAR+F+E       D++G
Sbjct  490   GLLDTGITPGHPSFSDEGMPPPPAKWKGKCEFA-TGCNNKLIGARNFAEDVAGPATDEEG  548

Query  1789  hgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAI  1610
             HGTHTA TA GN+V+GANV+G+ANGTA G+APLAHLA+YKVC E GCS+S ILAAMD A+
Sbjct  549   HGTHTASTAGGNYVKGANVFGNANGTAVGMAPLAHLAMYKVCGE-GCSESAILAAMDAAV  607

Query  1609  EDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLT  1430
             EDGVD+LSLSLGG S  F EDSIA+GA++A++KGIFVS SAGNEGP  G+LSNEAPW+ T
Sbjct  608   EDGVDVLSLSLGGGSVPFFEDSIAVGAFTAIQKGIFVSCSAGNEGPLYGTLSNEAPWIFT  667

Query  1429  VGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSES  1250
             VGAST+DR ++AT  LGN     GE+ FQPKDF S+LL LV+ G N   ++SS +C   S
Sbjct  668   VGASTIDRGIAATAKLGNGLTIDGESLFQPKDFPSTLLPLVYAGAN--GKASSAFCAPRS  725

Query  1249  LRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDI  1070
             LR+ DV+GK+V+C  GG + R  KG+ VK+  G  MIL+  +  G +T A  HVLPA  +
Sbjct  726   LRDVDVKGKVVLCERGGDIGRIDKGQEVKDNGGAAMILMNDKLNGFSTIADPHVLPATHV  785

Query  1069  TYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGP  890
             ++  G KI  YIN+TS P AT  FKGT+ G+ +AP V +FSSRGPNR+S GILKPDIIGP
Sbjct  786   SFLAGLKIQDYINSTSEPTATILFKGTVIGNPSAPEVTSFSSRGPNRQSFGILKPDIIGP  845

Query  889   GVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMT  710
             GV+ILA WP SV+NK N+KSTFN+ISGTSMSCPHLSG+AALLKSSHPDWSPA IKSA++T
Sbjct  846   GVSILAAWPVSVENKTNTKSTFNMISGTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIIT  905

Query  709   TADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTN  530
             TA ++N G  PI +Q    A +F+ GAGHVNPSKANDPGL+YD +P+DY+ YLCGLNYT+
Sbjct  906   TATLVNLGGKPIVDQTKAPADIFATGAGHVNPSKANDPGLIYDIQPDDYIAYLCGLNYTD  965

Query  529   REVGVILQHRVNCSAVISIPEAQLNYPSFSIIL-ESTAQTYTRTVTNVGEASSFYTVEIF  353
              EVG I+Q  V CS+   I EA+LNYPSFSIIL ES +QTYTRTVTNVG ASS YT E+ 
Sbjct  966   EEVGTIVQRTVECSSESIIAEAELNYPSFSIILPESGSQTYTRTVTNVGPASSSYTYEVV  1025

Query  352   EPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSP  173
              P GV ++V+P  + F+ VNQK TY+VTFS     +        QG L W S +H+V +P
Sbjct  1026  APTGVDISVQPDHIAFTAVNQKATYSVTFSRQKDVSLQ----FSQGLLTWISAQHNVTTP  1081

Query  172   IAA  164
             I A
Sbjct  1082  IVA  1084


 Score =   183 bits (464),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 134/196 (68%), Gaps = 2/196 (1%)
 Frame = -1

Query  742  SPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDY  563
            +PAM KSA++TTAD +     PI ++    ++VF+IGAGHVNPSKANDPGLVYD +P+DY
Sbjct  194  APAM-KSAIITTADRVTLDGLPILDETWSPSNVFAIGAGHVNPSKANDPGLVYDMQPDDY  252

Query  562  LPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGE  383
            +PYLC L YT+ +V VI+Q  V CS   +I EA+LNYPSFSI+L ST +TYT TVTNVG 
Sbjct  253  IPYLCSLGYTDDQVRVIVQQSVRCSNDTNIAEAELNYPSFSIVLGSTNRTYTWTVTNVGP  312

Query  382  ASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRW  203
            A+S +T+ I  PPGV ++V    ++F++V Q  T++VTF LS K + +    V Q     
Sbjct  313  ANSSHTINIAAPPGVDISVTTNIIEFTEVKQNATFSVTFRLSWKTS-ALFVQVAQEVEDL  371

Query  202  KSVKHHVRSPIAAKLV  155
               K H +S ++  +V
Sbjct  372  PKSKEHEKSSLSTYIV  387


 Score =   104 bits (259),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 100/167 (60%), Gaps = 45/167 (27%)
 Frame = -1

Query  2011  MGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGAR  1832
             MGFW+ S++ KGVIIGV D+GI   HPSFSDEGM PPP +WKG CEL    CNNK+IGAR
Sbjct  1     MGFWKQSNFRKGVIIGVQDTGITPSHPSFSDEGM-PPPEKWKGRCEL--VECNNKLIGAR  57

Query  1831  SF--SERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNE  1658
             +F   E+ ++  D DGH THTA T AGNFV+GA+V+                        
Sbjct  58    NFRNDEQGQAPLDQDGHSTHTASTTAGNFVQGASVF------------------------  93

Query  1657  IGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAM  1517
                             EDGVD++S+S+GG S+ F+ED IA+GA+ A+
Sbjct  94    ----------------EDGVDVISISIGGASTPFYEDVIAVGAFGAI  124


 Score = 61.2 bits (147),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 10/82 (12%)
 Frame = -1

Query  1228  GKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQK  1049
             G I++C          KG+ VK+A G  MIL+  +    +T A  HVLPA  ++Y  G  
Sbjct  122   GAILIC----------KGQEVKDAGGAAMILMNDDLNKFSTLADPHVLPATHVSYTAGMN  171

Query  1048  ILAYINATSNPMATFSFKGTIT  983
             IL YIN+T+ P AT  F+GT +
Sbjct  172   ILNYINSTAKPTATILFEGTFS  193



>gb|KDO47505.1| hypothetical protein CISIN_1g042259mg [Citrus sinensis]
Length=745

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/724 (59%), Positives = 530/724 (73%), Gaps = 14/724 (2%)
 Frame = -1

Query  2329  ASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGG--GYGESRMVFMYRN  2156
             A+ L+TYIV V  P    +        +DL++WY++FLP  ++     +  SRMV+ YRN
Sbjct  29    ANGLQTYIVHVRKPKQEGNFSIK----LDLDNWYRTFLPDNISKSIDAHHRSRMVYGYRN  84

Query  2155  VMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKG  1976
             V+ GFAA+L+AEEVK M  K GFISA  E IL   TTHSP FLGL QN GFW+DS+ GKG
Sbjct  85    VISGFAARLTAEEVKAMETKSGFISARVENILEPQTTHSPNFLGLHQNSGFWKDSNLGKG  144

Query  1975  VIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVFdd  1796
             VIIGVLD GI   HPSFSDEGMPPPPA+WKG CEL    CNNK+IGAR+F  +     D+
Sbjct  145   VIIGVLDMGITPGHPSFSDEGMPPPPAKWKGKCELEGANCNNKIIGARNFLNKSEPPIDN  204

Query  1795  dghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVC-NEIGCSDSEILAAMD  1619
             DGHGTHTA TAAGNFV GAN++G ANGTAAG+APLAHLAIYKVC  ++GC +S + AA+D
Sbjct  205   DGHGTHTASTAAGNFVNGANLFGQANGTAAGMAPLAHLAIYKVCETDLGCPESIVNAAID  264

Query  1618  TAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPW  1439
              A+E+GVD+LS+SLG  S  F  D++A  A++A +KGI VS SAGN GP + +L+NEAPW
Sbjct  265   AAVEEGVDVLSISLGSPSLPFFADAMATAAFTASQKGILVSCSAGNSGPNSSTLANEAPW  324

Query  1438  MLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCD  1259
             MLTVGAST+DR + A   LGN++ + GET FQPKDF S  L LV+PG      SS+ +C 
Sbjct  325   MLTVGASTIDRSIVALTQLGNQETYDGETIFQPKDFPSKQLPLVYPGVK---NSSAAFCL  381

Query  1258  SESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPA  1079
              E+L++ DV+GK+V+C  GG   R  KG+ VK+A G  MIL+  E +   T A  HVLPA
Sbjct  382   PETLKSIDVKGKVVLCQRGGGTQRIRKGKDVKDAGGAAMILMNDELFDYGTVADNHVLPA  441

Query  1078  IDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDI  899
             + ++YA G++I AYIN+TS+P A+  FKGT+ G K+AP VA FSSRGPN  SPGILKPDI
Sbjct  442   VYVSYAAGERIKAYINSTSSPTASIVFKGTVIGKKSAPEVAVFSSRGPNTASPGILKPDI  501

Query  898   IGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSA  719
             IGPGV+ILA WP S +N  N+KSTF +ISGTSMSCPHLSG+AALLKS+HPDWSPA IKSA
Sbjct  502   IGPGVSILAAWPFSEENITNTKSTFTMISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSA  561

Query  718   MMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLN  539
             +MTTADI+N    PI N HL+ A +F++GAGHVNPSKANDPGLVY+   +DY+ YLCG N
Sbjct  562   IMTTADIVNLEGKPIMNHHLLPADLFAVGAGHVNPSKANDPGLVYEISHDDYVRYLCGKN  621

Query  538   YTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVE  359
             YT++++  I+ H V CS V SI EA+LNYPSFS+ L S+ QTY RTVTNVG+ +SFYT  
Sbjct  622   YTDQQIEGIVDHDVQCSKVSSIAEAELNYPSFSVKLGSSPQTYNRTVTNVGQDNSFYTHH  681

Query  358   IFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVR  179
             I  P GVK+ V+P ++ F++ NQK T++VTF     +  S+    VQG L W S  H VR
Sbjct  682   IIVPEGVKIIVQPDKISFTEKNQKATFSVTFIRDQNSNASS----VQGYLSWVSATHTVR  737

Query  178   SPIA  167
             SPIA
Sbjct  738   SPIA  741



>ref|XP_002325705.1| hypothetical protein POPTR_0019s00970g [Populus trichocarpa]
 gb|EEF00087.1| hypothetical protein POPTR_0019s00970g [Populus trichocarpa]
Length=697

 Score =   801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/694 (60%), Positives = 519/694 (75%), Gaps = 9/694 (1%)
 Frame = -1

Query  2245  DLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPER  2066
             D++ WY+SFLPT        + R+V  Y NV+ GFAAKL+ +E K M  K+G +SA P++
Sbjct  8     DVDSWYRSFLPTATTSSS-NQQRLVHSYHNVVTGFAAKLTEQEAKAMEMKEGVVSARPQK  66

Query  2065  ILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWK  1886
             I  + TTH+P FLGLQQN+GFW  SSYGKGVIIGVLD+GI   HPSFSDEGMPPPPA+WK
Sbjct  67    IFHVKTTHTPSFLGLQQNLGFWNHSSYGKGVIIGVLDTGIKASHPSFSDEGMPPPPAKWK  126

Query  1885  GVCELNFTACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAA  1706
             G C+ N T CNNK+IGARS     +   DD+GHGTHTA TAAG++V+GA+ YG  NGTA 
Sbjct  127   GKCDFNATLCNNKLIGARSLYLPGKPPVDDNGHGTHTASTAAGSWVQGASFYGQLNGTAV  186

Query  1705  GVAPLAHLAIYKVCNEIG-CSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGA  1529
             G+APLAHLAIY+VCN  G C+DS+ILA MDTA+EDGVD+LSLSLGG S  F+EDSIA+GA
Sbjct  187   GIAPLAHLAIYRVCNGFGSCADSDILAGMDTAVEDGVDVLSLSLGGPSIPFYEDSIAIGA  246

Query  1528  YSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETA  1349
             + A++KG+FVS +AGN GPFN +LSNEAPW+LTVGA TVDR + A V+LGN   + G++ 
Sbjct  247   FGAIQKGVFVSCAAGNSGPFNQTLSNEAPWILTVGAGTVDRNIRAKVLLGNNASYDGQSF  306

Query  1348  FQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEA  1169
             +QP +F+S+LL L++ G N +D   S +CD  SL++ DV+GK+V+C + GF     KG+ 
Sbjct  307   YQPTNFSSTLLPLIYAGANGND---SAFCDPGSLKDVDVKGKVVLCESRGFSGAVDKGQE  363

Query  1168  VKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGT  989
             VK A G  MIL+  E +G  T+A  HVLPA D+TYADG  I AYIN+TS+PMAT  F+GT
Sbjct  364   VKYAGGAAMILMNAESFGNITTADLHVLPASDVTYADGLSIKAYINSTSSPMATILFEGT  423

Query  988   ITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISG  809
             + G   AP +A FSSRGP+  SPGILKPDIIGPGV+ILA WP +VDN  N+KS FN+ISG
Sbjct  424   VFGVPYAPQLAYFSSRGPSLASPGILKPDIIGPGVDILAAWPYAVDNNGNTKSAFNMISG  483

Query  808   TSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGA  629
             TSM+ PHL+G+AALLKSSHPDWSPA IKSAMMTTA++ N G  PI +      +VFSIG+
Sbjct  484   TSMATPHLTGIAALLKSSHPDWSPAAIKSAMMTTANLTNLGGTPITDDTFDPVNVFSIGS  543

Query  628   GHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYP  449
             GHVNP+KA+DPGL+YD +P+DY+PYLCGL Y +  +G+I+Q  V C    SIPEAQLNYP
Sbjct  544   GHVNPTKADDPGLIYDIQPDDYIPYLCGLGYNDTAIGIIVQRSVTCRNSSSIPEAQLNYP  603

Query  448   SFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVT  269
             SFS+ L S+ QTYTRTVTNVG  +S Y  EI  P GV V V P  +QFS+ + K TY+VT
Sbjct  604   SFSLNLTSSPQTYTRTVTNVGPFNSSYNAEIIAPQGVDVKVTPGVIQFSEGSPKATYSVT  663

Query  268   FSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             F   ++ A +N+ P  QG L W S  H VRSPIA
Sbjct  664   F---TRTANTNL-PFSQGYLNWVSADHVVRSPIA  693



>ref|XP_002299578.1| hypothetical protein POPTR_0001s08340g [Populus trichocarpa]
 gb|EEE84383.1| hypothetical protein POPTR_0001s08340g [Populus trichocarpa]
Length=698

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/694 (60%), Positives = 517/694 (74%), Gaps = 8/694 (1%)
 Frame = -1

Query  2245  DLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPER  2066
             +L+ WY+SFLP  V      + R+V  Y NV+ GFAAKL+ +E K M  K+GF+SA P++
Sbjct  8     ELDSWYQSFLPA-VTTSSSNQQRLVHSYHNVVTGFAAKLTEKEAKAMEMKEGFVSAHPQK  66

Query  2065  ILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWK  1886
             +  + TTH+P FLGLQQN+GFW  S+YGKGVIIGVLD+GI   HPSFSDEGMPPPPA+WK
Sbjct  67    VFHVKTTHTPNFLGLQQNLGFWNHSNYGKGVIIGVLDTGITPSHPSFSDEGMPPPPAKWK  126

Query  1885  GVCELNFTACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAA  1706
             G CE N T CNNK+IGAR+F    +   DD+GHGTHTA TAAG+ V+GA+ Y   NGTA 
Sbjct  127   GKCEFNGTLCNNKLIGARNFDSAGKPPVDDNGHGTHTASTAAGSRVQGASFYDQLNGTAV  186

Query  1705  GVAPLAHLAIYKVCNEIG-CSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGA  1529
             G+A  AHLAIY+VC+  G C +S ILA MDTA+EDG D+LSLSLG  S  F+EDSIA+GA
Sbjct  187   GIASSAHLAIYQVCSGFGSCEESNILAGMDTAVEDGADVLSLSLGAGSLPFYEDSIAIGA  246

Query  1528  YSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETA  1349
             + A++KGIFVS +AGNEGPF GSLSNEAPW+LTVGASTVDR + ATV+LGN+  + G++ 
Sbjct  247   FGAIQKGIFVSCAAGNEGPFKGSLSNEAPWILTVGASTVDRSIRATVLLGNKASYDGQSF  306

Query  1348  FQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEA  1169
             +QP +F+S+LL L++ G N SD ++  +CD  SL++ DV+GK+V+C +GGF +   KG+ 
Sbjct  307   YQPTNFSSTLLPLIYAGANGSDTAA--FCDPGSLKDVDVKGKVVLCESGGFSESVDKGQE  364

Query  1168  VKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGT  989
             VK+A G  MI++  E  G  T+A  HVLPA D+TYADG  I AYIN+TS+PMAT  FKGT
Sbjct  365   VKDAGGAAMIIMNDELSGNITTADFHVLPASDVTYADGLSIKAYINSTSSPMATILFKGT  424

Query  988   ITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISG  809
             + G   AP +A FSSRGP+ ESPGILKPDIIGPGV+ILA WP +VDN  N+KSTFN+ISG
Sbjct  425   VFGVPYAPQLADFSSRGPSLESPGILKPDIIGPGVDILAAWPYAVDNNRNTKSTFNMISG  484

Query  808   TSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGA  629
             TSM+ PHLSG+AALLKSSHPDWSPA IKSA+MTTA++ N G  PI +       VF+IG+
Sbjct  485   TSMATPHLSGIAALLKSSHPDWSPAAIKSAIMTTANLTNLGGTPITDDSFGPVDVFAIGS  544

Query  628   GHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYP  449
             GHVNP+KA+DPGLVYD +P+DY+PYLCGL Y N EVG+I+Q  V CS   SIPEAQLNYP
Sbjct  545   GHVNPTKADDPGLVYDIQPDDYIPYLCGLGYNNTEVGIIVQRPVTCSNSSSIPEAQLNYP  604

Query  448   SFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVT  269
             SFSI L S+ QTYTRTVTNVG   S Y  EI  P GV V V P  + F   + K  Y+VT
Sbjct  605   SFSIKLGSSPQTYTRTVTNVGPFKSSYIAEIIAPQGVDVKVTPNAIPFGGGDPKAAYSVT  664

Query  268   FSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             F   ++ A  N+ P  QG L W S  H VR+PIA
Sbjct  665   F---TRTANVNL-PFSQGYLNWVSADHVVRNPIA  694



>gb|KDP25551.1| hypothetical protein JCGZ_20707 [Jatropha curcas]
Length=757

 Score =   801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/762 (56%), Positives = 544/762 (71%), Gaps = 33/762 (4%)
 Frame = -1

Query  2377  FLILSVLIGFCSTATIASK----------LETYIVRVELPHsristqsssssSVDLEHWY  2228
             FLI+  L  F      A+K          L+ YIV V  P  R  +Q       +LE+W+
Sbjct  6     FLIVIFLFNFYPNIAQAAKHTTEITENKNLQAYIVHVSPPEGRTFSQRE-----NLENWH  60

Query  2227  KSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             KSFLP + A     + RM++ Y N++ GF+A+L+ EEVK M   +GF+ A PER L L T
Sbjct  61    KSFLPFSTASSEKQQKRMLYSYHNIISGFSARLTHEEVKAMEEINGFVLARPERKLHLQT  120

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             TH+P FLGL + MGFW++S++GKGVIIGVLD G+   HPSF+D+GMPPPPA+WKG CE N
Sbjct  121   THTPSFLGLHRQMGFWKESNFGKGVIIGVLDGGVFPSHPSFNDKGMPPPPAKWKGRCEFN  180

Query  1867  FTACNNKVIGARSFSERERSV--------FdddghgthtagtaaGNFVRGANVYGSANGT  1712
              + CNNK+IGARSF+   +++         D DGHGTHTA TAAG+FV  ANV G+A GT
Sbjct  181   ASKCNNKLIGARSFNLAAKAMKGIAAETPIDVDGHGTHTASTAAGSFVYNANVLGNAKGT  240

Query  1711  AAGVAPLAHLAIYKVC----NEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDS  1544
             A G+AP AHLAIYKVC    N+  C +S+ILA +D AI+DGVD+LSLS+G +S  F +D+
Sbjct  241   AVGMAPYAHLAIYKVCFGDPND-DCPESDILAGLDAAIQDGVDVLSLSIGDISMPFFQDN  299

Query  1543  IALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQF  1364
             IA+G+++A++KGIFVS +AGN GPFNG+LSNEAPW+LTVGAST+DRK++AT  LGN ++ 
Sbjct  300   IAIGSFAAIQKGIFVSCAAGNSGPFNGTLSNEAPWILTVGASTIDRKIAATAKLGNGEEL  359

Query  1363  HGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRR  1184
              GE+  QP +F ++LL LV+PG N   ES+  +C   +++  DV+ K+V+C  GG + R 
Sbjct  360   DGESVLQPSNFPTTLLPLVYPGMNGKTESA--FCSERAVQGMDVKDKVVLCERGGGIGRV  417

Query  1183  GKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATF  1004
              KGE VKNA G  MILI  E  G +T A AHVLPA  +++A G +I AYIN+T  PMAT 
Sbjct  418   AKGEEVKNAGGAAMILINDEISGFSTIADAHVLPATHVSFAAGLQIKAYINSTKTPMATI  477

Query  1003  SFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTF  824
              FKGT+ GD  +P V +FSSRGPN  SPGILKPDIIGPGV+ILA WP  +DN  N+KSTF
Sbjct  478   LFKGTVIGDPLSPAVTSFSSRGPNLASPGILKPDIIGPGVSILAAWPFPLDNTTNTKSTF  537

Query  823   NIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASV  644
             N++SGTSM+CPHLSG+AALLKSSHP WSPA IKSA+MTTADI N   +PI ++    A +
Sbjct  538   NLVSGTSMACPHLSGIAALLKSSHPYWSPAAIKSAIMTTADIFNMEGSPIVDEKHQPADL  597

Query  643   FSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEA  464
             F+IGAGHVNPS+ANDPGL+YD +P+DY+PYLCGL Y   +V +I   R+ CS  +SIPE 
Sbjct  598   FTIGAGHVNPSRANDPGLIYDIQPDDYIPYLCGLGYKEEQVSIIAHRRIKCSEKLSIPEG  657

Query  463   QLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKL  284
             QLNYPSFS+ L   +QT+TRTVTNVGEA+S Y   I  PPGV V VEP  L FS+VNQK+
Sbjct  658   QLNYPSFSVTL-GASQTFTRTVTNVGEANSVYAATIVPPPGVAVTVEPYRLYFSQVNQKV  716

Query  283   TYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
             TY+VTFS +  + +++     QG + W S KH VRSPI+ + 
Sbjct  717   TYSVTFSPTGSSGKTS--EFAQGYILWSSAKHLVRSPISVRF  756



>ref|XP_002275471.2| PREDICTED: uncharacterized protein LOC100242816 [Vitis vinifera]
Length=1485

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/724 (60%), Positives = 547/724 (76%), Gaps = 11/724 (2%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGF  2141
             L+TYIV V+  H R+ T+S       LE WY+SFLP   A     + R+V+ YRNV+ GF
Sbjct  58    LQTYIVHVKRTHRRVFTKSDG-----LESWYESFLPVATASSNR-KQRIVYSYRNVLNGF  111

Query  2140  AAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGV  1961
             AAKL+A+EVK M  KDGF+SA P+RILPLHTTHSP FLGL Q +GFW+ S+YGKGVIIGV
Sbjct  112   AAKLTAQEVKAMEEKDGFVSARPQRILPLHTTHSPSFLGLHQELGFWKGSNYGKGVIIGV  171

Query  1960  LDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSV--Fdddgh  1787
             LD+G+  DHPSFSDEG+PPPPA+WKG C+ N+T+CNNK+IGAR+F     +V   D++GH
Sbjct  172   LDTGLFPDHPSFSDEGLPPPPAKWKGKCDFNWTSCNNKIIGARNFDSGAEAVPPIDEEGH  231

Query  1786  gthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIE  1607
             GTHTA TAAGNFV  A+  G+ANGTA G+AP AHLAIYKVC+E GC+D++ILAA+DTAIE
Sbjct  232   GTHTASTAAGNFVPNADALGNANGTAVGMAPFAHLAIYKVCSEFGCADTDILAALDTAIE  291

Query  1606  DGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTV  1427
             DGVD+LSLSLGG S+ F  DSIALGA+SA++KGIFVS SAGN GP NGSLSNEAPW+LTV
Sbjct  292   DGVDVLSLSLGGGSAPFFADSIALGAFSAIQKGIFVSCSAGNSGPLNGSLSNEAPWILTV  351

Query  1426  GASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESL  1247
             GAST+DRK+ AT  LGN ++F GE+ FQP DF S+LL LV+ G N +  +SS  C  ESL
Sbjct  352   GASTIDRKIMATATLGNGEEFDGESLFQPSDFPSTLLPLVYAGANGN--ASSALCAPESL  409

Query  1246  RNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDIT  1067
             ++ DV GK+VVC  GG + R  KG+ VK+A G  MIL   E  G +T   AHVLPA  ++
Sbjct  410   KDVDVAGKVVVCDRGGGIGRIAKGQEVKDAGGAAMILTNDELNGFSTLVDAHVLPATHVS  469

Query  1066  YADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPG  887
             YA G KI +YI + S P AT  FKGTI G   AP V +FSSRGP+ ESPGILKPDIIGPG
Sbjct  470   YAAGLKIKSYIKSDSAPTATIVFKGTIIGVPTAPEVTSFSSRGPSLESPGILKPDIIGPG  529

Query  886   VNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTT  707
             V+ILA WP  ++N   SK TFN+ISGTSMSCPHLSG+AAL+KS+HPDWSPA IKSA++TT
Sbjct  530   VSILAAWPFPLENDTTSKPTFNVISGTSMSCPHLSGIAALIKSAHPDWSPAAIKSAIITT  589

Query  706   ADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNR  527
             AD+ N    PI ++    A +F+ GAGHVNPS ANDPGL+YD +P+DY+PYLCGL YT+ 
Sbjct  590   ADLHNLENKPIIDETFQPADLFATGAGHVNPSAANDPGLIYDLEPDDYIPYLCGLGYTDE  649

Query  526   EVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEP  347
             EVG+I+   + CS   SIPEAQLNYPSFSI L  ++ TY+RTVTNVG A+S Y+V+I  P
Sbjct  650   EVGLIVNRTLKCSEESSIPEAQLNYPSFSIALGPSSGTYSRTVTNVGAANSSYSVQILAP  709

Query  346   PGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
              GV+V+V P +L+F++VNQK+TY V+FS +S+ ++  +  + QG+    S++   +S + 
Sbjct  710   SGVEVSVNPDKLEFTEVNQKITYMVSFSRTSQRSQLFL-EIAQGSQFSSSIETTEKSMLQ  768

Query  166   AKLV  155
               +V
Sbjct  769   TYIV  772


 Score =   805 bits (2079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/749 (58%), Positives = 547/749 (73%), Gaps = 21/749 (3%)
 Frame = -1

Query  2383  RMFLILSVLIGFCST--ATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPT  2210
             ++FL ++    F S+   T  S L+TYIV     H +   +S+++   +LE W++SFLP 
Sbjct  744   QLFLEIAQGSQFSSSIETTEKSMLQTYIV-----HVKQLERSTTAQQENLESWHRSFLPV  798

Query  2209  TVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGF  2030
               A     E R+V+ Y+NV+ GFAA+L+ EEV+ M N DGFISA+PE++LPL TTHSP F
Sbjct  799   ATATSDNQE-RLVYSYKNVISGFAARLTEEEVRAMENMDGFISASPEKMLPLLTTHSPDF  857

Query  2029  LGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNN  1850
             LGL Q MGFW++S++GKGVIIGVLDSG+   HPSFS EG+PPPPA+WKG CE   + CNN
Sbjct  858   LGLHQEMGFWKESNFGKGVIIGVLDSGVLPSHPSFSGEGIPPPPAKWKGSCEFMASECNN  917

Query  1849  KVIGARSFSERERSV--------FdddghgthtagtaaGNFVRGANVYGSANGTAAGVAP  1694
             K+IGARSF+   ++          DDDGHGTHTA TAAG FV+ A+V G+A GTA G+AP
Sbjct  918   KLIGARSFNVGAKATKGVTAEPPLDDDGHGTHTASTAAGAFVKNADVLGNAKGTAVGMAP  977

Query  1693  LAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAME  1514
              AHLAIYKVC    C +S+++A +D A+EDGVD++S+SLG  +  F +D+IA+G+++AM+
Sbjct  978   YAHLAIYKVCFGPDCPESDVIAGLDAAVEDGVDVISISLGDPAVPFFQDNIAVGSFAAMQ  1037

Query  1513  KGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKD  1334
             KGIFVS SAGN GPFN +LSNEAPW+LTVGAS++DR + A   LGN +QF GET FQP D
Sbjct  1038  KGIFVSCSAGNSGPFNTTLSNEAPWILTVGASSIDRTIKAAAKLGNGEQFDGETLFQPSD  1097

Query  1333  FNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNAS  1154
             F ++ L LV+ G N   ES+   C   SL+N DV+GK+V+C  GG + R  KG  VKNA 
Sbjct  1098  FPATQLPLVYAGMNGKPESA--VCGEGSLKNIDVKGKVVLCDRGGGIARIDKGTEVKNAG  1155

Query  1153  GRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDK  974
             G  MIL+  E  G +T A AHVLPA  ++YA G KI AYIN+T+ P A   FKGT+ G+ 
Sbjct  1156  GAAMILVNQESDGFSTLADAHVLPATHVSYAAGLKIKAYINSTATPTAAILFKGTVIGNP  1215

Query  973   NAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSC  794
              +P + +FSSRGP+  SPGILKPDIIGPGV+ILA WP  +DN  NSKSTFNIISGTSMSC
Sbjct  1216  LSPAITSFSSRGPSFASPGILKPDIIGPGVSILAAWPFPLDNNINSKSTFNIISGTSMSC  1275

Query  793   PHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNP  614
             PHLSG+AALLKSSHPDWSPA IKSA+MTTAD+LN G  PI ++ L+ A +F+ GAGHVNP
Sbjct  1276  PHLSGIAALLKSSHPDWSPAAIKSAIMTTADLLNVGGKPIVDERLLPADIFATGAGHVNP  1335

Query  613   SKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSII  434
             S+ANDPGLVYD +P+DY+PYLCGL YT+ EVG++    + CS   SIPE +LNYPSFS+ 
Sbjct  1336  SRANDPGLVYDIEPDDYIPYLCGLGYTDTEVGILAHRSIKCSEESSIPEGELNYPSFSVA  1395

Query  433   LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSS  254
             L    QT+TRTVTNVGEA S YTV    P GV V+V P +L FSKVNQKLTY+VTFS +S
Sbjct  1396  L-GPPQTFTRTVTNVGEAYSSYTVTAIVPQGVDVSVNPDKLYFSKVNQKLTYSVTFSHNS  1454

Query  253   KAARSNMPPVVQGALRWKSVKHHVRSPIA  167
              + +S+     QG L+W S KH V SPI+
Sbjct  1455  SSGKSSK--FAQGYLKWVSGKHSVGSPIS  1481



>ref|XP_004300734.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=765

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/724 (59%), Positives = 534/724 (74%), Gaps = 14/724 (2%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGES-RMVFMYRNVMKG  2144
             ++TYIV +E P   + +    S   DLE WY+S+LP T+A     E  RMV+ YRNV  G
Sbjct  44    MQTYIVWLEKP---VGSLLEQSDHADLESWYQSYLPQTIASSNQLEKPRMVYAYRNVATG  100

Query  2143  FAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIG  1964
             FAAKL+ EEV EM  K+GFISA PER L +HTTHSP FLGLQQ MG  + S+YG+G+IIG
Sbjct  101   FAAKLTVEEVAEMEKKEGFISAHPERNLQMHTTHSPNFLGLQQGMGLSKGSNYGEGMIIG  160

Query  1963  VLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERS---VFddd  1793
             VLDSGI  DHPSF+DEG+PPPPA+WKG C+ N T CNNK+IGARSF+  + +     DD+
Sbjct  161   VLDSGIFPDHPSFNDEGVPPPPAKWKGRCDFNGTVCNNKLIGARSFNGGKTTGAPPVDDE  220

Query  1792  ghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTA  1613
             GHGTHT+ TAAGNFV+GA+V+G ANGTA G+AP AH+A+YKVC+E GCS+S+I+AAMDTA
Sbjct  221   GHGTHTSTTAAGNFVKGASVFGMANGTATGMAPHAHVAMYKVCSEDGCSESDIIAAMDTA  280

Query  1612  IEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWML  1433
             ++DGVD+LSLSLGG S+ F+ D IA+GA+ AM+KGIFVS SAGNEGP   +LSNEAPW+L
Sbjct  281   VDDGVDVLSLSLGGGSAFFYADGIAVGAFGAMQKGIFVSCSAGNEGPDYQTLSNEAPWIL  340

Query  1432  TVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSE  1253
             TVGAST+DR + AT  LGN Q++ GE+ FQPKDF+S L+ LV+ G ++++  SS +CD  
Sbjct  341   TVGASTIDRSIRATAKLGNGQEYDGESLFQPKDFSSDLVPLVYAGAHSNE--SSAFCDEG  398

Query  1252  SLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAID  1073
             SL N  V GK+VVC  GG + R  KG  VK A G  MIL+ P+  G +T A AHVLPA  
Sbjct  399   SLTN--VGGKVVVCELGGGVARIAKGVEVKRAGGVAMILVNPDFGGYSTLADAHVLPATH  456

Query  1072  ITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIG  893
             +++A G  I  YIN+TS P AT  FKGT+ GD+ AP V  FSSRGP+  SP ILKPDIIG
Sbjct  457   VSFAAGVSIKTYINSTSTPTATVLFKGTVIGDQLAPKVGFFSSRGPSLASPAILKPDIIG  516

Query  892   PGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMM  713
             PGV+ILA WP SVDN  +SK+TFNIISGTSMSCPHLSG+AALLKS HPDWSPA IKSAMM
Sbjct  517   PGVSILAAWPFSVDNATDSKATFNIISGTSMSCPHLSGIAALLKSVHPDWSPAAIKSAMM  576

Query  712   TTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYT  533
             TTA++ N   + I ++ L  A +F+IGAGHVNPSKANDPGL+YD +P+DY+PYLCGLNYT
Sbjct  577   TTAEVNNLAGSAILDETLSAADLFAIGAGHVNPSKANDPGLIYDIQPQDYIPYLCGLNYT  636

Query  532   NREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL--ESTAQTYTRTVTNVGEASSFYTVE  359
             ++++  I Q +V CS V +IPE QLNYPSFSI +      Q YTRT+TNVG A+S Y + 
Sbjct  637   SKQIAAITQQKVQCSKVGAIPEGQLNYPSFSIFILPGGKPQKYTRTLTNVGPANSTYKLA  696

Query  358   IFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVR  179
                   + + V P  L F++VNQKLTY V F+    A    + P  QG L W S +H V 
Sbjct  697   PLSQHKMNITVLPEVLTFTEVNQKLTYQVVFAAQDGAGGDGI-PFSQGYLSWVSNQHTVN  755

Query  178   SPIA  167
             +PI+
Sbjct  756   TPIS  759



>gb|KDP25554.1| hypothetical protein JCGZ_20710 [Jatropha curcas]
Length=746

 Score =   798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/722 (60%), Positives = 527/722 (73%), Gaps = 22/722 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             SKLETYIV +E P   +   S      DL+ WY+SFLP         + R+V  Y  V+ 
Sbjct  41    SKLETYIVFLEKPEGAVFKDSK-----DLDSWYQSFLPDDTFSSN--QPRLVHSYHQVVT  93

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAAKL+ EEVKE+  K+GF+SA P R++PLHTTH+P FLGLQQN+GFW  S+YGKGVII
Sbjct  94    GFAAKLTTEEVKEIAKKEGFVSARPRRMVPLHTTHTPSFLGLQQNIGFWNYSNYGKGVII  153

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT-ACNNKVIGARSFSERERSVFdddg  1790
             G++DSGI  DHPSFS EGMPPPPA+WKG CELN T +CNNK+IGAR+F+    +  D+  
Sbjct  154   GLIDSGITPDHPSFSGEGMPPPPAKWKGKCELNGTYSCNNKLIGARNFALDSNNTDDEYH  213

Query  1789  hgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIG-CSDSEILAAMDTA  1613
             HGTHTA TAAGN V GA+ +G ANGTA G+APLAHLA+YKV        DSEILAAMD A
Sbjct  214   HGTHTASTAAGNPVEGASYFGHANGTAVGMAPLAHLAMYKVSGRASEAGDSEILAAMDAA  273

Query  1612  IEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWML  1433
             +ED VD+LSLSLG  S  F++D IALGAY+A++KGIFVS SAGN GP+N SLSNEAPW+L
Sbjct  274   VEDNVDVLSLSLGIGSHPFYDDVIALGAYAAIQKGIFVSCSAGNSGPWNSSLSNEAPWIL  333

Query  1432  TVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSE  1253
             TVGASTVDR + ATV+LGN  + +GE+ FQP DF S+LL LV+ G + ++  SS YC+  
Sbjct  334   TVGASTVDRAIRATVLLGNNVELNGESLFQPADFPSTLLPLVYAGADGNE--SSAYCEPG  391

Query  1252  SLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAID  1073
             SL N DV+GKIV+C  GG+     KGE VKN  G  MI +  E  G  T A  HVLPA  
Sbjct  392   SLANIDVKGKIVLC-EGGY-GSISKGEEVKNNGGVAMIAMNGEYDGFVTGAQLHVLPASR  449

Query  1072  ITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIG  893
             ++Y DG  I AYI +T +P AT  FKGT+TG  NAP +A FSSRGPN  SPGILKPDIIG
Sbjct  450   VSYMDGLAIKAYIYSTPSPNATILFKGTVTGLPNAPQLAEFSSRGPNIASPGILKPDIIG  509

Query  892   PGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMM  713
             PGV ILA WP SVDN     + F +ISGTSMSCPHLSG+AALLK++HPDWSPA IKSA+M
Sbjct  510   PGVKILAAWPVSVDNS----TKFAMISGTSMSCPHLSGIAALLKNAHPDWSPAAIKSAIM  565

Query  712   TTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYT  533
             T A++++ G  PI ++  VT +VF IGAGHVNPS+ANDPGL+YD +P+DY+PYLCGL Y+
Sbjct  566   TAANLVDLGGKPISDEQFVTTTVFDIGAGHVNPSRANDPGLIYDIQPDDYIPYLCGLGYS  625

Query  532   NREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIF  353
             +++VG+I+QH V CS   ++ EAQLNYPSFSI L ST QTYTRTVTNVG+ +S YT+EI 
Sbjct  626   DKQVGLIVQHTVTCSNDSNVLEAQLNYPSFSIKLGSTPQTYTRTVTNVGQPNSIYTLEIL  685

Query  352   EPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSP  173
              P GV + V P  + F+ VNQK TY+VTFS    A+ +      QG L W +  + VRSP
Sbjct  686   APEGVNIKVTPDTINFNGVNQKATYSVTFSRDEYASGA-----TQGYLNWVADGYSVRSP  740

Query  172   IA  167
             IA
Sbjct  741   IA  742



>gb|KDP25559.1| hypothetical protein JCGZ_20715 [Jatropha curcas]
Length=745

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/744 (58%), Positives = 521/744 (70%), Gaps = 15/744 (2%)
 Frame = -1

Query  2392  KFLRMFLILSVLIGFCSTATIASK-LETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             K + + L+  V I   S AT   + +ETYIV VE P S  S Q+      DL+ WY+SFL
Sbjct  11    KMVVICLLSLVSIASSSLATTEERNIETYIVLVEKPESAASMQAK-----DLDIWYQSFL  65

Query  2215  PTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSP  2036
             P + +      +R+V+ Y NV+ GFAAK++AEE K +  K+GF+ A PE++L LHTTHSP
Sbjct  66    PVSNSKSNQ-TARIVYSYHNVVSGFAAKMTAEEAKSIEGKEGFLLARPEKVLHLHTTHSP  124

Query  2035  GFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTAC  1856
              FLGLQQN+GFW  SSYGKGVIIGVLD+GI  DHPSFSDEGMPPPPA+WKG CE N   C
Sbjct  125   RFLGLQQNVGFWNYSSYGKGVIIGVLDTGIFPDHPSFSDEGMPPPPAKWKGKCEFNEIVC  184

Query  1855  NNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAI  1676
             NNK+IGAR+F    +            +  A    V+ AN++G ANGTA G+APLAHLA+
Sbjct  185   NNKLIGARNFISAGKPPIGFGHGTHTASTAAGSP-VQSANLFGQANGTAVGIAPLAHLAM  243

Query  1675  YKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVS  1496
             YKVC   GC ++ +LAAMDTAI+DGVD+LSLSLGG S  F  D IA+GAY A+ KGIFVS
Sbjct  244   YKVCAGFGCPETAVLAAMDTAIDDGVDVLSLSLGGASLPFFHDVIAIGAYGAIRKGIFVS  303

Query  1495  ASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLL  1316
              SAGN GP N SLSNEAPW+LTVGAST+DR + AT++LGN   F+GE+ FQPKD     L
Sbjct  304   CSAGNSGPGNSSLSNEAPWILTVGASTIDRTIRATILLGNMSTFYGESLFQPKDLLPKFL  363

Query  1315  SLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMIL  1136
              LV+ G N    +SS +C   SLR  DV+GKIV+C +GG ++R  KG+ VK+  G  MIL
Sbjct  364   PLVYAGAN--GNASSAFCAPGSLRKVDVKGKIVLCESGGEIERIDKGQEVKDNGGAAMIL  421

Query  1135  IEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVA  956
             +  E  G  T A  HVLPA  + Y DG  I +Y N+TS+P+AT  F+GT+TG   AP VA
Sbjct  422   MNDELNGYITEADFHVLPASHVNYVDGIAIKSYFNSTSSPVATILFQGTVTGLPKAPQVA  481

Query  955   AFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGV  776
              FSSRGP+  SPGILKPDI GPGV+ILA WP SVDN+  SKSTFN +SGTSMSCPHLSGV
Sbjct  482   EFSSRGPSVASPGILKPDITGPGVSILAAWPISVDNRIKSKSTFNFLSGTSMSCPHLSGV  541

Query  775   AALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDP  596
             AALLKS+HPDWSPA IKSA+MTTA I N    PI ++  V A+VF +G+GHVNPS+AN+P
Sbjct  542   AALLKSAHPDWSPAAIKSAIMTTARISNLLGEPISDEQFVPANVFDLGSGHVNPSEANNP  601

Query  595   GLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQ  416
             GLVYD +P+DY+PYLCGL Y+++EVG+I+Q  V CS    IPEAQLNYPSFSI L ST Q
Sbjct  602   GLVYDIQPDDYIPYLCGLAYSDKEVGLIVQRPVKCSNYSRIPEAQLNYPSFSIKLGSTPQ  661

Query  415   TYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKV-NQKLTYNVTFSLSSKAARS  239
             TY RTVTNVG   S +  EI  PPGV V V+P  L FS   NQK TY+VTF  +  A  +
Sbjct  662   TYLRTVTNVGLPGSAFLPEIIAPPGVDVEVKPNALVFSNSENQKATYSVTFRRNGNANGA  721

Query  238   NMPPVVQGALRWKSVKHHVRSPIA  167
                   QG + W S  + V SPIA
Sbjct  722   ----FAQGYITWTSELYSVTSPIA  741



>ref|XP_004300735.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=756

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/727 (58%), Positives = 541/727 (74%), Gaps = 14/727 (2%)
 Frame = -1

Query  2329  ASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGG-YGESRMVFMYRNV  2153
             A  ++TYIV +E P S    QS      DLE WY+SFLP T+       + RM++ Y NV
Sbjct  33    ADSMQTYIVLIERPTSNFGPQSDHE---DLERWYQSFLPQTIVNSNQLVKPRMIYAYHNV  89

Query  2152  MKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGV  1973
             + GFAAKL+AEEV+EM  KDGFI+A PER L LHTTHSP FLGLQQ +G W+ S+YG+GV
Sbjct  90    VTGFAAKLTAEEVEEMEKKDGFITAHPERNLQLHTTHSPNFLGLQQGVGLWKGSNYGEGV  149

Query  1972  IIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERS---VF  1802
             IIGVLD+GI   HPSFSD+G+PPPPA+WKG C+ N T CNNK+IGARSF   + +     
Sbjct  150   IIGVLDTGITPGHPSFSDKGVPPPPAKWKGKCDFNATFCNNKLIGARSFQGGKTTGAPPV  209

Query  1801  dddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAM  1622
             D  GHGTHT+ TAAGNFV+GA+V+G ANGTA+G+AP AHLA+Y+VCNE GC +S+ILAAM
Sbjct  210   DIIGHGTHTSSTAAGNFVKGASVFGMANGTASGMAPYAHLAMYQVCNEQGCDESDILAAM  269

Query  1621  DTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAP  1442
             DTA++DGVD+LS+SLGG S++F+ D IA+G+Y A++ GIFVS SAGN+GP   S++NEAP
Sbjct  270   DTAVDDGVDVLSISLGGGSATFYWDYIAIGSYGAIQNGIFVSCSAGNDGPDYSSVTNEAP  329

Query  1441  WMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYC  1262
             W+LTVGAS++DR + AT  LGN +++ GE+ FQPKDF+S L  LV+ G ++ D  S+ +C
Sbjct  330   WILTVGASSIDRHIIATAKLGNGEEYDGESVFQPKDFDSKLYPLVYAGPHSKD--STAFC  387

Query  1261  DSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLP  1082
             D  SL   DV GK+VVC  GG + R  KG  VK A G  MIL+  +  G TT A AHVLP
Sbjct  388   DVGSL--TDVEGKVVVCEVGGDIARIAKGIEVKRAGGVAMILVNQDFGGYTTIADAHVLP  445

Query  1081  AIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPD  902
             A  ++YA G  I  YIN+TS P AT  FKGT+ GD+ AP V+ FSSRGP+  +PGILKPD
Sbjct  446   ATHVSYAAGVSIKTYINSTSTPTATILFKGTVIGDQLAPKVSFFSSRGPSMATPGILKPD  505

Query  901   IIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKS  722
             IIGPGV+ILA WP  VDN   SK+TF+IISGTSMSCPHLSG+AALLKSSHPDWSPA IKS
Sbjct  506   IIGPGVSILAAWPFLVDNSTQSKATFDIISGTSMSCPHLSGIAALLKSSHPDWSPAAIKS  565

Query  721   AMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGL  542
             A+MTTA++ N   +PI ++ L  A++F+IGAGHVNPSKANDPGL+YDT+PEDY+PY CGL
Sbjct  566   AIMTTAEVDNLAGSPIVDETLYAANLFAIGAGHVNPSKANDPGLIYDTQPEDYIPYFCGL  625

Query  541   NYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTA--QTYTRTVTNVGEASSFY  368
             NYT++++ +I Q +V CS V +IPEAQLNYP+FS+ ++     Q YTRTVTNVG A S Y
Sbjct  626   NYTDQQIQIITQQKVKCSEVGAIPEAQLNYPTFSLFIDPAGKPQNYTRTVTNVGPAKSTY  685

Query  367   TVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKH  188
              + +  P  + + V+P +L F++V QK+TY+V F+  + A +  +  + QG L W S +H
Sbjct  686   ELAVVSPHKMDIRVQPEKLTFTEVGQKMTYHVVFTAQNGAGKDGI-TMSQGYLSWVSDQH  744

Query  187   HVRSPIA  167
              VRS I+
Sbjct  745   AVRSQIS  751



>ref|XP_003525747.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=749

 Score =   793 bits (2049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/757 (56%), Positives = 530/757 (70%), Gaps = 25/757 (3%)
 Frame = -1

Query  2389  FLRMFLILSVLIGFC-----STATIASKLETYIVRVELPHsristqsssssSVDLEHWYK  2225
             F+    +LS  I F      ++AT +SK  TYI+ V  P  +   QS      DLE WY+
Sbjct  6     FIAFTFVLSFHIHFAHGNELNSATSSSK--TYIIHVTGPQGKTLAQSE-----DLESWYR  58

Query  2224  SFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTT  2045
             SF+P T+      + RM++ YRNVM GFAA+L+ EE++ +  K+GFISA PER+L   TT
Sbjct  59    SFMPPTIMSSEE-QPRMIYSYRNVMSGFAARLTEEELRSVQKKNGFISAHPERMLHRQTT  117

Query  2044  HSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNF  1865
             H+P FLGLQQ+MGFW++S++GKGVI+GV+DSGI  DHPSFSD GMPPPP +WKG CELN 
Sbjct  118   HTPQFLGLQQDMGFWKESNFGKGVIVGVVDSGIEPDHPSFSDAGMPPPPLKWKGRCELNA  177

Query  1864  TACNNKVIGARSFS------ERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAG  1703
             T CNNK+IGARSF+      +   S  D+DGHGTHT+ TAAG FV  A V G+A GTAAG
Sbjct  178   TFCNNKLIGARSFNLAATAMKGADSPIDEDGHGTHTSSTAAGAFVDHAEVLGNAKGTAAG  237

Query  1702  VAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVD-IlslslggmssSFHEDSIALGAY  1526
             +AP AHLA+Y+VC    C++S+ILAA+D A+EDGVD I           F  DSIA+GA+
Sbjct  238   IAPYAHLAMYRVCFGEDCAESDILAALDAAVEDGVDVISISLGLSEPPPFFNDSIAIGAF  297

Query  1525  SAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAF  1346
             +AM+KGIFVS +AGN GPF+GSL N APW+LTVGAS +DR ++AT  LGN Q+F GE+ F
Sbjct  298   AAMQKGIFVSCAAGNSGPFHGSLVNGAPWVLTVGASNIDRSIAATAKLGNGQEFDGESVF  357

Query  1345  QPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAV  1166
             QP DF+ +LL L + G+N   E++  +C + SL + D RGK+V+C  GG + R  KGE V
Sbjct  358   QPSDFSPTLLPLAYAGKNGKQEAA--FCANGSLNDCDFRGKVVLCERGGGIGRIAKGEEV  415

Query  1165  KNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTI  986
             K   G  MIL+  E  G +  A  HVLPA  ++Y  G KI AYIN+T+ P AT  FKGTI
Sbjct  416   KRVGGAAMILMNDESNGFSVLADVHVLPATHLSYDSGLKIKAYINSTAIPTATILFKGTI  475

Query  985   TGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGT  806
              G+  AP V +FSSRGPN  SPGILKPDIIGPGVNILA WP  ++N  +SKSTFNI+SGT
Sbjct  476   IGNSLAPAVTSFSSRGPNLPSPGILKPDIIGPGVNILAAWPFPLNNDTDSKSTFNIMSGT  535

Query  805   SMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAG  626
             SMSCPHLSGVAALLKSSHP WSPA IKSA+MT+ADI+N     I ++ L  A VF+ G+G
Sbjct  536   SMSCPHLSGVAALLKSSHPHWSPAAIKSAIMTSADIINFEHKLIVDETLYPADVFATGSG  595

Query  625   HVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPS  446
             HVNPS+ANDPGLVYD +P+DY+PYLCGL Y + EVG+I    + CS   SIPE +LNYPS
Sbjct  596   HVNPSRANDPGLVYDIQPDDYIPYLCGLGYGDTEVGIIAHKTITCSETSSIPEGELNYPS  655

Query  445   FSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTF  266
             FS++L S  QT+TRTVTNVGEA+S Y V +  P GV+V V P  L FS+ NQK TY+V+F
Sbjct  656   FSVVLGS-PQTFTRTVTNVGEANSSYVVMVMAPEGVEVKVRPNNLTFSEANQKETYSVSF  714

Query  265   SLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
             S       +      QG L+W S KH VRSPI    V
Sbjct  715   SRIESGNET--AEYAQGFLQWVSAKHTVRSPILVDFV  749



>ref|XP_007208859.1| hypothetical protein PRUPE_ppa025839mg, partial [Prunus persica]
 gb|EMJ10058.1| hypothetical protein PRUPE_ppa025839mg, partial [Prunus persica]
Length=729

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/725 (59%), Positives = 530/725 (73%), Gaps = 18/725 (2%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             + F  MF  LSV +    T    S ++TYIV V+ P   +       S  DLE WY +FL
Sbjct  15    LGFSVMFY-LSVAVA-AETGEGKSSMQTYIVWVKRP---VQNLFFVKSHEDLESWYHTFL  69

Query  2215  PTTVAGGGY-GESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHS  2039
             P T+A      +SRMV  YRNV  GFAAKL+ EEVK M  K+GF+SA PERILPLHTTHS
Sbjct  70    PDTIANSNEPTKSRMVHTYRNVATGFAAKLTPEEVKAMEQKEGFVSAHPERILPLHTTHS  129

Query  2038  PGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA  1859
             P FLGLQQ +G W+ ++YG+GVIIGVLD+GI  DHPSFSDEG+PPPPA+WKG C+ + T 
Sbjct  130   PNFLGLQQGLGVWKGANYGEGVIIGVLDTGIGPDHPSFSDEGVPPPPAKWKGKCDFDGTL  189

Query  1858  CNNKVIGARSFSERERS---VFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLA  1688
             CNNK+IGAR+F   + +     DD+GHGTHT+ TAAGNFV+GAN +G ANGTAAG+AP A
Sbjct  190   CNNKLIGARNFQSGKTTGGPPVDDEGHGTHTSSTAAGNFVKGANAFGMANGTAAGMAPYA  249

Query  1687  HLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKG  1508
             HLA+YK+C+E GC++ +I+AA+DTA+EDGVD+LSLSLGG S  F+ED IA+GA+ A++KG
Sbjct  250   HLAMYKICSEDGCTEGDIVAALDTAVEDGVDVLSLSLGGPSFPFYEDGIAVGAFGAIQKG  309

Query  1507  IFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFN  1328
             IFVS SAGN GP   SLSNEAPW+LTVGAST+DR + AT +LG+  +F G + FQPKDFN
Sbjct  310   IFVSCSAGNSGPSYESLSNEAPWILTVGASTIDRSIRATALLGDHGEFDGVSLFQPKDFN  369

Query  1327  SSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGR  1148
             S+LL LV+PG N +   SS  C   SL N  + GKIVVC  G    R  KGE VK A G 
Sbjct  370   STLLPLVYPGANGN--PSSALCSPGSLEN--LEGKIVVCEGG--RGRVAKGEEVKRAGGA  423

Query  1147  GMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNA  968
              MIL+     G +  A AHVLPA  ++Y  G  I A+IN+TS P AT  FKGT+ GD  A
Sbjct  424   AMILVNQAIDGYSVLADAHVLPATHVSYKAGLDIKAFINSTSTPTATILFKGTVIGDPLA  483

Query  967   PTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPH  788
             P VA+FSSRGP+  SPGILKPDIIGPGV+ILA WP SVDN    K+TFN++SGTSMSCPH
Sbjct  484   PKVASFSSRGPSTTSPGILKPDIIGPGVSILAAWPVSVDNGTEGKATFNMVSGTSMSCPH  543

Query  787   LSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSK  608
             LSG+AALLKSSHPDWSPA IKSA+MTTA++ N   + I +Q L  A +F++GAGHVNPSK
Sbjct  544   LSGIAALLKSSHPDWSPAAIKSAIMTTAEVENLAGSAIVDQTLFPADIFALGAGHVNPSK  603

Query  607   ANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL-  431
             ANDPGL+YD +PEDY+PYLCGLNYT+ ++ VI Q  VNCS V ++PEAQLNYP+FSI   
Sbjct  604   ANDPGLIYDIQPEDYIPYLCGLNYTDEQIQVITQQTVNCSQVGAVPEAQLNYPTFSIKTG  663

Query  430   --ESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLS  257
               E+  Q YTRTVTNVG A+S Y + +  PP V ++V P+ L F++ NQK+TY+V F+  
Sbjct  664   SSETRTQYYTRTVTNVGPANSTYNLALVVPPKVGMSVNPQVLTFTEFNQKITYHVEFNAH  723

Query  256   SKAAR  242
               A +
Sbjct  724   DDAGK  728



>ref|XP_006428960.1| hypothetical protein CICLE_v10011144mg [Citrus clementina]
 gb|ESR42200.1| hypothetical protein CICLE_v10011144mg [Citrus clementina]
Length=745

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/724 (59%), Positives = 531/724 (73%), Gaps = 14/724 (2%)
 Frame = -1

Query  2329  ASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGG--GYGESRMVFMYRN  2156
             A+ L+TYIV V  P    +        +DL++WY++FLP  ++     +  SRMV+ YRN
Sbjct  29    ANGLQTYIVHVRKPKQEGNFSIK----LDLDNWYRTFLPDNISKSIDAHHRSRMVYGYRN  84

Query  2155  VMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKG  1976
             V+ GFAA+L+AEEVK M  K GFISA  E IL   TTHSP FLGL QN GFW+DS+ GKG
Sbjct  85    VISGFAARLTAEEVKAMETKSGFISARVENILEPQTTHSPNFLGLHQNSGFWKDSNLGKG  144

Query  1975  VIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVFdd  1796
             VIIGVLD GI   HPSFSDEGMPPPPA+WKG CEL    CNNK+IGAR+F  +     D+
Sbjct  145   VIIGVLDMGITPGHPSFSDEGMPPPPAKWKGKCELEGANCNNKIIGARNFLNKSEPPIDN  204

Query  1795  dghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCN-EIGCSDSEILAAMD  1619
             DGHGTHTA TAAGNFV GAN++G ANGTAAG+APLAHLAIYKVC  ++GC +S + AA+D
Sbjct  205   DGHGTHTASTAAGNFVNGANLFGQANGTAAGMAPLAHLAIYKVCETDLGCPESIVNAAID  264

Query  1618  TAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPW  1439
              A+E+GVD+LS+SLG  S  F  D++A  A++A +KGI VS SAGN GP + +L+NEAPW
Sbjct  265   AAVEEGVDVLSISLGSPSLPFFADAMATAAFTATQKGILVSCSAGNSGPNSSTLANEAPW  324

Query  1438  MLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCD  1259
             MLTVGAST+DR + A   LGN++ + GET FQPKDF S  L LV+PG      SS+ +C 
Sbjct  325   MLTVGASTIDRSIVALTQLGNQETYDGETIFQPKDFPSKQLPLVYPGVK---NSSAAFCL  381

Query  1258  SESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPA  1079
              E+L++ DV+GK+V+C  GG   R  KG+ VK+A G  MIL+  E +   T A  HVLPA
Sbjct  382   PETLKSIDVKGKVVLCQRGGGTQRIRKGKDVKDAGGAAMILMNDELFDYGTVADNHVLPA  441

Query  1078  IDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDI  899
             + ++YA G++I AYIN+TS+P A+  FKGT+ G K+AP VA FSSRGPN+ SPGILKPDI
Sbjct  442   VYVSYAAGERIKAYINSTSSPTASIVFKGTVIGKKSAPEVAVFSSRGPNKASPGILKPDI  501

Query  898   IGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSA  719
             IGPGV+ILA WP S +N  N+KSTF +ISGTSMSCPHLSG+AALLKS+HPDWSPA IKSA
Sbjct  502   IGPGVSILAAWPFSEENITNTKSTFTMISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSA  561

Query  718   MMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLN  539
             +MTTADI+N    PI N HL+ A +F++GAGHVNPSKANDPGLVYD   +DY+ YLCG N
Sbjct  562   IMTTADIVNLEGKPIMNHHLLPADLFAVGAGHVNPSKANDPGLVYDISHDDYVRYLCGKN  621

Query  538   YTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVE  359
             YT++++  I+ H V CS V SI EA+LNYPSFS+ L S+ QTY RTVTNVG+ +SFYT  
Sbjct  622   YTDQQIEGIVDHDVQCSKVSSIAEAELNYPSFSVKLGSSPQTYNRTVTNVGQDNSFYTHH  681

Query  358   IFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVR  179
             I  P GVK+ V+P ++ F++ NQK TY+VTF     +  S+    VQG L W S  H VR
Sbjct  682   IIVPEGVKIIVQPDKISFTEKNQKATYSVTFIRDQISNASS----VQGYLSWVSATHTVR  737

Query  178   SPIA  167
             SPIA
Sbjct  738   SPIA  741



>ref|XP_009629567.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=651

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/654 (65%), Positives = 507/654 (78%), Gaps = 10/654 (2%)
 Frame = -1

Query  2107  MGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPS  1928
             M  ++GF+SA PER L L+TTHS  FLGL QNMGFW DS+YGKGVIIGV+D+GI  DHPS
Sbjct  1     MEKREGFVSARPERQLDLYTTHSLNFLGLHQNMGFWNDSNYGKGVIIGVIDTGIFPDHPS  60

Query  1927  FSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-SERERSVFdddghgthtagtaaGNF  1751
             FSD+GMPPPPA+WKG CE N T CN K+IGAR F S    S +D++GHGTHTA TAAGNF
Sbjct  61    FSDDGMPPPPAKWKGKCEFNVTKCNKKLIGARYFLSSGNGSPWDENGHGTHTASTAAGNF  120

Query  1750  VRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslgg  1571
             V GAN++G+ANGTAAGVAPLAH+AIYKVC+ I CS+S+ LAAMD AIEDGVD+LSLSLG 
Sbjct  121   VPGANIFGNANGTAAGVAPLAHVAIYKVCSGITCSESDTLAAMDMAIEDGVDVLSLSLGR  180

Query  1570  mssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSAT  1391
             ++++F+ D+IALGA+SAMEKGIFVS +AGN GP + S +NEAPW+LTVGAST+DRK+ AT
Sbjct  181   LTNNFYSDNIALGAFSAMEKGIFVSCAAGNSGPSSFSTANEAPWILTVGASTIDRKIKAT  240

Query  1390  VVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVC  1211
              VLGN ++F GE+AFQP DF  +LL L +PG N SD S + YC   SL N +V GKIV+C
Sbjct  241   AVLGNSEEFDGESAFQPSDFPPTLLPLAYPGSNASD-SDAKYCTPTSLNNTNVMGKIVLC  299

Query  1210  MTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYIN  1031
               G    R  KG+ VK A G  MIL+  E    TT A AHVLP   +TYADG KI+ YIN
Sbjct  300   EVGK-TTRVDKGKVVKAAGGAAMILMNTETLANTTLAEAHVLPVTHVTYADGIKIIEYIN  358

Query  1030  ATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVD  851
             +T  P AT  FKGTI GD  AP VA FSSRGPN  SPGILKPDIIGPGVNILA W  S++
Sbjct  359   STLIPTATIVFKGTIIGDDRAPVVAGFSSRGPNYASPGILKPDIIGPGVNILAAWHVSLE  418

Query  850   NKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQ  671
             N  N+ S FN+ISGTSMSCPHLSGVAALLKSSH DWSPA IKSA+MTTAD+LN G + I+
Sbjct  419   NNTNTNSNFNMISGTSMSCPHLSGVAALLKSSHLDWSPAAIKSAIMTTADVLNLGLSSIE  478

Query  670   NQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNC  491
             +Q  + ASVF+ GAGHVNPSKANDPGL+YD +  DY+ YLCGLNYT+R+VG+ LQ +V C
Sbjct  479   DQTYLPASVFATGAGHVNPSKANDPGLIYDIEQADYIAYLCGLNYTDRQVGIFLQRKVKC  538

Query  490   SAVISIPEAQLNYPSFSIILE--STAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPR  317
             SA+ SI E QLNYPSFSI +   STAQTY+R VTNVG+A+S Y+VEI  PPGV V VEP 
Sbjct  539   SAITSILEGQLNYPSFSIQVRSNSTAQTYSRNVTNVGQANSTYSVEIDSPPGVDVKVEPT  598

Query  316   ELQFSKVNQKLTYNVTFS-LSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
              L FS+VNQKL+Y VTF+ L+++ + S+     QG+LRW S KH VRSPIA + 
Sbjct  599   TLAFSEVNQKLSYQVTFTPLATRPSTSSN----QGSLRWISEKHIVRSPIAVRF  648



>ref|XP_006480601.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=745

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/724 (59%), Positives = 530/724 (73%), Gaps = 14/724 (2%)
 Frame = -1

Query  2329  ASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGG--GYGESRMVFMYRN  2156
             A+ L+TYIV V  P    +        +DL++WY++FLP  ++     +  SRMV+ YRN
Sbjct  29    ANGLQTYIVHVRKPKQEGNFSIK----LDLDNWYRTFLPDNISKSIDAHHRSRMVYGYRN  84

Query  2155  VMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKG  1976
             V+ GFAA+L+AEEVK M  K GFISA  E IL   TTHSP FLGL QN GFW+DS+ GKG
Sbjct  85    VISGFAARLTAEEVKAMETKSGFISARVENILEPQTTHSPNFLGLHQNSGFWKDSNLGKG  144

Query  1975  VIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVFdd  1796
             VIIGVLD GI   HPSFSDEGMPPPPA+WKG CEL    CNNK+IGAR+F  +     D+
Sbjct  145   VIIGVLDMGITPGHPSFSDEGMPPPPAKWKGKCELEGANCNNKIIGARNFLNKSEPPIDN  204

Query  1795  dghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVC-NEIGCSDSEILAAMD  1619
             DGHGTHTA TAAGNFV GAN++G ANGTAAG+APLAHLAIYKVC  ++GC +S + AA+D
Sbjct  205   DGHGTHTASTAAGNFVNGANLFGQANGTAAGMAPLAHLAIYKVCETDLGCPESIVNAAID  264

Query  1618  TAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPW  1439
              A+E+GVD+LS+SLG  S  F  D++A  A++A +KGI VS SAGN GP + +L+NEAPW
Sbjct  265   AAVEEGVDVLSISLGSPSLPFFADAMATAAFTATQKGILVSCSAGNSGPNSSTLANEAPW  324

Query  1438  MLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCD  1259
             MLTVGAST+DR + A   LGN++ + GET FQPKDF S  L LV+PG      SS+ +C 
Sbjct  325   MLTVGASTIDRSIVALTQLGNQETYDGETIFQPKDFPSKQLPLVYPGVK---NSSAAFCL  381

Query  1258  SESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPA  1079
              E+L++ DV+GK+V+C  GG   R  KG+ VK+A G  MIL+  E +   T A  HVLPA
Sbjct  382   PETLKSIDVKGKVVLCQRGGGTQRIRKGKDVKDAGGAAMILMNDELFDYGTVADNHVLPA  441

Query  1078  IDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDI  899
             + ++YA G++I AYIN+TS+P A+  FKGT+ G K+AP VA FSSRGPN+ SPGILKPDI
Sbjct  442   VYVSYAAGERIKAYINSTSSPTASIVFKGTVIGKKSAPEVAVFSSRGPNKASPGILKPDI  501

Query  898   IGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSA  719
             IGPGV+ILA WP S +N  N+KSTF +ISGTSMSCPHLSG+AALLKS+HPDWSPA IKSA
Sbjct  502   IGPGVSILAAWPFSEENITNTKSTFTMISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSA  561

Query  718   MMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLN  539
             +MTTADI+N    PI N HL+ A +F++GAGHVNPSKANDPGLVYD   +DY+ YLCG N
Sbjct  562   IMTTADIVNLEGKPIMNHHLLPADLFAVGAGHVNPSKANDPGLVYDISHDDYVRYLCGKN  621

Query  538   YTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVE  359
             YT++++  I+ H V CS V SI EA+LNYPSFS+ L S+ QTY RTVTNVG+ +SFYT  
Sbjct  622   YTDQQIEGIVDHDVQCSKVSSIAEAELNYPSFSVKLGSSPQTYNRTVTNVGQDNSFYTHH  681

Query  358   IFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVR  179
             I  P GVK+ V+P ++ F++ NQK TY+VTF     +  S     VQG L W S  H VR
Sbjct  682   IIVPEGVKIIVQPDKISFTEKNQKATYSVTFIRDQISNAS----CVQGYLSWVSATHTVR  737

Query  178   SPIA  167
             SPIA
Sbjct  738   SPIA  741



>ref|XP_011029125.1| PREDICTED: subtilisin-like protease SDD1 [Populus euphratica]
Length=762

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/721 (59%), Positives = 525/721 (73%), Gaps = 13/721 (2%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S L TYI+ ++ P   +S +       +L+ WY+SFLP  V      + R+V  Y NV+ 
Sbjct  50    SNLVTYIIFLKKPEDMVSAERE-----ELDSWYQSFLPA-VTTSSSNQQRLVHSYHNVVT  103

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAAKL+ +E K M  K+G +SA P+++  + TTH+P FLGLQQN+GFW  S+YGKGVII
Sbjct  104   GFAAKLTEKEAKAMEMKEGLVSAHPQKVFRVKTTHTPSFLGLQQNLGFWNHSNYGKGVII  163

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVFdddgh  1787
             GVLDSGI   HPSFSDEGMPPPPA+WKG CELN T CNNK+IGAR+F    +   DD+GH
Sbjct  164   GVLDSGITPSHPSFSDEGMPPPPAKWKGKCELNGTLCNNKLIGARNFYSAGKPPVDDNGH  223

Query  1786  gthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIG-CSDSEILAAMDTAI  1610
             GTHTA TAAG+ V+GA+ Y   NGTA G+A  AHLAIY+VC+  G C +S ILA MDTA+
Sbjct  224   GTHTASTAAGSRVQGASFYDQLNGTAVGIASSAHLAIYQVCDGFGSCEESNILAGMDTAV  283

Query  1609  EDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLT  1430
             EDG D+LSLSLGG S  F+EDSIA+GA+ A++KGIFVS +AGNEGP+  SLSNEAPW+LT
Sbjct  284   EDGADVLSLSLGGGSLPFYEDSIAIGAFGAIQKGIFVSCAAGNEGPYKESLSNEAPWILT  343

Query  1429  VGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSES  1250
             VGASTVDR + ATV+LGN+  + G++ +QP +F+S+LL L++ G N SD ++  +CD  S
Sbjct  344   VGASTVDRSIRATVLLGNKASYDGQSFYQPTNFSSTLLPLIYAGANGSDTAA--FCDPGS  401

Query  1249  LRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDI  1070
              ++ DV+GK+V+C +GGF +   KG+ VK A G  MI++  E  G  T+A  HVLPA D+
Sbjct  402   SKDVDVKGKVVLCESGGFSESVDKGQEVKYAGGAAMIIMNDELSGNITTADFHVLPASDV  461

Query  1069  TYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGP  890
             TYADG  I AYI +TS+PMAT  FKGT+ G   AP +A FSSRGP+ ESPGILKPDIIGP
Sbjct  462   TYADGLSIKAYIKSTSSPMATILFKGTVFGVPYAPQLAYFSSRGPSLESPGILKPDIIGP  521

Query  889   GVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMT  710
             GV+ILA WP +VDN  N+KSTFN+ISGTSM+ PHLSG+AALLKSSHP WSPA IKSA+MT
Sbjct  522   GVDILAAWPYAVDNHRNTKSTFNMISGTSMATPHLSGIAALLKSSHPHWSPAAIKSAIMT  581

Query  709   TADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTN  530
             TA++ N G  PI +       VF+IG+GHVNP+KA+DPG VYD +P+DY+PYLCGL Y N
Sbjct  582   TANLTNLGGTPITDDSFGPVDVFAIGSGHVNPTKADDPGFVYDIQPDDYIPYLCGLGYNN  641

Query  529   REVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFE  350
              EVG+I+Q  V CS   SIPEAQLNYPSFSI L ST QTYTRTVTNVG   S Y  EI  
Sbjct  642   TEVGIIVQRPVTCSNSSSIPEAQLNYPSFSIKLGSTPQTYTRTVTNVGPFKSSYIAEIIA  701

Query  349   PPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPI  170
             P GV V V P  + F   + K TY+VTF   ++ A  N+ P  QG L W S  H VR+PI
Sbjct  702   PQGVDVKVTPNAIPFGGGDPKATYSVTF---TRTANVNL-PFSQGYLNWVSADHVVRNPI  757

Query  169   A  167
             A
Sbjct  758   A  758



>ref|XP_004300737.1| PREDICTED: subtilisin-like protease SDD1-like [Fragaria vesca 
subsp. vesca]
Length=721

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/724 (59%), Positives = 526/724 (73%), Gaps = 16/724 (2%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGG-GYGESRMVFMYRNVMKG  2144
             ++TYIV V+ P      +  S S  DLE WYKSFLP T        E R+V+ Y +V  G
Sbjct  1     MQTYIVWVKKP----VRKLFSESHQDLEGWYKSFLPKTFTNSMEVMEQRLVYAYHHVATG  56

Query  2143  FAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIG  1964
             FAAKL+AEEVKEM  KDGFISA  ERILPLHTTH+P FLGL QN+G W+ S YG+G+IIG
Sbjct  57    FAAKLTAEEVKEMAVKDGFISAHQERILPLHTTHTPNFLGLYQNLGLWKGSYYGEGIIIG  116

Query  1963  VLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERS---VFddd  1793
             VLD+GI   HPSF D G+ PPPA+WKG C+ N T CNNK+IGARSF   + +     D +
Sbjct  117   VLDTGITPGHPSFHDAGVNPPPAKWKGKCDFNGTFCNNKLIGARSFQGGKSTGAPPVDIE  176

Query  1792  ghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTA  1613
             GHGTHT+ TAAGNFV+GANV+G A GTA+G+AP AH+A+Y++CNE GCS+S+I+AAMDTA
Sbjct  177   GHGTHTSSTAAGNFVKGANVFGMAEGTASGMAPYAHVAMYQICNEDGCSESDIVAAMDTA  236

Query  1612  IEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWML  1433
             + DGVD+LSLSLGG S  F+ D IA+GA+ A++KGIFVS SAGN GP  GSLSNEAPW+L
Sbjct  237   VADGVDVLSLSLGGGSVPFYGDGIAVGAFGAIQKGIFVSCSAGNSGPDYGSLSNEAPWIL  296

Query  1432  TVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSE  1253
             TVGASTVDR + AT  LGN +++ GE+ FQ KDF+S LL LV+ G  ++D  S+  CD  
Sbjct  297   TVGASTVDRSIKATAKLGNGKEYDGESLFQDKDFSSELLPLVYAGAYSND--STALCDIG  354

Query  1252  SLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAID  1073
             +L    V G++V+C  GG + R  KGE VK A G  MIL+  E  G +T A AHVLPA  
Sbjct  355   TLNG--VEGQVVLCERGGGIGRIAKGEEVKRAGGAAMILMNQETDGFSTLADAHVLPATH  412

Query  1072  ITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIG  893
             ++YA G  I  YIN+TS P AT  FKGT+ GD+NAP V +FSSRGP+  S GILKPDIIG
Sbjct  413   LSYAAGVSIKEYINSTSTPTATILFKGTVIGDQNAPAVTSFSSRGPSIASTGILKPDIIG  472

Query  892   PGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMM  713
             PGV+ILA WP SVDN   S  TFN++SGTSMSCPHLSG+AALLKSSHPDWSPA IKSA++
Sbjct  473   PGVSILAAWPVSVDNGTESTETFNMVSGTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIV  532

Query  712   TTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYT  533
             TTAD++N G  PI ++ L  A +F+ GAGHVNP+KA+DPGL+YDT P DY+PYLCGLNYT
Sbjct  533   TTADMVNLGGKPIVDETLTPADIFATGAGHVNPTKADDPGLIYDTTPGDYIPYLCGLNYT  592

Query  532   NREVGVILQHRVNCSAVISIPEAQLNYPSFSIILE--STAQTYTRTVTNVGEASSFYTVE  359
               ++ +I Q  V CS V  IPE +LNYPSFSII +  S +Q+YTRTVTNVG A+S Y +E
Sbjct  593   EDQIQIITQQTVKCSEVGVIPEQELNYPSFSIIFQDLSESQSYTRTVTNVGPANSTYNLE  652

Query  358   IFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVR  179
             +  P  + ++V P +L F++V Q +TY V F     A +    P  QG LRW + +H V 
Sbjct  653   LMVPHKMGMSVNPGQLVFTEVGQTMTYRVDFIPEEGAGKD--APFSQGYLRWFNDQHSVA  710

Query  178   SPIA  167
             SPI+
Sbjct  711   SPIS  714



>gb|EYU29562.1| hypothetical protein MIMGU_mgv1a001898mg [Erythranthe guttata]
Length=742

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/749 (58%), Positives = 549/749 (73%), Gaps = 19/749 (3%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASK---LETYIVRVELPHsristqsssssSVDLEHWYK  2225
             M +  +FL L+ ++ F +T  + SK   L+TYIV VELP     T SS  +  DL+ +Y+
Sbjct  1     MGYYTLFLTLTCVLCF-NTIFVRSKDSNLQTYIVHVELPSFPTLTTSSLLTE-DLQAYYQ  58

Query  2224  SFLPTTVAGGG--YGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLH  2051
             +FL +T++       E  +++ Y NV  GF+A+LS E+VK M  K GFISA P++ L LH
Sbjct  59    TFLASTLSASSPSTDEPSIIYSYHNVFHGFSARLSPEQVKAMEKKPGFISARPQKTLSLH  118

Query  2050  TTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCEL  1871
             TTHSP FLGL QN GFWRDS+YG+G+IIGVLDSG+  +HPSF+D+GMPPPPARW+G CE 
Sbjct  119   TTHSPNFLGLNQNTGFWRDSNYGRGMIIGVLDSGVNPNHPSFNDDGMPPPPARWRGRCEF  178

Query  1870  NFTA--CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVA  1697
             N T   CNNK+IGAR F+  + +  D+DGHGTHTA TAAGNFV GANV+G+ANGTAAGVA
Sbjct  179   NSTIARCNNKLIGARFFTIGDGTPSDEDGHGTHTASTAAGNFVPGANVFGNANGTAAGVA  238

Query  1696  PLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAM  1517
             PLAH+A YKVC    C +S+I+AAMD AI+DGVDI+SLSLGG +  F  ++IA+GA+SA+
Sbjct  239   PLAHVATYKVCTTT-CEESDIVAAMDAAIDDGVDIISLSLGGPAQDFFGENIAVGAFSAI  297

Query  1516  EKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPK  1337
             E+GIFVSASAGN GPF G+  N APW+LTVGAS+VDRK+ AT VLGN ++  GE+ FQP 
Sbjct  298   ERGIFVSASAGNNGPFYGTAQNGAPWILTVGASSVDRKIRATAVLGNNEELDGESTFQPS  357

Query  1336  DFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNA  1157
             DF ++LL L +   ++       +C   SLR+ D++G IV+C  GG + R  KG AV+ A
Sbjct  358   DFPTTLLPLFYSPNDS-------FCSPASLRSLDLQGMIVLCDNGGGIGRIAKGRAVRAA  410

Query  1156  SGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGD  977
              G  M+++  +  G TT++ +HVLPA  ++Y DG ++ AY+N+T++P AT SFKGT+ GD
Sbjct  411   GGAAMVIVNQQRQGFTTNSDSHVLPATHLSYTDGLRVKAYLNSTASPTATISFKGTVIGD  470

Query  976   KNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMS  797
               AP VAAFS+RGPN  SPGILKPDIIGPG NILA W  SV+N   + S FNIISGTSMS
Sbjct  471   DRAPQVAAFSARGPNPPSPGILKPDIIGPGHNILAAWHVSVENNTGTNSNFNIISGTSMS  530

Query  796   CPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVN  617
             CPHLSGVAALLKS HPDWSPA IKSA+MTTAD++N   NPI++Q    A VF+IG+GHVN
Sbjct  531   CPHLSGVAALLKSVHPDWSPAAIKSAIMTTADLVNLAGNPIEDQTQSRADVFAIGSGHVN  590

Query  616   PSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSI  437
               KA DPGLVYD  P+DY+PYLCGLNYT+++V VI+   V C+ + SIPEA+LNYPSFS+
Sbjct  591   ILKATDPGLVYDMGPQDYVPYLCGLNYTDQQVAVIVNRVVRCAEISSIPEAELNYPSFSV  650

Query  436   ILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLS  257
             ++ +T+ TY RTVTNVGEA+S YTV     P V V VEP  LQFS +NQ LTY  TF+ S
Sbjct  651   VIGNTSTTYNRTVTNVGEANSVYTVRA-ALPLVDVRVEPTTLQFSAINQTLTYQTTFTRS  709

Query  256   SKAARSNMPPVVQGALRWKSVKHHVRSPI  170
             S  A + +   VQG L W S KH VRSPI
Sbjct  710   SGNA-TIVNVYVQGFLTWTSAKHTVRSPI  737



>ref|XP_002509661.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF51048.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=745

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/722 (59%), Positives = 525/722 (73%), Gaps = 20/722 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S LETYI+ +E      S       S DL  WY+SFLP   +      SR+V  YR+V+ 
Sbjct  38    SDLETYIILLE-----KSEGREFKESKDLRSWYQSFLPANTSSSEL--SRLVHSYRHVVT  90

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAAKL+AEE K M  ++GF+ A P+R++PLHTTH+P FLGLQQN+GFW+ S++GKGVII
Sbjct  91    GFAAKLTAEEAKAMEMREGFVLARPQRMVPLHTTHTPSFLGLQQNLGFWKHSNFGKGVII  150

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT-ACNNKVIGARSFSERERSVFdddg  1790
             GV+DSGI  DHPSFS EGMPPPP +W G CEL  T +CNNK+IGAR+F+     +FD+  
Sbjct  151   GVVDSGITPDHPSFSGEGMPPPPEKWTGKCELKGTLSCNNKLIGARNFATNSNDLFDEVA  210

Query  1789  hgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNE-IGCSDSEILAAMDTA  1613
             HGTHTA TAAG+ V+GA+ +G ANGTA G+APLAHLA+YKV        +SEILAAMD A
Sbjct  211   HGTHTASTAAGSPVQGASYFGQANGTAIGMAPLAHLAMYKVSGRGRKVGESEILAAMDAA  270

Query  1612  IEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWML  1433
             IE+GVDILSLSLG  +  F++D +ALGAY+A++KGIFVS SAGN GP N SLSNEAPW+L
Sbjct  271   IEEGVDILSLSLGIGTHPFYDDVVALGAYAAIQKGIFVSCSAGNSGPDNSSLSNEAPWIL  330

Query  1432  TVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSE  1253
             TVGASTVDR + ATV+LGN+ + +GE+ FQPK F S+LL LV+ G N +  S+S  CD  
Sbjct  331   TVGASTVDRAIRATVLLGNKAELNGESLFQPKYFPSTLLPLVYAGANGNALSAS--CDDG  388

Query  1252  SLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAID  1073
             +LRN DV+GKIV+C  G       KG+ VK   G  MI++  E  G +T A+ HVLPA  
Sbjct  389   TLRNVDVKGKIVLCEGGS--GTISKGQEVKENGGAAMIVMNYENEGFSTEASLHVLPASH  446

Query  1072  ITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIG  893
             + Y  G  I AYIN+TS+P AT  FKGT+ G  +AP VA FSSRGP+  SPGILKPDIIG
Sbjct  447   VNYEAGSAIKAYINSTSSPKATILFKGTVVGLTDAPQVAYFSSRGPSMASPGILKPDIIG  506

Query  892   PGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMM  713
             PGV ILA WP SVDN  N    FN+ISGTSMSCPHLSG+AALLKS+HPDWSPA IKSA+M
Sbjct  507   PGVRILAAWPVSVDNTTNR---FNMISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIM  563

Query  712   TTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYT  533
             TTA++ N G  PI ++  V ++VF +GAGHVNPS+ANDPGL+YD +P+DY+PYLCGL Y+
Sbjct  564   TTANLDNLGGKPISDEDFVPSTVFDMGAGHVNPSRANDPGLIYDIQPDDYIPYLCGLGYS  623

Query  532   NREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIF  353
             ++ V VI+Q +V C+ V SIPEAQLNYPSFSIIL S  QTYTRTVTN G+ +S Y  EIF
Sbjct  624   DKHVRVIVQRKVKCTNVTSIPEAQLNYPSFSIILGSKPQTYTRTVTNFGQPNSAYDFEIF  683

Query  352   EPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSP  173
              P GV + V P  + FS + QK TY+VTFS + KA  S      QG L+W +  + V SP
Sbjct  684   APKGVDILVTPHRISFSGLKQKATYSVTFSRNGKANGS----FAQGYLKWMADGYKVNSP  739

Query  172   IA  167
             IA
Sbjct  740   IA  741



>ref|XP_006358842.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=649

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/654 (63%), Positives = 497/654 (76%), Gaps = 8/654 (1%)
 Frame = -1

Query  2107  MGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPS  1928
             M   +GFISA PER+L L+TTHS  FLGL +NMGFW DS+YGKGVIIGV+D+GI  DHPS
Sbjct  1     MEKMEGFISARPERLLDLYTTHSVNFLGLHENMGFWNDSNYGKGVIIGVIDTGIFPDHPS  60

Query  1927  FSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-SERERSVFdddghgthtagtaaGNF  1751
             F+D+GMPPPPA+WKG CE N T CNNK+IGAR F S    + +D+ GHGTHTA TAAG F
Sbjct  61    FNDDGMPPPPAKWKGKCEFNVTKCNNKLIGARYFQSSGNETSWDEIGHGTHTASTAAGRF  120

Query  1750  VRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslgg  1571
             V GAN++GSANGTA GVAPLAH+A+YKVC+ + CS+S++LAAMD AI+DGVD+LSLS+G 
Sbjct  121   VPGANIFGSANGTAVGVAPLAHVAMYKVCSALTCSESDVLAAMDMAIDDGVDVLSLSIGT  180

Query  1570  mssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSAT  1391
             ++++F+ED+IALGA+SAM+KGIFVS +AGN GP   S SNEAPW+LTVGAST+DRK+ AT
Sbjct  181   LTNNFYEDNIALGAFSAMQKGIFVSCAAGNSGPSRFSTSNEAPWILTVGASTIDRKIKAT  240

Query  1390  VVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVC  1211
              VLGN Q+F GE+AFQP DF  +LL LV+PG NTS+ ++  YC  +SL N +V GKIV+C
Sbjct  241   AVLGNNQEFDGESAFQPSDFPPTLLPLVYPGSNTSNFNAK-YCTPDSLNNTNVMGKIVLC  299

Query  1210  MTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYIN  1031
               G    R  +G AV+ A G GMIL+ PE+   TT A  HVLP   ++Y  G KI  YIN
Sbjct  300   EVG-ITARVDQGIAVEAAGGAGMILMNPEDMANTTLAEVHVLPVTHVSYTAGLKIKKYIN  358

Query  1030  ATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVD  851
             +T  P AT  FKGTI GD  AP VA FSSRGPN  SPGILKPDIIGPGVNILA W  S++
Sbjct  359   STLIPTATIVFKGTIIGDDRAPVVAGFSSRGPNYASPGILKPDIIGPGVNILAAWHISLE  418

Query  850   NKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQ  671
             N  N+ S FN+ISGTSMSCPHLSGVAALLKS HPDWSPA IKSA+MTTAD LN   N I+
Sbjct  419   NNTNTNSRFNMISGTSMSCPHLSGVAALLKSVHPDWSPAAIKSAIMTTADDLNLRSNLIE  478

Query  670   NQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNC  491
             ++  + A+VF+ GAGHVNPSKANDPGL+YD +P DYL YLCGLNYT+R+VG+ LQ + NC
Sbjct  479   DETYLPANVFATGAGHVNPSKANDPGLIYDIEPSDYLSYLCGLNYTDRQVGIFLQRKANC  538

Query  490   SAVISIPEAQLNYPSFSIILE--STAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPR  317
             S + SI E QLNYPSFSI++   STAQ Y+RTVTNVG+A S Y VEI  PPG+ V VEP 
Sbjct  539   SEITSILEGQLNYPSFSILVRVNSTAQVYSRTVTNVGQAYSTYRVEIGSPPGLDVKVEPT  598

Query  316   ELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
              L FS+V QKL+Y VTF+  +    +      QG  RW S KH VRS IA + +
Sbjct  599   TLVFSEVKQKLSYQVTFTPLATLPNTTFS---QGYFRWISEKHIVRSQIAVRFL  649



>ref|XP_003550884.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=741

 Score =   787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/749 (56%), Positives = 531/749 (71%), Gaps = 18/749 (2%)
 Frame = -1

Query  2380  MFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVA  2201
                IL+ L+ F   ++ AS  +TYI+ VE P  +   Q+      DLE WY SF+P T  
Sbjct  4     FLFILTFLLSFHKLSSAASSSKTYIIHVEGPQDKTLDQTE-----DLESWYHSFMPPTTM  58

Query  2200  GGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGL  2021
                  + RM++ YRNVM GFAA+L+ EE++ M  K+GFISA PER+L   TT++P FLGL
Sbjct  59    SSEE-QPRMIYSYRNVMSGFAARLTEEELRTMEKKNGFISARPERMLHCLTTNTPQFLGL  117

Query  2020  QQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVI  1841
             Q+  G W++S++GKG+IIGVLDSGI   HPSFSD GMPPPP +WKG CE+N TACNNK+I
Sbjct  118   QKQTGLWKESNFGKGIIIGVLDSGITPGHPSFSDAGMPPPPPKWKGRCEINVTACNNKLI  177

Query  1840  GARSFSERER------SVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLA  1679
             G R+F+  E+      +  D+DGHGTHTA TAAG FV  A + G+A GTAAG+AP AHLA
Sbjct  178   GVRAFNLAEKLAKGAEAAIDEDGHGTHTASTAAGAFVDHAELLGNAKGTAAGIAPYAHLA  237

Query  1678  IYKVCNEIGCSDSEILAAMDTAIEDGVD-IlslslggmssSFHEDSIALGAYSAMEKGIF  1502
             IY+VC    C +S+ILAAMD A+EDGVD I          S  +DS A+GA++AM+KGIF
Sbjct  238   IYRVCFGKDCHESDILAAMDAAVEDGVDVISISLGSHTPKSIFDDSTAIGAFAAMQKGIF  297

Query  1501  VSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSS  1322
             VS +AGN GPF+GSL N APW+LTVGAS +DR ++AT  LGN Q+F GE+ FQP DF+ +
Sbjct  298   VSCAAGNSGPFHGSLINGAPWVLTVGASNIDRSIAATAKLGNGQEFDGESVFQPSDFSPT  357

Query  1321  LLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGM  1142
             LL L + G+N   E++  +C + SL ++D RGK+V+C  GG + R  KGE VK   G  M
Sbjct  358   LLPLAYAGKNGKQEAA--FCANGSLNDSDFRGKVVLCERGGGIGRIPKGEEVKRVGGAAM  415

Query  1141  ILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPT  962
             IL   E  G + SA  HVLPA  ++Y  G KI AYIN+T+ P+AT  FKGTI G+  AP 
Sbjct  416   ILANDESNGFSLSADVHVLPATHVSYDAGLKIKAYINSTAIPIATILFKGTIIGNSLAPA  475

Query  961   VAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLS  782
             V +FSSRGPN  SPGILKPDIIGPGVNILA WP  ++N  +SKSTFN +SGTSMSCPHLS
Sbjct  476   VTSFSSRGPNLPSPGILKPDIIGPGVNILAAWPFPLNNDTDSKSTFNFMSGTSMSCPHLS  535

Query  781   GVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKAN  602
             G+AALLKSSHP WSPA IKSA+MT+ADI+N  +  I ++ L  A VF+ G+GHVNPS+AN
Sbjct  536   GIAALLKSSHPHWSPAAIKSAIMTSADIINFERKLIVDETLHPADVFATGSGHVNPSRAN  595

Query  601   DPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILEST  422
             DPGLVYD +P+DY+PYLCGL Y++ +VG+I    + CS   SIPE +LNYPSFS++L S 
Sbjct  596   DPGLVYDIQPDDYIPYLCGLGYSDTQVGIIAHKTIKCSETSSIPEGELNYPSFSVVLGS-  654

Query  421   AQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAAR  242
              QT+TRTVTNVGEA+S Y V +  P GV+V V+P +L FS+ NQK TY+VTFS   K+  
Sbjct  655   PQTFTRTVTNVGEANSSYVVMVMAPEGVEVRVQPNKLYFSEANQKDTYSVTFS-RIKSGN  713

Query  241   SNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
               +   VQG L+W S KH VRSPI+   V
Sbjct  714   ETV-KYVQGFLQWVSAKHIVRSPISVNFV  741



>emb|CDP10008.1| unnamed protein product [Coffea canephora]
Length=1406

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/749 (57%), Positives = 527/749 (70%), Gaps = 38/749 (5%)
 Frame = -1

Query  2392  KFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssss--SVDLEHWYKSF  2219
             K  +++ I  + +   +     S LETYIV VELP S     +++SS  + DL+ WY SF
Sbjct  683   KRKKIYCIAQIFVQLITCEQ--SNLETYIVHVELPESGTQLSTTNSSIPNEDLDSWYNSF  740

Query  2218  LPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHS  2039
             LPT  A    G  R+++ Y NV KGFAAKLSAE+VK M    GF+SA P+++L LHTTH+
Sbjct  741   LPTVTASSNDGP-RIIYPYHNVFKGFAAKLSAEDVKAMEKMPGFVSARPQKVLSLHTTHT  799

Query  2038  PGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA  1859
             P FLGL  N GFW+ S+YGKGVIIGVLDSGI  DHPSF DEGMPPPPA+WKG CE N + 
Sbjct  800   PNFLGLHPNSGFWKASNYGKGVIIGVLDSGITPDHPSFGDEGMPPPPAKWKGKCEFNTSV  859

Query  1858  CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLA  1679
             CNNK+IGAR F   + S  D  GHGTHTA TAAG++V GANV+G+ANGTA G+APLAHLA
Sbjct  860   CNNKLIGARFFRHGDGSSIDGIGHGTHTASTAAGSYVEGANVFGNANGTAVGIAPLAHLA  919

Query  1678  IYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFV  1499
             IYKVC    CS+                         S  F+ D+IALGAY A EKGIFV
Sbjct  920   IYKVCTTSSCSERS-----------------------SEPFYADNIALGAYRATEKGIFV  956

Query  1498  SASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSL  1319
             S SAGN+GP + +LSNEAPW+LTVGAST DRK+ ATVVLGN+++  GET  QPKDF S+ 
Sbjct  957   SCSAGNDGPSSSTLSNEAPWILTVGASTTDRKIRATVVLGNKEKLEGETLHQPKDFPSTQ  1016

Query  1318  LSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGG--FLDRRGKGEAVKNASGRG  1145
               + FPG N SD ++  +C +  L    ++GKI VC  G    LD+    + VK A G G
Sbjct  1017  FRIFFPGANQSDPNADRFCTTALLNQTGIKGKIAVCDIGEIPLLDKE---KNVKAAGGVG  1073

Query  1144  MILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAP  965
             MI+I PEE+G TTS  A+ LPA  +TYAD  K++ Y+N   +P A  SFKGT+ GD +AP
Sbjct  1074  MIIINPEEFGYTTSVDAYSLPATQVTYADRLKLIKYVNTARSPKAAISFKGTMIGDNHAP  1133

Query  964   TVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHL  785
              VA FSSRGP++ S GILKPDIIGPGVNILA W  SV+N PN+KS FN+ISGTSM+CPHL
Sbjct  1134  AVAYFSSRGPSQASIGILKPDIIGPGVNILAAWHRSVENNPNTKSNFNVISGTSMACPHL  1193

Query  784   SGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKA  605
             SGVAALLKS+HP+WSPA IKSAM+TT D++N  + PI++Q  + A +F+ GAGHVNP+ A
Sbjct  1194  SGVAALLKSAHPNWSPAAIKSAMITTTDLVNLAKKPIEDQRQLPADIFATGAGHVNPASA  1253

Query  604   NDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILES  425
             ++PGL+YD +P+DY+PYLCGLNYT+++VG+ILQ +V CS + +IPE QLNYPSFS+++  
Sbjct  1254  SNPGLIYDIEPKDYIPYLCGLNYTDKQVGLILQRKVKCSEISNIPEGQLNYPSFSVVVRL  1313

Query  424   TAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAA  245
               Q YTRTVTNVGEASS Y V+I  P GV V V P  L F+KVNQKL Y VTFS S  A 
Sbjct  1314  AVQKYTRTVTNVGEASSVYHVQIVAPAGVNVRVNPTMLSFTKVNQKLAYEVTFSPSGSA-  1372

Query  244   RSNMPPVVQGALRWKS--VKHHVRSPIAA  164
               N   V QG+L W S   K+ VRSPIAA
Sbjct  1373  --NNIAVSQGSLTWHSSNSKYSVRSPIAA  1399


 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/481 (63%), Positives = 370/481 (77%), Gaps = 8/481 (2%)
 Frame = -1

Query  1600  VDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGA  1421
             +DILSLSLGG S  F+ D+IALGAYSAMEKGIFVS SAGN+GP + +LSNEAPW+LTVGA
Sbjct  198   IDILSLSLGGSSEPFYADNIALGAYSAMEKGIFVSCSAGNDGPTSSTLSNEAPWILTVGA  257

Query  1420  STVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRN  1241
             ST+DRK+ AT VLGN+++  GET +QPKDF S+L  + +PG N SD ++  +C    L  
Sbjct  258   STIDRKIRATAVLGNKEELEGETLYQPKDFPSTLFPIYYPGANQSDFNADRFCTPALLNK  317

Query  1240  ADVRGKIVVCMTGG--FLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDIT  1067
               ++GKI VC  G    LD   KG+ VK A G GMI++ P++YG T  A AHVLPA  + 
Sbjct  318   TGIKGKIAVCEVGANAMLD---KGKNVKAAGGVGMIIVNPQQYGYTPRADAHVLPATHLN  374

Query  1066  YADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPG  887
             YAD  K++ YI  TS+PMA  SFKGTI GD +AP VA FSSRGP++ S GILKPDIIGPG
Sbjct  375   YADRLKLIEYIKTTSSPMAAISFKGTIIGDGHAPAVAYFSSRGPSQASIGILKPDIIGPG  434

Query  886   VNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTT  707
             VNILA W  SV+N  N+KS FN+ISGTSMSCPHLSGVAALLKS+HPDWSPA IKSAMMTT
Sbjct  435   VNILAAWYRSVENNTNTKSNFNVISGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAMMTT  494

Query  706   ADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNR  527
              D++N  +NPI++Q  + A++F  GAGHVNP++A++PGL+YD +P+DY+PYLCGLNYTNR
Sbjct  495   TDLVNLAKNPIEDQRQLPANIFDSGAGHVNPARASNPGLIYDIEPKDYIPYLCGLNYTNR  554

Query  526   EVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEP  347
             EV ++LQ +VNCS + SIPEAQLNYPSF+I++ S  Q YTRTVTNVGEA+S Y+V+I  P
Sbjct  555   EVALVLQRKVNCSEIPSIPEAQLNYPSFAIVVRSAVQKYTRTVTNVGEANSVYSVQIVAP  614

Query  346   PGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
              GV V V P  L F+KVNQKLTY VTFS S  A  SN+  V QG+L W S K+ VRSPIA
Sbjct  615   AGVNVTVNPTTLSFTKVNQKLTYEVTFSPSRLA--SNI-TVSQGSLTWISSKNAVRSPIA  671

Query  166   A  164
             A
Sbjct  672   A  672


 Score =   221 bits (562),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 134/195 (69%), Gaps = 9/195 (5%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIA------SKLETYIVRVELPHsristqsssss--SVDLEHW  2231
             L   L L   + F S A  A      S LETYIV VE P S     ++SSS  + DL+ W
Sbjct  3     LVQILTLFCALSFHSLAISALDFQEQSNLETYIVHVEFPESDTQLSTASSSIPNEDLDGW  62

Query  2230  YKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLH  2051
             Y SFLPT  A       RM++ Y NV KGFAAKLSAE++K M  K GF+SA P+++L LH
Sbjct  63    YNSFLPTVTASSN-DAPRMIYPYHNVFKGFAAKLSAEDIKAMEKKPGFLSARPQKVLLLH  121

Query  2050  TTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCEL  1871
             TTH+P FLGL QNMGFW +S+YGKGVIIGVLD+GI  DHPSF DEGMPPPPA+WKG CE 
Sbjct  122   TTHTPNFLGLHQNMGFWNESNYGKGVIIGVLDTGITPDHPSFGDEGMPPPPAKWKGRCEF  181

Query  1870  NFTACNNKVIGARSF  1826
             N + CNNK+IGAR F
Sbjct  182   NTSVCNNKLIGARFF  196



>ref|XP_006358905.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=650

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/649 (63%), Positives = 494/649 (76%), Gaps = 8/649 (1%)
 Frame = -1

Query  2107  MGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPS  1928
             M   +GF+SA PE +L L+TTHS  F+GL QNMGFW DS+YGKGVIIGV+D+GI  DHPS
Sbjct  1     MEKMEGFVSARPEGLLDLYTTHSVNFMGLNQNMGFWNDSNYGKGVIIGVIDTGIFPDHPS  60

Query  1927  FSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVFdddghgthtagtaaGNFV  1748
             FSD+GMPPPPA+WKG+C+ N T CNNK+IGAR F   E   +D++GHGTHTA TAAG FV
Sbjct  61    FSDDGMPPPPAKWKGICQFNTTKCNNKIIGARYFRYTENDPWDENGHGTHTASTAAGRFV  120

Query  1747  RGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggm  1568
              GAN++G+ANGTA GVAPLAH+AIYK C+ IGCS S++LAA+D AIEDGVD+LS+SLG  
Sbjct  121   PGANIFGNANGTAVGVAPLAHVAIYKTCSAIGCSGSDVLAAIDMAIEDGVDVLSISLGSR  180

Query  1567  ssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATV  1388
             +  F+ED IALGA+SAME+GIFVS SAGN GP+  S+SN+APW+LTVGAST+DRK+ AT 
Sbjct  181   ARQFYEDIIALGAFSAMERGIFVSCSAGNSGPYIFSISNDAPWILTVGASTIDRKIKATA  240

Query  1387  VLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCM  1208
             VLGN Q+F GE+AFQP DF  +LL L++PG NTSD  +  YC   SL N +V GKIV+C+
Sbjct  241   VLGNNQEFDGESAFQPSDFPPTLLPLIYPGINTSDILAK-YCYPTSLSNTNVMGKIVLCV  299

Query  1207  TGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINA  1028
               G      KG AVK A G  MI++ PE +  TT A AHVLP   +TYADG KI  YIN+
Sbjct  300   -AGITRAVDKGIAVKAAGGAAMIIMNPEYWANTTLAEAHVLPMTHVTYADGLKIQEYINS  358

Query  1027  TSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDN  848
             T+ P AT  FKGTI GD   P VA FSSRGP+  SP ILKPDIIGPGVNILA W  S++N
Sbjct  359   TTTPTATIVFKGTIIGDNRNPVVAGFSSRGPSYASPRILKPDIIGPGVNILAAWHISLEN  418

Query  847   KPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQN  668
                + STFN+ISGTS+SCPHLSGVAALLKS HPDWSPA IKSA+MTTAD++N   N I++
Sbjct  419   DMRTNSTFNMISGTSVSCPHLSGVAALLKSIHPDWSPAAIKSAIMTTADVINLKSNLIED  478

Query  667   QHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCS  488
             +  + A VF+ GAGHVNPSKANDPGL+YD KP DY+PYLCGLNYTNR+V VI+Q +VNCS
Sbjct  479   ETYLPADVFATGAGHVNPSKANDPGLIYDIKPSDYIPYLCGLNYTNRQVTVIVQRKVNCS  538

Query  487   AVISIPEAQLNYPSFSIILESTA--QTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRE  314
              + SI E QLNYPSFSI + S +  Q Y+RTVTNVG+A+S Y V+I  P G+ V VEP  
Sbjct  539   EITSILEGQLNYPSFSIQVRSNSEVQVYSRTVTNVGKANSTYRVDIDSPRGLDVKVEPTT  598

Query  313   LQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             L FS+V QKL+Y VTF  +  A  S +    QG+LRW S  H VRSPIA
Sbjct  599   LVFSEVKQKLSYQVTF--TPFATPSTI--YTQGSLRWISENHIVRSPIA  643



>ref|XP_002509658.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF51045.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=738

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/722 (58%), Positives = 527/722 (73%), Gaps = 20/722 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             + LETYI+ +E P      + +     DL  WY SFLP         +SR+V  YR+V+ 
Sbjct  31    TNLETYIILLEKPQGADFMEFN-----DLHGWYLSFLPANTFSSE--QSRLVHSYRHVVT  83

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAAKL+AEE K M  ++GF+ A P+R++PLHTTH+P FLGLQQN+GFW+ S++GKGVII
Sbjct  84    GFAAKLTAEEAKAMEMREGFVLARPQRMVPLHTTHTPSFLGLQQNLGFWKHSNFGKGVII  143

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT-ACNNKVIGARSFSERERSVFdddg  1790
             GV+DSGI  DHPSFS EGMPPPPA+W G CEL  T +CNNK+IGAR+F+     +FD   
Sbjct  144   GVVDSGITPDHPSFSGEGMPPPPAKWTGKCELKGTLSCNNKLIGARNFATNSNDLFDKVA  203

Query  1789  hgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEI-GCSDSEILAAMDTA  1613
             HGTHTA TAAG+ V+GA+ +G ANGTA G+APLAHLA+YKV        +SEILAAMD A
Sbjct  204   HGTHTASTAAGSPVQGASYFGQANGTAIGMAPLAHLAMYKVSGRARKAGESEILAAMDAA  263

Query  1612  IEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWML  1433
             IE+GVDILSLSLG  +  F++D IALGAY+A++K IFVS SAGN GP++ SLSNEAPW+L
Sbjct  264   IEEGVDILSLSLGIGTHPFYDDVIALGAYAAIQKRIFVSCSAGNSGPYSCSLSNEAPWIL  323

Query  1432  TVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSE  1253
             TVGASTVDR + ATV+LGN+ + +GE+ FQPKDF S+LL LV+ G N +  S+S  CD  
Sbjct  324   TVGASTVDRAIRATVLLGNKVELNGESLFQPKDFPSTLLPLVYAGANGNASSAS--CDHG  381

Query  1252  SLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAID  1073
             SL+N DV+GKIV+C  G  ++   KG+ VK+  G  MI++  +  G  T+   HVLPA  
Sbjct  382   SLKNVDVKGKIVLCEGG--IETISKGQEVKDNGGAAMIVMNDDLEGFITAPRLHVLPASH  439

Query  1072  ITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIG  893
             ++Y  G  I AYIN+ S+P AT  FKGT+ G  +AP VA FSSRGP+  SPGILKPDIIG
Sbjct  440   VSYEAGSSIKAYINSASSPKATILFKGTVVGLSDAPQVAYFSSRGPSCASPGILKPDIIG  499

Query  892   PGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMM  713
             PGV ILA WP SVDN  N    FN+ISGTSMSCPHL+G+AALLKS+HPDWSPA IKSA+M
Sbjct  500   PGVRILAAWPVSVDNTSNR---FNMISGTSMSCPHLTGIAALLKSAHPDWSPAAIKSAIM  556

Query  712   TTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYT  533
             TTA + N G  PI +Q  V A+VF +GAGHVNPS+ANDPGLVYD +P+DY+PYLCGL Y+
Sbjct  557   TTASLDNLGGKPISDQDYVPATVFDMGAGHVNPSRANDPGLVYDIQPDDYIPYLCGLGYS  616

Query  532   NREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIF  353
             ++ V VI+Q +V C+ V +IPEAQLNYPSFSI L S+ QTYTRTVTN G+ +S Y +EIF
Sbjct  617   DKHVRVIVQRKVKCTNVATIPEAQLNYPSFSIKLGSSPQTYTRTVTNFGQPNSAYYLEIF  676

Query  352   EPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSP  173
              P GV V V P+++ F+ VNQK TY+ TFS +  A         QG L+W +  + V SP
Sbjct  677   APKGVDVMVTPQKITFNGVNQKATYSATFSKNGNANGL----FAQGYLKWVAEGYSVGSP  732

Query  172   IA  167
             IA
Sbjct  733   IA  734



>ref|XP_004300736.1| PREDICTED: subtilisin-like protease SDD1-like [Fragaria vesca 
subsp. vesca]
Length=762

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/724 (60%), Positives = 531/724 (73%), Gaps = 16/724 (2%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGES-RMVFMYRNVMKG  2144
             ++TYIV VE P S    QS      DLE WY+SFLP T+A     E  RMV+ Y NV  G
Sbjct  44    MQTYIVWVEKPSSNFLAQSDHE---DLESWYQSFLPQTIANSNQLEKPRMVYAYHNVATG  100

Query  2143  FAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIG  1964
             FAA+L+AEEVKEM  K+GFISA PER L LHTTHSP FLGLQQ +G W+ S YG+GVIIG
Sbjct  101   FAARLTAEEVKEMEKKEGFISAHPERKLQLHTTHSPNFLGLQQQVGLWKGSHYGEGVIIG  160

Query  1963  VLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERS---VFddd  1793
             VLD+GI   HPSFSD+G+P PPA+WKG C+   T CN+K+IGARSF   + +     D  
Sbjct  161   VLDTGITPGHPSFSDKGVPAPPAKWKGKCDFKGTGCNDKLIGARSFDGGKTTGGPPVDAA  220

Query  1792  ghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTA  1613
             GHGTHT+ TAAGNFV GA+V+G A GTAAG+APLAHLA+Y+VC+E GC DS+I+A +DTA
Sbjct  221   GHGTHTSSTAAGNFVDGASVFGMAKGTAAGMAPLAHLAMYQVCSEDGCYDSDIIAGIDTA  280

Query  1612  IEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWML  1433
             + DGVD++S+SLGG S+ F+ DSIALGAY A++KGIFVS SAGNEGP   SLSNEAPW+L
Sbjct  281   VGDGVDVISISLGGGSAPFYGDSIALGAYGAIQKGIFVSCSAGNEGPDYSSLSNEAPWIL  340

Query  1432  TVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSE  1253
             TVGAST+DR + AT  LGN ++  GE+ FQPKDF S L  LV+   +++D  S+ +CD  
Sbjct  341   TVGASTIDRNIRATAKLGNGEEHDGESLFQPKDFGSELFPLVYAAAHSND--STAFCDVG  398

Query  1252  SLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAID  1073
             +L N  V GKIVVC  GG + R  KG  VK A G  MIL+ P+  G TT A AHVLPA  
Sbjct  399   TLSN--VEGKIVVCELGGEVKRIAKGIEVKRAGGVAMILVNPDFGGDTTIADAHVLPATH  456

Query  1072  ITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIG  893
             ++YA G  I AYIN+TS P AT  FKGT+ GD+ AP V+ FSSRGP+ ESPGILKPDIIG
Sbjct  457   VSYAAGVSIQAYINSTSTPTATILFKGTVIGDQLAPKVSFFSSRGPSIESPGILKPDIIG  516

Query  892   PGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMM  713
             PGV+ILA WP SVDN    K TF+I+SGTSMSCPHLSG+AALLKSSHPDWSPA IKSA+M
Sbjct  517   PGVSILAAWPFSVDNTTEYK-TFDIVSGTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIM  575

Query  712   TTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYT  533
             TTA++ N   + I ++ L +A++F+IGAGHVNPSKANDPGL+YD KP+DY+PYLCGLNYT
Sbjct  576   TTAEVDNLAGSAIIDETLNSANLFAIGAGHVNPSKANDPGLIYDLKPQDYIPYLCGLNYT  635

Query  532   NREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTA--QTYTRTVTNVGEASSFYTVE  359
             +R + +I Q  V CS V SIPEAQLNYPSFS+ L+     Q YTRTVTNVG A S Y + 
Sbjct  636   DRHIAIITQKTVKCSEVGSIPEAQLNYPSFSLFLDPAGEPQNYTRTVTNVGPAKSTYELA  695

Query  358   IFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVR  179
             +  P  V ++V+P +L F++V Q +TY+V F+    A +  +    QG L W S +H VR
Sbjct  696   VVSPHKVDISVQPEQLTFTEVGQTMTYHVVFAAQYDAGKDGI--TSQGYLSWVSDQHSVR  753

Query  178   SPIA  167
             S I+
Sbjct  754   SQIS  757



>ref|XP_002303551.2| hypothetical protein POPTR_0003s11870g [Populus trichocarpa]
 gb|EEE78530.2| hypothetical protein POPTR_0003s11870g [Populus trichocarpa]
Length=764

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/759 (57%), Positives = 531/759 (70%), Gaps = 33/759 (4%)
 Frame = -1

Query  2377  FLILSVLIGFC--------STATIASK--LETYIVRVELPHsristqsssssSVDLEHWY  2228
              L+L   + FC         T  I  K  L  YIV V  P  R   +       DLE WY
Sbjct  6     LLLLIFKLNFCPEIAQATQHTTKITEKTTLLNYIVHVAKPEGRTMAEFE-----DLESWY  60

Query  2227  KSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             +SFLP + A     + RM++ Y+NVM GFAA+L+ EEVK M  KDGF+SA PERIL L T
Sbjct  61    QSFLPVSTASS-EKQQRMLYAYQNVMSGFAARLTQEEVKSMEEKDGFLSARPERILHLQT  119

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             TH+P FLGL Q +GFW++S++GKGVIIGVLD GI   HPSFSDEGMPPPPA+WKG C+ N
Sbjct  120   THTPRFLGLHQELGFWKESNFGKGVIIGVLDGGIFPSHPSFSDEGMPPPPAKWKGRCDFN  179

Query  1867  FTACNNKVIGARSFS---------ERERSVFdddghgthtagtaaGNFVRGANVYGSANG  1715
              + CNNK+IGARSF+                D DGHGTHTA TAAG FV+ A V G+A G
Sbjct  180   ASDCNNKLIGARSFNIAAKAKKGSAATEPPIDVDGHGTHTASTAAGAFVKDAEVLGNARG  239

Query  1714  TAAGVAPLAHLAIYKVC-NEIG--CSDSEILAAMDTAIEDGVDIlslslggmssSFHEDS  1544
             TA G+AP AHLAIYKVC  + G  C +S+ILA +D A++DGVD+LSLSLG  S     D+
Sbjct  240   TAVGIAPHAHLAIYKVCFGDPGDDCPESDILAGLDAAVQDGVDVLSLSLGEDSVPLFNDT  299

Query  1543  IALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQF  1364
             IA+G+++A++KGIFVS SAGN GPFNG+LSNEAPW+LTVGASTVDR+ SAT  LGN +Q 
Sbjct  300   IAIGSFAAIQKGIFVSCSAGNSGPFNGTLSNEAPWILTVGASTVDRRFSATARLGNGEQI  359

Query  1363  HGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRR  1184
              GE+  Q  +F S+LL LV+ G   S + +S  C   +L   DV+GKIV+C  GG + R 
Sbjct  360   DGESLSQHSNFPSTLLPLVYAGM--SGKPNSSLCGEGALEGMDVKGKIVLCERGGGIGRI  417

Query  1183  GKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATF  1004
              KG  VKNA G  MIL+  E  G +T+A  HVLPA  +++A G KI AYIN+T  PMAT 
Sbjct  418   AKGGEVKNAGGAAMILMNEEADGFSTNADVHVLPATHVSFAAGLKIKAYINSTQAPMATI  477

Query  1003  SFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTF  824
              FKGT+ GD ++P VA+FSSRGP+  SPGILKPDIIGPGV+ILA WP  +DN  NSKSTF
Sbjct  478   LFKGTVIGDSSSPFVASFSSRGPSLASPGILKPDIIGPGVSILAAWPFPLDNNTNSKSTF  537

Query  823   NIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASV  644
             NIISGTSMSCPHLSG+AALLKSSHP WSPA IKSA+MTTAD LN     I +Q L  A +
Sbjct  538   NIISGTSMSCPHLSGIAALLKSSHPYWSPAAIKSAIMTTADTLNMEGKLIVDQTLQPADI  597

Query  643   FSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEA  464
             F+ GAGHVNPS+AN+PGLVYD +P+DY+PYLCGL Y + EV +I+  +V CS   SIPE 
Sbjct  598   FATGAGHVNPSRANNPGLVYDIQPDDYIPYLCGLGYADNEVSIIVHEQVKCSEKPSIPEG  657

Query  463   QLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKL  284
             +LNYPSF++ L   +QT+TRTVTNVG+ +S Y V I  PPGV V V+P +L FSKVNQK 
Sbjct  658   ELNYPSFAVTL-GPSQTFTRTVTNVGDVNSAYEVAIVSPPGVDVTVKPSKLYFSKVNQKA  716

Query  283   TYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             TY+V FS +    +++     QG + W S K+ VRSPIA
Sbjct  717   TYSVAFSRTEYGGKTS--ETAQGYIVWASAKYTVRSPIA  753



>ref|XP_010053374.1| PREDICTED: subtilisin-like protease SDD1 [Eucalyptus grandis]
Length=752

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/748 (57%), Positives = 527/748 (70%), Gaps = 15/748 (2%)
 Frame = -1

Query  2383  RMFLILSV--LIGF-CS------TATIASKLETYIVRVELPHsristqsssssSVDLEHW  2231
             R F +++V  L+GF CS      TA    + E  ++   + H R       + S DL+ W
Sbjct  7     RKFPMVAVFFLVGFICSFSFHPATAQTVLEHEQNVLSTYIVHVRKRAGEVFARSEDLQSW  66

Query  2230  YKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLH  2051
             Y+SFLP          +RMV  Y+N + GFAAK++A+E KE+   D  +S   E+I  LH
Sbjct  67    YQSFLPQMTPNSDQ-TNRMVHSYKNSITGFAAKMTADEAKELLKLDAVVSVKQEKIFSLH  125

Query  2050  TTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCEL  1871
             TTHSP FL L   +G W+DS+ GKGVIIGVLD+GI   HPSF DEGM  PPA+WKG C  
Sbjct  126   TTHSPSFLNLNPGVGLWKDSTLGKGVIIGVLDTGITPGHPSFDDEGMSFPPAKWKGKCTF  185

Query  1870  NFTACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPL  1691
             N T+CNNK+IGAR+F        D+DGHGTHT+ TAAGNFV+ ANV G A GTA GVAP 
Sbjct  186   NATSCNNKLIGARNFVTSTLPPTDEDGHGTHTSSTAAGNFVKNANVLGQALGTAIGVAPH  245

Query  1690  AHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEK  1511
             AHLA+Y+VC+++GC +S ILAAMD AIEDGVD+LSLSLGG S+ F+ DSIA+GA+SA++K
Sbjct  246   AHLAMYQVCSDVGCPESSILAAMDAAIEDGVDVLSLSLGGGSTPFYADSIAVGAFSAIQK  305

Query  1510  GIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDF  1331
             GIFVS SAGN GP N SLSNEAPW+LTVGAST+DR + AT  LGN  + +GE+ FQPKDF
Sbjct  306   GIFVSCSAGNSGPINTSLSNEAPWILTVGASTIDRTVKATAKLGNGAEHNGESLFQPKDF  365

Query  1330  NSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASG  1151
              S+   LV+ G N +  S+   C   SLRN DV+GK+V+C  GG + R  KG+ VK+A G
Sbjct  366   GSAY-PLVYAGANGNQTSA--LCAEGSLRNLDVKGKVVLCERGGGIARIAKGQEVKDAGG  422

Query  1150  RGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKN  971
               MI++  E  G +T A AHVLPA  I YADG KI +YIN+TSNPMAT  FKGTI G+  
Sbjct  423   AAMIMMNDELNGYSTLADAHVLPATHIPYADGLKIKSYINSTSNPMATILFKGTIIGNSE  482

Query  970   APTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCP  791
             AP V +FSSRGP+ ESPGILKPDIIGPGV+ILA WP S+DN   +  TFNIISGTSMSCP
Sbjct  483   APAVTSFSSRGPSFESPGILKPDIIGPGVSILAAWPFSLDNSSTTDVTFNIISGTSMSCP  542

Query  790   HLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPS  611
             HLSG+AALLKSSHPDWSPA IKSA+MTTA  +N G  PI ++ L+ A +F+ GAGHVNP 
Sbjct  543   HLSGIAALLKSSHPDWSPAAIKSAIMTTAYQINLGSKPIVDETLLPADIFATGAGHVNPP  602

Query  610   KANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL  431
             KA+DPGL+YD KP++Y+PYLCGL Y + E+  I Q +  C  + SIP+AQLNYPSFSIIL
Sbjct  603   KADDPGLIYDIKPDNYIPYLCGLGYKDSEIETITQEKAKCLQIKSIPQAQLNYPSFSIIL  662

Query  430   ESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSK  251
              S+AQ Y+RTVTNVG A S YT ++  P GV V V P E++FS   Q  TY V F  SS 
Sbjct  663   GSSAQNYSRTVTNVGPADSSYTYKVDAPEGVDVTVYPSEIKFSVAVQMATYTVGFHRSSG  722

Query  250   AARSNMPPVVQGALRWKSVKHHVRSPIA  167
              + +   P  QG+L W S  H VRSPIA
Sbjct  723   GSFTK--PFAQGSLTWVSSDHSVRSPIA  748



>ref|XP_008238728.1| PREDICTED: subtilisin-like protease SDD1 [Prunus mume]
Length=763

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/756 (56%), Positives = 541/756 (72%), Gaps = 24/756 (3%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIASK-----LETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             L+M ++  + + F S+ ++A+      ++TYIV VE P   ++  SS+ S  DLE WY++
Sbjct  9     LQMQIVYLLCLLFMSSLSLAADEEQNGMQTYIVWVEKP---VAQGSSAQSHEDLESWYQT  65

Query  2221  FLP--TTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             FLP  T        + R+V  Y NV  GFAAKL+ EEVK M  K GF+SA PE ILPLHT
Sbjct  66    FLPESTIATSNQLSKPRIVHAYHNVATGFAAKLTPEEVKAMEKKPGFVSAYPEAILPLHT  125

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             THSP FLGL Q +GFW+ S+YGKGVIIGVLD+G++ DHPSFSD G+PPPPA+WKG CE N
Sbjct  126   THSPNFLGLNQGLGFWKGSNYGKGVIIGVLDTGVSPDHPSFSDAGVPPPPAKWKGKCEFN  185

Query  1867  FTACNNKVIGARSFSERERSV------FdddghgthtagtaaGNFVRGANVYGSANGTAA  1706
                CNNK+IGAR+F+             D +GHGTHT+ TAAGNFV+GA V+G   GTA 
Sbjct  186   GRVCNNKLIGARNFNGISTGQPAGDPPLDQEGHGTHTSSTAAGNFVKGAAVFGMVKGTAV  245

Query  1705  GVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAY  1526
             G+AP AHLAIY+VC+  GC++ +ILAAMD A++DGVD+LSLSLGG S  F+ D +A+GA+
Sbjct  246   GMAPYAHLAIYRVCSVAGCAEGDILAAMDAAVDDGVDVLSLSLGGFSRPFYSDGVAVGAF  305

Query  1525  SAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAF  1346
              A++KGIFVS SAGN GP   + SNEAPW+LTVGAST+DR + AT  LGN+++++GE+ F
Sbjct  306   GAIQKGIFVSCSAGNSGPSYSTSSNEAPWILTVGASTIDRNIRATARLGNKKEYNGESLF  365

Query  1345  QPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAV  1166
             QP +FNS ++  +    +  +++++ +CD  +L+N  V+GKIV+C  GG   R  KG  V
Sbjct  366   QPNNFNSKIMLPLVDAGSLGNQTTA-FCDPGTLKN--VKGKIVLCERGGAGGRIDKGAEV  422

Query  1165  KNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTI  986
             K A G  MIL+     G +T A  HVLP   ++Y  G KI +Y+ +T+ P AT  FKGT+
Sbjct  423   KRAGGAAMILMNQRIDGFSTLADPHVLPTAHVSYNAGLKIKSYLKSTTKPTATILFKGTV  482

Query  985   TGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGT  806
              GDK+AP+VA+FSSRGP+  SPGILKPDI GPGV+ILA WP SVDN   SK+TFNIISGT
Sbjct  483   IGDKHAPSVASFSSRGPSTASPGILKPDITGPGVSILATWPVSVDNATKSKATFNIISGT  542

Query  805   SMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAG  626
             SMSCPHLSG+AALLK SHPDWSPA IKSA+MTTAD+ N G   I +Q L  A +F+IGAG
Sbjct  543   SMSCPHLSGIAALLKGSHPDWSPAAIKSAIMTTADVHNLGGKSIVDQTLKAADLFAIGAG  602

Query  625   HVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPS  446
             HVNPSKANDPGLVYDT+P +Y+ YLCGLNYT++++ +I Q  V+CS + +IPEAQLNYPS
Sbjct  603   HVNPSKANDPGLVYDTQPNNYIQYLCGLNYTDKQIQIITQQTVDCSKIGAIPEAQLNYPS  662

Query  445   FSIIL----ESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTY  278
             FSII+    ++ +Q YTRTV NVGEA+S Y ++I  P  V VNV P  L+F+KV Q +TY
Sbjct  663   FSIIIGSNKKTKSQLYTRTVKNVGEANSTYKLDILAPHKVDVNVSPEVLKFTKVKQTITY  722

Query  277   NVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPI  170
              V F     A +  +    +G LRW S KH+V SPI
Sbjct  723   RVKFVAQDGAGKDGV-LFGKGYLRWVSDKHNVTSPI  757



>ref|XP_009373361.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=780

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/733 (58%), Positives = 537/733 (73%), Gaps = 23/733 (3%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYG-ESRMVFMYRNVMKG  2144
             ++TYIV VE P   +S + S  S+ DLE WY+SFLP ++A        RMV  YRN+  G
Sbjct  51    MQTYIVWVEKP---VSQKFSLQSNEDLESWYQSFLPESIASSNQQMNQRMVHSYRNIATG  107

Query  2143  FAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIG  1964
             FAAKL+ EEV+EM  K+GF+SA P+RILPL TTH+P FLGL Q  G W  ++YGKGVIIG
Sbjct  108   FAAKLTPEEVREMVTKEGFVSARPQRILPLQTTHTPDFLGLHQGSGLWEAATYGKGVIIG  167

Query  1963  VLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF------SERERSVF  1802
             +LD+GI  DHPSF+DEGMPPPPA+WKG CE N T CNNK+IGAR+F        + R  F
Sbjct  168   LLDTGIVPDHPSFNDEGMPPPPAKWKGKCEFNETLCNNKLIGARNFIGVGKGQPKRRFPF  227

Query  1801  dddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAM  1622
             D DGHG+HT+ TAAG FV GA+VYG ANGTAAG+AP AHLA+YKVC   GC+D++I AA+
Sbjct  228   DIDGHGSHTSSTAAGRFVEGASVYGQANGTAAGMAPYAHLAMYKVCEGFGCADADIFAAL  287

Query  1621  DTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAP  1442
             D AI+DGVD+LSLSLGG S  F++D IA+GA++A++KGIF S + GN GP+N SLSNEAP
Sbjct  288   DVAIDDGVDVLSLSLGGPSLPFYDDVIAIGAFAAIQKGIFFSCAGGNSGPWNRSLSNEAP  347

Query  1441  WMLTVGASTVDRKLSATVVLGNRQQFH--GETAFQPKDFNSSLLSLVFPGQNTSDESSSP  1268
             W+LTVGAST DR L++ + +G+ +Q+H  G++  QP+DF+S++L  +    +  ++SS  
Sbjct  348   WILTVGASTTDRILTSGLQIGDEKQYHFDGKSLSQPEDFDSTVLLPLVDAGSFGNQSS--  405

Query  1267  YCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHV  1088
             +C + SL N  V GKIV+C TGG +    KGE VK A G  MIL+  E  G +T A AHV
Sbjct  406   FCKAGSLEN--VEGKIVLCETGGGVTNIAKGEEVKRAGGAAMILMNKEIDGFSTLAEAHV  463

Query  1087  LPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILK  908
             LPA  ++YA G +I  YI++TS P  T  F GT+ GD  AP VA+FSSRGPN  SPGILK
Sbjct  464   LPATHVSYAAGLQIKLYISSTSTPKGTILFNGTVIGDALAPKVASFSSRGPNIASPGILK  523

Query  907   PDIIGPGVNILAPWPTSVDN--KPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPA  734
             PD+IGPGV+ILA WP +VDN   PN K+ FNIISGTSM+CPHLSG+AALLKS+HPDWSPA
Sbjct  524   PDVIGPGVSILAAWPYNVDNVTHPNPKALFNIISGTSMACPHLSGIAALLKSTHPDWSPA  583

Query  733   MIKSAMMTTADILNHGQNPIQNQH-LVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLP  557
              IKSA+MTTAD+LN   +PI ++  L  A VF+IGAGHVNPSKANDPGL++D KPEDY+P
Sbjct  584   AIKSAIMTTADVLNLLGSPIVDESGLKPADVFAIGAGHVNPSKANDPGLIFDLKPEDYIP  643

Query  556   YLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL---ESTAQTYTRTVTNVG  386
             YLCGLNY +  + +I Q  V CS V +IPEAQLNYPSF+I +   ++  Q YTRTV NVG
Sbjct  644   YLCGLNYNDTAIKIITQQAVKCSQVGAIPEAQLNYPSFAITIGRNQTRTQYYTRTVRNVG  703

Query  385   EASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALR  206
              A+S Y +E+  P  + ++V P+ L F++VNQ++TYNV F+    A +  + P  QG LR
Sbjct  704   PATSTYNLELLVPHEMGMSVNPQVLTFTEVNQEITYNVEFNAHDGAGKDGV-PFGQGYLR  762

Query  205   WKSVKHHVRSPIA  167
             W S KH+V +PIA
Sbjct  763   WFSDKHNVTTPIA  775



>ref|XP_011033844.1| PREDICTED: subtilisin-like protease SDD1 [Populus euphratica]
Length=766

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/762 (56%), Positives = 534/762 (70%), Gaps = 33/762 (4%)
 Frame = -1

Query  2377  FLILSVLIGFC--------STATIASK--LETYIVRVELPHsristqsssssSVDLEHWY  2228
              L+L  ++ FC         T  I  K  L  YIV V  P  R   +       DLE WY
Sbjct  15    LLLLIFMLNFCPEIAQATQHTTKITEKTTLLNYIVHVAKPEGRTLAEFE-----DLESWY  69

Query  2227  KSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             +SFLP + A     + RM++ Y+NVM GFAA+L+ EEVK M  KDGF+SA PERIL L T
Sbjct  70    QSFLPVSTASS-EKQQRMLYAYQNVMSGFAARLTQEEVKSMEEKDGFLSARPERILHLQT  128

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             TH+P FLGL Q +GFW++S++GKGVI+GVLD GI   HPSF+DEGMPPPPA+WKG C+ N
Sbjct  129   THTPRFLGLHQELGFWKESNFGKGVIVGVLDGGIFPSHPSFNDEGMPPPPAKWKGRCDFN  188

Query  1867  FTACNNKVIGARSFS---------ERERSVFdddghgthtagtaaGNFVRGANVYGSANG  1715
              + CNNK+IGARSF+                D DGHGTHTA TAAG FV+ A V G+A G
Sbjct  189   ASDCNNKLIGARSFNIAAKAKKGSAATEPPIDVDGHGTHTASTAAGAFVKDAEVLGNARG  248

Query  1714  TAAGVAPLAHLAIYKVC-NEIG--CSDSEILAAMDTAIEDGVDIlslslggmssSFHEDS  1544
             TA G+AP AHLAIYKVC  + G  C +S+ILA +D A++DGVD+LSLSLGG S  F  D+
Sbjct  249   TAVGIAPHAHLAIYKVCFGDPGDDCPESDILAGLDAAVQDGVDVLSLSLGGDSVPFFNDT  308

Query  1543  IALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQF  1364
             IA+G+++A++KGIFVS SAGN GPF G+LSNEAPW+LTVGASTVDR+++A   LGN +Q 
Sbjct  309   IAIGSFAAIQKGIFVSCSAGNSGPFTGTLSNEAPWILTVGASTVDRRIAAIARLGNGEQI  368

Query  1363  HGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRR  1184
              GE+  Q  +F S+LL LV+ G   S + +S  C   +L   DVRGKIV+C  GG + R 
Sbjct  369   DGESLSQHSNFPSTLLPLVYAGM--SGKPNSSLCGEGALEGMDVRGKIVLCERGGGIGRI  426

Query  1183  GKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATF  1004
              KG  VKNA G  MIL+  E  G +T+A  HVLPA  +++A G KI AYIN+T  PMAT 
Sbjct  427   AKGGEVKNAGGAAMILMNEEADGFSTNADVHVLPATHVSFAKGLKIKAYINSTQAPMATI  486

Query  1003  SFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTF  824
              FKGT  GD ++P VA+FSSRGP+  SPGILKPDIIGPGV+ILA WP  +DN  NSKSTF
Sbjct  487   LFKGTAIGDPSSPFVASFSSRGPSLASPGILKPDIIGPGVSILAAWPFPLDNNTNSKSTF  546

Query  823   NIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASV  644
             NIISGTSMSCPHLSG+AALLKSSHP WSPA IKSA+MTTAD LN     I +Q L  A +
Sbjct  547   NIISGTSMSCPHLSGIAALLKSSHPYWSPAAIKSAIMTTADTLNMEGKLIVDQTLQPADI  606

Query  643   FSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEA  464
             F+ GAGHVNPS+AN+PGLVYD +P++Y+PYLCGL Y + EV +I+  +V CS   SIPE 
Sbjct  607   FATGAGHVNPSRANNPGLVYDIQPDNYIPYLCGLGYADNEVSIIVHEQVKCSEKPSIPEG  666

Query  463   QLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKL  284
             +LNYPSF++ L   +QT+TRTVTNVG+ +S Y V IF PPGV V V+P +L FSKVN+K 
Sbjct  667   ELNYPSFAVTL-GPSQTFTRTVTNVGDVNSAYEVAIFSPPGVDVTVKPSKLYFSKVNRKA  725

Query  283   TYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
             TY+V FS +    +++   + QG + W S K+ VRSPIA   
Sbjct  726   TYSVAFSRTEYGGKTS--EIAQGHIVWASSKYIVRSPIAVSF  765



>gb|KEH31683.1| subtilisin-like serine protease [Medicago truncatula]
Length=755

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/758 (56%), Positives = 535/758 (71%), Gaps = 31/758 (4%)
 Frame = -1

Query  2389  FLRMFLILSVLIGFC----------STATIASKLETYIVRVELPHsristqsssssSVDL  2240
             F+ +  +LS  I F           ST T  SK+  YI+ V  P  ++ TQS      DL
Sbjct  6     FIALTFVLSFHIHFTQGSELHPTARSTETSTSKI--YIIHVNKPEGKLFTQSEE----DL  59

Query  2239  EHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERIL  2060
             E W+ SF+PTTV      + RM++ YRNV+ GFAA+L+ EE++ +  K+GF+SA PER L
Sbjct  60    ESWHHSFMPTTVMSSDE-QPRMIYSYRNVLSGFAARLTQEELRAVQQKNGFVSAHPERTL  118

Query  2059  PLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIA-RDHPSFSDEGMPPPPARWKG  1883
                TTH+P FLGLQQN+G W++S++GKG+IIGVLDSGI   DHPSFSD G+PPPP++WKG
Sbjct  119   RRQTTHTPDFLGLQQNIGSWKESNFGKGIIIGVLDSGITPDDHPSFSDAGIPPPPSKWKG  178

Query  1882  VCELNFTACNNKVIGARSFS------ERERSVFdddghgthtagtaaGNFVRGANVYGSA  1721
              C+LN T CNNK+IGARSF+      E+  +  D+DGHGTHTA TAAG FV  A V G+A
Sbjct  179   RCKLNGTVCNNKLIGARSFNNAAVKGEKAEAPIDEDGHGTHTASTAAGAFVENAEVLGNA  238

Query  1720  NGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVD-IlslslggmssSFHEDS  1544
              GTAAG+AP AHLAIYKVC    C++S ILAA+D A+EDGVD I           F  DS
Sbjct  239   KGTAAGMAPHAHLAIYKVCFGEDCAESNILAALDAAVEDGVDVISISLGLSEPPPFFNDS  298

Query  1543  IALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQF  1364
              A+GA++A++KGIFVS +AGN GP + SL N APWMLTVGAST+DR + AT VLGN ++F
Sbjct  299   TAIGAFAAIQKGIFVSIAAGNFGPSDASLVNGAPWMLTVGASTIDRTIVATAVLGNGEEF  358

Query  1363  HGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRR  1184
              GE+ FQP DF+ +LL L + G N   ESS  +C + SL + D RGK+V+C  GG + R 
Sbjct  359   EGESVFQPSDFSPTLLPLAYAGINGKVESS--FCANGSLSDIDFRGKVVLCERGGGIGRI  416

Query  1183  GKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATF  1004
              KG+ V+ A G  MIL+  E  G + SA  HVLPA  ++YA G KI AYIN+TS P AT 
Sbjct  417   AKGQEVQRAGGAAMILMNDELNGFSLSADVHVLPATHVSYAAGLKIKAYINSTS-PTATI  475

Query  1003  SFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTF  824
             SFKGTI G+  AP+VA+FSSRGPN  SPGILKPDIIGPGVNILA WP  +DN  NSK  F
Sbjct  476   SFKGTIIGNSLAPSVASFSSRGPNLPSPGILKPDIIGPGVNILAAWPFPLDNNTNSKLNF  535

Query  823   NIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASV  644
             NI+SGTSMSCPHLSG+AALLKSSHPDWSPA IKSA+MT+AD LN     I ++ L  A++
Sbjct  536   NIMSGTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIMTSADTLNLENKLIVDETLQPANL  595

Query  643   FSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEA  464
             F+ G+GHVNP +A+DPGLVYD +P+DY+PYLCGL Y++REVG+I   ++NC+   SIPE 
Sbjct  596   FATGSGHVNPPRADDPGLVYDIQPDDYIPYLCGLGYSDREVGIIAHRKINCTETSSIPEG  655

Query  463   QLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKL  284
             +LNYPSFS++L S+ QT+TRTVTNVGEA S Y   +  P GV V+V P +L FS+ NQK 
Sbjct  656   ELNYPSFSVVLGSS-QTFTRTVTNVGEAQSSYFAIVAAPKGVDVSVHPNKLYFSEANQKQ  714

Query  283   TYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPI  170
             TY+VTF+      ++      QG L+W S KH VRSPI
Sbjct  715   TYSVTFNRIGSGHKTVEHG--QGFLKWVSAKHTVRSPI  750



>ref|XP_007208831.1| hypothetical protein PRUPE_ppa025337mg [Prunus persica]
 gb|EMJ10030.1| hypothetical protein PRUPE_ppa025337mg [Prunus persica]
Length=753

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/729 (57%), Positives = 526/729 (72%), Gaps = 19/729 (3%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLP--TTVAGGGYGESRMVFMYRNVMK  2147
             ++TYIV VE P   ++  SS+ S  DLE WY++FLP  T        + R+V  Y NV  
Sbjct  26    MQTYIVWVEKP---VAQGSSAQSHEDLESWYQTFLPESTIATSNQLSKPRIVHAYHNVAT  82

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAAKL+ EEVK M  K GF+SA PE ILPLHTTHSP FLGL Q +GFW+ S+YGKGVII
Sbjct  83    GFAAKLTPEEVKAMEKKPGFVSAHPEAILPLHTTHSPNFLGLNQGLGFWKGSNYGKGVII  142

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSV------  1805
             GVLD+G++ DHPSFSD G+PPPPA+WKG CE N   CNNK+IGAR+F+            
Sbjct  143   GVLDTGVSPDHPSFSDAGVPPPPAKWKGKCEFNGRVCNNKLIGARNFNGISTGQPAGDPP  202

Query  1804  FdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAA  1625
             FD +GHGTHT+ TAAGNFV+GA V+G   GTA G+AP AHLAIY+VC+  GC++ +ILAA
Sbjct  203   FDQEGHGTHTSSTAAGNFVKGAAVFGMVKGTAVGMAPYAHLAIYRVCSVAGCAEGDILAA  262

Query  1624  MDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEA  1445
             MD A++DGVD+LSLSLGG S  F+ D +A+GA+ A++KGIFVS SAGN GP   + SNEA
Sbjct  263   MDAAVDDGVDVLSLSLGGFSRPFYSDGVAVGAFGAIQKGIFVSCSAGNSGPSYSTSSNEA  322

Query  1444  PWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPY  1265
             PW+LTVGAST+DR + AT  LGN+++++GE+ FQP +FNS ++  +    +  +++S+ +
Sbjct  323   PWILTVGASTIDRNIRATARLGNKKEYNGESLFQPNNFNSKIMLPLVDAGSLGNQTSA-F  381

Query  1264  CDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVL  1085
             CD  +L+N  V+GKIV+C  GG   R  KG  VK A G  MIL+     G +T A  HVL
Sbjct  382   CDPGTLKN--VKGKIVLCERGGAGGRIDKGAEVKRAGGAAMILMNQRIDGFSTLADPHVL  439

Query  1084  PAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKP  905
             P   ++Y  G KI +Y+ +T+ P AT  FKGT+ GDK+AP+VA+FSSRGP+  SPGILKP
Sbjct  440   PTAHVSYDAGLKIKSYLKSTTKPTATILFKGTVIGDKHAPSVASFSSRGPSTASPGILKP  499

Query  904   DIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIK  725
             DI GPGV+ILA WP SVDN   SK+TFNIISGTSM+CPHLSG+AALLK SHPDWSPA IK
Sbjct  500   DITGPGVSILATWPVSVDNATKSKATFNIISGTSMACPHLSGIAALLKGSHPDWSPAAIK  559

Query  724   SAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCG  545
             SA+MTTAD+ N G   I +Q L  A +F+IGAGHVNPSKANDPGLVYDT+P +Y+ YLCG
Sbjct  560   SAIMTTADVHNLGGKSIVDQALKAADLFAIGAGHVNPSKANDPGLVYDTQPNNYIQYLCG  619

Query  544   LNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILEST----AQTYTRTVTNVGEAS  377
             LNYT++++ +I Q  V+CS + +IPEAQLNYPSFSII+ S     +Q YTRTV NVGEA+
Sbjct  620   LNYTDKQIQIITQQTVDCSKIGAIPEAQLNYPSFSIIIGSNKKTRSQLYTRTVKNVGEAN  679

Query  376   SFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKS  197
             S Y ++I  P  V VNV P  L+F+KV Q +TY V F     A +  +    +G LRW S
Sbjct  680   STYKLDILAPHKVDVNVSPEVLKFTKVKQTITYRVKFVAQEGAGKDGV-LFGKGYLRWVS  738

Query  196   VKHHVRSPI  170
               H+V SPI
Sbjct  739   DNHNVASPI  747



>gb|EYU22359.1| hypothetical protein MIMGU_mgv1a023284mg [Erythranthe guttata]
Length=731

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/746 (57%), Positives = 541/746 (73%), Gaps = 24/746 (3%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             M +  +FL L+         +  S L+TYIV VELP     T SS  +  DL+ +Y++FL
Sbjct  1     MGYYTLFLTLT---------SKDSNLQTYIVHVELPSFPTLTTSSLLTE-DLQAYYQTFL  50

Query  2215  PTTVAGGG--YGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTH  2042
              +T++       E  +++ Y NV  GF+A+LS E+VK M  K GFISA P++ L LHTTH
Sbjct  51    ASTLSASSPSTDEPSIIYSYHNVFHGFSARLSPEQVKAMEKKPGFISARPQKTLSLHTTH  110

Query  2041  SPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT  1862
             SP FLGL QN GFWRDS+YG+G+IIGVLDSG+  +HPSF+D+GMPPPPA W+G CE N T
Sbjct  111   SPNFLGLNQNTGFWRDSNYGRGMIIGVLDSGVNPNHPSFNDDGMPPPPASWRGRCEFNST  170

Query  1861  A--CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLA  1688
                CNNK+IGAR F+  + +  D+DGHGTHTA TAAGNFV GANV+G+ANGTAAGVAPLA
Sbjct  171   IARCNNKLIGARFFTIGDGTPSDEDGHGTHTASTAAGNFVPGANVFGNANGTAAGVAPLA  230

Query  1687  HLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKG  1508
             H+A YKVC    C +S+I+AAMD AI+DGVDI+SLSLGG +  F  ++IA+GA+SA+E+G
Sbjct  231   HVATYKVCTTT-CEESDIVAAMDAAIDDGVDIISLSLGGPAQDFFGENIAVGAFSAIERG  289

Query  1507  IFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFN  1328
             IFVSASAGN GPF G+  N APW+LTVGAS+VDRK+ AT VLGN ++  GE+ FQP DF 
Sbjct  290   IFVSASAGNNGPFYGTAQNGAPWILTVGASSVDRKIRATAVLGNNEELDGESTFQPSDFP  349

Query  1327  SSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGR  1148
             ++LL L +   ++       +C   SLR+ D++G IV+C  GG + R  KG AV+ A G 
Sbjct  350   TTLLPLFYSPNDS-------FCSPASLRSLDLQGMIVLCDNGGGIGRIAKGRAVRAAGGA  402

Query  1147  GMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNA  968
              M+++  +  G TT++ +HVLPA  ++Y DG ++ AY+N+T++P AT SFKGT+ GD  A
Sbjct  403   AMVIVNQQRQGFTTNSDSHVLPATHLSYTDGLRVKAYLNSTASPTATISFKGTVIGDDRA  462

Query  967   PTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPH  788
             P VAAFS+RGPN  SPGILKPDIIGPG NILA W  SV+N   + S FNIISGTSMSCPH
Sbjct  463   PQVAAFSARGPNPPSPGILKPDIIGPGHNILAAWHVSVENNTGTNSNFNIISGTSMSCPH  522

Query  787   LSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSK  608
             LSGVAALLKS HPDWSPA IKSA+MTTAD++N   NPI++Q    A VF+IG+GH+N  K
Sbjct  523   LSGVAALLKSVHPDWSPAAIKSAIMTTADLVNLAGNPIEDQTQSRADVFAIGSGHINILK  582

Query  607   ANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILE  428
             A DPGLVYD  P+DY+PYLCGLNYT+++V VI+   V C+ + SIPEA+LNYPSFS+ + 
Sbjct  583   ATDPGLVYDMGPQDYVPYLCGLNYTDQQVAVIVNRVVRCAEISSIPEAELNYPSFSVGIG  642

Query  427   STAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKA  248
             +T+ TY RTVTNVGEA+S YTV     P V V VEP  LQFS +NQ LTY  TF+ +S  
Sbjct  643   NTSTTYNRTVTNVGEANSIYTVRA-ALPLVDVRVEPTTLQFSAINQTLTYQTTFTRAS-G  700

Query  247   ARSNMPPVVQGALRWKSVKHHVRSPI  170
               + +  +VQG L W S +H VRSPI
Sbjct  701   NTTIVNVIVQGFLTWTSGRHTVRSPI  726



>ref|XP_010053378.1| PREDICTED: subtilisin-like protease SDD1 [Eucalyptus grandis]
Length=752

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/746 (56%), Positives = 521/746 (70%), Gaps = 9/746 (1%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFC---STATIASKLETYIVRVELPHsristqsssssSVDLEHWYK  2225
             +  + +F ++  +  F    +TA    + E  ++   + H R       + S DL+ WY+
Sbjct  9     LPMVAVFFLVGFICSFSFHPATAKTVLEHEQNVLSTYIVHVRKRAGEVFARSEDLQSWYQ  68

Query  2224  SFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTT  2045
             SFLP          +RMV  Y+N + GFAAK++ +EVKE+   D  +S   E+I  LHTT
Sbjct  69    SFLPQMTPNSDQ-TNRMVHSYKNSITGFAAKMTEDEVKELLKLDAVVSVKQEKIFSLHTT  127

Query  2044  HSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNF  1865
             HSP FL L   +G W+DS+ GKGVIIGVLD+GI  DHPSF DEGM  PPA+WKG C  N 
Sbjct  128   HSPSFLNLNPGVGLWKDSTLGKGVIIGVLDTGITPDHPSFDDEGMSSPPAKWKGKCNFNA  187

Query  1864  TACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAH  1685
             T+CNNK+IGAR+F        D+DGHGTHT+ TAAGNFV+ ANV G A GTA G+AP AH
Sbjct  188   TSCNNKLIGARNFVNSTLPPTDEDGHGTHTSSTAAGNFVKNANVLGQALGTAIGMAPHAH  247

Query  1684  LAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGI  1505
             LA+Y+VC+++GC +S ILA MD AIEDGVD+LSLSLGG S+ F+ DS A+GA+SA+ KGI
Sbjct  248   LAMYQVCSDVGCPESSILAGMDAAIEDGVDVLSLSLGGGSAPFYADSTAVGAFSAIRKGI  307

Query  1504  FVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNS  1325
             FVS SAGN GP N SLSN+APW+LTVGAST+DR + AT  LGN  ++ GE+ FQPKDF  
Sbjct  308   FVSCSAGNSGPINTSLSNDAPWILTVGASTIDRTIKATAKLGNGAEYDGESLFQPKDFGL  367

Query  1324  SLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRG  1145
             +  SLV+ G N +  S+   C   SLRN DV+GK+V+C  GG + R  KG+ VK+A G  
Sbjct  368   AY-SLVYAGANGNQTSA--ICAEGSLRNLDVKGKVVLCERGGGIARIAKGQEVKDAGGAA  424

Query  1144  MILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAP  965
             MIL+  E  G +T A AHVLPA  I YADG KI AYIN+TS+P AT  FKGTI  + +AP
Sbjct  425   MILMNDELNGYSTLADAHVLPATHIPYADGLKIKAYINSTSDPTATILFKGTIIRNSDAP  484

Query  964   TVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHL  785
              V +FSSRGP+ ESPGILKPDIIGPGV+ILA WP S+DN   ++ TFNIISGTSMSCPHL
Sbjct  485   AVTSFSSRGPSLESPGILKPDIIGPGVSILAAWPFSLDNSSTTEVTFNIISGTSMSCPHL  544

Query  784   SGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKA  605
             SG+AALLKSSHPDWSPA IKSA+MTTA  +N G  PI ++ L+ A +F+ GAGHVNP KA
Sbjct  545   SGIAALLKSSHPDWSPAAIKSAIMTTAYQMNLGSKPIIDETLLPADIFATGAGHVNPPKA  604

Query  604   NDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILES  425
             +DPGL+YD KP+DY+PYLCGL Y + E+  I Q +  CS + SIPEAQLNYPSFSIIL S
Sbjct  605   DDPGLIYDIKPDDYIPYLCGLGYKDSEIETITQEKAKCSQIKSIPEAQLNYPSFSIILGS  664

Query  424   TAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAA  245
             +AQ Y+RTVTNV    S YT ++  P GV V V P E++FS   Q  TY V F  SS  +
Sbjct  665   SAQNYSRTVTNVEPTHSSYTYKVDAPEGVDVTVYPSEIKFSVAVQIATYTVGFRRSSGGS  724

Query  244   RSNMPPVVQGALRWKSVKHHVRSPIA  167
              +   P  QG+L W S  H VRSPIA
Sbjct  725   VTK--PFAQGSLTWVSSDHSVRSPIA  748



>gb|EYU39035.1| hypothetical protein MIMGU_mgv1a001882mg [Erythranthe guttata]
Length=745

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/725 (58%), Positives = 532/725 (73%), Gaps = 17/725 (2%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S L+TYIV V+LP  R+S  S      +LE WY SFLP    G     +R+V  +R+V  
Sbjct  36    STLQTYIVHVKLPRGRVSADSD-----ELERWYISFLP----GDKGPRTRLVRTFRHVAT  86

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAAKL++EEVKEM  K+GFI+A  ++ L LHTTHSP FLGL QN+G W+ S+YG+GVII
Sbjct  87    GFAAKLTSEEVKEMEKKEGFITARLQKKLSLHTTHSPSFLGLHQNLGLWKGSNYGEGVII  146

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-SERERSVFdddg  1790
             G++DSGI+  H SF D  +PPPP +WKG CE +   CNNK+IGAR+F S+      DD G
Sbjct  147   GLIDSGISPGHSSFDDRDVPPPPKKWKGQCEFS-AGCNNKLIGARNFASDTWGPPVDDYG  205

Query  1789  hgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAI  1610
             HGTHTA TAAGNFV G NV+G ANGTA G+AP AHLA+YKVC++ GC +++ILAAMD AI
Sbjct  206   HGTHTASTAAGNFVPGGNVFGMANGTAVGMAPRAHLAMYKVCSDEGCYEADILAAMDAAI  265

Query  1609  EDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLT  1430
             EDGV ++SLSLGG S  F +D IA+GA++A++KGIFVS SAGN GPF+GSLSNEAPW+LT
Sbjct  266   EDGVHVMSLSLGGGSIDFFDDVIAIGAFAAIQKGIFVSCSAGNSGPFDGSLSNEAPWILT  325

Query  1429  VGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSES  1250
             VGAST+DR++ AT VLGN+ ++ GE+ +QP DF    + L+          ++  C+  S
Sbjct  326   VGASTIDRRIVATAVLGNKDEYTGESVYQPSDFPYEDMPLI---DAAGGNVTTGLCEPGS  382

Query  1249  LRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDI  1070
             L N DV+GKIV+C +GG+ D   KG+ VK+A G  MIL+  E    TT A  HVLPA ++
Sbjct  383   LDNIDVKGKIVLCQSGGWTDPIDKGQTVKDAGGAAMILMNKERDAYTTIADPHVLPATEV  442

Query  1069  TYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGP  890
             +Y  G KI AYI++TS P A   F+GT+ G  +A TVA+FSSRGP+  SPGILKPDI+GP
Sbjct  443   SYDAGVKIRAYISSTSTPRAAIMFRGTVIGFPSALTVASFSSRGPSSASPGILKPDIVGP  502

Query  889   GVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMT  710
             GVNILA WP SVDN PN  + FNIISGTSMSCPHLSGVAALLKS+HPDWSPA IKSA+MT
Sbjct  503   GVNILAAWPESVDNYPNENAIFNIISGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIMT  562

Query  709   TADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTN  530
             TA  L+    PI+++  + A +F++GAGHVNPS ANDPGLVYD +PEDY+PYLCGL YT+
Sbjct  563   TASQLDSAGGPIEDERHLPADIFALGAGHVNPSSANDPGLVYDLQPEDYIPYLCGLGYTD  622

Query  529   REVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFE  350
              E+  I+   V+CS + SIPEAQLNYPSFS+ L ++ +TYTRTVTNVGEA+S Y+VEI  
Sbjct  623   DEIETIVHQSVSCSNITSIPEAQLNYPSFSVQLGASTKTYTRTVTNVGEANSTYSVEIIR  682

Query  349   PPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPI  170
               GV + VEP  L FSKVNQK+TY ++F  SS +        VQGA+ W+S K  VRSPI
Sbjct  683   AKGVDLGVEPCTLSFSKVNQKMTYEISFRKSSTSVNGTF---VQGAIVWRSAKRAVRSPI  739

Query  169   AAKLV  155
             + KLV
Sbjct  740   SVKLV  744



>ref|XP_008381935.1| PREDICTED: subtilisin-like protease SDD1 [Malus domestica]
Length=752

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/765 (55%), Positives = 533/765 (70%), Gaps = 36/765 (5%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFC----------STATIASKLETYIVRVELPHsristqsssssSV  2246
             M FL +  ILS    FC             T  S L+TYIV V  P  R+  Q+      
Sbjct  4     MPFLTLIFILS----FCYVTAQKKELSPATTKTSNLQTYIVHVRQPEGRVFAQTE-----  54

Query  2245  DLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPER  2066
             DL+ W++SFLP T A       R+++ Y+ V+ GFAA+L+ +EVK M   D F++A P+R
Sbjct  55    DLKSWHESFLPXTTASADE-PPRLLYSYQXVISGFAARLTQDEVKAMQEMDXFVAAYPQR  113

Query  2065  ILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWK  1886
             +    TTH+P FLGL Q  G W+DS++GKGVIIGVLD GI  +HPSFS  G+PPPPA+WK
Sbjct  114   VFRRKTTHTPYFLGLHQQTGIWKDSNFGKGVIIGVLDGGIEPNHPSFSGAGIPPPPAKWK  173

Query  1885  GVCELNFTACNNKVIGARSFS--------ERERSVFdddghgthtagtaaGNFVRGANVY  1730
             G C+ N + CNNK+IGAR+F+        E+  +  D DGHGTHTA TAAG FV+ A+V 
Sbjct  174   GRCDFNXSDCNNKLIGARAFNLAAKALKGEKPEAPIDIDGHGTHTASTAAGAFVQNADVL  233

Query  1729  GSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHE  1550
             G+A GTA G+AP AHLAIYKVC    C D++ILAA++ A++DGVD++S+SLG  S  F +
Sbjct  234   GNAKGTAVGIAPHAHLAIYKVCFGDPCPDADILAALEAAVQDGVDVISISLGEASVPFFQ  293

Query  1549  DSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQ  1370
             D+ A+G+++A++KGIFVS +AGN GPFNG+LSNEAPWMLTVGAST+DR + AT  LGN Q
Sbjct  294   DTTAIGSFAAIQKGIFVSCAAGNSGPFNGTLSNEAPWMLTVGASTIDRXVVATAKLGNGQ  353

Query  1369  QFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLD  1190
              F GE+ FQP DF S+L+ L++ G N +D   S  C   SL+   V+GK+VVC  GG + 
Sbjct  354   VFDGESLFQPSDFPSTLMPLIYAGVNGND---SALCAEGSLKGLPVKGKVVVCERGGGIG  410

Query  1189  RRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMA  1010
             R  KGE VKNA G  MIL+  E  G++ SA  HVLPA  ++YA G KI AYIN+T  P A
Sbjct  411   RIAKGEEVKNAGGAAMILLNEETDGVSXSADVHVLPATHVSYAAGLKIKAYINSTXTPTA  470

Query  1009  TFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKS  830
             T  FKGT+ GD + P VA+FSSRGP+  SPGILKPDIIGPGV+ILA WP  VDN   SK 
Sbjct  471   TILFKGTVIGDSSTPVVASFSSRGPSLASPGILKPDIIGPGVSILAAWPFPVDNTTKSKI  530

Query  829   TFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTA  650
              FNI+SGTSMSCPHLSG+AALLKSSHP WSPA IKSA+MT+AD+LN    PI ++ L  A
Sbjct  531   NFNIMSGTSMSCPHLSGIAALLKSSHPYWSPAAIKSAIMTSADLLNLEGKPILDEQLQPA  590

Query  649   SVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIP  470
              V + GAG VNPSKANDPGL+YD +P+DY+PYLCGL Y + E+ +I+  ++ CS V SIP
Sbjct  591   DVLATGAGQVNPSKANDPGLIYDIQPDDYIPYLCGLGYKDDEISIIVHRQIKCSMVSSIP  650

Query  469   EAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQ  290
             E +LNYPSFS+ L   ++T+TRT+TNVGEA S Y V++  P GV V+V+P+ L F+KVNQ
Sbjct  651   EGELNYPSFSVTL-GPSZTFTRTLTNVGEAYSSYAVKVNAPEGVHVSVKPKTLNFTKVNQ  709

Query  289   KLTYNVTFS-LSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
             K++Y+VTFS + SK           G L W S K+ VRSP++ KL
Sbjct  710   KMSYSVTFSHIGSKGEAGEF---TXGFLTWVSAKYVVRSPVSVKL  751



>ref|XP_006477586.1| PREDICTED: subtilisin-like protease SDD1-like [Citrus sinensis]
Length=750

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/757 (55%), Positives = 538/757 (71%), Gaps = 30/757 (4%)
 Frame = -1

Query  2377  FLILSVLIGF----------CSTATIASKLETYIVRVELPHsristqsssssSVDLEHWY  2228
             F+ L++L  F           S+ T  S L+TYIV V+ P      +S       +E+W+
Sbjct  6     FIFLTLLFIFHFKKAHGTDQVSSVTERSNLQTYIVSVQQPEGSDLAESEY-----VENWH  60

Query  2227  KSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             +SFLP ++      + R  + Y+NV+ GFAAKL+ EEV++M  K+GF+SA PER + L T
Sbjct  61    RSFLPYSLESSDV-QQRPFYSYKNVISGFAAKLTEEEVQDMKKKNGFVSARPERKVRLQT  119

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             THSP FLGL Q MG W++S++GKGVIIG+LD GI  DHPSFSDEGMPPPPA+WKG C+  
Sbjct  120   THSPSFLGLHQGMGVWKESNFGKGVIIGILDGGINPDHPSFSDEGMPPPPAKWKGRCD--  177

Query  1867  FTACNNKVIGARSFS-----ERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAG  1703
             F+ CNNK+IGAR+F+     +      D DGHGTH AGTAAG FV+ A   G+A GTAAG
Sbjct  178   FSTCNNKLIGARTFNIEGNVKGTEPPIDVDGHGTHVAGTAAGAFVKNAESLGNAKGTAAG  237

Query  1702  VAPLAHLAIYKVC--NEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGA  1529
             +AP AHLAIYKVC   ++ C++S++LA +D AIEDGVD+LS+S+GG S  F  DSIA+G+
Sbjct  238   MAPYAHLAIYKVCFGGDVDCTESDLLAGLDAAIEDGVDVLSISIGGGSVPFFNDSIAVGS  297

Query  1528  YSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETA  1349
             ++A++KGIFVS +AGN GPFN ++SNEAPW+LTVGAST+DR + AT  LGNR++F GE+ 
Sbjct  298   FAAIQKGIFVSCAAGNSGPFNSTISNEAPWILTVGASTLDRSIVATAKLGNREEFDGESV  357

Query  1348  FQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEA  1169
             FQPKDF  + L LV+ G N   ES+  +C + SL   DV+GK+V+C  GG + R  KGE 
Sbjct  358   FQPKDFPQTPLPLVYAGMNGKPESA--FCGNGSLSGIDVKGKVVLCERGGGIARIFKGEQ  415

Query  1168  VKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGT  989
             VKNA G  MIL+  E    +  A  HVLPA  ++   G KI +YIN+T+ PMAT  FKGT
Sbjct  416   VKNAGGAAMILMNDEPNAFSVIADPHVLPATHVSNDAGLKIKSYINSTATPMATIIFKGT  475

Query  988   ITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISG  809
             + G+  APTV +FSSRGPN  SPGILKPDIIGPG++ILA W   +D   N KS FNI+SG
Sbjct  476   VIGNSLAPTVVSFSSRGPNLASPGILKPDIIGPGLSILAAWFEPLDFNTNPKSIFNIMSG  535

Query  808   TSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGA  629
             TSM+CPHLSG+AALLKSSHP WSPA IKSA+MTTAD+LN     I ++ L  A +F+IGA
Sbjct  536   TSMACPHLSGIAALLKSSHPYWSPAAIKSALMTTADLLNMNGERIVDETLRPADIFAIGA  595

Query  628   GHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYP  449
             GHVNPS+ANDPGLVYD +P+DY+PYLCGL Y+++EVG+++   V CS +  IPEAQLNYP
Sbjct  596   GHVNPSRANDPGLVYDIQPDDYIPYLCGLGYSDKEVGILVHRPVVCSRIGKIPEAQLNYP  655

Query  448   SFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVT  269
             SFS+ L   AQT+TRTVTNVG+  S Y V +  P GV V+V+P +L FSKVNQK TY+VT
Sbjct  656   SFSVTL-GPAQTFTRTVTNVGQVYSSYAVNVVAPQGVVVSVKPSKLYFSKVNQKATYSVT  714

Query  268   FSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
             F+ S     S      QG + W S K+ VRSPI+ +L
Sbjct  715   FTRSGSGYTSGQ--FAQGYITWVSAKYSVRSPISVRL  749



>ref|XP_002509656.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF51043.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=741

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/745 (57%), Positives = 529/745 (71%), Gaps = 23/745 (3%)
 Frame = -1

Query  2392  KFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLP  2213
             + + +FL+    +     A    +LETYIV VE    ++S QS      DL+ WY+SFL 
Sbjct  11    RIVAIFLLSFTSVFRSFLAIKEERLETYIVFVEKSEDQVSLQSK-----DLDRWYQSFL-  64

Query  2212  TTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPG  2033
              TV+     + RM+  YRNV+ GFAAK++A +   M  K GF+SA   ++LPLHTTH+P 
Sbjct  65    -TVSTASSIKPRMLHSYRNVVTGFAAKMTAHQANSMEEKKGFVSARLAKVLPLHTTHTPS  123

Query  2032  FLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN-FTAC  1856
             FLGLQQN+GFW +SSYGKGVIIG+LD+GI  DHPSF+DEGMP PP +WKG CE N  T C
Sbjct  124   FLGLQQNVGFWNNSSYGKGVIIGILDTGITPDHPSFNDEGMPSPPEKWKGKCEFNNKTVC  183

Query  1855  NNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAI  1676
             NNK+IGAR+         DD GHGTHTA TAAG+ ++GAN +G  NGTA+G+APLAHLA+
Sbjct  184   NNKLIGARNLVSAGSPPVDDMGHGTHTASTAAGSPLQGANYFGQVNGTASGIAPLAHLAL  243

Query  1675  YKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVS  1496
             Y+VC+E GC +SEILAAMD  +EDGVD++SLSLGG S  F+ D IA+GAY A+ KGIFVS
Sbjct  244   YRVCDESGCGESEILAAMDAGVEDGVDVISLSLGGPSLPFYSDVIAIGAYGAINKGIFVS  303

Query  1495  ASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLL  1316
              +AGN GP   SLSNEAPW+LTVGAST+DR + ATV+LGN  +  GE+ FQPKDF S LL
Sbjct  304   CAAGNSGPNEESLSNEAPWILTVGASTIDRAIRATVLLGNNTKLRGESLFQPKDFPSKLL  363

Query  1315  SLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMIL  1136
              LV+PG   S       C + SL+N DV+GKIV+C  GG +    KG+ VK+  G  MIL
Sbjct  364   PLVYPGGGASK------CKAGSLKNVDVKGKIVLCNRGGDVGVIDKGQEVKDNGGAAMIL  417

Query  1135  IEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVA  956
             +  E  G   SA  HVLPA  + Y DG  I +Y+++TS+P+AT  F+GT+TG  +AP VA
Sbjct  418   VNDEYSGYDISADLHVLPASHVDYVDGLTIKSYLHSTSSPVATILFEGTVTGVADAPQVA  477

Query  955   AFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGV  776
              FSSRGP++ SPGILKPDIIGPGVNILA WP S DN  N    FN+ISGTSMSCPHLSG+
Sbjct  478   TFSSRGPSQASPGILKPDIIGPGVNILAAWPESTDNSVNR---FNMISGTSMSCPHLSGI  534

Query  775   AALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDP  596
             AAL+KS+HPDWSPA IKSA+MTTA + +   NPI +Q  VT++VF IGAGHVNP++AN+P
Sbjct  535   AALIKSAHPDWSPAAIKSAIMTTASLSSLSGNPISDQQFVTSTVFDIGAGHVNPTEANNP  594

Query  595   GLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNC--SAVISIPEAQLNYPSFSIILEST  422
             GLVYD  PEDY+PYL GL Y++++VG+I+QH +    S+  +IPEAQLNYPSFS+ L S 
Sbjct  595   GLVYDILPEDYIPYLRGLGYSDKQVGLIVQHTMGSSNSSFRTIPEAQLNYPSFSVKLGSD  654

Query  421   AQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAAR  242
              QTYTRTVTNVG   + +T EI +P GV V V P +L F+ VNQK  Y+VTF+       
Sbjct  655   PQTYTRTVTNVGVPGTSFTYEIIQPQGVDVAVTPDKLVFNAVNQKAAYSVTFTKKEDGTG  714

Query  241   SNMPPVVQGALRWKSVKHHVRSPIA  167
             +      QG L WK+  + VRSPIA
Sbjct  715   T----FAQGYLTWKTDLYTVRSPIA  735



>ref|XP_006440474.1| hypothetical protein CICLE_v10023558mg [Citrus clementina]
 gb|ESR53714.1| hypothetical protein CICLE_v10023558mg [Citrus clementina]
Length=750

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/757 (55%), Positives = 537/757 (71%), Gaps = 30/757 (4%)
 Frame = -1

Query  2377  FLILSVLIGF----------CSTATIASKLETYIVRVELPHsristqsssssSVDLEHWY  2228
             F+ L++L  F           S+ T  S L+TYIV V+ P      +S       +E+W+
Sbjct  6     FIFLTLLFIFHFKKAHGTDQVSSVTERSNLQTYIVSVQQPEGSDLAESEY-----VENWH  60

Query  2227  KSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             +SFLP ++      + R  + Y+NV+ GFAAKL+ EEV++M  K+GF+SA PER + L T
Sbjct  61    RSFLPYSLESSDV-QQRPFYSYKNVISGFAAKLTEEEVQDMKKKNGFVSARPERKVRLQT  119

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             THSP FLGL Q MG W++S++GKGVIIG+LD GI  DHPSFSDEGMPPPPA+WKG C+  
Sbjct  120   THSPSFLGLHQGMGVWKESNFGKGVIIGILDGGINPDHPSFSDEGMPPPPAKWKGRCD--  177

Query  1867  FTACNNKVIGARSFS-----ERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAG  1703
             F+ CNNK+IGAR+F+     +      D DGHGTH AGTAAG FV+ A   G+A GTA G
Sbjct  178   FSTCNNKLIGARTFNIEGNVKGTEPPIDVDGHGTHVAGTAAGAFVKNAESLGNAKGTAVG  237

Query  1702  VAPLAHLAIYKVC--NEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGA  1529
             +AP AHLAIYKVC   ++ C++S++LA +D AIEDGVD+LS+S+GG S  F  DSIA+G+
Sbjct  238   MAPYAHLAIYKVCFGGDVDCTESDLLAGLDAAIEDGVDVLSISIGGGSVPFFNDSIAVGS  297

Query  1528  YSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETA  1349
             ++A++KGIFVS +AGN GPFN ++SNEAPW+LTVGAST+DR + AT  LGNR++F GE+ 
Sbjct  298   FAAIQKGIFVSCAAGNSGPFNSTISNEAPWILTVGASTLDRSIVATAKLGNREEFDGESV  357

Query  1348  FQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEA  1169
             FQPKDF  + L LV+ G N   ES+  +C + SL   DV+GK+V+C  GG + R  KGE 
Sbjct  358   FQPKDFPQTPLPLVYAGMNGKPESA--FCGNGSLSGIDVKGKVVLCERGGGIARIFKGEQ  415

Query  1168  VKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGT  989
             VKNA G  MIL+  E    +  A  HVLPA  ++   G KI +YIN+T+ PMAT  FKGT
Sbjct  416   VKNAGGAAMILMNDEPNAFSVIADPHVLPATHVSNDAGLKIKSYINSTATPMATIIFKGT  475

Query  988   ITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISG  809
             + G+  APTV +FSSRGPN  SPGILKPDIIGPG++ILA W   +D   N KS FNI+SG
Sbjct  476   VIGNSLAPTVVSFSSRGPNLASPGILKPDIIGPGLSILAAWFEPLDFNTNPKSIFNIMSG  535

Query  808   TSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGA  629
             TSM+CPHLSG+AALLKSSHP WSPA IKSA+MTTAD+LN     I ++ L  A +F+IGA
Sbjct  536   TSMACPHLSGIAALLKSSHPYWSPAAIKSALMTTADLLNMNGERIVDETLRPADIFAIGA  595

Query  628   GHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYP  449
             GHVNPS+ANDPGLVYD +P+DY+PYLCGL Y+++EVG+++   V CS +  IPEAQLNYP
Sbjct  596   GHVNPSRANDPGLVYDIQPDDYIPYLCGLGYSDKEVGILVHRPVVCSGIGKIPEAQLNYP  655

Query  448   SFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVT  269
             SFS+ L   AQT+TRTVTNVG+  S Y V +  P GV V+V+P +L FSKVNQK TY+VT
Sbjct  656   SFSVTL-GPAQTFTRTVTNVGQVYSSYAVNVVAPQGVVVSVKPSKLYFSKVNQKATYSVT  714

Query  268   FSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
             F+ S     S      QG + W S K+ VRSPI+ +L
Sbjct  715   FTRSGSGYTSGQ--FAQGYITWVSAKYSVRSPISVRL  749



>ref|XP_011081245.1| PREDICTED: subtilisin-like protease SDD1 [Sesamum indicum]
Length=668

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/675 (59%), Positives = 493/675 (73%), Gaps = 10/675 (1%)
 Frame = -1

Query  2176  MVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWR  1997
             M+F YR V  GFAA+LS +EVK+M  K+GF+ A P+ +L LHTTHSP FLGL QN GFW+
Sbjct  1     MIFSYREVFIGFAARLSPDEVKDMEKKEGFVYARPDEMLSLHTTHSPSFLGLNQNTGFWK  60

Query  1996  DSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSER  1817
             +S+YG+GVIIGVLD+GI   HPSFSD GMP PPA+WKG CE N   CNNK+IGAR F + 
Sbjct  61    ESNYGRGVIIGVLDTGIFPQHPSFSDVGMPRPPAKWKGRCERNTITCNNKIIGARYFVQS  120

Query  1816  ERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSE  1637
             +     + GHGTH AGTAAGNFVRGAN++G ANGTAAG+AP AHLAIYKVC ++ C  S 
Sbjct  121   DDQ---NAGHGTHCAGTAAGNFVRGANIFGLANGTAAGIAPYAHLAIYKVC-DVTCPTSS  176

Query  1636  ILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSL  1457
             ILA +D A+ DGVD+LS+SL    ++F +D  A+GA+ AMEKG+FVS SAGN GPF+ +L
Sbjct  177   ILAGIDAAVADGVDVLSISLSSAGNNFAQDLTAVGAFGAMEKGVFVSCSAGNRGPFSYTL  236

Query  1456  SNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDES  1277
             SN APW+LTVGAST DRK  AT VLG+ Q FHG +AFQP +F +++L L++ G     + 
Sbjct  237   SNPAPWVLTVGASTTDRKTRATAVLGDSQLFHGVSAFQPNNFPTTMLPLLYAGTLNPSDP  296

Query  1276  SSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSAT  1097
              + +C   SL + D+RGKIV+C  GG      KG+A+++A G  MIL+  E Y  T  A 
Sbjct  297   MARFCSRSSLNSMDLRGKIVLCDIGGVTAVE-KGQAIRSAGGAAMILVNDESYANTILAD  355

Query  1096  AHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPG  917
              HVLPA  +++ADG +I AYIN+   P+AT  F GT+ GD  AP VAAFSSRGPN  SPG
Sbjct  356   PHVLPATHVSHADGLRIKAYINSARAPVATIRFSGTLLGDNRAPVVAAFSSRGPNSLSPG  415

Query  916   ILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSP  737
             ILKPDI+GPGV+IL PW  +++N PN+   FN++SGTSM+CPHLSGVAALLKS+HP+WSP
Sbjct  416   ILKPDILGPGVDILGPWNIALENNPNTNFRFNMVSGTSMACPHLSGVAALLKSAHPNWSP  475

Query  736   AMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLP  557
             A IKSA+MTTAD++NH    IQ++  + A +F+ G+GHVNPS+ANDPGLVYD +P+DY+P
Sbjct  476   AAIKSAIMTTADVVNHAGGAIQDERFLPAGIFATGSGHVNPSRANDPGLVYDIQPQDYIP  535

Query  556   YLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL--ESTAQTYTRTVTNVGE  383
             YLCGLNYTN +V  I+  RVNC     IPEAQLNYPSF++     ST Q YTRTVTNVG+
Sbjct  536   YLCGLNYTNSQVSSIVGRRVNCLEESHIPEAQLNYPSFALTFAPSSTTQVYTRTVTNVGD  595

Query  382   ASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRW  203
               S Y VEIF P G+ V V P  L F++VNQ++ Y VTFS  +         VV+G LRW
Sbjct  596   PISSYNVEIFPPSGIDVRVFPTTLNFTRVNQQMHYLVTFSRLTSTLNG---VVVRGFLRW  652

Query  202   KSVKHHVRSPIAAKL  158
              S KH VRSPIA  L
Sbjct  653   TSSKHSVRSPIAVIL  667



>dbj|BAF95754.1| subtilase [Lotus japonicus]
Length=750

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/725 (59%), Positives = 520/725 (72%), Gaps = 23/725 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S L TYIV V  P    S         DL  +Y S LP +         R+VF YRNV+ 
Sbjct  40    SNLSTYIVHVRKPQVIQSD--------DLHTFYYSLLPESTK---TTNQRIVFTYRNVVN  88

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFA KL+ EE K +   +  +SA PE+IL LHTTH+P FLGLQQ +G W+ S+ GKGVII
Sbjct  89    GFAVKLTPEEAKALQQNEEVVSARPEKILSLHTTHTPSFLGLQQGLGLWKGSNSGKGVII  148

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA---CNNKVIGARSFSERERSV--F  1802
             G+LD+GI+  HPSFSDEGMP PPA+W G+CE  FT    CNNK+IGAR+F + +     F
Sbjct  149   GILDTGISPFHPSFSDEGMPSPPAKWNGICE--FTGKRTCNNKIIGARNFVKTKNLTLPF  206

Query  1801  dddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAM  1622
             DD GHGTHTA TAAG  V+GANVYG+ANGTA G+AP AH+A+YKVC  +GCS+S ILA M
Sbjct  207   DDVGHGTHTASTAAGRPVQGANVYGNANGTAVGMAPDAHIAMYKVCGLVGCSESAILAGM  266

Query  1621  DTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAP  1442
             DTA++DGVD+LSLSLGG S  F ED IALGA+ A++KGIFVS SA N GP   SLSNEAP
Sbjct  267   DTAVDDGVDVLSLSLGGPSGPFFEDPIALGAFGAIQKGIFVSCSAANSGPAYSSLSNEAP  326

Query  1441  WMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYC  1262
             W+LTVGAS++DR + AT  LGN +++ G++ FQPKDF  SLL LV+ G N  + + S +C
Sbjct  327   WILTVGASSIDRTIMATAKLGNGKEYVGQSVFQPKDFAPSLLPLVYAGAN-GNNNFSVFC  385

Query  1261  DSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLP  1082
               ESL  +DV GK+V+C  GGF+ R  KG+AVK+A G  MIL+          A  HVLP
Sbjct  386   APESLNRSDVEGKVVLCEDGGFVPRVFKGKAVKDAGGAAMILMNSVLEDFNPIADVHVLP  445

Query  1081  AIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPD  902
             A+ I+Y  G  +  YIN+TS P AT  F+GT+ G+  AP V +FSSRGP++ SPGILKPD
Sbjct  446   AVHISYEAGLALKEYINSTSTPTATILFEGTVIGNLLAPQVTSFSSRGPSKASPGILKPD  505

Query  901   IIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKS  722
             IIGPG+NILA WP S+DN  ++   FNIISGTSMSCPHLSG+AALLK+SHPDWSPA IKS
Sbjct  506   IIGPGLNILAAWPVSLDN--STTPPFNIISGTSMSCPHLSGIAALLKNSHPDWSPAAIKS  563

Query  721   AMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGL  542
             A+MTTA  +N G  PI +Q LV A VF+ GAGHVNP KANDPGLVYD +P DY+PYLCGL
Sbjct  564   AIMTTASQVNLGGTPILDQRLVPADVFATGAGHVNPVKANDPGLVYDIEPNDYIPYLCGL  623

Query  541   NYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTV  362
             NYT+REVGVILQ RV CS V  I EA+LNYPSFSI+L +T Q YTRTV NVG A+S YT 
Sbjct  624   NYTDREVGVILQQRVRCSEVNHIAEAELNYPSFSILLGNTTQLYTRTVANVGPANSTYTA  683

Query  361   EIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHV  182
             EI  P GV +++ P +L F++V QKLTY+V+F +     R N     QG+L+W S K+ V
Sbjct  684   EIGVPVGVGMSLSPAQLTFTEVGQKLTYSVSF-IPFSEDRDNH-TFAQGSLKWVSGKYSV  741

Query  181   RSPIA  167
             RSPI+
Sbjct  742   RSPIS  746



>ref|XP_010108071.1| Subtilisin-like protease SDD1 [Morus notabilis]
 gb|EXC17803.1| Subtilisin-like protease SDD1 [Morus notabilis]
Length=839

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/754 (57%), Positives = 535/754 (71%), Gaps = 20/754 (3%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             + F  +  + S +I    T T +S L+ YI+ V+ P  R+ +QS      DLE WY+SFL
Sbjct  97    LNFFHVIALQSEVISVSQT-TESSSLQNYIIHVKPPKGRVLSQSE-----DLESWYRSFL  150

Query  2215  PTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSP  2036
             P T A     + RM++ YRNV++GFAA+L+ ++V+ M  KDGFISA PERIL   TTH+P
Sbjct  151   PATTAASSDNQPRMLYAYRNVLRGFAARLTQDQVRAMEGKDGFISARPERILKKLTTHTP  210

Query  2035  GFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTAC  1856
              FLGL Q  GFWRDS++GKGVIIGVLD GI   HPSFSDEGMPPPPA+WKG C+ N + C
Sbjct  211   NFLGLHQQKGFWRDSNFGKGVIIGVLDGGIFPSHPSFSDEGMPPPPAKWKGRCDFNVSDC  270

Query  1855  NNKVIGARSFS--------ERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGV  1700
             NNK+IGARSF+        ++     D+DGHGTHTA TAAG FV  A+V G+A GTA G+
Sbjct  271   NNKLIGARSFNLAAKATKGDKAEPPIDEDGHGTHTASTAAGGFVNYADVLGNAKGTAVGM  330

Query  1699  APLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSA  1520
             AP AHLAIYKVC    C D++ILAA+D A+EDGVD+LSLSLG +S  F  DS+A+GA++A
Sbjct  331   APYAHLAIYKVCFGEDCPDADILAALDAAVEDGVDVLSLSLGDVSRPFFNDSLAIGAFAA  390

Query  1519  MEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQP  1340
              EKGI VS SAGN GP N +LSNEAPW+LTVGAST+DRK+ AT  LGN ++F GE+  + 
Sbjct  391   TEKGILVSCSAGNSGPVNSTLSNEAPWILTVGASTIDRKIIATAKLGNDEEFDGESIHR-  449

Query  1339  KDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKN  1160
              DF  +   LV+ G N   ++ S +C   SL++ DV+ K+V+C  GG + R  KGE VKN
Sbjct  450   GDFPQTSWPLVYAGIN--GKADSAFCAEGSLKDIDVKNKVVLCERGGGVGRIAKGEEVKN  507

Query  1159  ASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITG  980
             A G  MIL+  E  G +T A  H LPA  +++ADG KI AYIN+T+ P AT  FKGT+ G
Sbjct  508   AGGAAMILVNQESDGFSTEADPHALPAAHVSFADGLKIKAYINSTATPTATLFFKGTVIG  567

Query  979   DKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSM  800
             D  AP +A+FSSRGPN  SPGILKPDIIGPGV+ILA WP  +DN  N KS FNI+SGTSM
Sbjct  568   DSLAPFIASFSSRGPNLASPGILKPDIIGPGVSILAAWPFPLDNNTNPKSPFNIMSGTSM  627

Query  799   SCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHV  620
             SCPHLSG+A LLKSSHP WSPA IKSA+MTTADI+N     I +Q L  A VF+ GAGHV
Sbjct  628   SCPHLSGIAVLLKSSHPYWSPAAIKSAIMTTADIVNLEGKAILDQALTPADVFATGAGHV  687

Query  619   NPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFS  440
             NP KANDPGL+YD +P+DY+PYLCGL Y ++EVG++ +  + CS   SIPE +LNYPSFS
Sbjct  688   NPIKANDPGLIYDLQPDDYIPYLCGLGYNDKEVGIVARRPIKCSEKPSIPEGELNYPSFS  747

Query  439   IILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSL  260
             + L   +QT+TRTVTNVGEA S YT  I  P GV V+V+P +L FSKVNQK TY+V FS 
Sbjct  748   VTL-GPSQTFTRTVTNVGEAYSTYTANIMAPDGVYVSVKPSKLYFSKVNQKATYSVNFSR  806

Query  259   SSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
              + +  +   P  QG L W S +H VRSPI+ K 
Sbjct  807   ITSSGETG--PYGQGFLTWVSARHCVRSPISVKF  838



>ref|XP_002509665.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF51052.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=743

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/719 (58%), Positives = 517/719 (72%), Gaps = 18/719 (3%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGF  2141
             L+TYIV +E P     T+S      DL+ WY+SFLP         + R++  YR+V+ GF
Sbjct  38    LQTYIVLLEKPEGNQFTESK-----DLDSWYQSFLPDNSFSSN--QPRLLHSYRHVVTGF  90

Query  2140  AAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGV  1961
             AAKL+A+EV+ M  K GF+SA P R++PLHTTH+P FLGLQQN+GFW  S+YGKGV+IG+
Sbjct  91    AAKLTADEVQAMNKKKGFVSARPRRMVPLHTTHTPSFLGLQQNLGFWNYSNYGKGVVIGL  150

Query  1960  LDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVFdddghgt  1781
             +DSGI  DHPSFS EG+PPPPA+WKG C+ N T CNNK+IG R+F+    +  D+  HGT
Sbjct  151   IDSGITADHPSFSGEGLPPPPAKWKGKCD-NGTLCNNKLIGVRNFATDSNNTLDEYMHGT  209

Query  1780  htagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIG-CSDSEILAAMDTAIED  1604
             HTA TAAG+ V+ AN +G ANGTA G+APLAHLA+YKV    G   DSEILAAMD AIED
Sbjct  210   HTASTAAGSPVQNANYFGQANGTAIGMAPLAHLAMYKVSGRFGKAGDSEILAAMDAAIED  269

Query  1603  GVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVG  1424
             GVD+LSLSLG  S  F++D IALGAY+A++KGIFVS SAGN GP + SLSNEAPW+LTVG
Sbjct  270   GVDVLSLSLGIGSHPFYDDVIALGAYAAIQKGIFVSCSAGNSGPDSSSLSNEAPWILTVG  329

Query  1423  ASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLR  1244
             AS+VDR + ATV+LGN  + +GE+ FQP D  S+LL LV+ G   S   SS YC+  SL 
Sbjct  330   ASSVDRAIRATVLLGNNTELNGESLFQPNDSPSTLLPLVYAG--ASGTGSSAYCEPGSLS  387

Query  1243  NADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITY  1064
             N DV+GKIV+C  GG  +   KG+ VK+  G  MI++  E  G  T A  HVLPA  ++Y
Sbjct  388   NFDVKGKIVLCERGGSYETVLKGQEVKDNGGFAMIVMNDEFDGFVTEAEFHVLPASHVSY  447

Query  1063  ADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGV  884
               G  I  YIN+TS P AT  FKGT+ G   AP VA FSSRGP+  SPGILKPDIIGPGV
Sbjct  448   MAGLAIKTYINSTSTPKATIVFKGTVLGLPEAPQVADFSSRGPSVASPGILKPDIIGPGV  507

Query  883   NILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTA  704
              ILA WP SVDN  N    F++ISGTSMSCPHLSG+ ALL+S+HPDWSPA IKSA+MTTA
Sbjct  508   RILAAWPVSVDNTTNR---FDMISGTSMSCPHLSGIGALLRSAHPDWSPAAIKSAIMTTA  564

Query  703   DILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNRE  524
             +++N G   I +Q  V ++VF IGAGHVN S ANDPGL+YD +P+DY+PYLCGL Y++++
Sbjct  565   NMVNLGGKLISDQEFVLSTVFDIGAGHVNASGANDPGLIYDIQPDDYIPYLCGLGYSDKQ  624

Query  523   VGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPP  344
             VG+I+Q  V CS   SIPEAQLNYPSFSI L  T QTYTRTVTNVG+  S Y +E   P 
Sbjct  625   VGLIVQRAVKCSNDSSIPEAQLNYPSFSINLGPTPQTYTRTVTNVGKPDSTYFIEYSAPL  684

Query  343   GVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             GV + V P EL FS+VNQK TY+VTFS +  A  +     V G L+W +  ++VRS IA
Sbjct  685   GVDIEVTPAELIFSRVNQKATYSVTFSKNGNAGGT----FVDGYLKWVANGYNVRSVIA  739



>ref|XP_004147596.1| PREDICTED: subtilisin-like protease SDD1-like [Cucumis sativus]
 ref|XP_004164315.1| PREDICTED: subtilisin-like protease SDD1-like [Cucumis sativus]
 gb|KGN50165.1| hypothetical protein Csa_5G157240 [Cucumis sativus]
Length=745

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/735 (56%), Positives = 508/735 (69%), Gaps = 28/735 (4%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S L TYIV V+ P              DLE W++SFLPT++      +  +++ YRNVM 
Sbjct  28    SNLHTYIVHVKKPEVVD----------DLESWHRSFLPTSLENSEE-QPTLLYSYRNVMS  76

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GF+A+L+ E VK M  KDGF+SA  E I+ LHTTHSP FLGL +  GFW+DS++GKGVII
Sbjct  77    GFSARLTEEHVKAMEEKDGFVSARRETIVHLHTTHSPNFLGLNRQFGFWKDSNFGKGVII  136

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-----------SE  1820
             GVLD GI   HPSF D GMP PPA+WKG CE NF+ACNNK+IGARS            + 
Sbjct  137   GVLDGGITPSHPSFVDAGMPQPPAKWKGRCEFNFSACNNKLIGARSLNLASQALKGKITT  196

Query  1819  RERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDS  1640
              + S  D+DGHGTHTA TAAG FV GA   G+A GTA G+APLAHLAIYKVC    CS+ 
Sbjct  197   LDDSPIDEDGHGTHTASTAAGTFVDGAEALGNAFGTAVGMAPLAHLAIYKVCFGESCSNV  256

Query  1639  EILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGS  1460
             +ILA +D A+EDGVD+LS+SLGG    F  D  A+GA++A++KGIFVS SA N GPFN +
Sbjct  257   DILAGLDAAVEDGVDVLSISLGGPPVPFFADITAIGAFAAIQKGIFVSCSAANSGPFNAT  316

Query  1459  LSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDE  1280
             LSNEAPW+LTV AST+DRK++AT  LGN ++F GE+ FQP DF  + L LVFPG+     
Sbjct  317   LSNEAPWILTVAASTIDRKITATAKLGNGEEFDGESLFQPNDFPQTFLPLVFPGEK---N  373

Query  1279  SSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSA  1100
              +   C   SL+N DV+GK+VVC  GG + R  KG  VKNA G  MIL+  E  G TT A
Sbjct  374   ETVALCAEGSLKNIDVKGKVVVCDRGGGIARIAKGVEVKNAGGAAMILLNAESDGFTTEA  433

Query  1099  TAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESP  920
              AHVLPA  +++    KI AYIN+T+ P AT  FKGT  GD  +P +AAFSSRGP+  SP
Sbjct  434   DAHVLPASHVSHTAALKIKAYINSTTYPTATIVFKGTTIGDDFSPAIAAFSSRGPSLASP  493

Query  919   GILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWS  740
             GILKPDI GPGV+ILA WP  +DN  N+KSTFNI+SGTSMSCPHLSG+AAL+KS+HPDWS
Sbjct  494   GILKPDITGPGVSILAAWPFPLDNNTNTKSTFNIVSGTSMSCPHLSGIAALIKSAHPDWS  553

Query  739   PAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYL  560
             PA IKS++MTTA+I N   NPI +Q L  A +F+IGAGHVNPSKA DPGLVYD +P+DY+
Sbjct  554   PAAIKSSIMTTANITNLEGNPIVDQTLQPADLFAIGAGHVNPSKAVDPGLVYDIQPDDYI  613

Query  559   PYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEA  380
             PYLCGL YTN +V +I    ++C    SIPE +LNYPSF + L    QT++RTVT VG  
Sbjct  614   PYLCGLGYTNNQVSLIAHKPIDCLTTTSIPEGELNYPSFMVKL-GQVQTFSRTVTYVGSG  672

Query  379   SSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWK  200
                Y V I  P GV V V PR++ FS +NQK TY+VTF      + S      +G L+W 
Sbjct  673   REVYNVVIEAPEGVSVTVRPRKVIFSALNQKATYSVTFKRIGSISPST--EFAEGYLKWV  730

Query  199   SVKHHVRSPIAAKLV  155
             S KH VRSPI+ K V
Sbjct  731   SAKHLVRSPISVKFV  745



>gb|KDP25558.1| hypothetical protein JCGZ_20714 [Jatropha curcas]
Length=733

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/747 (59%), Positives = 543/747 (73%), Gaps = 25/747 (3%)
 Frame = -1

Query  2389  FLRMFLILSVLIGFC----STATIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
              L  F+IL+ L   C     T    + LETYIV ++ P   + TQS      DL+ WY+S
Sbjct  2     LLVFFIILNSLFSSCRASIETVKKENNLETYIVLLKKPEGAVFTQSK-----DLDSWYQS  56

Query  2221  FLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTH  2042
             FLP  V      + R+V  YR V+ GFAAKL+A+EVKEM  KDGF+SA P R++PLHTTH
Sbjct  57    FLP--VNSFSSDQPRLVHSYRQVVTGFAAKLTADEVKEMEKKDGFVSARPRRMVPLHTTH  114

Query  2041  SPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT  1862
             +P FLGLQQN GFW  SSYGKGVIIG++DSGI  DHPSFS EGMPPPP +WKG CELN T
Sbjct  115   TPSFLGLQQNSGFWNYSSYGKGVIIGLIDSGITPDHPSFSGEGMPPPPKKWKGKCELNGT  174

Query  1861  -ACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAH  1685
              +CNNK+IGAR+F+    +  D+  HGTHTA TAAG+ V+GAN +G  NGTA+G+APLAH
Sbjct  175   YSCNNKLIGARNFATDSNNTDDEYHHGTHTASTAAGSPVQGANFFGQVNGTASGMAPLAH  234

Query  1684  LAIYKVCNEIG-CSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKG  1508
             LA+YKV   IG   DSEILAAMD AIEDGVD+LSLSLG  S  F++D IALG Y+A++KG
Sbjct  235   LAMYKVSGRIGKGGDSEILAAMDAAIEDGVDVLSLSLGIGSHPFYDDVIALGTYAAIQKG  294

Query  1507  IFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFN  1328
             IFVS SAGN GP N SLSNEAPW+LTVGASTVDR++ ATV+LGN+ + +G++ +QP +F 
Sbjct  295   IFVSCSAGNSGPENTSLSNEAPWILTVGASTVDREIRATVLLGNKAELNGQSLYQP-NFP  353

Query  1327  SSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGR  1148
             S++L LV+ G N ++  SS YC+  SL N DV+GKIV+C  GGF     KG+ VKN  G 
Sbjct  354   STMLPLVYAGANGNE--SSAYCEPGSLANIDVKGKIVLC-EGGF-GTISKGQEVKNNGGA  409

Query  1147  GMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNA  968
              MI++  +  G  T+A+ HVLPA  ++Y  G +I AYIN+TS+P AT  FKGT+TG K+A
Sbjct  410   AMIVMNDKSDGFVTTASLHVLPASHVSYNAGSEIKAYINSTSSPTATILFKGTVTGLKDA  469

Query  967   PTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPH  788
             P VA FSSRGP+  SPGILKPDIIGPGV ILA WP SVDN   S   F +ISGTSMSCPH
Sbjct  470   PQVADFSSRGPSMASPGILKPDIIGPGVKILAAWPVSVDN---STHRFAMISGTSMSCPH  526

Query  787   LSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSK  608
             LSG+AALLKS+HPDWSPA IKSA++T+A++ N G   I ++  V A++F IGAGHVNP  
Sbjct  527   LSGIAALLKSAHPDWSPAAIKSAIITSANLNNLGGKAISDEQFVPATIFDIGAGHVNPPG  586

Query  607   ANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILE  428
             ANDPGL+YD +P+DY+PYLCGL Y++ +VG+I+Q  V CS   SIPEAQLNYPSFSI L 
Sbjct  587   ANDPGLIYDIQPDDYIPYLCGLGYSDTQVGLIVQQTVKCSNDSSIPEAQLNYPSFSIKLG  646

Query  427   STAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKA  248
             S+ +TYTRTVTNVG+ +S Y +EI  P GV V V P ++ FS  NQK TY+VTFS +  A
Sbjct  647   SSPKTYTRTVTNVGQPNSAYALEISAPKGVDVKVTPDKISFSGANQKATYSVTFSKNKNA  706

Query  247   ARSNMPPVVQGALRWKSVKHHVRSPIA  167
               S      QG ++W +    VR+PIA
Sbjct  707   TES----FAQGYIKWVADGKSVRTPIA  729



>ref|XP_003549875.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=749

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/755 (55%), Positives = 528/755 (70%), Gaps = 21/755 (3%)
 Frame = -1

Query  2389  FLRMFLILSVLIGFC---STATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSF  2219
             F+ +  +LS  I F       + AS  +TYI+ VE P  +   QS      DLE WY SF
Sbjct  6     FIALHFVLSFHIHFAHGNELPSAASSSKTYIIHVEGPQGKNLAQSE-----DLESWYHSF  60

Query  2218  LPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHS  2039
             +P T+      + RM++ YRNVM GFAA+L+ EE++ +  K+GFI A PERIL   TTH+
Sbjct  61    MPPTIMSSEE-QPRMIYSYRNVMSGFAARLTEEELRAVQKKNGFIYAQPERILHRQTTHT  119

Query  2038  PGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA  1859
             P FLGLQQ+MGFW++S++GKGVI+GV+DSGI   HPSFSD GMPPPP +WKG CELN TA
Sbjct  120   PQFLGLQQDMGFWKESNFGKGVIVGVVDSGITPGHPSFSDAGMPPPPPKWKGKCELNATA  179

Query  1858  CNNKVIGARSFS------ERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVA  1697
             CNNK+IGARSF+      +   S  D+DGHGTHTA TAAG FV  A + G+A GTAAG+A
Sbjct  180   CNNKLIGARSFNLAATAMKGADSPIDEDGHGTHTASTAAGAFVDHAELLGNAKGTAAGIA  239

Query  1696  PLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVD-IlslslggmssSFHEDSIALGAYSA  1520
             P AHLA+Y+VC    C +S+ILAA+D A+EDGVD I           F  DS A+GA++A
Sbjct  240   PHAHLAMYRVCFGEDCPESDILAALDAAVEDGVDVISISLGLSEPPPFFHDSTAIGAFAA  299

Query  1519  MEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQP  1340
             M+KGIFVS +AGN GPF+GSL N APW+LTVGAS +DR ++AT  LGN Q+F GE+ FQP
Sbjct  300   MQKGIFVSCAAGNSGPFHGSLINGAPWVLTVGASNIDRSIAATAKLGNGQEFDGESVFQP  359

Query  1339  KDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKN  1160
              DF+ +LL L + G+N   E++  +C + SL ++D RGK+V+C  GG + R  KGE VK 
Sbjct  360   SDFSPTLLPLAYAGKNGKQEAA--FCANGSLNDSDFRGKVVLCERGGGIGRIPKGEEVKR  417

Query  1159  ASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITG  980
               G  MIL   E  G + SA  HVLPA  ++Y  G KI AYIN+T+ P+AT  FKGTI G
Sbjct  418   VGGAAMILANDESNGFSLSADVHVLPATHVSYDAGLKIKAYINSTAIPIATILFKGTIIG  477

Query  979   DKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSM  800
             +  AP V +FSSRGPN  SPGILKPDIIGPGVNILA WP  ++N  +SKSTFN +SGTSM
Sbjct  478   NSLAPAVTSFSSRGPNLPSPGILKPDIIGPGVNILAAWPFPLNNDTDSKSTFNFMSGTSM  537

Query  799   SCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHV  620
             SCPHLSG+AALLKSSHP WSPA IKSA+MT+ADI+N  +  I ++ L  A VF+ G+GHV
Sbjct  538   SCPHLSGIAALLKSSHPHWSPAAIKSAIMTSADIINFERKLIVDETLHPADVFATGSGHV  597

Query  619   NPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFS  440
             NPS+ANDPGLVYD +P+DY+PYLCGL Y++ +VG+I    + CS   SIPE +LNYPSFS
Sbjct  598   NPSRANDPGLVYDIQPDDYIPYLCGLGYSDTQVGIIAHKTIKCSETSSIPEGELNYPSFS  657

Query  439   IILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSL  260
             ++L S  QT+TRTVTNVGEA+S Y V +  P GV+V ++P +L FS  NQK  Y+V+FS 
Sbjct  658   VVLGS-PQTFTRTVTNVGEANSSYVVMVMAPEGVEVRIQPNKLTFSGENQKEIYSVSFSR  716

Query  259   SSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
                   +      QG L+W S KH VRSPI    V
Sbjct  717   IESGNET--AEYAQGFLQWVSAKHSVRSPILVNFV  749



>ref|XP_002509660.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF51047.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=751

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/718 (58%), Positives = 520/718 (72%), Gaps = 21/718 (3%)
 Frame = -1

Query  2317  ETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFA  2138
             ETYIV ++ P   + T+S      DL+ WY SFLP  V      + R++  YR+V  GFA
Sbjct  50    ETYIVLLKKPEGSVFTESK-----DLDSWYHSFLP--VNAFSSEQPRLLHSYRHVATGFA  102

Query  2137  AKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVL  1958
             A+L AE+VK M NKDGF+SA P R++PLHTTH+P FLGL+ N+G W  S+ GKGVIIG++
Sbjct  103   ARLKAEDVKAMENKDGFVSARPRRMVPLHTTHTPSFLGLEHNLGLWNYSNDGKGVIIGLI  162

Query  1957  DSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVFdddghgth  1778
             DSGI  DHPSFSD+GMPPPPA+WKG C+ N T CNNK+IG R+F+    +  D+  HGTH
Sbjct  163   DSGITPDHPSFSDQGMPPPPAKWKGKCD-NETLCNNKLIGVRNFATDSNNTSDEYMHGTH  221

Query  1777  tagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIG-CSDSEILAAMDTAIEDG  1601
             TA TAAG+ V+ AN +G ANGTA G+APLAHLA+YKV        DSEILAAMD A+EDG
Sbjct  222   TASTAAGSPVQNANFFGQANGTAIGMAPLAHLAMYKVSGSASEAGDSEILAAMDAAVEDG  281

Query  1600  VDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGA  1421
             VD+LSLSLG  S  F++D IALGAY+A+ KGIFVS SAGN GP N SLSNEAPW+LTVGA
Sbjct  282   VDVLSLSLGIGSHPFYDDVIALGAYAAIRKGIFVSCSAGNSGPDNSSLSNEAPWILTVGA  341

Query  1420  STVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRN  1241
             STVDR + ATV+LGN  + +GE+ FQPKDF S+LL LV+ G N    +SS +C+  SL+N
Sbjct  342   STVDRAIRATVLLGNNAELNGESLFQPKDFPSTLLPLVYAGAN--GNASSGFCEPGSLKN  399

Query  1240  ADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYA  1061
              D++GK+V+C  G       KG+ VK+  G  MI+I  E  G  T+   HVLPA ++ Y 
Sbjct  400   VDIKGKVVLC-EGADFGTISKGQEVKDNGGAAMIVINDE--GFITTPRLHVLPASNVNYI  456

Query  1060  DGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVN  881
              G  I AYIN++S+PMAT  FKGT+ G  +AP VA FSSRGP+  SPGILKPDIIGPGV 
Sbjct  457   TGSAIKAYINSSSSPMATILFKGTVVGVPDAPQVADFSSRGPSIASPGILKPDIIGPGVR  516

Query  880   ILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTAD  701
             ILA WP SVDN  N    F++ISGTSMSCPHLSG+AALLK +HPDWSPA IKSA+MTTA+
Sbjct  517   ILAAWPVSVDNTTNR---FDMISGTSMSCPHLSGIAALLKHAHPDWSPAAIKSAIMTTAN  573

Query  700   ILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREV  521
             + N G  PI +Q  V A+VF +GAGHVNPS+ANDPGL+YD +PE+Y+PYLCGL Y++ +V
Sbjct  574   LNNLGGKPISDQEFVLATVFDMGAGHVNPSRANDPGLIYDIQPEEYIPYLCGLGYSDNQV  633

Query  520   GVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPG  341
             G+I+Q  V C+   SIPE+QLNYPSFSI L S+ +TYTRTVTNVG+ +S YT +I+ P G
Sbjct  634   GLIVQGSVKCTNDSSIPESQLNYPSFSIKLGSSPKTYTRTVTNVGKPTSAYTPKIYGPQG  693

Query  340   VKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             V V V P  + FS+VN+K TY VTFS + KA      P  QG L W    + V SPIA
Sbjct  694   VDVKVTPDIIHFSEVNEKATYTVTFSQNGKAGG----PFSQGYLTWVGEGYSVASPIA  747



>gb|KDP25553.1| hypothetical protein JCGZ_20709 [Jatropha curcas]
Length=743

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/722 (59%), Positives = 525/722 (73%), Gaps = 21/722 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S+LETYIV +E P   + T S      DL+ WY+SFLP         + R+V  Y  V+ 
Sbjct  37    SELETYIVFLEKPEGMMFTDSK-----DLDSWYQSFLPDDTLSSN--KPRLVHSYHQVVT  89

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAAKL+AEEVKE+  K+GF+SA P R++P HTTH+P FLGLQQN GFW  S+YGKGVI+
Sbjct  90    GFAAKLTAEEVKEIEKKEGFVSARPRRMVPFHTTHTPSFLGLQQNTGFWNYSNYGKGVIV  149

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT-ACNNKVIGARSFSERERSVFdddg  1790
             G++DSGI  DHPSFS EGMPPPPA+WKG CELN T +CNNK+IG R+F+    +  D+  
Sbjct  150   GLIDSGITPDHPSFSGEGMPPPPAKWKGKCELNGTYSCNNKLIGVRNFATDSNNTDDEYQ  209

Query  1789  hgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCS-DSEILAAMDTA  1613
             HGTHTA TAAG+ V+GAN +G ANGTA G+APLAHLA+YKV      + DSEILAAMD A
Sbjct  210   HGTHTASTAAGSPVQGANYFGQANGTAIGMAPLAHLAMYKVSGRASAAGDSEILAAMDAA  269

Query  1612  IEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWML  1433
             +ED VD+LSLSLG  S  F++D IALGAY+A++KGIF+S SAGN GP N SLSNEAPW+L
Sbjct  270   VEDNVDVLSLSLGIGSHPFYDDVIALGAYAAIQKGIFISCSAGNSGPENSSLSNEAPWIL  329

Query  1432  TVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSE  1253
             TVGASTVDR + ATV LGN  + +GE+ FQP DF S+LL LV+ G N    S+S  C+  
Sbjct  330   TVGASTVDRAIRATVFLGNNAELNGESLFQPADFPSTLLPLVYAGANGMASSAS--CEPG  387

Query  1252  SLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAID  1073
             SL+N DV+GKIV+C  GG+ D   KG+ VK+  G  MI++  E  G  T A  +VLPA  
Sbjct  388   SLKNVDVKGKIVLC-EGGY-DATYKGQEVKDNGGVAMIVMNDEYDGFVTDADLNVLPASR  445

Query  1072  ITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIG  893
             +++ DG  I AYI +TS+P AT  FKGT+TG  NAP +A FSSRGP+  SPGILKPDIIG
Sbjct  446   VSFMDGLAIKAYIYSTSSPNATILFKGTVTGLPNAPQLAEFSSRGPSLASPGILKPDIIG  505

Query  892   PGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMM  713
             PGV ILA WP SVDN  N    F +ISGTSMSCPHLSG+AALLKS+HPDWSPA IKSA+M
Sbjct  506   PGVRILAAWPVSVDNSINR---FAMISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIM  562

Query  712   TTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYT  533
             TT ++++ G  PI ++   T +VF IGAGHVNPS+ANDPGL+YD +P DY+PYLCGL Y+
Sbjct  563   TTDNLVDLGGKPISDEQFGTTTVFDIGAGHVNPSRANDPGLIYDIQPNDYIPYLCGLGYS  622

Query  532   NREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIF  353
              ++VG+I+QH V CS   SI EAQLNYPSFSI L ST QTYTRTVTNVG+ +S YT+EI 
Sbjct  623   AKQVGLIVQHTVTCSNDSSILEAQLNYPSFSIKLGSTPQTYTRTVTNVGQPNSTYTLEIL  682

Query  352   EPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSP  173
              P GV V V P  + FS VNQK TY+VTFS    A+ +      QG L W +  + VRSP
Sbjct  683   APEGVNVKVTPITINFSGVNQKATYSVTFSRDEYASGA-----TQGYLNWVADGYSVRSP  737

Query  172   IA  167
             +A
Sbjct  738   VA  739



>gb|KHN34449.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=689

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/684 (58%), Positives = 495/684 (72%), Gaps = 12/684 (2%)
 Frame = -1

Query  2185  ESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMG  2006
             + RM++ YRNVM GFAA+L+ EE++ +  K+GFISA PER+L   TTH+P FLGLQQ+MG
Sbjct  11    QPRMIYSYRNVMSGFAARLTEEELRSVQKKNGFISAHPERMLHRQTTHTPQFLGLQQDMG  70

Query  2005  FWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF  1826
             FW++S++GKGVI+GV+DSGI  DHPSFSD GMPPPP +WKG CELN T CNNK+IGARSF
Sbjct  71    FWKESNFGKGVIVGVVDSGIEPDHPSFSDAGMPPPPLKWKGRCELNATFCNNKLIGARSF  130

Query  1825  S------ERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVC  1664
             +      +   S  D+DGHGTHT+ TAAG FV  A V G+A GTAAG+AP AHLA+Y+VC
Sbjct  131   NLAATAMKGADSPIDEDGHGTHTSSTAAGAFVDHAEVLGNAKGTAAGIAPYAHLAMYRVC  190

Query  1663  NEIGCSDSEILAAMDTAIEDGVD-IlslslggmssSFHEDSIALGAYSAMEKGIFVSASA  1487
                 C++S+ILAA+D A+EDGVD I           F  DSIA+GA++AM+KGIFVS +A
Sbjct  191   FGEDCAESDILAALDAAVEDGVDVISISLGLSEPPPFFNDSIAIGAFAAMQKGIFVSCAA  250

Query  1486  GNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLV  1307
             GN GPF+GSL N APW+LTVGAS +DR ++AT  LGN Q+F GE+ FQP DF+ +LL L 
Sbjct  251   GNSGPFHGSLVNGAPWVLTVGASNIDRSIAATAKLGNGQEFDGESVFQPSDFSPTLLPLA  310

Query  1306  FPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEP  1127
             + G+N   E++  +C + SL ++D RGK+V+C  GG + R  KGE VK   G  MIL+  
Sbjct  311   YAGKNGKQEAA--FCANGSLNDSDFRGKVVLCERGGGIGRIAKGEEVKRVGGAAMILMND  368

Query  1126  EEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFS  947
             E  G +  A  HVLPA  ++Y  G KI AYIN+T+ P AT  FKGTI G+  AP V +FS
Sbjct  369   ESNGFSVLADVHVLPATHLSYDSGLKIKAYINSTAIPTATILFKGTIIGNSLAPAVTSFS  428

Query  946   SRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAAL  767
             SRGPN  SPGILKPDIIGPGVNILA WP  ++N  +SKSTFN +SGTSMSCPHLSG+AAL
Sbjct  429   SRGPNLPSPGILKPDIIGPGVNILAAWPFPLNNDTDSKSTFNFMSGTSMSCPHLSGIAAL  488

Query  766   LKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLV  587
             LKSSHP WSPA IKSA+MT+ADI+N     I ++ L  A VF+ G+GHVNPS+ANDPGLV
Sbjct  489   LKSSHPHWSPAAIKSAIMTSADIINFEHKLIVDETLYPADVFATGSGHVNPSRANDPGLV  548

Query  586   YDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYT  407
             YD +P+DY+PYLCGL Y + EVG+I    + CS   SIPE +LNYPSFS++L S  QT+T
Sbjct  549   YDIQPDDYIPYLCGLGYGDTEVGIIAHKTITCSETSSIPEGELNYPSFSVVLGS-PQTFT  607

Query  406   RTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPP  227
             RTVTNVGEA+S Y V +  P GV+V V P  L FS+ NQK TY+V+FS       +    
Sbjct  608   RTVTNVGEANSSYVVMVMAPEGVEVKVRPNNLTFSEANQKETYSVSFSRIESGNET--AE  665

Query  226   VVQGALRWKSVKHHVRSPIAAKLV  155
               QG L+W S KH VRSPI    V
Sbjct  666   YAQGFLQWVSAKHTVRSPILVDFV  689



>ref|XP_002303548.2| hypothetical protein POPTR_0003s11840g [Populus trichocarpa]
 gb|EEE78527.2| hypothetical protein POPTR_0003s11840g [Populus trichocarpa]
Length=749

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/721 (58%), Positives = 520/721 (72%), Gaps = 13/721 (2%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             SKLETYIV ++     +S +       DL++WY+SFLP  V      + R++  Y +V+ 
Sbjct  37    SKLETYIVFLKKSEGMVSAKPE-----DLDNWYQSFLPA-VTTSSSNQQRLIHSYHHVVT  90

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAAKL+ +E K M  K+GF+SA P+++L + TTH+P FLGL+QN+GFW  S+YGKGVI+
Sbjct  91    GFAAKLTKQEAKAMETKEGFVSAWPQKVLNVKTTHTPNFLGLEQNLGFWNHSNYGKGVIV  150

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVFdddgh  1787
             GVLD+G+  +HPSFSDEGMPPPP +WKG CE N T CNNK+IGAR+F        D  GH
Sbjct  151   GVLDTGVTPNHPSFSDEGMPPPPPKWKGKCEFNGTLCNNKLIGARNFYSAGTPPIDGHGH  210

Query  1786  gthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIG-CSDSEILAAMDTAI  1610
             GTHTA TAAGN V GA+ +   NGTA G+A  AHLAIY+VC+E G CS+S+ILA MDTA+
Sbjct  211   GTHTASTAAGNPVPGASFFEQYNGTAVGIASSAHLAIYQVCSEFGSCSESDILAGMDTAV  270

Query  1609  EDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLT  1430
             EDGVD+LSLSLGG S  F+EDSIA+GA+ A++KGIFVS +AGN GPFN SLSNEAPW+LT
Sbjct  271   EDGVDVLSLSLGGPSVPFYEDSIAIGAFGAIQKGIFVSCAAGNSGPFNESLSNEAPWILT  330

Query  1429  VGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSES  1250
             VGASTVDR + ATV+L N  Q+ GE+ +QP +F+S LL L + G N ++  S+ +CD  S
Sbjct  331   VGASTVDRSIRATVMLENNAQYDGESFYQPTNFSSFLLPLFYAGSNGNE--SAAFCDPGS  388

Query  1249  LRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDI  1070
             L++ DVRGK+V+C  GG+     KG+ VK+A G  MI++  E YG  T+A+ HVLPA  +
Sbjct  389   LKDVDVRGKVVLCERGGYSGLVYKGQEVKDAGGAAMIVMNDEFYGNVTTASLHVLPASHV  448

Query  1069  TYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGP  890
             TYADG  I AYIN+TS+PMAT  FKGT+ G   AP VA FSSRGP+  SPGILKPDI+GP
Sbjct  449   TYADGLSIKAYINSTSSPMATILFKGTVFGVPYAPQVAIFSSRGPSLASPGILKPDILGP  508

Query  889   GVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMT  710
             GV ILA W   VDN+ N+   FN+ISGTSM+ PHLSG+AALLKSSHPDWSPA IKSA+MT
Sbjct  509   GVRILAAWLHPVDNRLNTTPGFNVISGTSMATPHLSGIAALLKSSHPDWSPAAIKSAIMT  568

Query  709   TADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTN  530
             TA++ N G  PI +Q  V   VF IG+GHVNP+KA+DPGLVYD +P+DY+PYLCGL Y +
Sbjct  569   TANLTNLGGMPITDQFFVPVDVFGIGSGHVNPTKADDPGLVYDIQPDDYIPYLCGLGYND  628

Query  529   REVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFE  350
               +G+ILQ  V CS   SIPEAQLNYPSFSI L S  Q YTRTVTNVG   S Y  EI  
Sbjct  629   TAIGIILQRPVTCSNSSSIPEAQLNYPSFSIKLGSGPQAYTRTVTNVGPLKSSYIAEIIS  688

Query  349   PPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPI  170
             P GV V V P  ++F   + K TY+VTF+ ++        P  QG L W S  H VRSPI
Sbjct  689   PQGVDVKVTPSAIEFGGGSSKATYSVTFTRTANVKV----PFAQGYLNWVSADHVVRSPI  744

Query  169   A  167
             A
Sbjct  745   A  745



>ref|XP_003517445.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=747

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/726 (56%), Positives = 525/726 (72%), Gaps = 22/726 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             + L+TYIV V+ P +    QS      +L +WY+SFLP T       ++RM+F YRNV  
Sbjct  34    NNLKTYIVHVKKPETIPFLQSE-----ELHNWYRSFLPETTH-----KNRMIFSYRNVAS  83

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFA KL+ EE + +  KD  +SA PER L LHTTH+P FLGLQQ +G W  S+ G+GVII
Sbjct  84    GFAVKLTPEEAEALEEKDEIVSARPERTLSLHTTHTPSFLGLQQGVGLWNSSNLGEGVII  143

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT-ACNNKVIGARSF--SERERSVFdd  1796
             GV+D+GI   HPSF+DEGMPPPPA+W G CE      CNNK+IGAR+   S  E   F++
Sbjct  144   GVIDTGIYPFHPSFNDEGMPPPPAKWNGHCEFTGQRTCNNKLIGARNLLKSAIEEPPFEN  203

Query  1795  dghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNE-IGCSDSEILAAMD  1619
               HGTHTA  AAG FV  A+V+G A GTA+G+AP AH+A+YKVCN+ +GC++S ILAAMD
Sbjct  204   FFHGTHTAAEAAGRFVENASVFGMARGTASGIAPNAHVAMYKVCNDKVGCTESAILAAMD  263

Query  1618  TAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPW  1439
              AI+DGVD+LSLSLG  S  F ED IA+GA++A++ G+FVS SA N GP   +LSNEAPW
Sbjct  264   IAIDDGVDVLSLSLGLGSLPFFEDPIAIGAFAAIQSGVFVSCSAANSGPNYSTLSNEAPW  323

Query  1438  MLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCD  1259
             +LTVGAST+DRK++A+ VLGN  ++ GE+ FQP+D++ SLL LV+PG N ++ S   +C 
Sbjct  324   ILTVGASTIDRKIAASAVLGNGAEYEGESLFQPQDYSPSLLPLVYPGANGNNNSE--FCL  381

Query  1258  SESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPA  1079
               SL N DV+GK+VVC  GG      KG+ V  A G  MIL  PE +G +T A A+VLP 
Sbjct  382   PGSLNNIDVKGKVVVCDIGGGFPSVEKGQEVLKAGGAAMILANPESFGFSTFAVAYVLPT  441

Query  1078  IDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDI  899
             ++++Y  G  I +YIN+T +P AT SFKGT+ GD  APTV +FSSRGP++ SPGILKPDI
Sbjct  442   VEVSYVAGLAIKSYINSTYSPTATISFKGTVIGDALAPTVVSFSSRGPSQASPGILKPDI  501

Query  898   IGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSA  719
             IGPGVNILA W  SVDNK      +NI+SGTSMSCPHLSGVAALLKS+HPDWSPA IKSA
Sbjct  502   IGPGVNILAAWAVSVDNK---IPAYNIVSGTSMSCPHLSGVAALLKSAHPDWSPAAIKSA  558

Query  718   MMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLN  539
             +MTTA+ +N G  PI +Q  + A +F+ GAGHVNP+KANDPGLVYD +PEDY+PYLCGL 
Sbjct  559   IMTTANTVNLGGTPIVDQRNLPADIFATGAGHVNPNKANDPGLVYDIQPEDYVPYLCGLG  618

Query  538   YTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVE  359
             Y +RE+ +++Q RV CS+V +IPEAQLNYPSFSI++ S++Q Y+RT+TNVG A S YTVE
Sbjct  619   YDDREIAILVQSRVRCSSVKAIPEAQLNYPSFSILMGSSSQYYSRTLTNVGPAQSTYTVE  678

Query  358   IFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSV--KHH  185
             +  P  + ++V P ++ F++ NQK+T++V F    K  R N     QG+L W  V  KH 
Sbjct  679   LDVPLALGMSVNPSQITFTEANQKVTFSVEFIPQRKENRGNH-TFAQGSLTWVRVSDKHA  737

Query  184   VRSPIA  167
             VR PI+
Sbjct  738   VRIPIS  743



>gb|KCW77653.1| hypothetical protein EUGRSUZ_D01951 [Eucalyptus grandis]
Length=679

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/671 (61%), Positives = 493/671 (73%), Gaps = 5/671 (1%)
 Frame = -1

Query  2179  RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFW  2000
             RMV  Y+N + GFAAK++A+E KE+   D  +S   E+I  LHTTHSP FL L   +G W
Sbjct  10    RMVHSYKNSITGFAAKMTADEAKELLKLDAVVSVKQEKIFSLHTTHSPSFLNLNPGVGLW  69

Query  1999  RDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSE  1820
             +DS+ GKGVIIGVLD+GI   HPSF DEGM  PPA+WKG C  N T+CNNK+IGAR+F  
Sbjct  70    KDSTLGKGVIIGVLDTGITPGHPSFDDEGMSFPPAKWKGKCTFNATSCNNKLIGARNFVT  129

Query  1819  RERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDS  1640
                   D+DGHGTHT+ TAAGNFV+ ANV G A GTA GVAP AHLA+Y+VC+++GC +S
Sbjct  130   STLPPTDEDGHGTHTSSTAAGNFVKNANVLGQALGTAIGVAPHAHLAMYQVCSDVGCPES  189

Query  1639  EILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGS  1460
              ILAAMD AIEDGVD+LSLSLGG S+ F+ DSIA+GA+SA++KGIFVS SAGN GP N S
Sbjct  190   SILAAMDAAIEDGVDVLSLSLGGGSTPFYADSIAVGAFSAIQKGIFVSCSAGNSGPINTS  249

Query  1459  LSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDE  1280
             LSNEAPW+LTVGAST+DR + AT  LGN  + +GE+ FQPKDF S+   LV+ G N +  
Sbjct  250   LSNEAPWILTVGASTIDRTVKATAKLGNGAEHNGESLFQPKDFGSAY-PLVYAGANGNQT  308

Query  1279  SSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSA  1100
             S+   C   SLRN DV+GK+V+C  GG + R  KG+ VK+A G  MI++  E  G +T A
Sbjct  309   SA--LCAEGSLRNLDVKGKVVLCERGGGIARIAKGQEVKDAGGAAMIMMNDELNGYSTLA  366

Query  1099  TAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESP  920
              AHVLPA  I YADG KI +YIN+TSNPMAT  FKGTI G+  AP V +FSSRGP+ ESP
Sbjct  367   DAHVLPATHIPYADGLKIKSYINSTSNPMATILFKGTIIGNSEAPAVTSFSSRGPSFESP  426

Query  919   GILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWS  740
             GILKPDIIGPGV+ILA WP S+DN   +  TFNIISGTSMSCPHLSG+AALLKSSHPDWS
Sbjct  427   GILKPDIIGPGVSILAAWPFSLDNSSTTDVTFNIISGTSMSCPHLSGIAALLKSSHPDWS  486

Query  739   PAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYL  560
             PA IKSA+MTTA  +N G  PI ++ L+ A +F+ GAGHVNP KA+DPGL+YD KP++Y+
Sbjct  487   PAAIKSAIMTTAYQINLGSKPIVDETLLPADIFATGAGHVNPPKADDPGLIYDIKPDNYI  546

Query  559   PYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEA  380
             PYLCGL Y + E+  I Q +  C  + SIP+AQLNYPSFSIIL S+AQ Y+RTVTNVG A
Sbjct  547   PYLCGLGYKDSEIETITQEKAKCLQIKSIPQAQLNYPSFSIILGSSAQNYSRTVTNVGPA  606

Query  379   SSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWK  200
              S YT ++  P GV V V P E++FS   Q  TY V F  SS  + +   P  QG+L W 
Sbjct  607   DSSYTYKVDAPEGVDVTVYPSEIKFSVAVQMATYTVGFHRSSGGSFTK--PFAQGSLTWV  664

Query  199   SVKHHVRSPIA  167
             S  H VRSPIA
Sbjct  665   SSDHSVRSPIA  675



>ref|XP_004515784.1| PREDICTED: subtilisin-like protease SDD1-like [Cicer arietinum]
Length=753

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/753 (56%), Positives = 528/753 (70%), Gaps = 17/753 (2%)
 Frame = -1

Query  2380  MFLILSVLIGFCSTATIASKL---ETYIVRVELPHsristqsssssSVDLEHWYKSFLPT  2210
             +F+ L+ ++ F    T  S+L   ET   ++ + H         S S DLE W+ SF+P 
Sbjct  5     LFIALTFMLSFHIHFTQGSELVPTETSSSKIYIIHVNEPEGKMFSQSEDLESWHHSFMPP  64

Query  2209  TVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGF  2030
             TV      + RM++ YRNV+ GFAA+L+ EE++ +  K+GFISA PER+L   TTH+P F
Sbjct  65    TVMTSKEQQPRMIYSYRNVLSGFAARLTQEELRAVQQKNGFISAHPERMLRRQTTHTPDF  124

Query  2029  LGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNN  1850
             LGLQQ++G W+DS++GKGVIIGVLDSGI  DHPSFSD G+ PPP +WKG CELN TACNN
Sbjct  125   LGLQQDIGLWKDSNFGKGVIIGVLDSGITPDHPSFSDAGILPPPLKWKGRCELNGTACNN  184

Query  1849  KVIGARSFS--------ERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAP  1694
             K+IGARSF+        E+  +  D+DGHGTHTA TAAG FV  A V G+A GTAAG+AP
Sbjct  185   KLIGARSFNNAAKARKGEKGEAPIDEDGHGTHTASTAAGAFVDKAQVLGNAKGTAAGMAP  244

Query  1693  LAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVD-IlslslggmssSFHEDSIALGAYSAM  1517
              AHLAIYKVC    C +S+ILAA+D A+EDGVD I           F  DS A+GA++A+
Sbjct  245   HAHLAIYKVCFGEDCPESDILAALDAAVEDGVDVISISLGLSQPPPFFNDSTAIGAFAAI  304

Query  1516  EKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPK  1337
             +KGIFVS +AGN GPF+GSL N APW+LTVGAST+DR + AT  LGN ++F+GE+ FQP 
Sbjct  305   QKGIFVSCAAGNFGPFDGSLVNGAPWILTVGASTIDRSIVATARLGNAEEFNGESVFQPS  364

Query  1336  DFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNA  1157
             +F+ +LL L + G+N   + +S +C + SL + D RGK+V+C  GG + R  KGE VK A
Sbjct  365   NFSPTLLPLAYAGKN--GKQASTFCANGSLSDIDFRGKVVLCERGGGIGRIAKGEEVKRA  422

Query  1156  SGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGD  977
              G  MIL   +  G + SA  HVLPA  ++YA G KI AYIN+T+ P A  SFKGTI G+
Sbjct  423   GGAAMILTNDKINGFSLSADVHVLPATHVSYAAGLKIKAYINSTATPTANISFKGTIIGN  482

Query  976   KNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMS  797
               +P VA+FSSRGPN  SPGILKPDIIGPGVNILA WP  ++N  NS   FNI+SGTSMS
Sbjct  483   SLSPAVASFSSRGPNLPSPGILKPDIIGPGVNILAAWPFPLNNNTNSNLNFNIMSGTSMS  542

Query  796   CPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVN  617
             CPHLSG+AALLKSSHP WSPA IKSA+MT+AD LN    PI ++ L  A++ + G+GHVN
Sbjct  543   CPHLSGIAALLKSSHPHWSPAAIKSAIMTSADTLNLRNKPIVDEKLQPANLLATGSGHVN  602

Query  616   PSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSI  437
             PSKANDPGLVYD +P+DY+PYLCGL Y++ EVG+I    + CS   SI E +LNYPSFS+
Sbjct  603   PSKANDPGLVYDIQPDDYIPYLCGLGYSDVEVGIIAHKTIKCSETSSIAEGELNYPSFSV  662

Query  436   ILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLS  257
             +L S+ QT+TRTVTNVGEA S Y V +  P GV V V+P++L FSK NQK TY+VTF+  
Sbjct  663   VLGSS-QTFTRTVTNVGEAHSTYGVTVSAPKGVDVKVQPKKLIFSKANQKETYSVTFNRI  721

Query  256   SKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
                 ++      QG L+W S KH VRSPI  K 
Sbjct  722   GLGNKTE--EYAQGFLKWASAKHSVRSPILVKF  752



>gb|EPS72428.1| serine protease, partial [Genlisea aurea]
Length=726

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/720 (56%), Positives = 523/720 (73%), Gaps = 18/720 (3%)
 Frame = -1

Query  2314  TYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAA  2135
             TYIV VE P+    +       +DL+ WY SFLP T    G G+S +V  YRNV  GFAA
Sbjct  24    TYIVHVEPPYDLFDS-------IDLQKWYFSFLPETANFTG-GKSPIVHSYRNVFSGFAA  75

Query  2134  KLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLD  1955
             KLS  +V+ +  + GFISA P+R+L LHTT SP F+GL+++ G W+DS YGKGVI+GVLD
Sbjct  76    KLSEVDVEFVRRRKGFISATPQRVLQLHTTRSPEFMGLRRDFGLWKDSDYGKGVIVGVLD  135

Query  1954  SGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVFdddghgtht  1775
             +GI  +HPSF   GMPPPP RWKG CE NFTACN+K+IGAR+F + E    D +GHGTH+
Sbjct  136   TGIFPNHPSFDAGGMPPPPQRWKGKCEFNFTACNDKIIGARNFIDGEDGPMDRNGHGTHS  195

Query  1774  agtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVD  1595
             A TAAG FV  A+VYG+A GTAAGVAP+AHLAIYK C +  C +S++LAAMD AI+DGVD
Sbjct  196   ASTAAGRFVGDASVYGNAKGTAAGVAPMAHLAIYKSCTD-DCLESDVLAAMDAAIDDGVD  254

Query  1594  IlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGAST  1415
             ++S+S GG S  +++D+IALGAYSAM++GIFVS SAGN GPF+ +LSNEAPW+LTVGAST
Sbjct  255   VISISFGGFSREYYDDNIALGAYSAMQRGIFVSCSAGNNGPFHTTLSNEAPWILTVGAST  314

Query  1414  VDRKL-SATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNA  1238
             +DRKL  AT VLGN ++ +GE+ +QP DF S+   L+FPG N+++  +  YC   S  N 
Sbjct  315   IDRKLIRATAVLGNSEELNGESNYQPADFPSTDFPLIFPGLNSTNPRAR-YC-YPSFGNL  372

Query  1237  DVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYAD  1058
              + G IVVC   G + +  KG  V+NA   G+I++  E    TT + +HV+PA  ++YAD
Sbjct  373   TLTGTIVVCEDRGGIGKIAKGRVVRNAGAAGLIIVNGEADAYTTPSESHVIPATHLSYAD  432

Query  1057  GQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNI  878
             GQ+++AY+N+T+NP A  SF+GTI GD++AP VA++SSRGPN  S GILKPDIIGPG NI
Sbjct  433   GQRLIAYLNSTANPTAAISFRGTIIGDRDAPVVASYSSRGPNTPSRGILKPDIIGPGHNI  492

Query  877   LAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADI  698
             LA W  S++N   + S FNIISGTSM+CPHLSG AAL+K++HPDWSPA IKSA+MTTAD 
Sbjct  493   LAGWYQSLEN---TDSHFNIISGTSMACPHLSGAAALIKNAHPDWSPAAIKSALMTTADQ  549

Query  697   LNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVG  518
              N    PIQ+Q L  A  F+ G+GHVN ++A++PGL+YD +P+DYLPYLCGLNYT+++VG
Sbjct  550   TNIAGTPIQDQTLNPADAFATGSGHVNIARASNPGLIYDIQPDDYLPYLCGLNYTDQQVG  609

Query  517   VILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGV  338
             +I    VNCS + SIPEA+LNYPSFS+ +   + T+ RTVTNVGEA+  YT      P V
Sbjct  610   IIANRAVNCSNISSIPEAELNYPSFSVFVGDESLTFNRTVTNVGEANEVYTSRYTVFPSV  669

Query  337   KVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
              V +EP  LQF++V+Q++TY VTF+    A       ++QG+L W S  H VR P+ A +
Sbjct  670   DVKIEPSSLQFTEVHQRITYQVTFAKQPDAVSRT---IIQGSLTWTSASHSVRCPVIAVI  726



>ref|XP_007211044.1| hypothetical protein PRUPE_ppa019040mg [Prunus persica]
 gb|EMJ12243.1| hypothetical protein PRUPE_ppa019040mg [Prunus persica]
Length=752

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/747 (57%), Positives = 538/747 (72%), Gaps = 25/747 (3%)
 Frame = -1

Query  2359  LIGFCSTATIASK---LETYIVRVELPHsristqsssssSVDLEHWYKSFLP-TTVAGGG  2192
             L+ FC    +  +   L+TYIV VE P   +S    S S   LE WY+SFLP TTV    
Sbjct  9     LMQFCLLGLVQEEQNSLQTYIVWVEKP---VSRNIFSQSHEGLESWYQSFLPETTVNSNE  65

Query  2191  YGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQN  2012
                SR+V  YRNV  GFAAKL+ EEVK M  K GF+SA PERILPL TTH+P FLGL Q 
Sbjct  66    QKSSRIVHAYRNVGTGFAAKLTPEEVKAMEKKQGFVSARPERILPLQTTHTPDFLGLHQG  125

Query  2011  MGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGAR  1832
              G W+ ++YG+GVIIGVLD+GI   HPSFSDEG+PPPPARWKG CE N T CNNK+IGA+
Sbjct  126   YGLWKQTNYGEGVIIGVLDTGIGAGHPSFSDEGVPPPPARWKGKCEFNATLCNNKLIGAK  185

Query  1831  SF------SERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYK  1670
             +F      +  +    D+ GHGTHT+ TAAGNFV GA+V+G ANGTA G+AP AHLA+YK
Sbjct  186   NFVGSGKGNTTDSPPVDNHGHGTHTSSTAAGNFVAGASVFGEANGTAVGMAPYAHLAMYK  245

Query  1669  VCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSAS  1490
             VC   GC+D +ILAA+D A+EDGVD+LSLSLGG S  F+ED IA+GA++A++KGIF S +
Sbjct  246   VCAGGGCADGDILAALDAAVEDGVDVLSLSLGGESLPFYEDVIAIGAFAAIQKGIFFSCA  305

Query  1489  AGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQ--QFHGETAFQPKDFNSSL-  1319
             AGN GP   SLSNEAPW+LTVGAST DR L +   +G+ +   F G++  QP+DF+S++ 
Sbjct  306   AGNSGPSYNSLSNEAPWILTVGASTTDRILKSKAQIGDDKNNHFDGKSLSQPEDFDSTVS  365

Query  1318  LSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMI  1139
             L LV+ G   +  S+S  C + SL N  V GKIV+C TGG +    KGE VK A G  MI
Sbjct  366   LPLVYAGSVGNQPSAS--CKAGSLEN--VEGKIVLCETGGGVTNIAKGEEVKRAGGAAMI  421

Query  1138  LIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTV  959
             L+  E  G +T A +HVLP+  ++YA G +I +YI++TS+P A   F GT+ GD  AP V
Sbjct  422   LMNQETDGFSTLAESHVLPSTHVSYAAGLQIKSYISSTSSPTAKILFNGTVIGDALAPKV  481

Query  958   AAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSG  779
             A+FSSRGP+  SPGILKPDIIGPGV+ILA WP +VD +  SK+TFNIISGTSMS PHLSG
Sbjct  482   ASFSSRGPSSASPGILKPDIIGPGVSILAAWPVAVD-QTQSKATFNIISGTSMSTPHLSG  540

Query  778   VAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKAND  599
             +AALLKSSHPDWSPA IKSA+MTTA++LN    PI +Q L  A +F+ GAGHVNPSKAND
Sbjct  541   IAALLKSSHPDWSPAAIKSAIMTTANVLNLEGKPIVDQTLEPADIFATGAGHVNPSKAND  600

Query  598   PGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL---E  428
             PGLVYDT+P+DY+PYLCGLNYT++++ +I +  V CS V +IPEAQLNYPSFSI +   E
Sbjct  601   PGLVYDTQPKDYIPYLCGLNYTDQQIQLITKQAVICSQVEAIPEAQLNYPSFSIKIRSNE  660

Query  427   STAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKA  248
             + +Q YTRTV NVG ASS Y +++  P  + ++V P+ L F++VNQ+LT++V F     A
Sbjct  661   TQSQYYTRTVRNVGPASSTYNLDLLVPHKMGMSVNPQVLTFTEVNQELTFHVEFIAEDGA  720

Query  247   ARSNMPPVVQGALRWKSVKHHVRSPIA  167
              +  + P+ QG LRW S K++V SPIA
Sbjct  721   GKDGV-PISQGYLRWFSDKYNVTSPIA  746



>ref|XP_008437181.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=745

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/735 (56%), Positives = 510/735 (69%), Gaps = 28/735 (4%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S L TYIV V+ P              DLE W++SFLPT++      +  +++ YRNVM 
Sbjct  28    SNLHTYIVHVKKPEVVD----------DLEIWHRSFLPTSL-DNEEEQPTLLYSYRNVMS  76

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GF+A+L+ E VK M  KDGF+SA  E I+ LHTTH+P FLGL +  GFW+DS++GKGVII
Sbjct  77    GFSARLTEEHVKAMEEKDGFVSARRETIVHLHTTHTPDFLGLNRQFGFWKDSNFGKGVII  136

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-----------SE  1820
             GVLD GI  +HPSF D GM  PPA+WKG CE NF+ACNNK+IGARS            + 
Sbjct  137   GVLDGGITPNHPSFDDAGMAQPPAKWKGRCEFNFSACNNKLIGARSMNLASQALKGKITT  196

Query  1819  RERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDS  1640
              + S  D+DGHGTHTA TAAG FV GA   G+A GTA G+APLAHLAIYKVC    CSD 
Sbjct  197   LDDSPIDEDGHGTHTASTAAGTFVDGAEALGNAFGTAVGMAPLAHLAIYKVCFGEDCSDV  256

Query  1639  EILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGS  1460
             +ILA +D A+EDGVD+LS+SLGG S  F  D  A+G+++A++KGIFVS SA N GPFN +
Sbjct  257   DILAGLDAAVEDGVDVLSISLGGPSVPFFADITAIGSFAAIQKGIFVSCSAANSGPFNAT  316

Query  1459  LSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDE  1280
             LSNEAPW+LTV AST+DRK++AT  LGN ++F GE+ FQP DF  +LL LVFPG+     
Sbjct  317   LSNEAPWILTVAASTIDRKITATAKLGNGEEFDGESLFQPNDFPQTLLPLVFPGEK---N  373

Query  1279  SSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSA  1100
              +   C   SL+N DV+GK+VVC  GG + R  KG  VKN  G  MIL+  E  G TT  
Sbjct  374   ETVALCAEGSLKNIDVKGKVVVCERGGGIARIAKGVEVKNGGGAAMILLNAESDGFTTEV  433

Query  1099  TAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESP  920
              AHVLPA  +++    KI AYIN+T+ P AT  FKGT  GD  +P +A+FSSRGP+  SP
Sbjct  434   DAHVLPASHVSHTAALKIKAYINSTTYPTATILFKGTTIGDDFSPAIASFSSRGPSLASP  493

Query  919   GILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWS  740
             GILKPDI GPGV+ILA WP  +DN  N+KSTFNIISGTSMSCPHLSG+AAL+KS+HPDWS
Sbjct  494   GILKPDITGPGVSILAAWPFPLDNNTNTKSTFNIISGTSMSCPHLSGIAALIKSAHPDWS  553

Query  739   PAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYL  560
             PA IKS++MTTA+I N   NPI ++ L  A +F+IGAGHVNPSKA DPGLVYD +P+DY+
Sbjct  554   PAAIKSSIMTTANITNLEGNPILDETLQPADLFAIGAGHVNPSKAIDPGLVYDIQPDDYI  613

Query  559   PYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEA  380
             PYLCGL YTN +V +I    ++C    SIPE +LNYPSF + L    QT++RTVT+VG  
Sbjct  614   PYLCGLGYTNNQVSLIAHKPIDCLTTSSIPEGELNYPSFMVKL-GPVQTFSRTVTSVGSG  672

Query  379   SSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWK  200
                Y V I  P GV V V PR+L FS +NQK TY+VTF  S   + S      +G L+W 
Sbjct  673   RVVYNVVIEAPEGVSVTVRPRKLSFSALNQKATYSVTFKRSGSISPS--IEFAEGYLKWV  730

Query  199   SVKHHVRSPIAAKLV  155
             S KH VRSPI+ K V
Sbjct  731   SAKHVVRSPISVKFV  745



>ref|XP_008238737.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=762

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/757 (57%), Positives = 541/757 (71%), Gaps = 26/757 (3%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIASK----LETYIVRVELPHsristqsssssSVDLEHWYKSF  2219
             L    +L +   F  +  +A +    L+TYIV VE P   +S    S S   LE WY+SF
Sbjct  9     LMQLCLLGLTFMFYQSLGLAQEEQNSLQTYIVWVEKP---VSRNIFSQSHEGLESWYQSF  65

Query  2218  LP-TTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTH  2042
             LP TTV       SR+V  Y NV  GFAAKL+ EEVK M  K GF+SA PERILPL TTH
Sbjct  66    LPETTVNSNEQKSSRIVHAYCNVGTGFAAKLTPEEVKAMEKKQGFVSARPERILPLQTTH  125

Query  2041  SPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT  1862
             +P FLGL Q  G W+ ++YG+GVIIGVLD+GI   HPSFSDEG+PPPPARWKG CE N T
Sbjct  126   TPDFLGLHQGYGLWKQTNYGEGVIIGVLDTGIGAGHPSFSDEGVPPPPARWKGKCEFNAT  185

Query  1861  ACNNKVIGARSF------SERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGV  1700
              CNNK+IGA++F      +  +    D+ GHGTHT+ TAAGNFV GA+V+G ANGTA G+
Sbjct  186   LCNNKLIGAKNFVGSGKGNTTDSPPVDNHGHGTHTSSTAAGNFVAGASVFGEANGTAVGM  245

Query  1699  APLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSA  1520
             AP AHLA+YKVC   GC+D +ILAA+D A+EDGVD+LSLSLGG S  F+ED IA+GA++A
Sbjct  246   APYAHLAMYKVCAGGGCADGDILAALDAAVEDGVDVLSLSLGGESLPFYEDVIAIGAFAA  305

Query  1519  MEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQ--QFHGETAF  1346
             ++KGIF S +AGN GP   SLSNEAPW+LTVGAST DR L +   +G+ +   F G++  
Sbjct  306   IQKGIFFSCAAGNSGPSYNSLSNEAPWILTVGASTTDRILKSEAQIGDDKNNHFDGKSLS  365

Query  1345  QPKDFNSSL-LSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEA  1169
             QP+DFNS++ L LV+ G   +  S+S  C + SL N  V+GKIV+C TGG +    KGE 
Sbjct  366   QPEDFNSAVSLPLVYAGSVGNQLSAS--CKAGSLEN--VKGKIVLCETGGGVTNIAKGEE  421

Query  1168  VKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGT  989
             VK A G  MIL+  E  G +T A +HVLP+  ++YA G +I +YI++TS+P A   F GT
Sbjct  422   VKRAGGAAMILMNQETDGFSTLAESHVLPSTHVSYAAGLQIKSYISSTSSPTAKILFNGT  481

Query  988   ITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISG  809
             + GD  AP VA+FSSRGP+  SPGILKPDIIGPGV+ILA WP +VD +  SK+TFNIISG
Sbjct  482   VIGDALAPKVASFSSRGPSSASPGILKPDIIGPGVSILAAWPVAVD-QTQSKATFNIISG  540

Query  808   TSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGA  629
             TSMS PHLSG+AALLKSSHPDWSPA IKSA+MTTA++LN    PI +Q L  A +F+ GA
Sbjct  541   TSMSTPHLSGIAALLKSSHPDWSPAAIKSAIMTTANVLNLAGKPIVDQRLEPADIFATGA  600

Query  628   GHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYP  449
             GHVNPSKANDPGLVYDT+P+DY+PYLCGLNYT++++ +I +  V CS V +IPEAQLNYP
Sbjct  601   GHVNPSKANDPGLVYDTQPKDYIPYLCGLNYTDQQIQLITKQAVICSQVEAIPEAQLNYP  660

Query  448   SFSIIL---ESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTY  278
             SFSI +   E+ +Q YTRTV NVG ASS Y +++  P  + ++V P+ L F++VNQ+LT+
Sbjct  661   SFSIKIRSNETQSQYYTRTVRNVGPASSTYNLDLLVPHKMGMSVNPQMLTFTEVNQELTF  720

Query  277   NVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             +V F     A +  + P+ QG LRW S K++V SPIA
Sbjct  721   HVEFIAEDGAGKDGV-PISQGYLRWFSDKYNVTSPIA  756



>ref|XP_003611185.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES94143.1| subtilisin-like serine protease [Medicago truncatula]
Length=756

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/761 (56%), Positives = 528/761 (69%), Gaps = 37/761 (5%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIAS------------KLETYIVRVELPHsristqsssssSVD  2243
             +++ L++S++   CS   I S             L TYIV     H + S   +S  S D
Sbjct  8     MQLSLLVSLIFILCSFNQITSVFAAEENQEHDHNLMTYIV-----HVKKSENVASFQSED  62

Query  2242  LEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERI  2063
             L  WY SFLP         + RMVF YR+V  GFA KL+ EE K +  KDG + A PER 
Sbjct  63    LHSWYHSFLPQNFPH----KHRMVFSYRHVASGFAVKLTPEEAKSLQEKDGILLARPERT  118

Query  2062  LPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKG  1883
             L LHTTHSP FLGL+   G W D + GKGVIIGV+DSGI   HPSF+DEGMPPPPA+WKG
Sbjct  119   LSLHTTHSPTFLGLKHGQGLWNDDNLGKGVIIGVIDSGIFPSHPSFNDEGMPPPPAKWKG  178

Query  1882  VCELNFTA-CNNKVIGARSF--SERERSVFdddghgthtagtaaGNFVRGANVYGSANGT  1712
              CE N T  CNNK+IGARS   S  +   F++  HGTHTA  AAG F++ A+V+G+A G 
Sbjct  179   HCEFNGTKICNNKLIGARSLVKSTIQEPPFENIFHGTHTAAEAAGRFIKDASVFGNAKGV  238

Query  1711  AAGVAPLAHLAIYKVCNE-IGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIAL  1535
             AAG+AP AHLAIYKVCN+ I C +S ILAAMD AIEDGVD+LSLSLG  S  F ED IA+
Sbjct  239   AAGMAPNAHLAIYKVCNDKIECPESAILAAMDIAIEDGVDVLSLSLGLGSLPFFEDPIAI  298

Query  1534  GAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGE  1355
             GA++A + G+FVS SAGN GP   +LSNEAPW+LTVGAST+DRK+ A+  LGN +++ GE
Sbjct  299   GAFAATKNGVFVSCSAGNSGPEYSTLSNEAPWILTVGASTIDRKIVASAKLGNGEEYEGE  358

Query  1354  TAFQPKDFNSSLLSLVFPG-----QNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLD  1190
             T FQPKDF   L  LV+ G       T ++S    C   SL+N D+ GK+V+C  G  + 
Sbjct  359   TLFQPKDFPQQLFPLVYAGSLGYGNQTQNQS---LCLPGSLKNIDLSGKVVLCDIGEDVS  415

Query  1189  RRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMA  1010
                KG+ V NA+G  +IL+  E  G +T ATAHVLPA++++YA G  I  YIN+T NP A
Sbjct  416   TFVKGQEVLNANGVAVILVNSESDGFSTFATAHVLPAVEVSYAAGLTIKDYINSTYNPTA  475

Query  1009  TFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKS  830
             T  FKGT+ GD  AP+V +FSSRGP+++SPGILKPDIIGPGVNILA WP S+DNK     
Sbjct  476   TLLFKGTVIGDSLAPSVVSFSSRGPSQQSPGILKPDIIGPGVNILAAWPVSIDNK---TP  532

Query  829   TFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTA  650
              F I SGTSMSCPHLSG+AAL+KSSHPDWSPA IKSA+MTTA+ LN G  PI +Q L  A
Sbjct  533   PFAITSGTSMSCPHLSGIAALIKSSHPDWSPAAIKSAIMTTANTLNLGGIPILDQRLSPA  592

Query  649   SVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIP  470
              VF+ GAGHVNP KANDPGLVYD +PEDY+PYLCGL YT++E+ +I Q  VNCS V SIP
Sbjct  593   DVFATGAGHVNPVKANDPGLVYDIQPEDYVPYLCGLGYTDQEIELIAQWVVNCSNVKSIP  652

Query  469   EAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQ  290
             EAQLNYPSFSI+L S +Q YTRT+TNVG A+S Y VE+  P  + ++V P E+ F++VN+
Sbjct  653   EAQLNYPSFSILLGSDSQYYTRTLTNVGLANSTYRVELEVPLALGMSVNPSEITFNEVNE  712

Query  289   KLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             K++Y+V F   +K +R N     QG+L W S KH VR PI+
Sbjct  713   KVSYSVDFIPKTKESRGNN-TYAQGSLTWVSDKHAVRIPIS  752



>ref|XP_006358144.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=729

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/752 (56%), Positives = 536/752 (71%), Gaps = 36/752 (5%)
 Frame = -1

Query  2398  NMKFLRMFLILSVLI-----GFCSTATIASKLETYIVRVELPHsristqsssssSVDLEH  2234
             ++KF+ +F  + +L+      F    T  + LETYIV++ELP   + + S      DL  
Sbjct  2     DLKFVSIFFCIVILLHSSKSTFADHFTNQNDLETYIVQLELPDDFVFSNSK-----DLYL  56

Query  2233  WYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPL  2054
             W++SFLPTT        SR+++ YR+V  GFAA LS++EVK M  + GF+SA P+R+L L
Sbjct  57    WHQSFLPTTSENSDL-SSRIIYSYRHVFNGFAAMLSSDEVKMMEKQPGFVSARPQRVLQL  115

Query  2053  HTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCE  1874
             HTTHSP FLGL QN+G W  S+ GKGVIIG+LDSGI   HPSF+D GMPPPPA+WKG CE
Sbjct  116   HTTHSPSFLGLHQNVGLWNASNSGKGVIIGLLDSGINPKHPSFNDYGMPPPPAKWKGKCE  175

Query  1873  LNFTACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAP  1694
              N+ ACNNK+IGAR+  +  +S  D DGHGTHT+ TAAGNFV GAN  G+ANGTA G+AP
Sbjct  176   FNYKACNNKLIGARNLVKTAKSPLDGDGHGTHTSSTAAGNFVVGANFLGNANGTAVGIAP  235

Query  1693  LAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAME  1514
              AH+A+Y+VC+  GC +  ILA  D AIEDGVD++S+S+G M+   +E+ +A+GAY A+E
Sbjct  236   GAHVAMYRVCDTDGCPEVFILAGYDAAIEDGVDVISISIGAMAVPPYEEIMAIGAYRAIE  295

Query  1513  KGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKD  1334
             KGIFVS SAGN GP + ++ N +PW+LTVGAS+ DRKLSA  VLGN  ++ GE+AFQ  +
Sbjct  296   KGIFVSCSAGNSGPSSATVENGSPWILTVGASSTDRKLSAVAVLGNGAEYEGESAFQSTN  355

Query  1333  FNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNAS  1154
              +  LL L+  G            D ESL + DVRGKIV+C   G L     G+ VK A 
Sbjct  356   ISKKLLPLINGG------------DCESLASIDVRGKIVLCGAVGSLSGIEIGQEVKKAG  403

Query  1153  GRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDK  974
             G  MIL   EE G TT  T HVLPA  ++Y DG KI+ YI +TS P+AT SFKGT  GDK
Sbjct  404   GAAMILKNEEEQGYTTFVTVHVLPATHVSYLDGLKIIEYIKSTSTPVATISFKGTRIGDK  463

Query  973   NAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPW---PTSVDNKPNSKSTFNIISGTS  803
             +AP VA+FSSRGP   S GILKPDIIGPGVNILA W   P  V   P++ STFNIISGTS
Sbjct  464   HAPVVASFSSRGPYTISQGILKPDIIGPGVNILAAWIKPPAGV--IPSATSTFNIISGTS  521

Query  802   MSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGH  623
             MSCPHL+GVAALLKS+HPDWSPA IKSA+MTTAD++N G NPIQ++ L  A + ++G+GH
Sbjct  522   MSCPHLAGVAALLKSAHPDWSPAAIKSAIMTTADLVNLGNNPIQDEKLNPADLLTVGSGH  581

Query  622   VNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSF  443
             VNPSKAN+PGLVYD +P+DY+PYLCGL YT+++V  I+  +V+C++  SI EA+LNYPSF
Sbjct  582   VNPSKANNPGLVYDIQPQDYVPYLCGLKYTDQQVSTIVNKKVHCTS--SIAEAELNYPSF  639

Query  442   SIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFS  263
             SI L S+AQTYTRTVTNVGEA+S YTVE+    GV ++++P  L+FS +NQKL+Y VTF 
Sbjct  640   SIDLGSSAQTYTRTVTNVGEANSTYTVEVIGVEGVVLSIKPSILKFSALNQKLSYEVTFK  699

Query  262   LSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
              S+    S      QG + W S K+ VRSPI+
Sbjct  700   RSTSTDSS------QGYINWSSGKYSVRSPIS  725



>gb|KCW77772.1| hypothetical protein EUGRSUZ_D02072 [Eucalyptus grandis]
Length=807

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/718 (57%), Positives = 506/718 (70%), Gaps = 11/718 (2%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGF  2141
             L TYIV V  P          + S DL+ WY+SFLP T A     + RMV  Y++ + GF
Sbjct  97    LSTYIVHVRKP-----AGEVFARSEDLQSWYQSFLPQTAANWDQTK-RMVHSYKHAITGF  150

Query  2140  AAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGV  1961
             AAK++A+E KE+   D  +S   E+I  LHTTHSP FL L   MG W+ S+ GKGVIIGV
Sbjct  151   AAKMTADEAKELLKLDAVVSVKREKIFSLHTTHSPSFLNLNPGMGLWKASTLGKGVIIGV  210

Query  1960  LDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVFdddghgt  1781
             LD+GI   HPSF D+GM  PPA+WKG C  N T+CNNK+IGAR+F        D+DGHGT
Sbjct  211   LDTGITPGHPSFDDQGMSTPPAKWKGKCTFNATSCNNKLIGARNFVTSNLPPTDEDGHGT  270

Query  1780  htagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDG  1601
             HT+ TAAGNFV+ AN  G A G A G+AP AHLA+Y+VC+   C +S +LA MD AIEDG
Sbjct  271   HTSSTAAGNFVKKANFLGQAPGIAVGIAPRAHLAMYRVCSNGRCLESHVLAGMDAAIEDG  330

Query  1600  VDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGA  1421
             VD+LS+S+G   + F+ DS+A+GA+SA++KGIFVS SAGN GP N SLSNEAPW+LTVGA
Sbjct  331   VDVLSISIGFRQAPFYADSMAVGAFSAIQKGIFVSCSAGNRGPINTSLSNEAPWILTVGA  390

Query  1420  STVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRN  1241
             ST+DR + AT  LGN  ++ GE+ FQPKDF +S   LV+ G N +  S+   C   SLRN
Sbjct  391   STIDRTVKATAKLGNGAEYDGESLFQPKDF-ASAYPLVYAGANGNQTSA--ICAEGSLRN  447

Query  1240  ADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYA  1061
              DV+GK+V+C T   + R  +G+ VK+A G  MIL+  E  G +T A  HVLPA  I YA
Sbjct  448   LDVKGKVVLCETDRGIARIAQGQEVKDAGGVAMILMNNELNGYSTRADVHVLPATHIPYA  507

Query  1060  DGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVN  881
             DG KI AYIN+TS+P AT  FKGTI G+ +AP V +FSSRGP+ ESPGILKPDIIGPGV+
Sbjct  508   DGLKIKAYINSTSDPTATILFKGTIIGNSDAPAVTSFSSRGPSFESPGILKPDIIGPGVS  567

Query  880   ILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTAD  701
             ILA WP S+DN   + +TFNIISGTSMSCPHLSG+AALLKSSHPDWSPA IKSA+MTTA 
Sbjct  568   ILAAWPFSLDNSSTTDATFNIISGTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIMTTAY  627

Query  700   ILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREV  521
              +N G  PI ++ L+ A +F+IGAGHVNP KA+DPGL+YD KP DY+PYLCGL Y + E+
Sbjct  628   QMNLGSKPIIDETLLPADIFAIGAGHVNPPKADDPGLIYDIKPNDYIPYLCGLGYKDSEI  687

Query  520   GVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPG  341
               I Q +  CS + SIPEAQLNYPSFSIIL S+AQ Y+RTVTNVG A S YT ++  P G
Sbjct  688   ETITQEKAKCSQIKSIPEAQLNYPSFSIILGSSAQNYSRTVTNVGSADSSYTYKVDAPEG  747

Query  340   VKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             V V V P E++FS   Q  TY V F  SS    + + P  QG+L W S  H V+SPIA
Sbjct  748   VDVTVYPSEIKFSMAVQMATYTVGFHRSSGG--TVIKPFAQGSLTWVSSDHSVKSPIA  803



>gb|KCW77656.1| hypothetical protein EUGRSUZ_D01954 [Eucalyptus grandis]
Length=679

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/671 (60%), Positives = 490/671 (73%), Gaps = 5/671 (1%)
 Frame = -1

Query  2179  RMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFW  2000
             RMV  Y+N + GFAAK++ +EVKE+   D  +S   E+I  LHTTHSP FL L   +G W
Sbjct  10    RMVHSYKNSITGFAAKMTEDEVKELLKLDAVVSVKQEKIFSLHTTHSPSFLNLNPGVGLW  69

Query  1999  RDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSE  1820
             +DS+ GKGVIIGVLD+GI  DHPSF DEGM  PPA+WKG C  N T+CNNK+IGAR+F  
Sbjct  70    KDSTLGKGVIIGVLDTGITPDHPSFDDEGMSSPPAKWKGKCNFNATSCNNKLIGARNFVN  129

Query  1819  RERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDS  1640
                   D+DGHGTHT+ TAAGNFV+ ANV G A GTA G+AP AHLA+Y+VC+++GC +S
Sbjct  130   STLPPTDEDGHGTHTSSTAAGNFVKNANVLGQALGTAIGMAPHAHLAMYQVCSDVGCPES  189

Query  1639  EILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGS  1460
              ILA MD AIEDGVD+LSLSLGG S+ F+ DS A+GA+SA+ KGIFVS SAGN GP N S
Sbjct  190   SILAGMDAAIEDGVDVLSLSLGGGSAPFYADSTAVGAFSAIRKGIFVSCSAGNSGPINTS  249

Query  1459  LSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDE  1280
             LSN+APW+LTVGAST+DR + AT  LGN  ++ GE+ FQPKDF  +  SLV+ G N +  
Sbjct  250   LSNDAPWILTVGASTIDRTIKATAKLGNGAEYDGESLFQPKDFGLAY-SLVYAGANGNQT  308

Query  1279  SSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSA  1100
             S+   C   SLRN DV+GK+V+C  GG + R  KG+ VK+A G  MIL+  E  G +T A
Sbjct  309   SA--ICAEGSLRNLDVKGKVVLCERGGGIARIAKGQEVKDAGGAAMILMNDELNGYSTLA  366

Query  1099  TAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESP  920
              AHVLPA  I YADG KI AYIN+TS+P AT  FKGTI  + +AP V +FSSRGP+ ESP
Sbjct  367   DAHVLPATHIPYADGLKIKAYINSTSDPTATILFKGTIIRNSDAPAVTSFSSRGPSLESP  426

Query  919   GILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWS  740
             GILKPDIIGPGV+ILA WP S+DN   ++ TFNIISGTSMSCPHLSG+AALLKSSHPDWS
Sbjct  427   GILKPDIIGPGVSILAAWPFSLDNSSTTEVTFNIISGTSMSCPHLSGIAALLKSSHPDWS  486

Query  739   PAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYL  560
             PA IKSA+MTTA  +N G  PI ++ L+ A +F+ GAGHVNP KA+DPGL+YD KP+DY+
Sbjct  487   PAAIKSAIMTTAYQMNLGSKPIIDETLLPADIFATGAGHVNPPKADDPGLIYDIKPDDYI  546

Query  559   PYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEA  380
             PYLCGL Y + E+  I Q +  CS + SIPEAQLNYPSFSIIL S+AQ Y+RTVTNV   
Sbjct  547   PYLCGLGYKDSEIETITQEKAKCSQIKSIPEAQLNYPSFSIILGSSAQNYSRTVTNVEPT  606

Query  379   SSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWK  200
              S YT ++  P GV V V P E++FS   Q  TY V F  SS  + +   P  QG+L W 
Sbjct  607   HSSYTYKVDAPEGVDVTVYPSEIKFSVAVQIATYTVGFRRSSGGSVTK--PFAQGSLTWV  664

Query  199   SVKHHVRSPIA  167
             S  H VRSPIA
Sbjct  665   SSDHSVRSPIA  675



>ref|XP_007158428.1| hypothetical protein PHAVU_002G152400g [Phaseolus vulgaris]
 gb|ESW30422.1| hypothetical protein PHAVU_002G152400g [Phaseolus vulgaris]
Length=746

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/753 (55%), Positives = 532/753 (71%), Gaps = 31/753 (4%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIASK-----LETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             L +  +L ++    + AT  +K     L+TYIV V+ P SR + +S      +L  WY S
Sbjct  8     LELAFLLGLVFMLSTMATSFAKDHGSNLQTYIVHVKRPESRATIESE-----ELHKWYHS  62

Query  2221  FLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTH  2042
             FLP         + RMVF YRNV  GFA KL+ EE K +  KD  +SA PERIL LHTTH
Sbjct  63    FLPQ-----ASNKDRMVFSYRNVASGFAVKLTPEEAKALLEKDEIVSARPERILSLHTTH  117

Query  2041  SPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT  1862
             +P FLGL+Q +G W  S+ G+GVIIGV+D+GI   HPSF+DEGMPPPP +WKG CE  FT
Sbjct  118   TPSFLGLRQGLGLWNSSNLGQGVIIGVIDTGIYPFHPSFNDEGMPPPPPKWKGHCE--FT  175

Query  1861  A---CNNKVIGARSF--SERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVA  1697
                 CNNK+IGAR+   S  E   F++  HGTHTA  AAG FV  A+V+G+A GTAAG+A
Sbjct  176   GQRTCNNKLIGARNLLKSANEEPPFENFFHGTHTAAEAAGRFVENASVFGNAQGTAAGMA  235

Query  1696  PLAHLAIYKVCNE-IGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSA  1520
             P AHLA+YKVCN+ +GC++S ILAAMD AI+DGVD+LSLSLG  S  F ED IA+GA++A
Sbjct  236   PNAHLAMYKVCNDKVGCTESAILAAMDIAIDDGVDVLSLSLGLGSLPFVEDPIAIGAFAA  295

Query  1519  MEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQP  1340
             ++ G+FVS SA N GP   +LSNEAPW+LTVGAST+DRK++A+ VLGN  ++ GE+ FQP
Sbjct  296   IQNGVFVSCSAANSGPGYSTLSNEAPWILTVGASTIDRKIAASAVLGNGAEYEGESLFQP  355

Query  1339  KDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKN  1160
             +DF+ +LL LV+ G N    SS  +C    L N DV+GK+VVC  GG      KG+ V +
Sbjct  356   EDFSPTLLPLVYAGANGILNSS--FCVPGFLNNVDVKGKVVVCDIGGGFSSVVKGQVVLD  413

Query  1159  ASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITG  980
             A G  MIL   +  G +T A AHVLPA++++Y  G  I +YIN+T++P AT SFKGT+ G
Sbjct  414   AGGVAMILANSQSLGFSTFAVAHVLPAVEVSYVAGLAIKSYINSTTSPTATISFKGTVIG  473

Query  979   DKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSM  800
             D  AP V +FSSRGP++ SPGILKPDIIGPGVNILA W  SVDNK      +NI+SGTSM
Sbjct  474   DALAPAVVSFSSRGPSQASPGILKPDIIGPGVNILAAWAVSVDNK---IPPYNIVSGTSM  530

Query  799   SCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHV  620
             SCPHLSGVAALLKS+HPDWSPA IKSA+MTTA+ +N G  PI +Q L+ A +F+ GAGHV
Sbjct  531   SCPHLSGVAALLKSAHPDWSPAAIKSAIMTTANTVNLGGQPILDQRLLPADIFATGAGHV  590

Query  619   NPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFS  440
             NP+KANDPGLVYD + +DY+PYLCGL Y +RE+G+++Q RV CS V +IPEAQLNYPSFS
Sbjct  591   NPNKANDPGLVYDIQSDDYIPYLCGLGYEDREIGILVQRRVRCSGVKAIPEAQLNYPSFS  650

Query  439   IILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSL  260
             I++ S  Q YTRT+TNVG A + Y V++  P  + ++V P ++ F++VNQK+T++V F  
Sbjct  651   IVMGSDTQYYTRTLTNVGPAEATYIVDLVVPLAMGMSVNPSQITFTEVNQKVTFSVEFIP  710

Query  259   SSKAARSNMPPVVQGALRWKSV--KHHVRSPIA  167
               K  R N     QG+L W  V  KH VR P++
Sbjct  711   QIKENRGNH-TFAQGSLSWIRVSDKHTVRIPLS  742



>ref|XP_007155580.1| hypothetical protein PHAVU_003G214100g [Phaseolus vulgaris]
 gb|ESW27574.1| hypothetical protein PHAVU_003G214100g [Phaseolus vulgaris]
Length=749

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/755 (55%), Positives = 520/755 (69%), Gaps = 21/755 (3%)
 Frame = -1

Query  2389  FLRMFLILSVLIGFCST---ATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSF  2219
             F+ +  +LS  I F       + AS  +TYI+ V+ P  +   QS      DLE W+ SF
Sbjct  6     FIALTFVLSFHIHFAQANEQPSTASSSKTYIIHVKWPQGKTLAQSE-----DLESWHNSF  60

Query  2218  LPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHS  2039
             +P T       + RM++ YRNV+ GFAA+LS EE++ +  K+GFISA PER+L   TTH+
Sbjct  61    MPPTTMSS-EDQPRMIYSYRNVISGFAARLSEEELRAVEKKNGFISAHPERMLHRQTTHT  119

Query  2038  PGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA  1859
             P FLGLQQ MG W++S++GKGVI+GVLDSGI   HPSFSD GMPPPP +WKG CELN TA
Sbjct  120   PRFLGLQQQMGLWKESNFGKGVIVGVLDSGITPHHPSFSDAGMPPPPPKWKGRCELNGTA  179

Query  1858  CNNKVIGARSF------SERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVA  1697
             CNNK+IGARSF      ++   +  D+DGHGTHTA TAAG FV  A V G+A GTAAG+A
Sbjct  180   CNNKLIGARSFNLAAEPTKEAGTPIDEDGHGTHTASTAAGAFVDYAEVLGNAKGTAAGIA  239

Query  1696  PLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVD-IlslslggmssSFHEDSIALGAYSA  1520
             P AHLAIYKVC    C +S ILAA+D A+EDGVD I           F  DS A+G ++A
Sbjct  240   PHAHLAIYKVCFGEDCPESNILAALDAAVEDGVDVISISLGPSEPPPFFNDSTAIGTFAA  299

Query  1519  MEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQP  1340
             M+KGIFVS +AGN GP +GSL N APW+LTVGAS +DR   AT  LGN Q+F GET FQP
Sbjct  300   MQKGIFVSCAAGNSGPVHGSLVNGAPWILTVGASNIDRSFVATAKLGNGQEFDGETVFQP  359

Query  1339  KDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKN  1160
              DF+ + L L + G+N   E++  +C + SL + D RGK+V+C  GG + R  KGE VK 
Sbjct  360   SDFSPTPLFLRYAGKNGKQEAA--FCANGSLNDFDFRGKVVLCERGGGIGRIAKGEEVKR  417

Query  1159  ASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITG  980
             A G  MIL+  E  G + SA  HVLPA  ++Y  G +I AYIN+T+ P+AT  FKGTI G
Sbjct  418   AGGTAMILMNDESNGFSLSADVHVLPATHVSYDAGLQIKAYINSTATPIATILFKGTIIG  477

Query  979   DKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSM  800
             +  +P V++FSSRGPN  SPGILKPDI+GPGV+ILA WP  ++N  +SKSTFNI+SGTSM
Sbjct  478   NSLSPAVSSFSSRGPNLPSPGILKPDIVGPGVDILAAWPFPLNNNTHSKSTFNIMSGTSM  537

Query  799   SCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHV  620
             SCPHLSGVAALLKSSHP WSPA IKSA+MT+A+ILN     I ++ L TA VF+ G+GHV
Sbjct  538   SCPHLSGVAALLKSSHPHWSPAAIKSAIMTSAEILNFEHKLIVDETLHTADVFATGSGHV  597

Query  619   NPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFS  440
             NPS+ANDPGLVYD   +DY+PYLCGL Y++ EVG+I    V CS   SIPE QLNYPSFS
Sbjct  598   NPSRANDPGLVYDITADDYIPYLCGLGYSDTEVGIIAHRTVKCSQTPSIPEGQLNYPSFS  657

Query  439   IILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSL  260
             + L S  + +TRTVTNVGEA+S Y V +  P GV V V+P +L FS+ NQK TY+V+FS 
Sbjct  658   VSLGS-PKIFTRTVTNVGEANSSYEVTVKPPEGVDVKVKPNKLYFSEANQKETYSVSFSR  716

Query  259   SSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
                 A +      QG L+W S +H V SPI    V
Sbjct  717   ID--AGNETVEYAQGFLKWVSSEHTVSSPILVYFV  749



>gb|EYU39036.1| hypothetical protein MIMGU_mgv1a026993mg [Erythranthe guttata]
Length=745

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/756 (58%), Positives = 539/756 (71%), Gaps = 25/756 (3%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIA----------SKLETYIVRVELPHsristqsssssSVDLE  2237
             L MF+   + + F S   IA          S L+TYIVRV LP  R+   S       LE
Sbjct  3     LIMFIFYVICMLFSSPLVIADDITIEIPTKSNLQTYIVRVNLPRGRVLADSDK-----LE  57

Query  2236  HWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILP  2057
              WY SFLP          +R+V  YRNV  GFAAKLS EE KEM   +GFI+A P++ L 
Sbjct  58    SWYTSFLPAREEAD---SARLVHSYRNVATGFAAKLSPEEAKEMEKMEGFITARPQKKLS  114

Query  2056  LHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVC  1877
             LHTTHSP FLGL QN+G W+ S+YG+GVIIG+LD+GIA  HPSF D+ MPPPP +WKG C
Sbjct  115   LHTTHSPSFLGLHQNLGLWKSSNYGEGVIIGLLDTGIAPGHPSFDDKDMPPPPKKWKGKC  174

Query  1876  ELNFTACNNKVIGARSFSERERS--VFdddghgthtagtaaGNFVRGANVYGSANGTAAG  1703
             E    ACNNK+IGARSF     +    D++GHGTHTAGTAAGNFV GANV+G ANGTAAG
Sbjct  175   EFTGAACNNKLIGARSFISDGPAGPPVDEEGHGTHTAGTAAGNFVPGANVFGMANGTAAG  234

Query  1702  VAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYS  1523
             +AP AHLA+YKVC+E GC D++ILAAMDTA++DGVD+LSLSLGG S  F +D IA+GA++
Sbjct  235   MAPRAHLAVYKVCSEDGCGDADILAAMDTAVDDGVDVLSLSLGGGSFDFFDDVIAVGAFA  294

Query  1522  AMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQ  1343
             A++KGIFVS SAGN GPFN SLSNEAPW+LTVGAST DR++ AT VLGN+  + GE+ FQ
Sbjct  295   AIQKGIFVSCSAGNSGPFNASLSNEAPWILTVGASTTDRRILATTVLGNKDVYTGESLFQ  354

Query  1342  PKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVK  1163
             P +F    + L+  G   ++ +    C   SL + DV+GKIV+C  GG + R  KG+ VK
Sbjct  355   PSNFPYESMPLIDAGAGGNETAG--LCGPGSLDDTDVKGKIVLCQRGGGVARIEKGQTVK  412

Query  1162  NASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTIT  983
             +A G  MIL+  E     T A  HVLPA  ++Y  G+KI AYIN++S P A  +F+GT+ 
Sbjct  413   DAGGAAMILMNDELDAYDTVADPHVLPATHVSYDAGEKIRAYINSSSTPWAAITFQGTVI  472

Query  982   GDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTS  803
              + +APTVA+FSSRGP+  SPGILKPDIIGPGV+ILA WP SVDN  N  +TFN+ISGTS
Sbjct  473   ANPSAPTVASFSSRGPSLASPGILKPDIIGPGVSILAAWPVSVDNNTNENATFNMISGTS  532

Query  802   MSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGH  623
             MSCPHLSG+AALLKS+HPDWSPA IKSA+MTTA  L+    PI+++  + A VF++GAGH
Sbjct  533   MSCPHLSGIAALLKSTHPDWSPAAIKSAIMTTAGQLDLEGGPIEDERHLPADVFALGAGH  592

Query  622   VNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSF  443
             VNPS ANDPGLVYD +PEDY+PYLCGL YT+ E+  I+Q  V+CS + S+PE QLNYPSF
Sbjct  593   VNPSSANDPGLVYDLQPEDYIPYLCGLGYTDDEIRTIVQQSVSCSNITSVPEVQLNYPSF  652

Query  442   SIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFS  263
             S+ L    +TYTRTVTNVGEA+S Y+VE+    GV V V P  L F+KVNQK+TY + FS
Sbjct  653   SVKLGPATKTYTRTVTNVGEANSTYSVEVNRVKGVDVGVTPGTLSFTKVNQKMTYEIKFS  712

Query  262   LSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
              SS    +     VQGA+ W+S K  VRSPI+ KLV
Sbjct  713   KSSTRVNATF---VQGAIVWRSEKRAVRSPISVKLV  745



>ref|XP_004300738.1| PREDICTED: subtilisin-like protease SDD1-like [Fragaria vesca 
subsp. vesca]
Length=745

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/754 (54%), Positives = 526/754 (70%), Gaps = 21/754 (3%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFL  2216
             + FL +  +LS   G      I S L+TYIV V  P  R+   +      DLE W+KSFL
Sbjct  4     IPFLTLIFMLSFSHGIAQKTEI-SPLQTYIVHVMQPEGRVFAATE-----DLESWHKSFL  57

Query  2215  PTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSP  2036
             P+  A     ++R+++ Y+ V+ GF+A+L+ EEVK M   DGF++A PER+    TTH+P
Sbjct  58    PSMTASSD-DQTRLLYSYKTVISGFSARLTQEEVKVMELMDGFVAAHPERVFRRKTTHTP  116

Query  2035  GFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTAC  1856
              FLGL +  G W+DS++GKGVIIGVLD G+   HPSFS  G+PPPPA+WKG C+ N + C
Sbjct  117   NFLGLNRQAGIWKDSNFGKGVIIGVLDGGVFPSHPSFSGAGIPPPPAKWKGRCDFNVSEC  176

Query  1855  NNKVIGARSFS--------ERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGV  1700
             NNK+IGA+SF+         +     D+DGHGTHTA TA G FV+ A+V G+A GTA G+
Sbjct  177   NNKLIGAQSFNLAAMALKGAKAEPPIDEDGHGTHTASTAGGAFVQNADVLGNAKGTAVGM  236

Query  1699  APLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSA  1520
             AP AHLAIYKVC    C +S+ILAA++ A+ DGVD++S+SLG  S  F +DS A+G+++A
Sbjct  237   APYAHLAIYKVCFGEPCPESDILAALEAAVHDGVDVISISLGEDSVPFFQDSTAIGSFAA  296

Query  1519  MEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQP  1340
             ++KGIFVS +AGN GPFNG++SNEAPW+LTVGAST+DR++ A+  LGN   F GE+ FQP
Sbjct  297   IQKGIFVSCAAGNSGPFNGTISNEAPWILTVGASTLDRRIVASAALGNGLVFDGESLFQP  356

Query  1339  KDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKN  1160
             KDF S+LL LV+ G     ES+  +C   SL+N  V+GK+VVC  GG + R  KG  VKN
Sbjct  357   KDFPSTLLPLVYAGVIGKVESA--FCAEGSLKNISVKGKVVVCERGGGIGRIDKGVEVKN  414

Query  1159  ASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITG  980
             A G  MIL+  E  G +TSA AHVLPA  +T+A G  I AYIN+T+ P AT  FKGT+ G
Sbjct  415   AGGAAMILLNAETDGFSTSADAHVLPAAHVTHAAGLNIKAYINSTATPTATILFKGTVIG  474

Query  979   DKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSM  800
             D  +P VA+FSSRGPN  SPGILKPDIIGPGVN+LA WP  +DN   + STFNIISGTSM
Sbjct  475   DSTSPAVASFSSRGPNLASPGILKPDIIGPGVNVLAAWPFPLDNNTKAASTFNIISGTSM  534

Query  799   SCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHV  620
             SCPHLSG+AALLKSSHP WSPA IKSA+MT+AD++N     I ++ L  A V + GAGHV
Sbjct  535   SCPHLSGIAALLKSSHPYWSPAAIKSAIMTSADLINLQGKLIFDETLQPADVLATGAGHV  594

Query  619   NPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFS  440
             NPSKA DPGLVYD +P+DY+PYLCGL Y + EV ++    + CS V SIPE +LNYPSFS
Sbjct  595   NPSKATDPGLVYDIQPDDYIPYLCGLGYKDSEVSILAHRPITCSKVSSIPEGELNYPSFS  654

Query  439   IILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSL  260
             + L   +QT+TRTVTNVG   S Y+V++  P GV V V+P  L F+K+NQK++Y+VTFS 
Sbjct  655   VKL-GPSQTFTRTVTNVGAPYSTYSVKVNAPQGVYVTVKPSTLYFTKMNQKMSYSVTFSH  713

Query  259   SSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
              S     +     QG + W S KH VRSP++  L
Sbjct  714   GSGGKAGSF---TQGFITWASAKHIVRSPVSVLL  744



>ref|XP_008238729.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=758

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/736 (57%), Positives = 535/736 (73%), Gaps = 23/736 (3%)
 Frame = -1

Query  2329  ASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGG-YGESRMVFMYRNV  2153
             ++ ++TYIV V+ P S+  +  S     DLE WY+SFLP T A      + RMV+ Y NV
Sbjct  27    SNDMQTYIVWVQKPASQKFSAESHE---DLESWYQSFLPETDANSNQLTKQRMVYAYHNV  83

Query  2152  MKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGV  1973
               GFAA+L+ EEVK M   +GF+SA PE+ILP+ TTHSP FLGL Q  G W  ++YG+GV
Sbjct  84    ATGFAARLTPEEVKTMETIEGFVSARPEKILPVQTTHSPDFLGLHQGFGLWEATNYGEGV  143

Query  1972  IIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF------SERER  1811
             IIG+LD+GI  DHPSFSDEGMPPPPA+WKG CE N T CNNK+IGAR+F           
Sbjct  144   IIGLLDTGITPDHPSFSDEGMPPPPAKWKGKCEFNGTLCNNKLIGARNFMGVGKGQPPPG  203

Query  1810  SVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEIL  1631
               FD DGHGTHT+ TAAG FV GA+V+G ANGTAAG+AP AHLA+YKVC+  GC++++IL
Sbjct  204   PPFDIDGHGTHTSSTAAGRFVEGASVFGQANGTAAGMAPKAHLAVYKVCSGFGCAEADIL  263

Query  1630  AAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSN  1451
             AA+D A++DGVD+LSLSLGG S  F++D IA+GA++A++KGIF S +AGN GPFN SLSN
Sbjct  264   AALDVAVDDGVDVLSLSLGGPSLPFYKDVIAIGAFAAIQKGIFFSCAAGNFGPFNHSLSN  323

Query  1450  EAPWMLTVGASTVDRKLSATVVLGNRQ--QFHGETAFQPKDFNSSL---LSLVFPGQNTS  1286
             EAPW+LTVGAST DR L +   +G+ +   F G++  QP+DF+S++   L LV+ G   +
Sbjct  324   EAPWILTVGASTTDRILKSEAQIGDNKNNHFDGKSLSQPQDFDSTVSLPLPLVYAGSVGA  383

Query  1285  DESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITT  1106
               S+  +C   +L N  V GKIV+C TGG +    KGE VK A G  MIL+  E  G +T
Sbjct  384   QPSA--FCKEGTLEN--VEGKIVLCETGGGVTNIAKGEEVKRAGGAAMILMNQETDGFST  439

Query  1105  SATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRE  926
              A +H LP   ++YA G +I +YI++TS+P AT  F GT+ GD  AP VA FSSRGPN+ 
Sbjct  440   LAESHALPTTHVSYAAGLQIKSYISSTSSPTATILFNGTVIGDALAPRVAFFSSRGPNKA  499

Query  925   SPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPD  746
             SPGILKPDIIGPGV+ILA WP SVDN   SK+TFNIISGTSM+CPHLSG+AAL+KSSHPD
Sbjct  500   SPGILKPDIIGPGVDILAAWPVSVDNATQSKATFNIISGTSMACPHLSGIAALVKSSHPD  559

Query  745   WSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPED  566
             WSPA IKSA+MTTAD+LN    PI +Q    A+VF++GAGHVNPSKANDPGL+YDT+PED
Sbjct  560   WSPAAIKSAIMTTADVLNLAGMPIVDQDQKPANVFAMGAGHVNPSKANDPGLIYDTQPED  619

Query  565   YLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL---ESTAQTYTRTVT  395
             Y+PYLCGLNYT++E+ +I Q +VNCS V  IPEAQLNYPSFSI +   ES +Q YTRTV 
Sbjct  620   YIPYLCGLNYTDKEIQIITQQKVNCSQVEVIPEAQLNYPSFSIKIGSNESQSQYYTRTVR  679

Query  394   NVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQG  215
             NVG AS+ Y +++  P  + ++V P  L F++VNQ++T++V F     A +  +    QG
Sbjct  680   NVGPASTTYNLDLLVPHKMGMSVNPGVLTFTEVNQEITFHVEFIAQDGAGKDGV-AFGQG  738

Query  214   ALRWKSVKHHVRSPIA  167
              LRW S KH+V SPIA
Sbjct  739   YLRWVSDKHNVTSPIA  754



>gb|KHN09747.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=689

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/684 (58%), Positives = 498/684 (73%), Gaps = 12/684 (2%)
 Frame = -1

Query  2185  ESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMG  2006
             + RM++ YRNVM GFAA+L+ EE++ M  K+GFISA PER+L   TT++P FLGLQ+  G
Sbjct  11    QPRMIYSYRNVMSGFAARLTEEELRTMEKKNGFISARPERMLHCLTTNTPQFLGLQKQTG  70

Query  2005  FWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF  1826
              W++S++GKG+IIGVLDSGI   HPSFSD GMPPPP +WKG CE+N TACNNK+IG R+F
Sbjct  71    LWKESNFGKGIIIGVLDSGITPGHPSFSDAGMPPPPPKWKGRCEINVTACNNKLIGVRAF  130

Query  1825  SERER------SVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVC  1664
             +  E+      +  D+DGHGTHTA TAAG FV  A + G+A GTAAG+AP AHLAIY+VC
Sbjct  131   NLAEKLAKGAEAAIDEDGHGTHTASTAAGAFVDHAELLGNAKGTAAGIAPYAHLAIYRVC  190

Query  1663  NEIGCSDSEILAAMDTAIEDGVD-IlslslggmssSFHEDSIALGAYSAMEKGIFVSASA  1487
                 C +S+ILAAMD A+EDGVD I          S  +DS A+GA++AM+KGIFVS +A
Sbjct  191   FGKDCHESDILAAMDAAVEDGVDVISISLGSHTPKSIFDDSTAIGAFAAMQKGIFVSCAA  250

Query  1486  GNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLV  1307
             GN GPF+GSL N APW+LTVGAS +DR ++AT  LGN Q+F GE+ FQP DF+ +LL L 
Sbjct  251   GNSGPFHGSLINGAPWVLTVGASNIDRSIAATAKLGNGQEFDGESVFQPSDFSPTLLPLA  310

Query  1306  FPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEP  1127
             + G+N   E++  +C + SL ++D RGK+V+C  GG + R  KGE VK   G  MIL+  
Sbjct  311   YAGKNGKQEAA--FCANGSLNDSDFRGKVVLCERGGGIGRIPKGEEVKRVGGAAMILMND  368

Query  1126  EEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFS  947
             E  G +  A  HVLPA  ++Y  G KI AYIN+T+ P+AT  FKGTI G+  AP V +FS
Sbjct  369   ESNGFSVLADVHVLPATHVSYDAGLKIKAYINSTAIPIATILFKGTIIGNSLAPAVTSFS  428

Query  946   SRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAAL  767
             SRGPN  SPGILKPDIIGPGVNILA WP  ++N  +SKSTFN +SGTSMSCPHLSG+AAL
Sbjct  429   SRGPNLPSPGILKPDIIGPGVNILAAWPFPLNNDTDSKSTFNFMSGTSMSCPHLSGIAAL  488

Query  766   LKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLV  587
             LKSSHP WSPA IKSA+MT+ADI+N  +  I ++ L  A VF+ G+GHVNPS+ANDPGLV
Sbjct  489   LKSSHPHWSPAAIKSAIMTSADIINFERKLIVDETLHPADVFATGSGHVNPSRANDPGLV  548

Query  586   YDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYT  407
             YD +P+DY+PYLCGL Y++ +VG+I    + CS   SIPE +LNYPSFS++L S  QT+T
Sbjct  549   YDIQPDDYIPYLCGLGYSDTQVGIIAHKTIKCSETSSIPEGELNYPSFSVVLGS-PQTFT  607

Query  406   RTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPP  227
             RTVTNVGEA+S Y V +  P GV+V V+P +L FS+ NQK TY+VTFS       +    
Sbjct  608   RTVTNVGEANSSYVVMVMAPEGVEVRVQPNKLYFSEANQKDTYSVTFSRIKSGNETVK--  665

Query  226   VVQGALRWKSVKHHVRSPIAAKLV  155
              VQG L+W S KH VRSPI+   V
Sbjct  666   YVQGFLQWVSAKHIVRSPISVNFV  689



>dbj|BAF95753.1| subtilase [Lotus japonicus]
Length=755

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/706 (57%), Positives = 506/706 (72%), Gaps = 17/706 (2%)
 Frame = -1

Query  2245  DLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPER  2066
             DLE WY SFLP T+      + R+++ Y+NV++GFAA L+ EE+  +  K+GFISA P+R
Sbjct  58    DLESWYHSFLPPTLMSSEE-QPRVIYSYKNVLRGFAASLTQEELSAVEKKNGFISAHPQR  116

Query  2065  ILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWK  1886
             +L   TTH+P FLGLQQ+ G W++S++GKGVIIGVLDSGI   HPSFSD G+PPPP +WK
Sbjct  117   VLHRQTTHTPKFLGLQQDTGVWKESNFGKGVIIGVLDSGITPGHPSFSDVGIPPPPPKWK  176

Query  1885  GVCELNFTACNNKVIGARSFS--------ERERSVFdddghgthtagtaaGNFVRGANVY  1730
             G C+LN TACNNK+IGAR+F+        ++  +  D+DGHGTHTA TAAG FV  A V 
Sbjct  177   GRCDLNVTACNNKLIGARAFNLAAEAMNGKKAEAPIDEDGHGTHTASTAAGAFVNYAEVL  236

Query  1729  GSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVD-IlslslggmssSFH  1553
             G+A GTAAG+AP AHLAIYKVC    C +S+ILAA+D A+EDGVD I           F 
Sbjct  237   GNAKGTAAGMAPHAHLAIYKVCFGEDCPESDILAALDAAVEDGVDVISISLGLSEPPPFF  296

Query  1552  EDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNR  1373
              DS A+GA++AM+KGIFVS +AGN GPFN S+ N APW+LTVGAST+DR++ AT  LGN 
Sbjct  297   NDSTAIGAFAAMQKGIFVSCAAGNSGPFNSSIVNAAPWILTVGASTIDRRIVATAKLGNG  356

Query  1372  QQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFL  1193
             Q+F GE+ FQP  F  +LL L + G+N  +ES+  +C + SL ++  RGK+V+C  GG +
Sbjct  357   QEFDGESVFQPSSFTPTLLPLAYAGKNGKEESA--FCANGSLDDSAFRGKVVLCERGGGI  414

Query  1192  DRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPM  1013
              R  KGE VK A G  MIL+  E    + SA  H LPA  ++YA G +I AYIN+T+ P 
Sbjct  415   ARIAKGEEVKRAGGAAMILMNDETNAFSLSADVHALPATHVSYAAGIEIKAYINSTATPT  474

Query  1012  ATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSK  833
             AT  FKGT+ G+  AP VA+FSSRGPN  SPGILKPDIIGPGVNILA WP  + N  +SK
Sbjct  475   ATILFKGTVIGNSLAPAVASFSSRGPNLPSPGILKPDIIGPGVNILAAWPFPLSNSTDSK  534

Query  832   STFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVT  653
              TFNI SGTSMSCPHLSG+AALLKSSHP WSPA IKSA+MT+AD +N G   I ++ L  
Sbjct  535   LTFNIESGTSMSCPHLSGIAALLKSSHPHWSPAAIKSAIMTSADTINLGNKLIVDETLQP  594

Query  652   ASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISI  473
               +F+ G+GHVNPS+ANDPGLVYD +P+DY+PYLCGL Y+  EVG+I   ++ CSA  SI
Sbjct  595   TDLFATGSGHVNPSRANDPGLVYDIQPDDYIPYLCGLGYSETEVGIIAHRKIKCSA--SI  652

Query  472   PEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVN  293
             PE +LNYPSFS+ L S+ +T+TRTVTNVGEA S Y + +  P GV V V+P +L FS+VN
Sbjct  653   PEGELNYPSFSVELGSS-KTFTRTVTNVGEAHSSYDLIVAAPQGVDVKVQPYKLNFSEVN  711

Query  292   QKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
             QK TY+VTFS +    ++      QG L+W S KH VRSPI+ K +
Sbjct  712   QKETYSVTFSRTGLGNKTQ--EYAQGFLKWVSTKHTVRSPISVKFI  755



>ref|XP_003611201.1| Subtilisin-like serine protease [Medicago truncatula]
Length=756

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/761 (56%), Positives = 525/761 (69%), Gaps = 37/761 (5%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIAS------------KLETYIVRVELPHsristqsssssSVD  2243
             +++ L++S++   CS   I S             L TYIV     H + S   +S  S D
Sbjct  8     MQLSLLVSLIFILCSFNQITSVFAAEENQEHDHNLMTYIV-----HVKKSENVASFQSED  62

Query  2242  LEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERI  2063
             L  WY SFLP         + RMVF YR+V  GFA KL+ EE K +  KDG + A PER 
Sbjct  63    LHSWYHSFLPQNFPH----KDRMVFSYRHVASGFAVKLTPEEAKSLQEKDGILLARPERT  118

Query  2062  LPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKG  1883
             L LHTTHSP FLGL+   G W D + GKGVIIGV+DSGI   HPSF+DEGMPPPPA+WKG
Sbjct  119   LSLHTTHSPTFLGLKHGQGLWNDDNLGKGVIIGVIDSGIFPSHPSFNDEGMPPPPAKWKG  178

Query  1882  VCELN-FTACNNKVIGARSF--SERERSVFdddghgthtagtaaGNFVRGANVYGSANGT  1712
              CE N    CNNK+IGARS   S  +   F++  HGTHTA  AAG F++ A+V+G+A G 
Sbjct  179   HCEFNGMKICNNKLIGARSLVKSTIQEPPFENIFHGTHTAAEAAGRFIKDASVFGNAKGV  238

Query  1711  AAGVAPLAHLAIYKVCNE-IGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIAL  1535
             AAG+AP AHLAIYKVCN+ I C +S ILAAMD AIEDGVD+LSLSLG  S  F ED IA+
Sbjct  239   AAGMAPNAHLAIYKVCNDKIECPESAILAAMDIAIEDGVDVLSLSLGLGSLPFFEDPIAI  298

Query  1534  GAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGE  1355
             GA++A + GIFVS SA N GP   +LSNEAPW+LTVGAST+DRK+ A+  LGN +++ GE
Sbjct  299   GAFAATQNGIFVSCSAANSGPEYSTLSNEAPWILTVGASTIDRKIVASAKLGNGEEYEGE  358

Query  1354  TAFQPKDFNSSLLSLVFPG-----QNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLD  1190
             T FQPKDF   L  LV+ G       T ++S    C   SL+N D+ GK+V+C  G  + 
Sbjct  359   TLFQPKDFPQQLFPLVYAGSLGYGNQTQNQS---LCLPGSLKNIDLSGKVVLCDIGEDVS  415

Query  1189  RRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMA  1010
                KG+ V NA+G  +IL+  E  G +T ATAHVLPA++++YA G  I  YIN+T NP A
Sbjct  416   TFVKGQEVLNANGVAVILVNSESDGFSTFATAHVLPAVEVSYAAGLTIKDYINSTYNPTA  475

Query  1009  TFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKS  830
             T  FKGT+ GD  AP+V +FSSRGP+++SPGILKPDIIGPGVNILA WP S+DNK     
Sbjct  476   TLLFKGTVIGDSLAPSVVSFSSRGPSQQSPGILKPDIIGPGVNILAAWPVSIDNK---TP  532

Query  829   TFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTA  650
              F I SGTSMSCPHLSG+AAL+KSSHPDWSPA IKSA+MTTA+ LN G  PI +Q L  A
Sbjct  533   PFAITSGTSMSCPHLSGIAALIKSSHPDWSPAAIKSAIMTTANTLNLGGIPILDQRLSPA  592

Query  649   SVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIP  470
              VF+ GAGHVNP KANDPGLVYD +PEDY+PYLCGL YT++E+ +I Q  VNCS V SIP
Sbjct  593   DVFATGAGHVNPVKANDPGLVYDIQPEDYVPYLCGLGYTDQEIELIAQWVVNCSNVKSIP  652

Query  469   EAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQ  290
             EAQL+YPSFSI+L S +Q YTRT+TNVG A+S Y VE+  P    ++V P E+ FS+V++
Sbjct  653   EAQLSYPSFSILLGSDSQYYTRTLTNVGLANSTYRVELEVPLAFGMSVNPSEITFSEVDE  712

Query  289   KLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             K++Y+V F   +K +R N     QG+L W S KH VR PI+
Sbjct  713   KVSYSVDFIPKTKESRGNN-TYAQGSLTWVSDKHAVRIPIS  752



>ref|XP_002509667.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF51054.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=753

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/719 (58%), Positives = 515/719 (72%), Gaps = 18/719 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S LE YI+ +E P  ++           LE WY+SFLP         +SR++  YR+V+ 
Sbjct  48    STLEIYIILLEKPQGKVFRDFE-----HLESWYRSFLPENTFRSN--KSRLLHSYRHVVT  100

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAAKL+AEEV  M  K+GF++A P  ++ LHTTH+P FLGLQQN+GFW  S+YGKGVII
Sbjct  101   GFAAKLTAEEVNSMEYKEGFVTALPGSLVRLHTTHTPSFLGLQQNLGFWNYSNYGKGVII  160

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVFdddgh  1787
             G++DSGI  DHPSFS EGMP PPARWKG CE N T CNNK+IGAR+F+   +   D+  H
Sbjct  161   GLVDSGITPDHPSFSSEGMPLPPARWKGKCEYNETLCNNKIIGARNFNMDSKDTSDEYNH  220

Query  1786  gthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIE  1607
             GTHTA  AAG+ V+G N +G ANGTA+GVAPLAHLA+YK+ NE   + SEILAA+D AI+
Sbjct  221   GTHTASIAAGSPVQGVNFFGQANGTASGVAPLAHLAMYKISNE--ATTSEILAAIDAAID  278

Query  1606  DGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTV  1427
             DGVD+LSLS+G  S  F++D IA+ AY+A+ KGIFVS+SAGNEG   G LSNEAPWMLTV
Sbjct  279   DGVDVLSLSIGIDSHPFYDDVIAIAAYAAIRKGIFVSSSAGNEGKDKGPLSNEAPWMLTV  338

Query  1426  GASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESL  1247
             GASTVDR + ATV+LGN  + +GE+ FQPKDF S++L LV+ G+N +  S+S  C   SL
Sbjct  339   GASTVDRTIRATVLLGNNTELNGESLFQPKDFPSTMLPLVYAGENGNALSAS--CMPGSL  396

Query  1246  RNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDIT  1067
             +N DVRGKIV+C  G   D   KGE VK   G  MI++  +  G   SA  HVLPA  ++
Sbjct  397   KNVDVRGKIVLCERGSAHDMIFKGEVVKRNGGVAMIVMNGQSDGFIISADLHVLPASHVS  456

Query  1066  YADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPG  887
                G  I AYIN+TS+P+ T  F+GT+TG   AP VA FSSRGP++ SPGILKPDIIGPG
Sbjct  457   CMAGLAIKAYINSTSSPIGTILFEGTVTGLPEAPQVAEFSSRGPSKASPGILKPDIIGPG  516

Query  886   VNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTT  707
             VNILA WP S +  PN    FN+ SGTSMSCPHLSG+AALLKS+HPDWSPA IKSA+MTT
Sbjct  517   VNILAAWPVSEEEAPNR---FNMKSGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIMTT  573

Query  706   ADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNR  527
             A++ N    PI +Q  V A+ F IGAGHVNPS+AN+PGL+YD +P+DYLPYLCGL Y+N+
Sbjct  574   ANVFNLDGKPITDQQFVPATYFDIGAGHVNPSRANEPGLIYDIQPDDYLPYLCGLGYSNK  633

Query  526   EVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEP  347
             +VGVI Q RVNCS  +S+PEAQLNYPSFS+ L S+ QT  RTVTNVG+ +S Y +E F P
Sbjct  634   QVGVITQRRVNCSKNLSMPEAQLNYPSFSVKLGSSPQTCARTVTNVGKPNSSYILETFAP  693

Query  346   PGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPI  170
              GV V V P ++ F+ +NQK TY + FS     + S      QG L W +  + VRSPI
Sbjct  694   RGVDVKVTPNKITFTGLNQKATYTIAFSKMGNTSVS----FAQGYLNWVADGYSVRSPI  748



>gb|EYU39028.1| hypothetical protein MIMGU_mgv1a002635mg [Erythranthe guttata]
Length=651

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/654 (63%), Positives = 482/654 (74%), Gaps = 8/654 (1%)
 Frame = -1

Query  2107  MGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPS  1928
             M +  GFISA PER L +HTTHSP FLGL QNMGFW+ S+YGKGVIIGVLDSGI   HPS
Sbjct  1     MESNPGFISAEPERKLDMHTTHSPNFLGLNQNMGFWQGSNYGKGVIIGVLDSGIFPSHPS  60

Query  1927  FSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVFdddghgthtagtaaGNFV  1748
             FSDEGMPPPPA+WKG CE N T CNNK+IGAR  +  + S  DD GHGTHTA TAAG+FV
Sbjct  61    FSDEGMPPPPAKWKGKCEFNPTVCNNKIIGARYLNFFDGSPLDDGGHGTHTASTAAGSFV  120

Query  1747  RGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggm  1568
               ANV+G+ANGTA+G+APLAHLAIYKVC+ I C +S ILAAMD AIEDGVDILSLSLGG 
Sbjct  121   ASANVFGNANGTASGIAPLAHLAIYKVCSSI-CLESNILAAMDAAIEDGVDILSLSLGGP  179

Query  1567  ssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATV  1388
             S  F+ DSIALGA+SAM+KGI VS SAGN GPFN S+ NEAPW+LTVGAST+DRK+ AT 
Sbjct  180   SRDFYLDSIALGAFSAMKKGILVSCSAGNSGPFNFSMENEAPWILTVGASTIDRKIRATA  239

Query  1387  VLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCM  1208
             +LGN     GET FQP DF S+L  LV+ G   + +    YC   SL   D+RG IVVC 
Sbjct  240   LLGNNISVDGETLFQPSDFPSTLFPLVYAGSLNTSDPHIQYCTRASLNKTDLRGMIVVCE  299

Query  1207  TGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINA  1028
              G   D   KG  VKNA G  MIL+    Y   T + AHVLP   + Y DG KI  YIN+
Sbjct  300   MG-LGDGVSKGVEVKNAGGAAMILVNHWLYANMTLSYAHVLPTTHVGYVDGLKIKTYINS  358

Query  1027  TSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDN  848
             T+ PMA   FKGTI GD  AP VAAFSSRGPN  SPGILKPDIIGPGVNILA WP S++N
Sbjct  359   TTTPMAAILFKGTIIGDDRAPVVAAFSSRGPNIASPGILKPDIIGPGVNILAAWPVSIEN  418

Query  847   KPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQN  668
               N+ +TFNIISGTSMSCPHLSGVAALLKS+HPDWSPA IKSA+MTTAD++N  QNPI++
Sbjct  419   NTNTNATFNIISGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIMTTADVVNLAQNPIED  478

Query  667   QHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCS  488
             +  V A++F+ G+GHVNPS+ANDPGL+YD K EDY PYLCGLNYTN +V +I+Q +V+CS
Sbjct  479   ERFVPAALFATGSGHVNPSRANDPGLIYDLKSEDYFPYLCGLNYTNLQVSIIMQKKVDCS  538

Query  487   AVISIPEAQLNYPSFSII---LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPR  317
                 I EAQLNYPSF+I    L+   QTYTRTVTNVGE  S Y VEI  PPG+ V VEP 
Sbjct  539   VEARISEAQLNYPSFAITFGPLQPITQTYTRTVTNVGEPVSSYVVEIVPPPGIGVVVEPT  598

Query  316   ELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKS-VKHHVRSPIAAKL  158
              L F++ N  L Y VTF  +   + +N    +QG L+W S  K+ VR+PIA  L
Sbjct  599   SLDFTEANPILQYQVTF--TRLGSTTNNAGYIQGYLKWNSGAKYSVRTPIAVIL  650



>ref|XP_003538510.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=748

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/728 (56%), Positives = 522/728 (72%), Gaps = 22/728 (3%)
 Frame = -1

Query  2332  IASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNV  2153
             I + L+TYIV V+ P +    QS      +L +WY SFLP T       ++RMVF YRNV
Sbjct  33    INNNLQTYIVHVKKPETISFLQSE-----ELHNWYYSFLPQTTH-----KNRMVFSYRNV  82

Query  2152  MKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGV  1973
               GFA KL+ EE K +  KD  +SA PER L LHTTH+P FLGL+Q +G W  S+ G+GV
Sbjct  83    ASGFAVKLTPEEAKVLQEKDEIVSARPERTLSLHTTHTPSFLGLRQGVGLWNSSNLGEGV  142

Query  1972  IIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT-ACNNKVIGARSFSER--ERSVF  1802
             IIGV+D+GI   HPSF+DEG+PPPPA+W G CE      CNNK+IGAR+  +   E   F
Sbjct  143   IIGVIDTGIYPFHPSFNDEGIPPPPAKWNGHCEFTGQRTCNNKLIGARNLLKNAIEEPPF  202

Query  1801  dddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCN-EIGCSDSEILAA  1625
             ++  HGTHTA  AAG FV  A+V+G A GTA+G+AP +H+A+YKVCN E+GC++S ILAA
Sbjct  203   ENFFHGTHTAAEAAGRFVENASVFGMAQGTASGIAPNSHVAMYKVCNDEVGCTESAILAA  262

Query  1624  MDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEA  1445
             MD AI+DGVD+LSLSLG  S  F ED IA+GA+ A++ G+FVS SA N GP   +LSNEA
Sbjct  263   MDIAIDDGVDVLSLSLGLGSLPFFEDPIAIGAFVAIQSGVFVSCSAANSGPDYSTLSNEA  322

Query  1444  PWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPY  1265
             PW+LTVGAST+DRK++A+ VLGN  ++ GE+ FQP+DF+ SLL LV+ G N ++ S   +
Sbjct  323   PWILTVGASTIDRKIAASAVLGNGAEYEGESLFQPQDFSPSLLPLVYSGANGNNNSE--F  380

Query  1264  CDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVL  1085
             C   SL N DV+GK+VVC  GG     GKG+ V  A G  MIL  PE  G +T A A+VL
Sbjct  381   CLPGSLNNVDVKGKVVVCDIGGGFPSVGKGQEVLKAGGAAMILANPEPLGFSTFAVAYVL  440

Query  1084  PAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKP  905
             P ++++Y  G  I +YIN++ +P AT SFKGT+ GD+ APTV +FSSRGP++ SPGILKP
Sbjct  441   PTVEVSYFAGLAIKSYINSSYSPTATISFKGTVIGDELAPTVVSFSSRGPSQASPGILKP  500

Query  904   DIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIK  725
             DIIGPGVNILA W  SVDNK      +N++SGTSMSCPHLSGVAALLKS+HPDWSPA IK
Sbjct  501   DIIGPGVNILAAWAVSVDNK---IPAYNVVSGTSMSCPHLSGVAALLKSAHPDWSPAAIK  557

Query  724   SAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCG  545
             SA+MTTA  +N G  PI +Q  + A +F+ GAGHVNP+KANDPGLVYD +PEDY+PYLCG
Sbjct  558   SAIMTTAYTVNLGGTPIVDQRNLPADIFATGAGHVNPNKANDPGLVYDIQPEDYVPYLCG  617

Query  544   LNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYT  365
             L Y +RE+ +++Q RV CS   +IPEAQLNYPSFSI++ S++Q YTRT+TNVG A S YT
Sbjct  618   LGYEDREIEILVQRRVRCSGGKAIPEAQLNYPSFSILMGSSSQYYTRTLTNVGPAQSTYT  677

Query  364   VEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSV--K  191
             V++  P  + ++V P ++ F++VNQK+T++V F    K  R N     QG+L W  V  K
Sbjct  678   VQLDVPLALGISVNPSQITFTEVNQKVTFSVEFIPEIKENRGNH-TFAQGSLTWVRVSDK  736

Query  190   HHVRSPIA  167
             H VR PI+
Sbjct  737   HAVRIPIS  744



>ref|XP_011071709.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=1222

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/748 (58%), Positives = 536/748 (72%), Gaps = 20/748 (3%)
 Frame = -1

Query  2380  MFLILSVLIGFCSTATIA-SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTV  2204
               +IL  + G   +  IA S  +TYIV V LP  ++  +S      DLE WY+SFLP   
Sbjct  488   FLMILLWMEGLDRSKFIAQSTRQTYIVHVNLPADQVPGESR-----DLETWYRSFLPEAT  542

Query  2203  AGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLG  2024
             A      SR+   YRNV+ GFAAKLS E+VKEM  K+GF+ A PE++  L TTHSP FLG
Sbjct  543   ANSEE-PSRIRHRYRNVVTGFAAKLSPEDVKEMEKKEGFLHARPEKMYALKTTHSPNFLG  601

Query  2023  LQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKV  1844
             L QN+G W +S YGKGVIIGVLDSGI   HPSF DEG+PPPPARWKG CEL  TACNNK+
Sbjct  602   LYQNLGSWPESDYGKGVIIGVLDSGITPGHPSFDDEGVPPPPARWKGKCELKGTACNNKL  661

Query  1843  IGARSFSERERSV-FdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKV  1667
             IGAR+F+  +     D DGHGTHTA TAAGNFV GANV+G ANG A+G++PLAHLAIYKV
Sbjct  662   IGARNFARDDPGPPIDHDGHGTHTASTAAGNFVSGANVFGQANGVASGLSPLAHLAIYKV  721

Query  1666  CNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASA  1487
             C+E GC +S+ILAA D AIEDGV++LS+S+GG+S+ F+ED IALGA+SAMEKGI VS SA
Sbjct  722   CSEEGCYESDILAAFDAAIEDGVNLLSISIGGISAPFYEDGIALGAFSAMEKGILVSCSA  781

Query  1486  GNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLV  1307
              N+GP   SL NEAPW+LTVGAST+DRK+ AT +LGN++++ G++ +Q  DF ++LL L+
Sbjct  782   NNDGPNYFSLENEAPWILTVGASTIDRKIVATALLGNQEEYDGQSLYQIHDFPATLLPLI  841

Query  1306  FPGQ--NTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILI  1133
               G   N +DE    +C   SL + DV+GK+V+C+ GG + R  KG+ VK+A G  MIL+
Sbjct  842   NAGSQGNKADE----FCAPGSLNDIDVKGKVVLCVRGGGIARIAKGQTVKDAGGAAMILM  897

Query  1132  EPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAA  953
               +     T A AHVLPA  ++YADG+KI AYIN+TSNP AT  FKGT+ GDK AP VA+
Sbjct  898   NDKPDAYDTLADAHVLPAAHVSYADGEKIRAYINSTSNPKATILFKGTVIGDKTAPMVAS  957

Query  952   FSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVA  773
             +SSRGP+  SP ILKPDIIGPG +ILA WP  VDN  N K+TFN+ISGTSM+CPHLSG+A
Sbjct  958   YSSRGPSLASPLILKPDIIGPGSSILAAWPKPVDNTTNVKATFNMISGTSMACPHLSGIA  1017

Query  772   ALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPG  593
             AL+KS HPDWSPAMIKSA+MT+A   N   + I +Q L+ A +F+ GAGHVNP +A DPG
Sbjct  1018  ALIKSVHPDWSPAMIKSAIMTSATQTNLNNSLILDQRLLPADIFATGAGHVNPPRALDPG  1077

Query  592   LVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNC--SAVISIPEAQLNYPSFSIILESTA  419
             LVYD K  DY+ YLC + YT  +V +I+  ++NC  S    +P  QLNYPSF+I L   +
Sbjct  1078  LVYDIKTRDYISYLCYM-YTENQVAIIVNRKINCGGSEYKGVPGPQLNYPSFAIQLGYGS  1136

Query  418   QTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARS  239
             QTY RTVTNVG+A S Y V+I   PGV V VEP+ L FSKVNQK TY V+FS     A  
Sbjct  1137  QTYPRTVTNVGDAKSSYYVQIENVPGVDVTVEPKVLAFSKVNQKKTYTVSFSRQDFTANG  1196

Query  238   NMPPVVQGALRWKSVKHHVRSPIAAKLV  155
             +    VQG++ W SVKH VR P++  LV
Sbjct  1197  SY---VQGSIAWISVKHIVRIPVSVHLV  1221


 Score =   234 bits (598),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 156/306 (51%), Positives = 183/306 (60%), Gaps = 59/306 (19%)
 Frame = -1

Query  2380  MFLILSVLIGFCSTATI------ASKLETYIVRVELPHsristqsssssSVDLEHWYKSF  2219
              FL+L  L+ F    T        + L+TYIV VEL               D E WY SF
Sbjct  5     FFLVLICLLNFHQFLTAENLDSPQNTLQTYIVHVELQSD------------DTESWYNSF  52

Query  2218  LPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHS  2039
             LPT VA     + ++++ YRNV  GFAAKLS ++VK M  K GFISA PE+I PLHTTHS
Sbjct  53    LPTDVAARN-DKPQILYRYRNVFSGFAAKLSVDDVKTMQQKAGFISARPEQIFPLHTTHS  111

Query  2038  PGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA  1859
             P FLGL QN+GFW  S+YGKGVIIGVLD+GI  DHPSF+DEG+ PPPA+WKG C+ +  A
Sbjct  112   PNFLGLNQNLGFWNASNYGKGVIIGVLDTGILPDHPSFNDEGLLPPPAKWKGECQFSSRA  171

Query  1858  CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLA  1679
             CNNK+IGAR F     S  D+DGHGTHTA TAAGNF   AN++                 
Sbjct  172   CNNKLIGARYFRSGSGSPLDEDGHGTHTASTAAGNFAGRANIF-----------------  214

Query  1678  IYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFV  1499
                                    EDGVD+LSLSLGG S  F+ D+IALGAY A EKGIFV
Sbjct  215   -----------------------EDGVDVLSLSLGGPSLPFYIDNIALGAYRATEKGIFV  251

Query  1498  SASAGN  1481
             S SAGN
Sbjct  252   SCSAGN  257


 Score =   227 bits (579),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = -1

Query  745  WSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPED  566
            WSPA IKSA+MTTA   N G NPIQ++  + A +F+ G+GHVNPS+ANDPGL+YD +P D
Sbjct  319  WSPAAIKSAIMTTAYQANLGGNPIQDERFLPADIFATGSGHVNPSRANDPGLIYDIQPND  378

Query  565  YLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVG  386
            Y+PYLCGLNYTN++V +I+Q RV+CS V SIP++QLNYP+FSI+L ST QTYTRTVTNVG
Sbjct  379  YIPYLCGLNYTNQQVSLIVQQRVDCSRVSSIPQSQLNYPAFSIVLGSTPQTYTRTVTNVG  438

Query  385  EASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAA  245
            E  S Y V+I  P GV V VEP +L FS++ QKL+Y VTF+ S++ +
Sbjct  439  EPKSLYNVQIVSPAGVVVKVEPAKLSFSRLGQKLSYRVTFTRSAQTS  485


 Score = 68.6 bits (166),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -1

Query  1177  GEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSF  998
             G  VKNA G  MIL+  E  G TT A AHVLPA  I+YAD  KI AY+N+ S P A   +
Sbjct  256   GNNVKNAGGAAMILLNQEPQGYTTQAEAHVLPAAQISYADALKIKAYLNSASRPTARILY  315

Query  997   KGT  989
             KGT
Sbjct  316   KGT  318



>gb|AES94159.2| subtilisin-like serine protease [Medicago truncatula]
Length=776

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/761 (56%), Positives = 525/761 (69%), Gaps = 37/761 (5%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIAS------------KLETYIVRVELPHsristqsssssSVD  2243
             +++ L++S++   CS   I S             L TYIV     H + S   +S  S D
Sbjct  28    MQLSLLVSLIFILCSFNQITSVFAAEENQEHDHNLMTYIV-----HVKKSENVASFQSED  82

Query  2242  LEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERI  2063
             L  WY SFLP         + RMVF YR+V  GFA KL+ EE K +  KDG + A PER 
Sbjct  83    LHSWYHSFLPQNFPH----KDRMVFSYRHVASGFAVKLTPEEAKSLQEKDGILLARPERT  138

Query  2062  LPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKG  1883
             L LHTTHSP FLGL+   G W D + GKGVIIGV+DSGI   HPSF+DEGMPPPPA+WKG
Sbjct  139   LSLHTTHSPTFLGLKHGQGLWNDDNLGKGVIIGVIDSGIFPSHPSFNDEGMPPPPAKWKG  198

Query  1882  VCELN-FTACNNKVIGARSF--SERERSVFdddghgthtagtaaGNFVRGANVYGSANGT  1712
              CE N    CNNK+IGARS   S  +   F++  HGTHTA  AAG F++ A+V+G+A G 
Sbjct  199   HCEFNGMKICNNKLIGARSLVKSTIQEPPFENIFHGTHTAAEAAGRFIKDASVFGNAKGV  258

Query  1711  AAGVAPLAHLAIYKVCNE-IGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIAL  1535
             AAG+AP AHLAIYKVCN+ I C +S ILAAMD AIEDGVD+LSLSLG  S  F ED IA+
Sbjct  259   AAGMAPNAHLAIYKVCNDKIECPESAILAAMDIAIEDGVDVLSLSLGLGSLPFFEDPIAI  318

Query  1534  GAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGE  1355
             GA++A + GIFVS SA N GP   +LSNEAPW+LTVGAST+DRK+ A+  LGN +++ GE
Sbjct  319   GAFAATQNGIFVSCSAANSGPEYSTLSNEAPWILTVGASTIDRKIVASAKLGNGEEYEGE  378

Query  1354  TAFQPKDFNSSLLSLVFPG-----QNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLD  1190
             T FQPKDF   L  LV+ G       T ++S    C   SL+N D+ GK+V+C  G  + 
Sbjct  379   TLFQPKDFPQQLFPLVYAGSLGYGNQTQNQS---LCLPGSLKNIDLSGKVVLCDIGEDVS  435

Query  1189  RRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMA  1010
                KG+ V NA+G  +IL+  E  G +T ATAHVLPA++++YA G  I  YIN+T NP A
Sbjct  436   TFVKGQEVLNANGVAVILVNSESDGFSTFATAHVLPAVEVSYAAGLTIKDYINSTYNPTA  495

Query  1009  TFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKS  830
             T  FKGT+ GD  AP+V +FSSRGP+++SPGILKPDIIGPGVNILA WP S+DNK     
Sbjct  496   TLLFKGTVIGDSLAPSVVSFSSRGPSQQSPGILKPDIIGPGVNILAAWPVSIDNK---TP  552

Query  829   TFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTA  650
              F I SGTSMSCPHLSG+AAL+KSSHPDWSPA IKSA+MTTA+ LN G  PI +Q L  A
Sbjct  553   PFAITSGTSMSCPHLSGIAALIKSSHPDWSPAAIKSAIMTTANTLNLGGIPILDQRLSPA  612

Query  649   SVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIP  470
              VF+ GAGHVNP KANDPGLVYD +PEDY+PYLCGL YT++E+ +I Q  VNCS V SIP
Sbjct  613   DVFATGAGHVNPVKANDPGLVYDIQPEDYVPYLCGLGYTDQEIELIAQWVVNCSNVKSIP  672

Query  469   EAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQ  290
             EAQL+YPSFSI+L S +Q YTRT+TNVG A+S Y VE+  P    ++V P E+ FS+V++
Sbjct  673   EAQLSYPSFSILLGSDSQYYTRTLTNVGLANSTYRVELEVPLAFGMSVNPSEITFSEVDE  732

Query  289   KLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             K++Y+V F   +K +R N     QG+L W S KH VR PI+
Sbjct  733   KVSYSVDFIPKTKESRGNN-TYAQGSLTWVSDKHAVRIPIS  772



>ref|XP_004511628.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=763

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/732 (57%), Positives = 513/732 (70%), Gaps = 30/732 (4%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGF  2141
             L TYIV VE      S +++S  S+DL  WY SFLP T       +SRMVF YRNV  GF
Sbjct  44    LMTYIVHVE-----KSEKAASLQSLDLHEWYHSFLPQTSH-----KSRMVFTYRNVASGF  93

Query  2140  AAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGV  1961
             A KL+ EE K +  K+  +SA PER L LHTTH+P FLGL+Q  G W D + GKGVIIG+
Sbjct  94    AVKLTPEEAKSLQEKEEIVSARPERTLSLHTTHTPTFLGLKQGQGLWNDDNLGKGVIIGI  153

Query  1960  LDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA---CNNKVIGARSF--SERERSVFdd  1796
             +D+GI   HPSF+DEG+ PPPA+WKG CE  FT    CNNK+IGARS   S  +   F+ 
Sbjct  154   IDTGIYPFHPSFNDEGISPPPAKWKGHCE--FTGGRICNNKLIGARSLLKSAIQEPPFET  211

Query  1795  dghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCN---EIGCSDSEILAA  1625
               HGTHTA  AAG FV  A+V+G+A G AAG+AP AH+A+YKVCN   +  C +S ILAA
Sbjct  212   IFHGTHTAAEAAGRFVEDASVFGNAKGVAAGMAPNAHIAMYKVCNSNEKFECPESAILAA  271

Query  1624  MDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEA  1445
             MD AIEDGVD+LSLSLG  S  F ED IA+GA++A + GIFVS SA N GP   +LSNEA
Sbjct  272   MDIAIEDGVDVLSLSLGLGSLPFFEDPIAIGAFAATQNGIFVSCSAANSGPGYSTLSNEA  331

Query  1444  PWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPG------QNTSD  1283
             PW+LTVGAST+DRK+ A+  LGN +++ GET FQPKDF+  LL LV+ G      Q+ + 
Sbjct  332   PWILTVGASTIDRKIVASAKLGNGEEYEGETLFQPKDFSQQLLPLVYAGSYGNSNQSQTQ  391

Query  1282  ESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTS  1103
              S    C   SL+N D+RGK+V+C  GG +    KG+ V N+ G  MIL  PE  G +T 
Sbjct  392   TSDQSLCVPGSLKNVDLRGKVVLCDIGGGIPSDLKGQEVLNSGGVAMILANPERLGFSTF  451

Query  1102  ATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRES  923
             ATA VLPA++++YA G  I +YIN T+ P +T  FKGT+ GD  AP+V +FSSRGPN+ES
Sbjct  452   ATATVLPAVEVSYAAGLSIKSYINLTNTPTSTLLFKGTVIGDSLAPSVVSFSSRGPNQES  511

Query  922   PGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDW  743
             PGILKPDIIGPGVNILA W  SVDNK      +NI+SGTSMSCPHLSG+AALLKSSHPDW
Sbjct  512   PGILKPDIIGPGVNILAAWAISVDNK---IPPYNIVSGTSMSCPHLSGIAALLKSSHPDW  568

Query  742   SPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDY  563
             SPA IKSA+MTTA   N    PI +Q L+ A VF+ GAGHVNP KANDPGLVYD KPEDY
Sbjct  569   SPAAIKSAIMTTATTKNLAGLPIMDQRLLPADVFATGAGHVNPVKANDPGLVYDIKPEDY  628

Query  562   LPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGE  383
             +PYLCGL Y+++E+ VI+Q +V CS V SI EA+LNYPSFSI+L S +Q YTRT+TNVG 
Sbjct  629   VPYLCGLGYSDKEIEVIIQWKVKCSDVKSIAEAELNYPSFSILLGSDSQFYTRTLTNVGP  688

Query  382   ASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRW  203
              +S Y VEI  P  + ++V P E+ FS+VNQK++Y V F    K  R N     QG++ W
Sbjct  689   VNSTYRVEIEVPLSLGMSVNPSEITFSEVNQKVSYTVDFIPQIKENRGNH-TFAQGSITW  747

Query  202   KSVKHHVRSPIA  167
              S KH VR PI+
Sbjct  748   VSDKHAVRIPIS  759



>ref|XP_003538718.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=758

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/729 (57%), Positives = 517/729 (71%), Gaps = 19/729 (3%)
 Frame = -1

Query  2332  IASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNV  2153
             + S L TYIVRV+ P S+           DL  WY S LP +       + R+ F YRNV
Sbjct  38    VPSSLLTYIVRVKKPQSQGDDSLQYK---DLHSWYHSLLPASTKTD-QNQQRITFSYRNV  93

Query  2152  MKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGV  1973
             + GFA KL+ EE K +  K+  +SA PER   LHTTH+P FLGLQQ +G W +S++GKG+
Sbjct  94    VDGFAVKLNPEEAKALQEKEEVVSARPERTFSLHTTHTPSFLGLQQGLGLWTNSNFGKGI  153

Query  1972  IIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA---CNNKVIGARSFSERERSVF  1802
             IIG+LD+GI  DH SF+DEGMP PPA+W G CE  FT    CNNK+IGAR+F +   S  
Sbjct  154   IIGILDTGITPDHLSFNDEGMPLPPAKWSGHCE--FTGEKTCNNKLIGARNFVKNPNSTL  211

Query  1801  --dddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILA  1628
               DD GHGTHTA TAAG FV+GA+V+G+A GTA G+AP AHLAIYKVC+  GCS+S ILA
Sbjct  212   PLDDVGHGTHTASTAAGRFVQGASVFGNAKGTAVGMAPDAHLAIYKVCDLFGCSESAILA  271

Query  1627  AMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNE  1448
              MDTAI+DGVDILSLSLGG  + F +D IALGA+SA++KGIFVS SA N GPF  SLSNE
Sbjct  272   GMDTAIQDGVDILSLSLGGPPAPFFDDPIALGAFSAIQKGIFVSCSAANAGPFYSSLSNE  331

Query  1447  APWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSP  1268
             APW+LTVGAST+DR++ A   LGN + F+GE+ FQP +F S+LL LV+ G N +D  SS 
Sbjct  332   APWILTVGASTIDRRIVAAAKLGNGEAFNGESVFQPNNFTSTLLPLVYAGANGND--SST  389

Query  1267  YCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHV  1088
             +C   SL++ DV+GK+V+C  GGF+ R  KG+ VK+A G  MIL+          A  HV
Sbjct  390   FCAPGSLQSMDVKGKVVLCEIGGFVRRVDKGQEVKSAGGAAMILMNSPIEDFNPFADVHV  449

Query  1087  LPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILK  908
             LPA  ++Y  G  I  YIN+TS P AT  F+GT+ G+ +AP V +FSSRGP+ ESPGILK
Sbjct  450   LPATHVSYKAGLAIKNYINSTSTPTATILFQGTVIGNPHAPAVTSFSSRGPSLESPGILK  509

Query  907   PDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMI  728
             PDIIGPG NILA WP S+DN   +   FNIISGTSMSCPHLSG+AALLK+SHPDWSPA I
Sbjct  510   PDIIGPGQNILAAWPLSLDN---NLPPFNIISGTSMSCPHLSGIAALLKNSHPDWSPAAI  566

Query  727   KSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLC  548
             KSA+MT+A+ +N G  PI  Q L+ A VF+ GAGHVNP KANDPGLVYD +P DY+PYLC
Sbjct  567   KSAIMTSANTVNLGGKPILEQRLLPADVFATGAGHVNPLKANDPGLVYDLQPTDYIPYLC  626

Query  547   GLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFY  368
             GLNYT++EVG IL  +V C  V SI EAQLNYPSFSI L S++Q YTRT+TNVG A+  Y
Sbjct  627   GLNYTDKEVGFILNQKVKCLEVKSIAEAQLNYPSFSIRLGSSSQFYTRTLTNVGPANITY  686

Query  367   TVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSV--  194
             +VE+  P  V +++ P E+ F++V QK++Y+V F    K  R    P  QG+++W S   
Sbjct  687   SVEVDAPSAVSISISPAEIAFTEVKQKVSYSVGFYPEGKNNRRKH-PFAQGSIKWVSSNG  745

Query  193   KHHVRSPIA  167
             K+ V  PIA
Sbjct  746   KYSVSIPIA  754



>ref|XP_002275410.2| PREDICTED: subtilisin-like protease SDD1 [Vitis vinifera]
Length=755

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/733 (57%), Positives = 521/733 (71%), Gaps = 14/733 (2%)
 Frame = -1

Query  2356  IGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESR  2177
             + F   A   S L+TYIV V  P  + S QS +     LE WY+SFLP +       + R
Sbjct  30    VAFQQIAAEKSMLKTYIVHVNDPVGKFSAQSEA-----LESWYQSFLPASTESENQ-QQR  83

Query  2176  MVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWR  1997
             +++ YR+V+ GFAA+L+ EEVK M  KDGF+SA PE+I  LHTT +PGFLGL    GFW+
Sbjct  84    LLYSYRHVISGFAARLTEEEVKAMEKKDGFVSATPEKIYHLHTTRTPGFLGLHNRSGFWK  143

Query  1996  DSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSER  1817
              S++G+GVIIG+LD+G+   HPSFSDEGMP PPA+W G CE N TACNNK+IGAR+F   
Sbjct  144   GSNFGEGVIIGILDTGVYPQHPSFSDEGMPLPPAKWTGTCEFNGTACNNKLIGARNFDSL  203

Query  1816  --ERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSD  1643
               ++   D++GHGTHTA TAAGN+V+ AN+YG+A GTAAG+AP AH+A+YKVC  +GC  
Sbjct  204   TPKQLPIDEEGHGTHTASTAAGNYVKHANMYGNAKGTAAGIAPRAHVAVYKVCGLLGCGG  263

Query  1642  SEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNG  1463
             S+ILAA D AIEDGVD+LSLSLGG SS F++D +ALGA++A+ KGIFVS SAGN GP + 
Sbjct  264   SDILAAYDAAIEDGVDVLSLSLGGESSPFYDDPVALGAFAAIRKGIFVSCSAGNSGPAHF  323

Query  1462  SLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSD  1283
             +LSNEAPW+LTV AST+DR ++AT  LGN ++F GE+ +QP++F+S LL LV+ G N + 
Sbjct  324   TLSNEAPWILTVAASTLDRSITATAKLGNTEEFDGESLYQPRNFSSKLLPLVYAGANGNQ  383

Query  1282  ESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTS  1103
              S+  YC   SL+N DV+GK+VVC  GG + R  KG  VKNA G  MIL        +T 
Sbjct  384   TSA--YCAPGSLKNLDVKGKVVVCDRGGDIGRTEKGVEVKNAGGAAMILANSINDSFSTF  441

Query  1102  ATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRES  923
             A  HVLPA  ++YA G KI AY  +TSNP AT  FKGT  G  +AP + +FSSRGP+  S
Sbjct  442   ADPHVLPATHVSYAAGLKIKAYTKSTSNPSATILFKGTNVGVTSAPQITSFSSRGPSIAS  501

Query  922   PGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDW  743
             PGILKPDI GPGV+ILA WP  + N   SKSTFN+ISGTSMSCPHLSGVAALLKS+HP+W
Sbjct  502   PGILKPDITGPGVSILAAWPAPLLNVTGSKSTFNMISGTSMSCPHLSGVAALLKSAHPNW  561

Query  742   SPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDY  563
             SPA IKSA++TTAD LN    PI +   + A +F+IGAGHVNPSKANDPGL+YD +P DY
Sbjct  562   SPAAIKSAILTTADTLNLKDEPILDDKHMPADLFAIGAGHVNPSKANDPGLIYDIEPYDY  621

Query  562   LPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGE  383
             +PYLCGL YTN +V  I+  +VNCS   SIPEA+LNYPSFSI L S    + R VTNVG+
Sbjct  622   IPYLCGLGYTNAQVEAIVLRKVNCSKESSIPEAELNYPSFSIALGSKDLKFKRVVTNVGK  681

Query  382   ASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTF-SLSSKAARSNMPPVVQGALR  206
               S Y V I  P GV V V+P ++ F+KV QK +Y V F S+    +R+      QG L+
Sbjct  682   PHSSYAVSINAPEGVDVVVKPTKIHFNKVYQKKSYTVIFRSIGGVDSRNRY---AQGFLK  738

Query  205   WKSVKHHVRSPIA  167
             W S  H  +SPI+
Sbjct  739   WVSATHSAKSPIS  751



>gb|KDO63673.1| hypothetical protein CISIN_1g039265mg, partial [Citrus sinensis]
Length=708

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/730 (57%), Positives = 523/730 (72%), Gaps = 30/730 (4%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S L+TYIV V+ P      +S       +E+W++SFLP ++      + R  + Y+NV+ 
Sbjct  1     SNLQTYIVSVQQPEGSDLAESEY-----VENWHRSFLPYSLESSDV-QQRPFYSYKNVIS  54

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAAKL+ EEV++M  K+GF+SA PER + L TTHSP FLGL Q MG W++S++GKGVII
Sbjct  55    GFAAKLTEEEVQDMKKKNGFVSARPERKVRLQTTHSPSFLGLHQGMGVWKESNFGKGVII  114

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFS-----ERERSVF  1802
             G+LD GI  DHPSFSDEGMPPPPA+WKG C+  F+ CNNK+IGAR+F+     +      
Sbjct  115   GILDGGINPDHPSFSDEGMPPPPAKWKGRCD--FSTCNNKLIGARTFNIEGNVKGTEPPI  172

Query  1801  dddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVC--NEIGCSDSEILA  1628
             D DGHGTH AGTAAG FV+ A   G+A GTAAG+AP AHLAIYKVC   ++ C++S++LA
Sbjct  173   DVDGHGTHVAGTAAGAFVKNAESLGNAKGTAAGMAPYAHLAIYKVCFGGDVDCTESDLLA  232

Query  1627  AMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNE  1448
              +D AIEDGVD+LS+S+GG S  F  DSIA+G+++A++KGIFVS +AGN GPFN ++SNE
Sbjct  233   GLDAAIEDGVDVLSISIGGGSVPFFNDSIAVGSFAAIQKGIFVSCAAGNSGPFNSTISNE  292

Query  1447  APWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSP  1268
             APW+LTVGAST+DR + AT  LGNR++F GE+ FQPKDF  + L LV+ G N   ES+  
Sbjct  293   APWILTVGASTLDRSIVATAKLGNREEFDGESVFQPKDFPQTPLPLVYAGMNGKPESA--  350

Query  1267  YCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHV  1088
             +C + SL   DV+GK+V+C  GG + R  KGE VKNA G  MIL+  E    +  A  HV
Sbjct  351   FCGNGSLSGIDVKGKVVLCERGGGIARIFKGEQVKNAGGAAMILMNDEPNAFSVIADPHV  410

Query  1087  LPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILK  908
             LPA  ++   G KI +YIN+T+ PMAT  FKGT+ G+  APTV +FSSRGPN  SPGILK
Sbjct  411   LPATHVSNDAGLKIKSYINSTATPMATIIFKGTVIGNSLAPTVVSFSSRGPNLASPGILK  470

Query  907   PDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMI  728
             PDIIGPG++ILA W   +D   N KS FNI+SGTSM+CPHLSG+AALLKSSHP WSPA I
Sbjct  471   PDIIGPGLSILAAWFEPLDFNTNPKSIFNIMSGTSMACPHLSGIAALLKSSHPYWSPAAI  530

Query  727   KSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLC  548
             KSA+MTTAD+LN     I ++ L  A +F+IGAGHVNPS+ANDPGLVYD +P+DY+PYLC
Sbjct  531   KSALMTTADLLNMNGERIVDETLRPADIFAIGAGHVNPSRANDPGLVYDIQPDDYIPYLC  590

Query  547   GLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFY  368
             GL Y+++EVG IL HR         P AQLNYPSFS+ L   AQT+TRTVTNVG+  S Y
Sbjct  591   GLGYSDKEVG-ILVHR---------PVAQLNYPSFSVTL-GPAQTFTRTVTNVGQVYSSY  639

Query  367   TVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKH  188
              V +  P GV V+V+P +L FSKVNQK TY+VTF+ S     S      QG + W S K+
Sbjct  640   AVNVVAPQGVVVSVKPSKLYFSKVNQKATYSVTFTRSGSGYTSGQ--FAQGYITWVSAKY  697

Query  187   HVRSPIAAKL  158
              VRSPI+ +L
Sbjct  698   SVRSPISVRL  707



>ref|XP_010317341.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=730

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/743 (56%), Positives = 536/743 (72%), Gaps = 29/743 (4%)
 Frame = -1

Query  2398  NMKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSF  2219
             ++ F  +FL  S    F    T  S L TYIV++E P   + + ++     DL  W++SF
Sbjct  7     SLIFFWVFLFHSSKT-FGDHFTNRSDLHTYIVQLEFPDDIVLSDTN-----DLHLWHQSF  60

Query  2218  LPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHS  2039
             LPTT A   +  SR+++ YR+V  GFAA LS++EVKE+  K GF+SA P+RI+ L TTH+
Sbjct  61    LPTTSANS-HLSSRIIYSYRHVFHGFAAMLSSDEVKEIELKPGFVSARPQRIVELDTTHT  119

Query  2038  PGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA  1859
             P FLGL QN+G W  S+ G+GVIIG+LDSGI   HPSFSD  MPPPPA+WKG CE N  A
Sbjct  120   PSFLGLHQNVGLWNTSNSGEGVIIGLLDSGITPKHPSFSDNEMPPPPAKWKGKCEFNSKA  179

Query  1858  CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLA  1679
             CNNK+IGAR+F     S  D +GHGTHT+ TAAGNFV GAN+ G+ANGTA G+AP AHLA
Sbjct  180   CNNKLIGARNFVTTSASPLDVEGHGTHTSSTAAGNFVNGANLLGNANGTAVGIAPRAHLA  239

Query  1678  IYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFV  1499
             +Y+VC++  C +S ILA +++A+EDGVD+LS+SLGG    F+EDS+A+GA+SA++KGIFV
Sbjct  240   MYRVCDDGVCPESYILAGLESAVEDGVDVLSISLGGTPVPFYEDSLAIGAFSAIQKGIFV  299

Query  1498  SASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSL  1319
             S SAGN+GP  G+L N APW+LTV A+T DRK+ A  VLGN  ++ GE+A+QP + +   
Sbjct  300   SCSAGNKGPEVGTLKNGAPWILTVAAATTDRKIRAVAVLGNGAKYVGESAYQPTNLSGKW  359

Query  1318  LSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMI  1139
             L LV          ++  C  ESL   DV+GKIV+C T G L R  KGEAVKNA G  MI
Sbjct  360   LPLV----------NANGC--ESLSTIDVKGKIVLCDTSGDLSRIEKGEAVKNAGGAAMI  407

Query  1138  LIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTV  959
             L+  ++ G TT A  HVLPA  ++Y +G KI+ YI +T +P+AT SFKGT  G K+ PTV
Sbjct  408   LMNEKKRGYTTIADVHVLPATHVSYFNGLKIINYIKSTPSPVATISFKGTELGSKHVPTV  467

Query  958   AAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSG  779
             A+FSSRGP   SPGILKPDI GPGVNILA WPTS+     S  TFNIISGTSM+CPHL+G
Sbjct  468   ASFSSRGPFLPSPGILKPDISGPGVNILAAWPTSLGEMITS--TFNIISGTSMACPHLAG  525

Query  778   VAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKAND  599
             VAALLKS+HPDWSPA IKSA+MTTADI+N  ++PI+++ L  A++F+IG+G+VNPS+A+D
Sbjct  526   VAALLKSAHPDWSPAAIKSAIMTTADIINLKKHPIEDERLNRANLFTIGSGNVNPSRASD  585

Query  598   PGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTA  419
             PGL+YD  PEDY+PYLCGL YT+++V  I++ +V+C++  SI EA+LNYPSFSI  +S A
Sbjct  586   PGLIYDIHPEDYIPYLCGLKYTDQQVSSIVRRKVHCTS--SIAEAELNYPSFSISSKSRA  643

Query  418   QTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARS  239
             QTYTRTVTNVGEA+S YTVE++   GVKV V P  L+FS +NQK +YNVT       + S
Sbjct  644   QTYTRTVTNVGEANSTYTVEVYGLNGVKVAVNPTTLKFSGLNQKASYNVTVKHLKHRSHS  703

Query  238   NMPPVVQGALRWKSVKHHVRSPI  170
                   QG + W S ++ V SPI
Sbjct  704   ------QGYITWSSSRYSVTSPI  720



>ref|XP_011081167.1| PREDICTED: subtilisin-like protease SDD1 [Sesamum indicum]
Length=1084

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/729 (57%), Positives = 522/729 (72%), Gaps = 21/729 (3%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGF  2141
             LETYIV V+ P  R+  Q       D++ +++SFLP   A        +++ YRNV+ GF
Sbjct  370   LETYIVHVKKPEGRLEVQLD-----DMKSYHQSFLPVRTAVSSADRQPLLYSYRNVISGF  424

Query  2140  AAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGV  1961
             +A+L+AEEV+ M  KDGFISA  ER+    TTHSP FLGL Q MGFW+ S+YGKGVI+GV
Sbjct  425   SARLTAEEVEAMKEKDGFISARLERMYRPLTTHSPNFLGLHQEMGFWKKSNYGKGVIVGV  484

Query  1960  LDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-------SERERSVF  1802
             LD+GI   HPSFS E MPPPPA+WKG CE   T CNNK+IGARSF       S    +  
Sbjct  485   LDTGIFPSHPSFSGEDMPPPPAKWKGKCEFKATECNNKLIGARSFNLAANASSLEAETPL  544

Query  1801  dddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAM  1622
             DDDGHGTHTA TAAG FV+ A+  G+A GTA G+AP AHLAIYKVC    C +S+ILA +
Sbjct  545   DDDGHGTHTASTAAGGFVQNASALGNAYGTAVGIAPQAHLAIYKVCFGPDCPESDILAGL  604

Query  1621  DTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAP  1442
             D A+EDGVD+LS+SLG  S+ F+ D++A+G+++A +KGIFVS + GN GP   ++SNEAP
Sbjct  605   DAAVEDGVDVLSISLGEESTPFYNDNLAVGSFAAAQKGIFVSCAGGNSGPSQQTISNEAP  664

Query  1441  WMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYC  1262
             W+LTVGAST+DR + AT  LG+ Q+F GE+ FQPKDF  +LL LV+ G N   +S+  +C
Sbjct  665   WILTVGASTIDRSIRATAKLGDGQEFDGESVFQPKDFPPTLLPLVYAGSNGKQDSA--FC  722

Query  1261  DSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLP  1082
              + SL   DV+GK+V+C  GG + R  KG  VKNA G  MIL   +  G +TSA AHVLP
Sbjct  723   ANGSLSGVDVKGKVVLCDRGGGIARLDKGREVKNAGGAAMILANQQSDGFSTSADAHVLP  782

Query  1081  AIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPD  902
             A  + Y+ G KI AYIN+T++P AT  FKGT+ GD  AP VA+FSSRGP+  +PGILKPD
Sbjct  783   ATHVAYSSGLKIKAYINSTTSPTATILFKGTVIGDPLAPIVASFSSRGPSLATPGILKPD  842

Query  901   IIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKS  722
             IIGPGVNI+A WP  +D   NSK TFN+ SGTSMSCPHLSGVAALLKS+HP WSPA IKS
Sbjct  843   IIGPGVNIIAAWPFPLDGSTNSKLTFNVESGTSMSCPHLSGVAALLKSAHPYWSPAAIKS  902

Query  721   AMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGL  542
             A+MTTAD++N     I ++ L  A +F+ GAGHVNPSKANDPGLVYD   +DY+PYLCGL
Sbjct  903   AIMTTADLVNIKGTSIVDERLTPADIFATGAGHVNPSKANDPGLVYDIAADDYIPYLCGL  962

Query  541   NYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTV  362
              YT+ +VG+I    V+C++   IPE QLNYPSFS  L S+ QT+TRTVTNVGEA S+YTV
Sbjct  963   GYTDEQVGIIAHKSVHCTS--KIPEGQLNYPSFSATLGSS-QTFTRTVTNVGEAVSYYTV  1019

Query  361   EIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHV  182
             +I EP GV ++V+P +L F++V +K TY+VTFS SS  + +      QG L W S KH V
Sbjct  1020  KIVEPQGVSISVQPAKLSFTRVGEKATYSVTFSRSSNISNT----FSQGYLLWVSTKHTV  1075

Query  181   RSPIAAKLV  155
             RS I+ KL+
Sbjct  1076  RSVISVKLI  1084


 Score =   210 bits (535),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 134/192 (70%), Gaps = 5/192 (3%)
 Frame = -1

Query  745  WSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPED  566
            WSPA IKSA+MTTA   N     I ++  + A +F++GAGHVNP  ANDPGL+YD +PED
Sbjct  165  WSPAAIKSAIMTTATQWNLHGGAILDERYLPADIFALGAGHVNPPSANDPGLIYDLQPED  224

Query  565  YLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVG  386
            Y+PYLCGL Y+N E+ +I+QH V CS V SIPEAQLNYPSFS+ L +  +TYTRTVTNVG
Sbjct  225  YIPYLCGLGYSNNEIEIIVQHPVTCSNVTSIPEAQLNYPSFSVELGADKKTYTRTVTNVG  284

Query  385  EASSFYTVEIF--EPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGA  212
            EA+S Y VEI      GV V V P  L FS+VNQKLTY ++FS S+  A +     V+GA
Sbjct  285  EANSTYMVEIELDSAQGVDVAVTPATLSFSEVNQKLTYEISFSKSATPANATF---VEGA  341

Query  211  LRWKSVKHHVRS  176
            + W+     +R+
Sbjct  342  VVWRLAPRWLRA  353


 Score = 72.0 bits (175),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -1

Query  1189  RRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMA  1010
             R  KG+ VK+A G GMIL+  E  G +T A  HVLPA  ++YA G+ I AYIN+TS P A
Sbjct  98    RIAKGQTVKDAGGAGMILMNAEPDGYSTIADPHVLPATHVSYAAGESIRAYINSTSTPTA  157

Query  1009  TFSFKGT  989
             T  F+GT
Sbjct  158   TIIFRGT  164


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 78/136 (57%), Gaps = 42/136 (31%)
 Frame = -1

Query  1912  MPPPPARWKGVCE-LNFTACNNKVIGARSF-SERERSVFdddghgthtagtaaGNFVRGA  1739
             MPPPPA+WKG CE +  T CNNK+IGAR+F S+      DD+GHGTHTA TAAGNFV+GA
Sbjct  1     MPPPPAKWKGKCEFVTGTMCNNKLIGARNFVSDLPGPPVDDEGHGTHTASTAAGNFVQGA  60

Query  1738  NVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssS  1559
             NV+G                                        DGVD+LSLSLGG S  
Sbjct  61    NVFG----------------------------------------DGVDVLSLSLGGGSIE  80

Query  1558  FHEDSIALGAYSAMEK  1511
             F +D IA+GA++A++K
Sbjct  81    FFQDGIAIGAFAAIQK  96



>ref|XP_007210956.1| hypothetical protein PRUPE_ppa023717mg [Prunus persica]
 gb|EMJ12155.1| hypothetical protein PRUPE_ppa023717mg [Prunus persica]
Length=729

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/733 (58%), Positives = 532/733 (73%), Gaps = 23/733 (3%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGG-YGESRMVFMYRNVMKG  2144
             ++TYIV V+ P S+  +  S     DLE WY+SFLP T A      + RMV+ Y NV  G
Sbjct  1     MQTYIVWVQKPASQKFSAESHE---DLESWYQSFLPETDANSNQLTKQRMVYAYHNVATG  57

Query  2143  FAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIG  1964
             FAA+L+ EEVK M   +GF+SA PE+ILPL TTHSP FLGL Q  G W  ++YG+GVIIG
Sbjct  58    FAARLTPEEVKTMETIEGFVSARPEKILPLQTTHSPDFLGLHQGFGLWEATNYGEGVIIG  117

Query  1963  VLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSV------F  1802
             +LD+GI  DHPSFSDEGMPPPPA+WKG CE N T CNNK+IGAR+F    +        F
Sbjct  118   LLDTGITPDHPSFSDEGMPPPPAKWKGKCEFNGTLCNNKLIGARNFKGVGKDQPPPGPPF  177

Query  1801  dddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAM  1622
             D DGHGTHT+ TAAG FV GA+V+G ANGTAAG+AP AHLA+YKVC+  GC++++ILAA+
Sbjct  178   DIDGHGTHTSSTAAGRFVEGASVFGQANGTAAGMAPKAHLAVYKVCSGFGCAEADILAAL  237

Query  1621  DTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAP  1442
             D A++DGVD+LSLSLGG S  F++D IA+GA++A++KGIF S + GN GPFN SLSNEAP
Sbjct  238   DVAVDDGVDVLSLSLGGPSLPFYKDVIAIGAFAAIQKGIFFSCAGGNFGPFNRSLSNEAP  297

Query  1441  WMLTVGASTVDRKLSATVVLGNRQ--QFHGETAFQPKDFNSSL---LSLVFPGQNTSDES  1277
             W+LTVGAST DR L +   +G+ +   F G++  QP+DF+S++   L LV+ G   +  S
Sbjct  298   WILTVGASTTDRILKSEAQIGDDKNNHFDGKSLSQPQDFDSTVSLPLPLVYAGSVGNQPS  357

Query  1276  SSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSAT  1097
             +  +C   +L N  V GKIV+C TGG +    KGE VK A G  MIL+  E  G +T A 
Sbjct  358   A--FCKKGTLEN--VEGKIVLCETGGGVTNIAKGEEVKRAGGAAMILMNQETDGFSTLAE  413

Query  1096  AHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPG  917
             +H LP   ++YA G +I +YI++TS+P AT  F GT+ GD  AP VA FSSRGPN+ SPG
Sbjct  414   SHALPTTHVSYAAGLQIKSYISSTSSPTATILFNGTVIGDALAPRVAFFSSRGPNKASPG  473

Query  916   ILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSP  737
             ILKPDIIGPGV+ILA WP SVDN   SK+TFNIISGTSM+CPHLSG+AAL+KSSHPDWSP
Sbjct  474   ILKPDIIGPGVDILAAWPVSVDNATQSKATFNIISGTSMACPHLSGIAALVKSSHPDWSP  533

Query  736   AMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLP  557
             A IKSA+MTTAD+LN    PI +Q    A+VF+IGAGHVNPSKANDPGL+YDT+PEDY+P
Sbjct  534   AAIKSAIMTTADVLNLAGLPIVDQDQRPANVFAIGAGHVNPSKANDPGLIYDTQPEDYIP  593

Query  556   YLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL---ESTAQTYTRTVTNVG  386
             YLCGLNYT++E+ +I Q +VNCS V  I EAQLNYPSFSI +   ES +Q YTRTV NVG
Sbjct  594   YLCGLNYTDKEIQIITQQKVNCSQVGVISEAQLNYPSFSIKIGSNESQSQYYTRTVRNVG  653

Query  385   EASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALR  206
              AS+ Y +++  P  + ++V P  L F++VNQ++T++V F     A +  +    QG LR
Sbjct  654   PASTTYNLDLLVPHKMGMSVNPGVLTFTEVNQEITFHVEFIAQDGAGKDGV-AFGQGYLR  712

Query  205   WKSVKHHVRSPIA  167
             W S KH+V SPIA
Sbjct  713   WVSDKHNVTSPIA  725



>ref|XP_003611196.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES94154.1| subtilisin-like serine protease [Medicago truncatula]
Length=748

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/761 (55%), Positives = 528/761 (69%), Gaps = 35/761 (5%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIASK---------LETYIVRVELPHsristqsssssSVD  2243
             M  + + L++S++   CS + +A++         L TYIV     H + S   +S  S D
Sbjct  1     MMKMELRLLVSLIFILCSISMLAAEENLEHDQINLMTYIV-----HVKKSENVASHQSED  55

Query  2242  LEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERI  2063
             L  WY SFLP T       + RMVF YR V  GFA KL+ EE K +  K   +SA PER 
Sbjct  56    LHSWYHSFLPQTFPH----KERMVFSYRKVASGFAVKLTPEEAKSLQEKGEIVSARPERT  111

Query  2062  LPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKG  1883
             L LHTTH+P FLGL+Q  G W D + GKGVIIG++D+GI   HPSF+DEGMPPPPA+WKG
Sbjct  112   LELHTTHTPTFLGLKQGQGLWSDDNLGKGVIIGIIDTGIFPLHPSFNDEGMPPPPAKWKG  171

Query  1882  VCELNF-TACNNKVIGARSF--SERERSVFdddghgthtagtaaGNFVRGANVYGSANGT  1712
              CE      CNNK+IGAR+   S  +   F++  HGTHTA  AAG F+  A+V+G+A G 
Sbjct  172   HCEFTGGQVCNNKLIGARNLVKSAIQEPPFENFFHGTHTAAEAAGRFIEDASVFGNAKGV  231

Query  1711  AAGVAPLAHLAIYKVCNE-IGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIAL  1535
             AAG+AP AHLAIYKVCN+ IGC++S ILAAMD AIEDGVD+LSLSLG  S  F ED IA+
Sbjct  232   AAGMAPNAHLAIYKVCNDKIGCTESAILAAMDIAIEDGVDVLSLSLGLGSLPFFEDPIAI  291

Query  1534  GAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGE  1355
             GA++A + G+FVS SA N GP   +LSNEAPW+LTVGAST+DRK+ A+  LGN +++ GE
Sbjct  292   GAFAATQNGVFVSCSAANSGPGYSTLSNEAPWILTVGASTIDRKIVASAKLGNGEEYEGE  351

Query  1354  TAFQPKDFNSSLLSLVFPG-----QNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLD  1190
             T FQPKDF+  LL LV+PG       T ++S    C   SL+N D+ GK+V+C  G  + 
Sbjct  352   TLFQPKDFSQQLLPLVYPGSFGYGNQTQNQS---LCLPGSLKNIDLSGKVVLCDVGN-VS  407

Query  1189  RRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMA  1010
                KG+ V N+ G  MIL   E  G +T A AHVLPA++++YA G  I +YI +T NP A
Sbjct  408   SIVKGQEVLNSGGIAMILANSEALGFSTFAIAHVLPAVEVSYAAGLTIKSYIKSTYNPTA  467

Query  1009  TFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKS  830
             T  FKGTI GD  AP+V  FSSRGP++ESPGILKPDIIGPGVNILA W  SVDNK     
Sbjct  468   TLIFKGTIIGDSLAPSVVYFSSRGPSQESPGILKPDIIGPGVNILAAWAVSVDNK---IP  524

Query  829   TFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTA  650
              F+I+SGTSMSCPHLSG+AAL+KSSHPDWSPA IKSA+MTTA+ LN G  PI +Q L  A
Sbjct  525   AFDIVSGTSMSCPHLSGIAALIKSSHPDWSPAAIKSAIMTTANTLNLGGIPILDQRLFPA  584

Query  649   SVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIP  470
              +F+ GAGHVNP KANDPGLVYD +PEDY+PYLCGL Y+++E+ VI+Q +V CS V SIP
Sbjct  585   DIFATGAGHVNPVKANDPGLVYDIEPEDYVPYLCGLGYSDKEIEVIVQWKVKCSNVKSIP  644

Query  469   EAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQ  290
             EAQLNYPSFSI+L S +Q YTRT+TNVG A+S Y VE+  P  + ++V P E+ F++VN+
Sbjct  645   EAQLNYPSFSILLGSDSQYYTRTLTNVGFANSTYKVELEVPLALGMSVNPSEITFTEVNE  704

Query  289   KLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             K++++V F    K  R N     QG+L W S +H VR PI+
Sbjct  705   KVSFSVEFIPQIKENRRNH-TFGQGSLTWVSDRHAVRIPIS  744



>gb|KDP25555.1| hypothetical protein JCGZ_20711 [Jatropha curcas]
Length=746

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/759 (55%), Positives = 527/759 (69%), Gaps = 36/759 (5%)
 Frame = -1

Query  2389  FLRMFLILSVLIGF------------CSTATIA--SKLETYIVRVELPHsristqsssss  2252
              L  FLIL+ +  F             S AT+   S LETYIV +  P     T+S    
Sbjct  2     LLMSFLILNSIFRFSIAISETPVRSSTSEATLEEESNLETYIVLLMKPEDVQFTESK---  58

Query  2251  SVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAP  2072
               DL+ WY+SFLP         + R++  Y +V+ GFAAKL+AEE K +  K+G + A P
Sbjct  59    --DLDSWYQSFLPANSFSSDQVQPRLIHSYHHVVTGFAAKLTAEEAKAIEIKEGVVLARP  116

Query  2071  ERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPAR  1892
             +R+L LHTTH+P FLGLQQN+G W+ S+YGKGVIIGV+DSGI  DHPSFS EGMPPPP +
Sbjct  117   QRMLTLHTTHTPSFLGLQQNLGLWKQSNYGKGVIIGVVDSGITADHPSFSGEGMPPPPEK  176

Query  1891  WKGVCELNFT-ACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANG  1715
             WKG CEL  T +CNNK+IGAR+F+     + D D HGTHTA TAAG+ V+G + +G ANG
Sbjct  177   WKGKCELKGTLSCNNKLIGARNFATNSNDLVDRDEHGTHTASTAAGSPVQGVSYFGQANG  236

Query  1714  TAAGVAPLAHLAIYKVC---NEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDS  1544
             TA G+APL+HLA+YKV    N+ G  +SE+LAAMD A+EDGVD+LSLS+G  S  F++D 
Sbjct  237   TAVGMAPLSHLAMYKVSGRDNKAG--ESELLAAMDAAVEDGVDVLSLSIGSDSHPFYDDV  294

Query  1543  IALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQF  1364
             +A+ AY+A++KGIFVS SAGNEGP++ +LSNEAPW+LTVGASTVDR + ATV+LGN+ + 
Sbjct  295   LAIAAYAAIQKGIFVSCSAGNEGPYSKTLSNEAPWLLTVGASTVDRAIRATVLLGNKAEL  354

Query  1363  HGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRR  1184
             +GE+ FQPK F   LL LV+ G N    S+S  CD  SL+N +V+GKIV+C  GG+ +  
Sbjct  355   NGESLFQPKSFLPKLLPLVYAGANGDARSAS--CDEGSLKNVNVKGKIVLC-EGGY-ETV  410

Query  1183  GKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATF  1004
              KG+ VK+  G  MI++  ++ G  T A  HVLPA  ++Y  G  I AYINATS+P AT 
Sbjct  411   SKGQEVKDNGGAAMIVMNDQDEGFVTQADNHVLPASHVSYIAGSAIKAYINATSSPKATI  470

Query  1003  SFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTF  824
              FKGT+ G   AP VA+FSSRGP+  SPGILKPDIIGPGV ILA WP S DN  N    F
Sbjct  471   LFKGTVFGLPEAPQVASFSSRGPSTASPGILKPDIIGPGVRILAAWPHSADNTTNR---F  527

Query  823   NIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASV  644
               +SGTSMSCPHLSGVAALLKS HPDWSPA IKSA+MTTA++ N G  PI +     +++
Sbjct  528   EFLSGTSMSCPHLSGVAALLKSVHPDWSPAAIKSAIMTTANLYNLGGKPITDIWFFPSTL  587

Query  643   FSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEA  464
             F IGAGHVNP+ A +PGL+YD +PEDY+PYLCGL Y+++ V VI+  RV CS   SIPEA
Sbjct  588   FDIGAGHVNPTAACNPGLIYDIQPEDYIPYLCGLGYSDKHVSVIVHKRVKCSKRTSIPEA  647

Query  463   QLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKL  284
             QLNYPSFSI L S  QTY RTVTNVG+  S Y++EI  P GV + V P ++ FS+V QK 
Sbjct  648   QLNYPSFSIKLGSGPQTYIRTVTNVGQPHSTYSLEIVTPNGVDIIVTPDKISFSEVKQKA  707

Query  283   TYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             TY+VTF  + KA  S      QG L W    + V+SPIA
Sbjct  708   TYSVTFRKNGKANAS----YAQGYLNWVGEGYRVKSPIA  742



>ref|XP_003611195.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES94153.1| subtilisin-like serine protease [Medicago truncatula]
Length=756

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/763 (55%), Positives = 523/763 (69%), Gaps = 41/763 (5%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIAS------------KLETYIVRVELPHsristqsssssSVD  2243
             +++ L++S++   CS   I S             L TYIV     H + S   +S  S D
Sbjct  8     MQLSLLVSLIFILCSFNQITSVFAAEENQEHDHNLMTYIV-----HVKKSENVASFQSED  62

Query  2242  LEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERI  2063
             L  WY SFLP         + RMVF YR+V  GFA KL+ EE K +  KDG + A PER 
Sbjct  63    LHSWYHSFLPQNFPH----KDRMVFSYRHVASGFAVKLTPEEAKSLQEKDGILLARPERT  118

Query  2062  LPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKG  1883
             L LHTTHSP FLGL+   G W D + GKGVIIGV+DSGI   HPSF+DEGMPPPPA+WKG
Sbjct  119   LSLHTTHSPTFLGLKHGQGLWNDDNLGKGVIIGVIDSGIYPYHPSFNDEGMPPPPAKWKG  178

Query  1882  VCELNFTA---CNNKVIGARSF--SERERSVFdddghgthtagtaaGNFVRGANVYGSAN  1718
              CE  FT    CNNK+IGARS   S  +    +   HGTHTA  AAG FV  A+V+G+A 
Sbjct  179   HCE--FTGGKICNNKLIGARSLVKSTIQELPLEKHFHGTHTAAEAAGRFVEDASVFGNAK  236

Query  1717  GTAAGVAPLAHLAIYKVCNE-IGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSI  1541
             G AAG+AP AH+A+YKVC + I C++S ILAAMD AIEDGVD+LSLSLG  S  F ED I
Sbjct  237   GVAAGMAPNAHIAMYKVCTDNIPCAESSILAAMDIAIEDGVDVLSLSLGLGSLPFFEDPI  296

Query  1540  ALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFH  1361
             A+GA++A + G+FVS SA N GP   +LSNEAPW+LTVGAST+DRK+ A   LGN  ++ 
Sbjct  297   AIGAFAATQNGVFVSCSAANSGPGYSTLSNEAPWVLTVGASTIDRKIVALAKLGNGNEYE  356

Query  1360  GETAFQPKDFNSSLLSLVFPG-----QNTSDESSSPYCDSESLRNADVRGKIVVCMTGGF  1196
             GET FQPKDF+  L+ LV+ G       T ++S    C   SL+N D+ GK+VVC  GG 
Sbjct  357   GETLFQPKDFSEQLMPLVYSGSFGFGNQTQNQS---LCLPGSLKNIDLSGKVVVCDVGGR  413

Query  1195  LDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNP  1016
             +    KG+ V N+ G  MIL   E  G +TSATAHVLPA+ ++YA G  I  YI +T NP
Sbjct  414   VSTIVKGQEVLNSGGVAMILANSETLGFSTSATAHVLPAVQLSYAAGLTIKEYIKSTYNP  473

Query  1015  MATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNS  836
              AT  FKGT+ GD  AP+V +FSSRGP++ESPGILKPDIIGPGVNILA W  SVDNK   
Sbjct  474   SATLIFKGTVIGDSLAPSVVSFSSRGPSQESPGILKPDIIGPGVNILAAWGVSVDNK---  530

Query  835   KSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLV  656
                FNI+SGTSMSCPHLSG++AL+KSSHPDWSPA IKSA+MTTA+ LN G  PI +Q L+
Sbjct  531   IPAFNIVSGTSMSCPHLSGISALIKSSHPDWSPAAIKSAIMTTANTLNLGGIPILDQRLL  590

Query  655   TASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVIS  476
              A +F+ GAGHVNP KANDPGLVYD +PEDY+PYLCGL Y+++E+ VI+Q +V CS V S
Sbjct  591   PADIFATGAGHVNPVKANDPGLVYDIEPEDYVPYLCGLGYSDKEIEVIVQRKVKCSNVKS  650

Query  475   IPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKV  296
             IPEAQLNYPSFSI+L S +Q YTRT+TNVG A+S Y VE+  P  + ++V P E+ F++V
Sbjct  651   IPEAQLNYPSFSILLGSDSQYYTRTLTNVGFANSTYKVELEVPLALGMSVNPSEITFTEV  710

Query  295   NQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             N+K+++++ F    K  R +     QG+L W S KH VR PI+
Sbjct  711   NEKVSFSIEFIPQIKENRRSQ-TFAQGSLTWVSDKHAVRIPIS  752



>ref|XP_009616445.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=727

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/748 (55%), Positives = 529/748 (71%), Gaps = 34/748 (5%)
 Frame = -1

Query  2398  NMKFLRMFLILSVLIG---FCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWY  2228
             ++K +  FL +++L+    F    T  S ++TYIV +E     + + S      DL  W+
Sbjct  2     DLKLVLTFLCIALLLSSKTFGDHFTNQSDIDTYIVLLEFRDDLVFSDSK-----DLYRWH  56

Query  2227  KSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             +SFLPTT     +  SR++  YR+V  GFAA LS++EVK +  K GF+SA  + +L LHT
Sbjct  57    QSFLPTTSTNSEH-SSRIIHSYRHVFNGFAAVLSSDEVKMIEKKPGFVSARRQNVLQLHT  115

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             THSP FLGL QN+G W  S+ GKGVIIGV+D+GI   HPSF+D GMPPPP++WKG CE N
Sbjct  116   THSPDFLGLHQNVGLWNVSNSGKGVIIGVIDTGITPQHPSFNDNGMPPPPSKWKGKCEFN  175

Query  1867  FTACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLA  1688
              T CNNK+IGAR+F++   S  DDDGHGTHT+ TAAGNFV GAN+  +A GTAAG+AP A
Sbjct  176   LTVCNNKLIGARNFAQNATSPVDDDGHGTHTSSTAAGNFVEGANLLVNAKGTAAGIAPRA  235

Query  1687  HLAIYKVCNEIGCSDSEILAAMDTAIEDGVD-IlslslggmssSFHEDSIALGAYSAMEK  1511
             H+A+Y+VC    C +S+ILA +D AIEDGVD I        S S ++D +A+G+YSA+EK
Sbjct  236   HVAMYRVCAS-KCQESDILAGLDAAIEDGVDVISISLGSLASMSLYDDVVAIGSYSAIEK  294

Query  1510  GIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDF  1331
             GIFVSASAGN GP NGS++N APW+LTVGAST DRK+SA  VLGN  ++ GE+ +QP +F
Sbjct  295   GIFVSASAGNTGPVNGSVTNGAPWLLTVGASTTDRKISAVAVLGNGAEYGGESVYQPSNF  354

Query  1330  NSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVC-MTGGFLDRRGKGEAVKNAS  1154
             +  LL LV P           YC  E L   DV+GKIV+C  +         G+ VK+A 
Sbjct  355   SQKLLPLVNP----------EYC--EFLSTIDVKGKIVLCERSNTGYSAVQYGQNVKDAG  402

Query  1153  GRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDK  974
             G  MIL+  E  G TT A  HVLPA  ++YADG+KIL Y+ +T+ P+AT SFKGT  GDK
Sbjct  403   GAAMILMNNEWRGYTTIADVHVLPATHVSYADGEKILNYMKSTTAPVATISFKGTRIGDK  462

Query  973   NAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSC  794
             +AP VA FSSRGP   S GILKPDIIGPGVNILA W TSV    ++ S FNI+SGTSM+C
Sbjct  463   HAPAVADFSSRGP--FSFGILKPDIIGPGVNILAAWRTSVGEITSATSIFNILSGTSMAC  520

Query  793   PHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNP  614
             PHL+GVAALLKS+HPDWSPA IKSA+MTTAD +N G +PIQ++    A++ + G+GHVNP
Sbjct  521   PHLAGVAALLKSTHPDWSPAAIKSAIMTTADFVNLGNDPIQDERFKPANLLATGSGHVNP  580

Query  613   SKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSII  434
             S+ANDPGL+YD +PEDY+PYLCGLNYT+++V VI++ +V+C++  SIPE++LN PSFSI 
Sbjct  581   SRANDPGLIYDIQPEDYVPYLCGLNYTDQQVSVIVKRKVHCTS--SIPESELNNPSFSIP  638

Query  433   LESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSS  254
             L+S  QTYTRTVTNVGEA+S YTV++F   GV+V V P  L+FS +NQK +YNVT   S 
Sbjct  639   LKSGDQTYTRTVTNVGEANSTYTVKVFGLDGVEVTVNPTTLKFSALNQKASYNVTVKPSP  698

Query  253   KAARSNMPPVVQGALRWKSVKHHVRSPI  170
               A S      QG + W S ++ VRSPI
Sbjct  699   LIADS------QGYITWSSDRYSVRSPI  720



>gb|KHN09746.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=686

 Score =   752 bits (1942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/684 (57%), Positives = 494/684 (72%), Gaps = 15/684 (2%)
 Frame = -1

Query  2185  ESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMG  2006
             + RM++ YRNVM GFAA+L+ EE++ +  K+GFI A PERIL   TTH+P FLGLQQ+MG
Sbjct  11    QPRMIYSYRNVMSGFAARLTEEELRAVQKKNGFIYAQPERILHRQTTHTPQFLGLQQDMG  70

Query  2005  FWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF  1826
             FW++S++GKGVI+GV+DSGI  DHPSFSD GMPP   +WKG CELN TACNNK+IGARSF
Sbjct  71    FWKESNFGKGVIVGVVDSGIEPDHPSFSDAGMPP---KWKGKCELNATACNNKLIGARSF  127

Query  1825  S------ERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVC  1664
             +      +   S  D+DGHGTHTA TAAG FV  A + G+A GTAAG+AP AHLA+Y+VC
Sbjct  128   NLAATAMKGADSPIDEDGHGTHTASTAAGAFVDHAELLGNAKGTAAGIAPYAHLAMYRVC  187

Query  1663  NEIGCSDSEILAAMDTAIEDGVD-IlslslggmssSFHEDSIALGAYSAMEKGIFVSASA  1487
                 C +S+ILAA+D A+EDGVD I           F  DS A+GA++AM+KGIFVS +A
Sbjct  188   FGEDCPESDILAALDAAVEDGVDVISISLGLSEPPPFFHDSTAIGAFAAMQKGIFVSCAA  247

Query  1486  GNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLV  1307
             GN GPF+GSL N APW+LTVGAS +DR ++AT  LGN Q+F GE+ FQP DF+ +LL L 
Sbjct  248   GNSGPFHGSLINGAPWVLTVGASNIDRSIAATAKLGNGQEFDGESVFQPSDFSPTLLPLA  307

Query  1306  FPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEP  1127
             + G+N   E++  +C + SL ++D RGK+V+C  GG + R  KGE VK   G  MIL+  
Sbjct  308   YAGKNGKQEAA--FCANGSLNDSDFRGKVVLCERGGGIGRIPKGEEVKRVGGAAMILMND  365

Query  1126  EEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFS  947
             E  G +  A  HVLPA  ++Y  G KI AYIN+T+ P+AT  FKGTI G+  AP V +FS
Sbjct  366   ESNGFSVLADVHVLPATHVSYDAGLKIKAYINSTAIPIATILFKGTIIGNSLAPAVTSFS  425

Query  946   SRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAAL  767
             SRGPN  SPGILKPDIIGPGVNILA WP  ++N  +SKSTFN +SGTSMSCPHLSG+AAL
Sbjct  426   SRGPNLPSPGILKPDIIGPGVNILAAWPFPLNNDTDSKSTFNFMSGTSMSCPHLSGIAAL  485

Query  766   LKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLV  587
             LKSSHP WSPA IKSA+MT+ADI+N  +  I ++ L  A VF+ G+GHVNPS+ANDPGLV
Sbjct  486   LKSSHPHWSPAAIKSAIMTSADIINFERKLIVDETLHPADVFATGSGHVNPSRANDPGLV  545

Query  586   YDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYT  407
             YD +P+DY+PYLCGL Y++ +VG+I    + CS   SIPE +LNYPSFS++L S  QT+T
Sbjct  546   YDIQPDDYIPYLCGLGYSDTQVGIIAHKTIKCSETSSIPEGELNYPSFSVVLGS-PQTFT  604

Query  406   RTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPP  227
             RTVTNVGEA+S Y V +  P GV+V ++P +L FS  NQK  Y+V+FS       +    
Sbjct  605   RTVTNVGEANSSYVVMVMAPEGVEVRIQPNKLTFSGENQKEIYSVSFSRIESGNET--AE  662

Query  226   VVQGALRWKSVKHHVRSPIAAKLV  155
               QG L+W S KH VRSPI    V
Sbjct  663   YAQGFLQWVSAKHSVRSPILVNFV  686



>gb|EYU29357.1| hypothetical protein MIMGU_mgv1a021077mg [Erythranthe guttata]
Length=719

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/731 (58%), Positives = 517/731 (71%), Gaps = 35/731 (5%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTV------AGGGYGESRMVFMYR  2159
             L+ YIV V+                DLE +Y SFLPT              + R+++ YR
Sbjct  4     LDVYIVHVDHAQISD----------DLETFYDSFLPTNTNLAAASTNSTTDQPRILYRYR  53

Query  2158  NVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGK  1979
             +V+ GFAAKLSA +V+ M +  GF+SA PER+L LHTTHSP FLGL QN G W++SSYGK
Sbjct  54    HVISGFAAKLSAADVEVMRHMKGFVSARPERMLHLHTTHSPNFLGLNQNTGLWKNSSYGK  113

Query  1978  GVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCEL--NFTACNNKVIGARSF---SERE  1814
             G+IIG++DSGI  DHPS +D GMPPPPA+WKG C+      ACNNK+IGAR F   S  E
Sbjct  114   GIIIGMVDSGILPDHPSLADRGMPPPPAKWKGKCDFISRKWACNNKLIGARYFYHNSGTE  173

Query  1813  RSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEI  1634
               + D  GHGTHT+G AAGNFV GA  +G+A GTA+G+AP AH+A+Y+ C    C++S +
Sbjct  174   PPLIDQIGHGTHTSGIAAGNFVEGAGFFGNAGGTASGIAPFAHVAMYQPCKYHNCTESNV  233

Query  1633  LAAMDTAIEDGVDIlslslg-gmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSL  1457
              AAMD AIEDGVD+LS+SLG      F +D +A+GA+ A+EKGI VS SAGN+GP + SL
Sbjct  234   AAAMDAAIEDGVDVLSMSLGGAYLHRFPDDIMAIGAFRAIEKGIVVSCSAGNDGPKSKSL  293

Query  1456  SNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNS-SLLSLVFPGQNTSDE  1280
             SNEAPW++TVGAST+DRK+ AT +LGN ++  GET      F S   L LV+P    +  
Sbjct  294   SNEAPWIMTVGASTIDRKIVATAMLGNGEELEGETG---TGFPSIGKLHLVYPRSFYTRV  350

Query  1279  SSSPYCDSESLRNADVRGKIVVCMTGGFLDRR-GKGEAVKNASGRGMILIEPEEYGITTS  1103
             SS  Y       N DVRGKIV+C +G  +  R  +G  VK A G  MILI  +  G TT 
Sbjct  351   SSCVY-----RFNTDVRGKIVLCDSGDHISNRVEQGRTVKKAGGAAMILINYKSDGDTTF  405

Query  1102  ATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRES  923
                HVLPA+ I Y DG K+ AY+N+TSNP AT SFKGT+ G   AP V AFSSRGPN+ S
Sbjct  406   DDPHVLPAMQIGYVDGLKLKAYVNSTSNPTATMSFKGTVIGSGRAPVVPAFSSRGPNKVS  465

Query  922   PGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDW  743
             PGILKPDIIGPGVNILA WP SV+NK N KSTFNI+ GTSMSCPHLSGVAALLKS+HPDW
Sbjct  466   PGILKPDIIGPGVNILAAWPVSVENKTNIKSTFNILYGTSMSCPHLSGVAALLKSAHPDW  525

Query  742   SPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDY  563
             SPA IKSA+MTTAD LN   NPI+N+HL  ASVF++G+GHVNPS+ANDPGLVYD  P+DY
Sbjct  526   SPAAIKSAIMTTADHLNLKGNPIENEHLKPASVFAVGSGHVNPSRANDPGLVYDILPDDY  585

Query  562   LPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGE  383
             +PYLCGLNYTN+EVG+I++ +V+CS   SIPEAQLNYPSFSII  ST QTYTRT+TNVG+
Sbjct  586   IPYLCGLNYTNQEVGIIVKCKVDCSKKKSIPEAQLNYPSFSIIFGSTPQTYTRTLTNVGK  645

Query  382   ASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRW  203
             A+S Y VEI    GV V VEP +L F K+  K +Y+VTF+ ++K A   M    QG +RW
Sbjct  646   ANSSYDVEIVSSHGVNVKVEPHKLVFPKLGDKSSYSVTFTRTTKEA---MNSTTQGFIRW  702

Query  202   KSVKHHVRSPI  170
              +  H VRSPI
Sbjct  703   YTADHSVRSPI  713



>ref|XP_008381959.1| PREDICTED: subtilisin-like protease SDD1 [Malus domestica]
Length=1289

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/733 (57%), Positives = 535/733 (73%), Gaps = 23/733 (3%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYG-ESRMVFMYRNVMKG  2144
             ++TYIV VE P   +S + S  S+ DL  WY+SFLP ++A        RMV  YRN+  G
Sbjct  560   MQTYIVWVEKP---VSQKFSPQSNEDLGXWYQSFLPESIASSNQQMNQRMVHSYRNIATG  616

Query  2143  FAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIG  1964
             FAAKL+ EEV+EM  K+GF+SA P+RILPL TTH+P FLGL Q  G W  ++YGKGVIIG
Sbjct  617   FAAKLTPEEVREMETKEGFVSARPQRILPLQTTHTPDFLGLHQGSGLWEAATYGKGVIIG  676

Query  1963  VLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF------SERERSVF  1802
             +LD+GI  DHPSF+DEGMPPPPA+WKG CE N T CNNK+IGAR+F        + R  F
Sbjct  677   LLDTGIVPDHPSFNDEGMPPPPAKWKGKCEFNETLCNNKLIGARNFIGVGKGQPKRRFPF  736

Query  1801  dddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAM  1622
             D  GHG+HT+ TAAG FV GA+VYG ANGTAAG+AP AHLA+YKVC   GC+D++I AA+
Sbjct  737   DIAGHGSHTSSTAAGRFVEGASVYGQANGTAAGMAPYAHLAMYKVCEGFGCADADIFAAL  796

Query  1621  DTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAP  1442
             D AI+DGVD+LSLSLGG S  F++D IA+GA++A++KGIF S + GN GP+N +LSN+AP
Sbjct  797   DVAIDDGVDVLSLSLGGPSLPFYDDVIAIGAFAAIQKGIFFSCAGGNSGPWNRTLSNDAP  856

Query  1441  WMLTVGASTVDRKLSATVVLGNRQQFH--GETAFQPKDFNSSLLSLVFPGQNTSDESSSP  1268
             W+LTVGAST DR L++ + +G+ +Q+H  G++  QP+DF+ ++L  +    +  ++SS  
Sbjct  857   WILTVGASTTDRILTSGLQIGDEKQYHFDGKSLSQPEDFDXTVLLPLVDAGSFGNQSS--  914

Query  1267  YCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHV  1088
             +C + SL+N  V GKIV+C TGG +    KGE VK A G  MIL+  E  G +T A AHV
Sbjct  915   FCKAGSLKN--VEGKIVLCETGGGVTNIXKGEEVKRAGGAAMILMNKEIDGFSTLAEAHV  972

Query  1087  LPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILK  908
             LPA  ++YA G +I  YI++TS P  T  F GT+ GD  AP VA+FSSRGPN  SPGILK
Sbjct  973   LPATHVSYAAGLQIKLYISSTSTPKGTILFNGTVIGDALAPKVASFSSRGPNIASPGILK  1032

Query  907   PDIIGPGVNILAPWPTSVDN--KPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPA  734
             PD+IGPGV+ILA WP +VDN   PN K+ FNIISGTSM+CPHLSG+AALLKS+HPDWSPA
Sbjct  1033  PDVIGPGVSILAAWPYNVDNVTHPNPKALFNIISGTSMACPHLSGIAALLKSTHPDWSPA  1092

Query  733   MIKSAMMTTADILNHGQNPIQNQH-LVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLP  557
              IKSA+MTTAD+LN   +PI ++  L  A VF+IGAGHVNPSKANDPGL++D KPEDY+P
Sbjct  1093  AIKSAIMTTADVLNLLGSPIVDESGLKPADVFAIGAGHVNPSKANDPGLIFDLKPEDYIP  1152

Query  556   YLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL---ESTAQTYTRTVTNVG  386
             YLCGLNY +  + +I Q  V CS V +IPEAQLNYPSF+I +   ++  Q YTRTV NVG
Sbjct  1153  YLCGLNYNDTVIKIITQQAVKCSQVGAIPEAQLNYPSFAITIGPNQTRTQYYTRTVRNVG  1212

Query  385   EASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALR  206
              A+S Y +E+  P  + ++V P+ L F++VNQ++TY+V F+    A +  + P  QG LR
Sbjct  1213  PATSTYNLELLVPHEMGMSVNPQVLTFTEVNQEITYHVEFNAHDGAGKDGV-PFGQGYLR  1271

Query  205   WKSVKHHVRSPIA  167
             W S KH+V +PIA
Sbjct  1272  WFSDKHNVTTPIA  1284


 Score =   310 bits (795),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 152/250 (61%), Positives = 191/250 (76%), Gaps = 5/250 (2%)
 Frame = -1

Query  991  TITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNK--PNSKSTFNI  818
            T+ GD  AP VA FSSRGP+  SPGILKPDIIGPGV+ILA WP SVDN   PN K+TFNI
Sbjct  283  TVIGDALAPKVAFFSSRGPSIASPGILKPDIIGPGVDILAAWPESVDNATLPNPKATFNI  342

Query  817  ISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFS  638
            ISGTSM+ PHLSG+ ALLK SHPDWSPA IKSA+MTTA++LN   + I +Q L  A +F+
Sbjct  343  ISGTSMATPHLSGIGALLKKSHPDWSPAXIKSAIMTTANVLNLAGSXIVDQQLQPADIFT  402

Query  637  IGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQL  458
            +GAGHVNP+ ANDPGL++D KPEDY+PYLCGL +   ++ +I Q  VNCS   +IPEAQL
Sbjct  403  LGAGHVNPAXANDPGLIFDIKPEDYIPYLCGLYHNETQIKMITQRXVNCSQAGAIPEAQL  462

Query  457  NYPSFSIIL---ESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQK  287
            NYPSF+I +   E+ +Q YTRTV NVG  SS Y++++  P  + ++V P+ L F+KVNQ+
Sbjct  463  NYPSFAITIGSNETQSQYYTRTVRNVGPXSSTYSLDLLVPHKMGMSVNPQVLTFTKVNQE  522

Query  286  LTYNVTFSLS  257
            +TY+V F LS
Sbjct  523  ITYHVEFXLS  532


 Score =   266 bits (681),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 165/313 (53%), Positives = 199/313 (64%), Gaps = 48/313 (15%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGY-GESRMVFMYRNVMKG  2144
             ++TYIV VE P          S  +DLE WY+SFLP T         SR+V  YR V+ G
Sbjct  1     MQTYIVFVEKP-----VSQKFSDQLDLESWYQSFLPETAQSSNQETSSRIVHAYRKVVTG  55

Query  2143  FAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIG  1964
             FAAKL+ EEVK M NK+GF+SA  ERILPL TTHSP FLGL Q  G W+ ++YG+GVIIG
Sbjct  56    FAAKLTPEEVKAMKNKEGFVSAREERILPLQTTHSPDFLGLHQGFGLWKQTNYGEGVIIG  115

Query  1963  VLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERER-----SVFd  1799
             +LD+GI  DHPSF DE + PPPA+WKG CE N T CNNK+IGAR+F   E      + FD
Sbjct  116   LLDTGIGPDHPSFXDEXVSPPPAKWKGKCEFNGTVCNNKLIGARNFIGXEEGHITGTPFD  175

Query  1798  ddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMD  1619
             + GHGTHT+ TAAGNFV+GA+V+G AN                                 
Sbjct  176   NHGHGTHTSSTAAGNFVQGASVFGEAN---------------------------------  202

Query  1618  TAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPW  1439
                 DGVD+LSLSLGG S  F+ D  A+GA++A++KGIF S +AGN GP   SLSNEAPW
Sbjct  203   ----DGVDVLSLSLGGESLXFYNDVJAIGAFAAIQKGIFFSCAAGNXGPSYESLSNEAPW  258

Query  1438  MLTVGASTVDRKL  1400
             +LTVGAST DR L
Sbjct  259   ILTVGASTTDRIL  271



>ref|XP_004511627.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=763

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/761 (55%), Positives = 524/761 (69%), Gaps = 34/761 (4%)
 Frame = -1

Query  2389  FLRMFLILSVLIGFCSTATIASK--------LETYIVRVELPHsristqsssssSVDLEH  2234
             F+ +  +L+ +    S++  A K        L TYIV     H + S  +++  S DL  
Sbjct  13    FVALIFMLNGINQITSSSLAAEKNQEHENENLMTYIV-----HVKKSENAATLQSQDLHE  67

Query  2233  WYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPL  2054
             W+ SFLP T       ++RMVF YRNV  GFA KL+ EE K +  K+  +SA PER L L
Sbjct  68    WFHSFLPQTSH-----KNRMVFTYRNVASGFAVKLTPEEAKSLQEKEEIVSARPERKLSL  122

Query  2053  HTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCE  1874
             HTTH+P FLGL+Q  G W   + GKGVIIG++D+GI   HPSF+DEGM PPPA+WKG CE
Sbjct  123   HTTHTPTFLGLKQGQGLWNYDNLGKGVIIGIIDTGINPFHPSFNDEGMAPPPAKWKGYCE  182

Query  1873  LNF-TACNNKVIGARSF--SERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAG  1703
                   CNNK++GAR+   S  +    +D  HGTHTA  AAG FV  A+V+G+A G AAG
Sbjct  183   FTRGRTCNNKLLGARNLVKSAMQELPNEDVFHGTHTAAEAAGRFVEDASVFGNAGGVAAG  242

Query  1702  VAPLAHLAIYKVC---NEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALG  1532
             +AP AH+AIYKVC   +EIGC +S ILAAMD AIEDGVD+LSLSLG  S  F EDSIA+G
Sbjct  243   MAPNAHIAIYKVCTIIDEIGCPESAILAAMDMAIEDGVDVLSLSLGLGSLPFFEDSIAIG  302

Query  1531  AYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGET  1352
             A++A + GIFVS SAGN GP   +LSNEAPW+LTVGAST+DRK+ A+  LG+ +++ GET
Sbjct  303   AFAATQNGIFVSCSAGNSGPDYSTLSNEAPWILTVGASTIDRKIVASAKLGDGEEYEGET  362

Query  1351  AFQPKDFNSSLLSLVFPG------QNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLD  1190
              FQPKDF+  L  LV+ G      Q+ +  S    C   SL+N D+RGK+V+C  GG + 
Sbjct  363   LFQPKDFSQQLFPLVYAGSYGNSNQSETQTSDQSLCFPGSLKNVDLRGKVVLCDAGGGIP  422

Query  1189  RRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMA  1010
                KG+ V N+ G  MIL  PEE G++T AT +VLPA++++YA G  I +YIN T+ P +
Sbjct  423   SDLKGQEVLNSGGVAMILANPEELGVSTFATPNVLPAVEVSYAAGLSIKSYINLTNTPTS  482

Query  1009  TFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKS  830
             T  FKGT+ GD  AP+V  FSSRGPN+ESPGILKPDIIGPGVNILA W  SVDNK     
Sbjct  483   TLLFKGTVIGDSLAPSVVTFSSRGPNQESPGILKPDIIGPGVNILAAWGISVDNK---IP  539

Query  829   TFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTA  650
              +NI+SGTSMSCPHLSG+AALLKSSHPDWSPA IKSA+MTTA   N    PI +Q L+ A
Sbjct  540   PYNIVSGTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIMTTATTKNLAGLPIMDQRLLPA  599

Query  649   SVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIP  470
              VF+ GAGHVNP KANDPGLVYD KPEDY+ YLCGL Y+++E+ +I+Q +VNC  V SI 
Sbjct  600   DVFATGAGHVNPVKANDPGLVYDIKPEDYVSYLCGLGYSDKEIEIIIQWKVNCFDVKSIA  659

Query  469   EAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQ  290
             EA+LNYPSFSI L S +Q YTRT+TNVG  +S Y V+I EP  + ++V P E+ FS+VNQ
Sbjct  660   EAELNYPSFSIRLGSDSQFYTRTLTNVGPVNSTYRVKIEEPLALGMSVNPTEITFSEVNQ  719

Query  289   KLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             K++Y+V F    K  R N     QG++ W S KH VR PI+
Sbjct  720   KVSYSVDFIPQGKENRGNA-TFAQGSITWVSDKHAVRVPIS  759



>ref|XP_011081104.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SDD1 
[Sesamum indicum]
Length=652

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/677 (61%), Positives = 497/677 (73%), Gaps = 30/677 (4%)
 Frame = -1

Query  2176  MVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWR  1997
             M++ Y NV KGFAA+LSA+E+K M NK GF+SA PER L LHTTHSP FLGL QNMGFW 
Sbjct  1     MIYSYHNVFKGFAARLSADELKAMENKVGFVSAHPERKLSLHTTHSPNFLGLNQNMGFWN  60

Query  1996  DSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA-CNNKVIGARSFSE  1820
             +S+YGKGVIIGVLD+GI                 +    C+ N T  CNNK+IGAR F+ 
Sbjct  61    ESNYGKGVIIGVLDTGIFPXXXXXXXXXXXXXXXK----CDFNVTTKCNNKLIGARYFNS  116

Query  1819  RERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDS  1640
              +  + DD+GHGTHTA TAAGNFVRGANV+G+ANGTA G+APLAHLAIYKVC+ + CS+S
Sbjct  117   FDGPI-DDNGHGTHTASTAAGNFVRGANVFGNANGTAVGIAPLAHLAIYKVCS-VSCSES  174

Query  1639  EILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGS  1460
             +ILAAMD AI+DGVDILSLSLGG +++F++DSIALGAYSAMEK +               
Sbjct  175   DILAAMDAAIDDGVDILSLSLGGFANNFYDDSIALGAYSAMEKVV---------------  219

Query  1459  LSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDE  1280
              SNEAPW+LTVGAST+DRK+ AT VLGN Q F GE+ FQP DF  + L LV+ G   + +
Sbjct  220   -SNEAPWILTVGASTIDRKIRATAVLGNNQTFDGESTFQPMDFPPTSLPLVYAGMLNTSD  278

Query  1279  SSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSA  1100
              +  +C + SL   D+RGKIVVC  G F  R  KG AVK A G  MIL+ P  Y   T +
Sbjct  279   RNIQFCTAASLNRTDIRGKIVVCEIG-FTTRIAKGRAVKAAGGAAMILVNPASYANLTLS  337

Query  1099  TAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESP  920
              +HVLPA  ++YADG KI  YIN+TS P A   FKGTI GD  AP VAAFSSRGPN  S 
Sbjct  338   ESHVLPATHVSYADGLKIKTYINSTSTPTAAIVFKGTIIGDDRAPVVAAFSSRGPNYVSR  397

Query  919   GILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWS  740
             GILKPDI+GPGVNILA WP SV+N  N+ +TFNIISGTSMSCPHLSGVAALLKSSHPDWS
Sbjct  398   GILKPDILGPGVNILAAWPVSVENNTNTNATFNIISGTSMSCPHLSGVAALLKSSHPDWS  457

Query  739   PAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYL  560
             PA IKSA+MTTADILN  QNPI+++  + A++F+ G+GHVNPS+AN+PGL+YD +P+DY+
Sbjct  458   PAAIKSAIMTTADILNLAQNPIEDERFLPANIFATGSGHVNPSRANNPGLIYDIQPKDYI  517

Query  559   PYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSII---LESTAQTYTRTVTNV  389
             PYLCGLNYT+R+V  ILQ +VNCSA   IPEAQLNYPSF++     + T QTYTRTVTNV
Sbjct  518   PYLCGLNYTDRQVASILQRKVNCSAESRIPEAQLNYPSFALTFSPFQPTVQTYTRTVTNV  577

Query  388   GEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGAL  209
             GEA+S Y V+I  PPG+ V VEP +L F +VNQKL Y VTF   S+   S+   VVQG L
Sbjct  578   GEANSSYVVKIVPPPGIDVVVEPSKLDFLEVNQKLQYQVTF---SRLNSSSNIGVVQGYL  634

Query  208   RWKSVKHHVRSPIAAKL  158
             +W S +  VRSPIA  L
Sbjct  635   KWNSSRRSVRSPIAVIL  651



>ref|XP_010325680.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=1227

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/732 (59%), Positives = 532/732 (73%), Gaps = 18/732 (2%)
 Frame = -1

Query  2344  STATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFM  2165
             + A  ++ L+TY+V V  P +RI   S      DLE +Y SFLP  +AG     SR++  
Sbjct  510   TVAQRSNALQTYLVHVNKPDARILANSD-----DLESYYSSFLPEVLAGAEE-PSRIIHS  563

Query  2164  YRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSY  1985
             Y +V  GFAA+LSAEEV EM  KDGF+SA  E+IL LHTTH+P FLGL +NMG W++S+Y
Sbjct  564   YHHVAIGFAARLSAEEVNEMEKKDGFVSARVEKILALHTTHTPNFLGLYRNMGLWQESNY  623

Query  1984  GKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCEL--NFTACNNKVIGARSF-SERE  1814
             GKGVIIGVLD+GI  +HPSFSDE MP PPA+WKG CE   N T CN K+IGAR+      
Sbjct  624   GKGVIIGVLDTGITPNHPSFSDENMPSPPAKWKGKCEFRGNVT-CNKKIIGARNLVGGSS  682

Query  1813  RSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEI  1634
                FDD+GHGTHT+ TAAGNFV  A+++G+ANGTAAG+APLAH+A+YKVC E  CSD +I
Sbjct  683   DPPFDDEGHGTHTSSTAAGNFVDDASLFGNANGTAAGMAPLAHIAMYKVCTE-SCSDVDI  741

Query  1633  LAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLS  1454
             LAA+D+AI+DGVD+LSLS+GG S  F+ED IA GA++AM+KGIFVS SAGNEGP N +LS
Sbjct  742   LAALDSAIDDGVDVLSLSIGGFSDPFYEDGIATGAFAAMQKGIFVSVSAGNEGPLNSTLS  801

Query  1453  NEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESS  1274
             NEAPW+LTVGAST DRK+ AT VLGN Q++ GE+AFQP  F  +LL LV+PG +  D + 
Sbjct  802   NEAPWILTVGASTHDRKIVATTVLGNGQEYDGESAFQPASFPHTLLPLVYPGFSDQDAA-  860

Query  1273  SPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATA  1094
                C S SL N DV+GK+VVC  GG + R  K + VK+A G  MIL   E  G  T A A
Sbjct  861   --LCSSGSLNNTDVKGKVVVCDRGGDVPRLEKSQTVKDAGGAAMILTNLEIDGDGTFADA  918

Query  1093  HVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGI  914
             HVLPA  + Y  G+ I AYIN+TS P A   FKGTI G K++P+V++FSSRGPN  SPGI
Sbjct  919   HVLPATHVGYTAGESIKAYINSTSTPSAGIIFKGTIIGFKSSPSVSSFSSRGPNLASPGI  978

Query  913   LKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPA  734
             +KPDIIGPGVNILA WP SV+NK  +  TFNIISGTSMSCPHLSG+AALLKS+HPDWSPA
Sbjct  979   VKPDIIGPGVNILAAWPISVENKTGTDLTFNIISGTSMSCPHLSGIAALLKSAHPDWSPA  1038

Query  733   MIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPY  554
              IKSA+MTTAD  N    PI +Q  + A +F+ GAGHVNPSKA+DPGL+YD K E+Y+ Y
Sbjct  1039  AIKSAIMTTADQFNLEGQPILDQRDLPADIFATGAGHVNPSKASDPGLIYDIKVENYIQY  1098

Query  553   LCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASS  374
             LCGL Y ++++ ++ Q  V CS   SI EA+LNYPSFSIIL    Q YTRTVTNVG+ASS
Sbjct  1099  LCGLGYKDKDIELLAQQTVKCSLQSSISEAELNYPSFSIILGPQTQNYTRTVTNVGDASS  1158

Query  373   FYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSV  194
              YTV I +  GV V VEP  L F++VNQ+ TY+V+F+ +           VQGA+ W S 
Sbjct  1159  TYTVNITQIQGVDVVVEPATLVFTQVNQQETYSVSFTQTGLITDR----FVQGAISWISN  1214

Query  193   KHHVRSPIAAKL  158
             K+ VR PI+ KL
Sbjct  1215  KYVVRIPISVKL  1226


 Score =   199 bits (505),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 130/187 (70%), Gaps = 4/187 (2%)
 Frame = -1

Query  742  SPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDY  563
            S A IKSA+MTTAD  N    PI +Q  + A +F+ GAGHVNPSKANDPGL+YD +P +Y
Sbjct  327  SIAAIKSAIMTTADQFNLEGQPILDQRNLPADIFATGAGHVNPSKANDPGLIYDIQPHNY  386

Query  562  LPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGE  383
            + YLCGL YT++++G+I+Q  + CS   +I EA+LNYPSFSIIL   +QTYTRTVTNVG+
Sbjct  387  IQYLCGLGYTDKQIGLIVQQTIKCSQQSAILEAELNYPSFSIILGPQSQTYTRTVTNVGD  446

Query  382  ASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRW  203
            ASS YTV I +  GV + V+P  L F+KVNQ+ TY+VTF+             VQGA+ W
Sbjct  447  ASSTYTVNITQIRGVHIVVKPTTLVFTKVNQQATYSVTFTQIGDITGH----FVQGAISW  502

Query  202  KSVKHHV  182
             S   H+
Sbjct  503  MSNNLHL  509


 Score =   184 bits (466),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 120/272 (44%), Positives = 160/272 (59%), Gaps = 48/272 (18%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S L+TYIV V  P  ++   S      DLE +Y SF+P  + G     +R++  Y +V+ 
Sbjct  24    SSLQTYIVHVNKPDVQVVANS-----ADLESYYNSFVPVEIVGSEE-PTRIIHSYHHVVS  77

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAA+LSAEEVKEM  KDGF+ A  E+IL LH T +P FLGL QN+G W++S+YGKGVII
Sbjct  78    GFAARLSAEEVKEMEMKDGFVYARVEKILALHITRTPNFLGLYQNVGLWQESNYGKGVII  137

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCE-LNFTACNNKVIGARSFSERERS-VFddd  1793
             GVLD+GI   HP FSD+ MPPPP +WKG CE +    CN K+IGAR+F       +F+  
Sbjct  138   GVLDTGINPGHPCFSDKNMPPPPEKWKGKCEFVGDVTCNKKLIGARNFVRGSTDPLFEKG  197

Query  1792  ghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTA  1613
             GHGT T+  AAGNFV  ANV+                                       
Sbjct  198   GHGTLTSSVAAGNFVDDANVF---------------------------------------  218

Query  1612  IEDGVDIlslslggmssSFHEDSIALGAYSAM  1517
              +DGVD+LSLS+GG ++ F++D +A+GA+  +
Sbjct  219   -DDGVDVLSLSIGGYTAPFYDDGMAIGAFGKI  249


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = -1

Query  1228  GKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQK  1049
             GKIVVC   G + +  KG+ V++A G  M+L   E  G  T A   +LP  ++ Y+ G+ 
Sbjct  247   GKIVVCDKSGGVTKLEKGKTVRDAGGVAMVLANLEIDGDGTLAYVDLLPTTNVGYSAGEI  306

Query  1048  ILAYINATSNPMATFSFKGT  989
             I AY+N+TS P+A   FKGT
Sbjct  307   IKAYVNSTSTPLAGILFKGT  326



>ref|XP_003611198.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES94156.1| subtilisin-like serine protease [Medicago truncatula]
Length=753

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/765 (55%), Positives = 525/765 (69%), Gaps = 38/765 (5%)
 Frame = -1

Query  2395  MKFLRMFLILSVLIGFCSTATIAS-------------KLETYIVRVELPHsristqssss  2255
             M  + + L++S++   CS   I S              L TYIV     H + S   +S 
Sbjct  1     MMKMELTLLVSLIFIICSINQITSMLIAEENLEHDQINLMTYIV-----HVKKSENVASL  55

Query  2254  sSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAA  2075
              S DL  WY SFLP T       + RMVF YR V  GFA KL+ EE K +  K   +SA 
Sbjct  56    QSEDLHSWYHSFLPQTFPH----KERMVFSYRKVASGFAVKLTPEEAKSLQEKGEIVSAR  111

Query  2074  PERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPA  1895
             PER L LHTTH+P FLGL+Q  G W D + GKGVIIG++DSGI   HPSF+DEGMPPPPA
Sbjct  112   PERTLELHTTHTPTFLGLKQGQGLWSDDNLGKGVIIGIIDSGIFPLHPSFNDEGMPPPPA  171

Query  1894  RWKGVCELNF-TACNNKVIGARSFSER--ERSVFdddghgthtagtaaGNFVRGANVYGS  1724
             +WKG CE      CNNK+IGAR+  +   +   F++  HGTHTA  AAG FV  A+V+G+
Sbjct  172   KWKGHCEFTGGQVCNNKLIGARNMVKNAIQEPPFENFFHGTHTAAEAAGRFVEDASVFGN  231

Query  1723  ANGTAAGVAPLAHLAIYKVCNE-IGCSDSEILAAMDTAIEDGVDIlslslggmssSFHED  1547
             A G AAG+AP AH+A+YKVC++ I C +S +LAA+D AIEDGVD+LSLSLG  S  F ED
Sbjct  232   AKGVAAGMAPNAHIAMYKVCDDNIRCFESSVLAAIDIAIEDGVDVLSLSLGLGSLPFFED  291

Query  1546  SIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQ  1367
              IA+GA++A + G+FVS SA N GP   +LSNEAPW+LTVGAST+DRK+ A+  LGN  +
Sbjct  292   PIAIGAFAATQNGVFVSCSAANSGPGYSTLSNEAPWILTVGASTIDRKIVASAKLGNGNE  351

Query  1366  FHGETAFQPKDFNSSLLSLVFPG-----QNTSDESSSPYCDSESLRNADVRGKIVVCMTG  1202
             + GET FQPKDF+  LL LV+ G       T ++S    C   SL+N D+ GK+V+C  G
Sbjct  352   YEGETLFQPKDFSEQLLPLVYAGSFGFGNQTQNQS---LCLPGSLKNIDLSGKVVLCDIG  408

Query  1201  GFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATS  1022
             G +    KG+ V N+ G  +IL+  E  G +T ATAHVLPA++++Y  G  I  YIN+T 
Sbjct  409   GRVPSTVKGQEVLNSGGVAVILVNSESDGFSTFATAHVLPAVEVSYKAGLTIKDYINSTY  468

Query  1021  NPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKP  842
             NP AT  FKGT+ GD  AP+V +FSSRGP++ESPGILKPDIIGPGVNILA W  SVDNK 
Sbjct  469   NPTATLIFKGTVIGDSLAPSVVSFSSRGPSQESPGILKPDIIGPGVNILAAWGVSVDNK-  527

Query  841   NSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQH  662
                  FNI+SGTSMSCPHLSG+AAL+KSSHPDWSPA IKSA+MTTA+ LN G  PI +Q 
Sbjct  528   --IPAFNIVSGTSMSCPHLSGIAALIKSSHPDWSPAAIKSAIMTTANTLNLGGIPILDQR  585

Query  661   LVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAV  482
             L+ A +F+ GAGHVNP KANDPGLVYD +PEDY+PYLCGL Y+++E+ VI+Q +V CS V
Sbjct  586   LLPADIFATGAGHVNPFKANDPGLVYDIEPEDYVPYLCGLGYSDKEIEVIVQWKVKCSNV  645

Query  481   ISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFS  302
              SIPEAQLNYPSFSI+L S +Q YTRT+TNVG A+S Y VE+  P  + ++V P E+ F+
Sbjct  646   KSIPEAQLNYPSFSILLGSDSQYYTRTLTNVGFANSTYRVELEVPLALGMSVNPSEITFT  705

Query  301   KVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             +VN+K++++V F    K  R N     QG+L W S KH VR PI+
Sbjct  706   EVNEKVSFSVEFIPQIKENRRNQ-TFGQGSLTWVSDKHAVRVPIS  749



>dbj|BAF95755.1| subtilase [Lotus japonicus]
Length=750

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/757 (56%), Positives = 527/757 (70%), Gaps = 35/757 (5%)
 Frame = -1

Query  2383  RMFLILSVLIGFCST-----ATIASK-------LETYIVRVELPHsristqsssssSVDL  2240
             RM L+L  L+G  S      A+IA++       L TYIV V+    ++  +    S+ +L
Sbjct  7     RMELVL--LLGLISMLSFIPASIAAEEGQEHDNLTTYIVHVK----KLEIEGPLQSTEEL  60

Query  2239  EHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERIL  2060
               W+ SFLP T       + RMVF YRNV  GFA +L+ EE   +  K+  +S  PER L
Sbjct  61    HTWHHSFLPET-----SNKDRMVFSYRNVASGFAVRLTPEEANALQEKEEVMSIRPERTL  115

Query  2059  PLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGV  1880
              LHTTH+P FLGL+Q  G W DS+ GKGVIIGV+D+GI   H SF+DEGMPPPPA+WKG 
Sbjct  116   SLHTTHTPSFLGLRQGQGLWNDSNLGKGVIIGVIDTGIYPFHLSFNDEGMPPPPAKWKGH  175

Query  1879  CELNF-TACNNKVIGARSF--SERERSVFdddghgthtagtaaGNFVRGANVYGSANGTA  1709
             CE    + CNNK+IGAR+   S  +   ++D  HGTHTA  AAG FV GA+V+G+A GTA
Sbjct  176   CEFTGGSVCNNKLIGARNLVKSAIQEPPYEDFFHGTHTAAEAAGRFVEGASVFGNARGTA  235

Query  1708  AGVAPLAHLAIYKVCN---EIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIA  1538
             AG+AP AHLAIYKVC+   +  C +S ILAAMD AIEDGVD+LSLSLG  S  F ED IA
Sbjct  236   AGMAPDAHLAIYKVCSSKVKDECPESAILAAMDIAIEDGVDVLSLSLGLGSLPFFEDPIA  295

Query  1537  LGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHG  1358
             +GA++A +KGIFVS SA N GP   SLSNEAPW+LTVGAST+DRK+SA+  LGN  ++ G
Sbjct  296   IGAFAATQKGIFVSCSAANSGPHYSSLSNEAPWILTVGASTIDRKISASAKLGNGAEYEG  355

Query  1357  ETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGK  1178
             ET FQPKDF+S LL LV+     ++  SS  C   SLRN +V+GK+VVC  GG +    K
Sbjct  356   ETLFQPKDFSSQLLPLVYAAAEKNN--SSALCAPGSLRNINVKGKVVVCDLGGGIPFIAK  413

Query  1177  GEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSF  998
             G+ V +A G  MIL   E +G TT A AHVLPA+ ++YA    I AYIN+T  P AT  F
Sbjct  414   GQEVLDAGGSAMILANIENFGFTTLANAHVLPAVHVSYAASLAIKAYINSTYTPTATVLF  473

Query  997   KGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNI  818
             +GTI GD  AP+VAAFSSRGP+++SPGILKPDIIGPGVNILA W  SVDNK      F+I
Sbjct  474   QGTIIGDSLAPSVAAFSSRGPSQQSPGILKPDIIGPGVNILAAWAVSVDNK---IPAFDI  530

Query  817   ISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFS  638
             ISGTSMSCPHLSG+AALLKS+HPDWSPA IKSA+MTTA+ LN    PI +Q L  A +F+
Sbjct  531   ISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIMTTANTLNLRGLPILDQRLQPADIFA  590

Query  637   IGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQL  458
              GAGHVNP +ANDPGLVYD +PEDY+PYLCGL Y++REV +I+Q  V C  V SI +A+L
Sbjct  591   TGAGHVNPVRANDPGLVYDIQPEDYVPYLCGLGYSDREVTIIVQRSVRCFNVKSIAQAEL  650

Query  457   NYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTY  278
             NYPSFSI+L S +Q YTRT+TNVG A+S YTV+I  P  + ++V P ++ F++VNQK+ Y
Sbjct  651   NYPSFSILLGSDSQFYTRTLTNVGPANSTYTVKIDVPLAMGISVSPSQITFTQVNQKVAY  710

Query  277   NVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
              V F    K  R N     QGA+ W S KH VR+PI+
Sbjct  711   FVDFIPQIKENRGNH-TFAQGAITWVSDKHVVRTPIS  746



>gb|EYU28957.1| hypothetical protein MIMGU_mgv1a020114mg [Erythranthe guttata]
Length=744

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/758 (56%), Positives = 525/758 (69%), Gaps = 28/758 (4%)
 Frame = -1

Query  2398  NMKFLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSF  2219
             NM  L    I +  +G  +     S  ETYIV ++LP       S      DLE WY SF
Sbjct  4     NMFLLAAICIFTYHLGISAN----SSFETYIVHLDLPAEFGQLLSE-----DLEPWYDSF  54

Query  2218  LPTTVA----GGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLH  2051
             LP+  A    G     SR+V  YRNV+ GFAAKLS +EVKEM  K GF+ A P+R    H
Sbjct  55    LPSETAAELNGNNPSSSRIVHAYRNVITGFAAKLSPDEVKEMEKKRGFLYARPQRKYGFH  114

Query  2050  TTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCEL  1871
             TTHSP FLGL Q +G W  S+YG+GVIIG++DSGI   HPSF DEGMPPPPA+WKG CEL
Sbjct  115   TTHSPNFLGLHQFVGSWPGSNYGEGVIIGMIDSGITPAHPSFDDEGMPPPPAKWKGKCEL  174

Query  1870  NFT-ACNNKVIGARSF-SERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVA  1697
             N T +CNNK+IGAR+F SE      DD GHGTHTA T+AGNFV GANV+G ANGTA+G+A
Sbjct  175   NGTLSCNNKLIGARNFASELPGPPVDDFGHGTHTASTSAGNFVSGANVFGQANGTASGIA  234

Query  1696  PLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAM  1517
             PLAHLAIYKV +     +S+ILA MD AIEDGVD++SLS+GG S+ F+EDSIA+GA+SA+
Sbjct  235   PLAHLAIYKVGSLGSLLESDILAGMDAAIEDGVDVISLSIGGPSTPFYEDSIAIGAFSAI  294

Query  1516  EKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPK  1337
             EKGIFVS SAGN GP + SLSNEAPW+LTVGAST+DRK+ AT  +G ++ + GE+ +QPK
Sbjct  295   EKGIFVSCSAGNGGPDDSSLSNEAPWILTVGASTIDRKIKATAFVGYKEAYDGESLYQPK  354

Query  1336  DFNSSLLSLVFPGQNTSDESSSPYCDSES-LRNADVRGKIVVCMTGGFLDRRGKGEAVKN  1160
               +S LL LV+ G +T       +CD    L + DV+GK+V+C  GG +    +G+ VK+
Sbjct  355   G-SSKLLPLVYGGNDTI----GAWCDDSGFLADVDVKGKVVLCEMGGDIGPVEQGQVVKD  409

Query  1159  ASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSN-PMATFSFKGTIT  983
             A G  MIL+  E  G  T    HVLPA  +++  G KI AYIN++S  P+A  SF GT+ 
Sbjct  410   AGGAAMILMNDEIDGYFTIPLPHVLPATLVSHDAGVKIKAYINSSSTTPIAAISFGGTVI  469

Query  982   GDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTS  803
             GDKNAPTV +FSSRGPN  SPGILKPDIIGPG +ILA WP S+DN  N K+TFN+ISGTS
Sbjct  470   GDKNAPTVTSFSSRGPNSASPGILKPDIIGPGASILAAWPLSIDNYTNEKATFNMISGTS  529

Query  802   MSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGH  623
             MSCPHLSGVAAL+KS+HPDWSPAMIKSA+MT++  +N G NPI ++  + A VF+IGAGH
Sbjct  530   MSCPHLSGVAALIKSAHPDWSPAMIKSAIMTSSTQINLGNNPILDEQHLPADVFAIGAGH  589

Query  622   VNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSA--VISIPEAQLNYP  449
             VNP  A DPGLVYD   +DY+ YLC L YT ++V  I+  ++NC+      +PEAQLNYP
Sbjct  590   VNPPMALDPGLVYDISTDDYILYLCFL-YTEQQVATIVHKKINCNGPKYTGVPEAQLNYP  648

Query  448   SFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVT  269
             SFS++L  T   Y+RTVTNVGEA S Y   +   PGV V VEP  L F++V Q+ TY V 
Sbjct  649   SFSVVLGYTGYIYSRTVTNVGEAESTYYARVESVPGVNVTVEPTVLSFTEVKQQSTYKVY  708

Query  268   FSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
             FS        +    VQG++ W S KH VR PI+ KLV
Sbjct  709   FSRQEFTTNGSY---VQGSIAWISTKHVVRIPISVKLV  743



>ref|XP_003525749.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=748

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/759 (53%), Positives = 529/759 (70%), Gaps = 32/759 (4%)
 Frame = -1

Query  2380  MFLILSVLIGFCSTATIASKL-------ETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             +F++ + ++ F +     S+L       +TYI+ V+ P  +   Q+      DLE WY S
Sbjct  5     LFIVFTFVLSFQTHFAQGSELPRTTSSSKTYIIHVKGPQDKSLDQTE-----DLESWYHS  59

Query  2221  FLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTH  2042
             F+P T+      + RM++ Y NVM GFAA+L+ EE+  +  KDGFISA PERIL   TT+
Sbjct  60    FMPPTIMSSEE-QPRMIYSYLNVMSGFAARLTEEELIAVEKKDGFISARPERILHRQTTN  118

Query  2041  SPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT  1862
             +P FLGLQ+  G W++S++GKG+IIGVLD+GI   HPSFSD GM PPP +WKG CE+N T
Sbjct  119   TPQFLGLQKQTGLWKESNFGKGIIIGVLDTGITPGHPSFSDAGMSPPPPKWKGRCEINVT  178

Query  1861  ACNNKVIGARSFSERER------SVFdddghgthtagtaaGNFVRGANVYGSANGTAAGV  1700
             ACNNK+IG R+F+   +      +  DD GHGTHTA TAAG FV  A V G+A GTA+G+
Sbjct  179   ACNNKLIGVRTFNHVAKLIKGAEAAIDDFGHGTHTASTAAGAFVDHAEVLGNAEGTASGI  238

Query  1699  APLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssS-FHEDSIALGAYS  1523
             AP AHLAIY+VC+++ C +S+ILAA+D A+EDGVD+LS+SLG   +  F +  IA+G ++
Sbjct  239   APYAHLAIYRVCSKV-CRESDILAALDAAVEDGVDVLSISLGSKRAKPFFDHGIAIGTFA  297

Query  1522  AMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQ  1343
             AM+KGIFVS +AGN+GP  GS+ N APW+LTVGAS ++R ++AT  LGN Q+F GE+ FQ
Sbjct  298   AMQKGIFVSCAAGNDGPLPGSVINGAPWILTVGASNINRSIAATAKLGNGQEFDGESIFQ  357

Query  1342  PKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVK  1163
             P DF+ +LL L + G N   E +  +C + SL + D RGK+V+C  GG +++  KG+ VK
Sbjct  358   PSDFSPTLLPLAYAGMNGKQEDA--FCGNGSLNDIDFRGKVVLCEKGGGIEKIAKGKEVK  415

Query  1162  NASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTIT  983
              A G  MIL+  E+ G + +   HVLP   ++Y  G KI AYI +T+ P AT  FKGTI 
Sbjct  416   RAGGAAMILMNDEKSGFSLNIDVHVLPTTHVSYDAGLKIKAYIYSTATPTATILFKGTII  475

Query  982   GDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTS  803
             G+  AP V +FS RGP+  SPGILKPDIIGPG+NILA WP  ++N   SKSTFNI+SGTS
Sbjct  476   GNSLAPVVTSFSGRGPSLPSPGILKPDIIGPGLNILAAWPFPLNNNTASKSTFNIMSGTS  535

Query  802   MSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGH  623
             MSCPHLSGVAALLKSSHP WSPA IKSA+MT+ADI++H +  I  + L  A VF+ G+G+
Sbjct  536   MSCPHLSGVAALLKSSHPHWSPAAIKSAIMTSADIISHERKHIVGETLQPADVFATGSGY  595

Query  622   VNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSF  443
             VNPS+ANDPGLVYD KP+DY+PYLCGL Y + EV +I    + CS   SI E +LNYPSF
Sbjct  596   VNPSRANDPGLVYDIKPDDYIPYLCGLGYKDTEVEIIAGRTIKCSETSSIREGELNYPSF  655

Query  442   SIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFS  263
             S++L+S  QT+TRTVTNVGEA+S Y V +  P GV V V+P +L FS+ NQK TY+VTFS
Sbjct  656   SVVLDS-PQTFTRTVTNVGEANSSYVVTVSAPDGVDVKVQPNKLYFSEANQKETYSVTFS  714

Query  262   ---LSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
                L  +  +      VQG L+W S KH VRSPI+   V
Sbjct  715   RIELDDETVK-----YVQGFLQWVSAKHTVRSPISISFV  748



>gb|EYU29555.1| hypothetical protein MIMGU_mgv1a022042mg [Erythranthe guttata]
Length=720

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/742 (57%), Positives = 524/742 (71%), Gaps = 37/742 (5%)
 Frame = -1

Query  2377  FLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTT--V  2204
             FL +  ++ F +    A  L  YIV V+   S            DLE +Y SFLPTT  V
Sbjct  6     FLFIICILNF-NQFLKAENLGVYIVYVDPAQSSD----------DLETFYDSFLPTTSNV  54

Query  2203  AGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLG  2024
                   + R+++ YR+V  GFAA+LS  +V+ M  K GFISA PER+L LHTTHSP FLG
Sbjct  55    TSNSDDQPRILYRYRHVFSGFAARLSTADVEAMRQKKGFISAQPERMLQLHTTHSPNFLG  114

Query  2023  LQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCE-LNFTACNNK  1847
             L QN G W+ S+YGKGVIIG++DS +A  HPSFSD+GMPP PA+WKGVC+      CNNK
Sbjct  115   LNQNTGLWKKSNYGKGVIIGMVDSAVAASHPSFSDKGMPPTPAKWKGVCDSFGTPPCNNK  174

Query  1846  VIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKV  1667
             +IG R FS  +R     +GHGTHT  TAAGNFV GA  +G+ANGTAAGVAPLAHLAIY+ 
Sbjct  175   LIGVR-FSLPQRPSRTTNGHGTHTMSTAAGNFVAGAGFFGNANGTAAGVAPLAHLAIYES  233

Query  1666  CNEIGCSDSEILAAMDTAIEDGVDIlslslggmssS-FHEDSIALGAYSAMEKGIFVSAS  1490
             C  +GC ++ +  A+D AI DGVDI+S+SLGG S   F +D IA+GAY AM++GI VS S
Sbjct  234   CGPLGCPNTAVADAIDAAIGDGVDIISISLGGGSRRGFSDDVIAVGAYRAMQRGIVVSCS  293

Query  1489  AGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSS-LLS  1313
             AGN G     L+N APW++TVGAST+DRK++AT+VLGN ++  GET    K F S+  L 
Sbjct  294   AGNSG--KSGLANGAPWIMTVGASTIDRKITATIVLGNGEEIEGETG---KGFPSTEKLE  348

Query  1312  LVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILI  1133
             LV+P Q    +  S            VRGKIVVC  GG + R   GE VK+A G  MIL+
Sbjct  349   LVYPRQFPPPKDDS------------VRGKIVVCEYGGGVSRIDIGEVVKSAGGAAMILL  396

Query  1132  EPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAA  953
               ++ G TT    HVLPA++I YADG KI AY+N+TSNP AT SFKGT+ G   AP VAA
Sbjct  397   NTKDLGDTTFDDPHVLPALEIGYADGLKIKAYLNSTSNPTATLSFKGTVIGGGRAPVVAA  456

Query  952   FSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVA  773
             FSSRGP+  SPGILKPDIIGPGVNILA WP S++N+ ++K  FNIISGTSMSCPHLSGVA
Sbjct  457   FSSRGPSVPSPGILKPDIIGPGVNILAAWPVSLENRTDTKPAFNIISGTSMSCPHLSGVA  516

Query  772   ALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPG  593
             ALLKS HPDWSPA+IKSA+MTTA  +N   NPI+++ L  A+VF IG+GHVNPS+A+DPG
Sbjct  517   ALLKSVHPDWSPAVIKSAIMTTAYQVNLKGNPIEDEQLQPATVFDIGSGHVNPSRADDPG  576

Query  592   LVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQT  413
             LVYD  P+DY+PY+CGLNYTN++VG+I+   V+CS   SIPEAQLNYPSFSII  S+ QT
Sbjct  577   LVYDILPDDYIPYVCGLNYTNQQVGIIVGRNVDCSKEKSIPEAQLNYPSFSIIFGSSPQT  636

Query  412   YTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNM  233
             YTRT+TNVG+A+S Y VEI  P GV V VEP++L F K+  K +YNVTF+ ++K A   M
Sbjct  637   YTRTLTNVGKANSSYDVEIVSPNGVTVKVEPKKLVFPKLGDKSSYNVTFTRTTKGA---M  693

Query  232   PPVVQGALRWKSVKHHVRSPIA  167
               + QG +RW +  + VRSPI+
Sbjct  694   NSITQGFIRWYTADYSVRSPIS  715



>ref|XP_004308725.1| PREDICTED: subtilisin-like protease SDD1-like [Fragaria vesca 
subsp. vesca]
Length=767

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/763 (56%), Positives = 535/763 (70%), Gaps = 35/763 (5%)
 Frame = -1

Query  2395  MKFLRMF-LILSVLIGFC-STATIASKLETYIVRVELPHsristqsssssSVDLEHWYKS  2222
             + F+ MF L L+VLI    S     S+++TY V V+ P  ++S  +S     DLE WY++
Sbjct  15    LGFIFMFHLSLAVLIDENDSIPDGDSRMQTYFVWVQKPTDKVSALNSQ----DLESWYQT  70

Query  2221  FLP--TTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             FLP  TT +       RM++ YRNV  GFAAKL+ EE+K M  KDGF+ A PER LPLHT
Sbjct  71    FLPESTTASSNKPSIPRMLYSYRNVATGFAAKLTPEEIKAMEKKDGFVHAHPERFLPLHT  130

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             THSP FLGLQQ  GFW+ ++YG+G+IIGVLD+GI+  HPSFSDEG+PPPP +WKG CE  
Sbjct  131   THSPNFLGLQQVFGFWKKTNYGEGMIIGVLDTGISPGHPSFSDEGVPPPPEKWKGKCEFK  190

Query  1867  F---TACNNKVIGARSFS----ERERSVFdddghgthtagtaaGNFVRGANVYGSANGTA  1709
             F   T CNNK+IGAR+F      +E S F ++GHGT T+  AAGNFV GA+V+G ANGTA
Sbjct  191   FNGRTVCNNKLIGARNFQGGKETKEVSPFGEEGHGTLTSSIAAGNFVEGASVFGMANGTA  250

Query  1708  AGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssS-FHEDSIALG  1532
             +G+AP AHLAIYKVC E GC++S+ILAA+D A+EDGVD+LSLS+G  SS  FHED +A+G
Sbjct  251   SGIAPYAHLAIYKVCTEAGCAESDILAAIDIAVEDGVDVLSLSIGFASSVPFHEDMVAIG  310

Query  1531  AYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFH--G  1358
             A+ A  KGIFVS SAGN GP   S+SNEAPW+LTVGAST+DRK+S+   LG+  ++   G
Sbjct  311   AFGAFRKGIFVSCSAGNSGPSYSSMSNEAPWILTVGASTIDRKISSIAQLGDSPKYFYSG  370

Query  1357  ETAFQPKDFNSS-LLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRG  1181
             E+ F PK+F++S LL LV+PG   ++++   +C   SL N  V GK+V+C  GG +    
Sbjct  371   ESLFDPKNFSTSPLLPLVYPGAIHNNKTE--FCALGSLVN--VEGKVVLCERGGGVGGTA  426

Query  1180  KGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFS  1001
             KGE VK A G  MIL+     G +T A A+VLPA ++ +  G  I  YIN+T+ P+AT  
Sbjct  427   KGEEVKRAGGAAMILVNEVTDGYSTLANAYVLPATNVGFQAGLSIKTYINSTTTPIATVY  486

Query  1000  FKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFN  821
                T+ GD  AP VA+FSSRGP+  SPGILKPDIIGPGVNILA WP SVDN     + F+
Sbjct  487   SPRTVIGDALAPMVASFSSRGPSIASPGILKPDIIGPGVNILAAWPVSVDNV----TKFD  542

Query  820   IISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVF  641
             I+SGTS+SCPHLSG+AAL+KSSHPDWSPA IKSA+MTTAD+LN    PI ++    A ++
Sbjct  543   ILSGTSVSCPHLSGIAALIKSSHPDWSPAAIKSAIMTTADLLNLKGTPIVDRSNTPADIY  602

Query  640   SIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQ  461
             S G+GHVNPSKANDPGL+YD +P+DY+PYLCGLNYTN ++ +I Q RV+CS V  I EAQ
Sbjct  603   STGSGHVNPSKANDPGLIYDIRPDDYIPYLCGLNYTNNQIEMITQQRVDCSEVGVIAEAQ  662

Query  460   LNYPSFSIILES-TAQTYTRTVTNVGEASSFYTVEIFEPP--GVKVN--VEPRELQFSKV  296
             LNYPSFSI + S   Q YTRTV NVG A S Y  EI EP   GV VN  V P  L F++V
Sbjct  663   LNYPSFSITIGSYQTQNYTRTVKNVGPAYSTYKSEIGEPQKWGVIVNVGVTPSVLTFTEV  722

Query  295   NQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             NQ +TYNV FS        +    +QG LRW S  H V SPIA
Sbjct  723   NQTITYNVEFSTKLVGQDGSF---LQGHLRWVSDNHSVYSPIA  762



>ref|XP_010317342.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=642

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/658 (59%), Positives = 487/658 (74%), Gaps = 25/658 (4%)
 Frame = -1

Query  2131  LSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDS  1952
             LS++EVK M  + GF+SA P+R+L LHTTHSP FLGL QN+G W  S+ GKGVIIG+LDS
Sbjct  2     LSSDEVKMMETQPGFVSARPQRVLQLHTTHSPSFLGLHQNVGLWNASNSGKGVIIGLLDS  61

Query  1951  GIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVFdddghgthta  1772
             GI  +HPSF+D GMPPPPA+WKG CE N+ ACNNK+IGAR+  +   S  D DGHGTHT+
Sbjct  62    GINPNHPSFNDHGMPPPPAKWKGKCEFNYKACNNKLIGARNLVKTAESPLDGDGHGTHTS  121

Query  1771  gtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDI  1592
              T AGNFV GAN+ G+ANGTA G+AP AH+A+Y+VC++ GC +  ILA  D AIEDGVD+
Sbjct  122   STGAGNFVGGANLLGNANGTAVGIAPRAHVAMYRVCDKDGCPEVFILAGFDAAIEDGVDV  181

Query  1591  lslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTV  1412
             +S S+G  +   + +++A+GAY A+EKGIFV+ SAGN GPF+ ++ N +PW+LTVGAS+ 
Sbjct  182   ISASVGATALPPYAETMAIGAYRAIEKGIFVTCSAGNSGPFSSTVENGSPWILTVGASST  241

Query  1411  DRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADV  1232
             DRK+SA  VLGN  ++ GE+AFQ  + +  LL L+  G            D ESL   DV
Sbjct  242   DRKISAVAVLGNGSEYEGESAFQSTNMSRKLLPLIDGG------------DCESLAIIDV  289

Query  1231  RGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQ  1052
             RGKIV+C   G L    KGE VK A G  MIL   EE G TT AT HVLPA  ++Y DG 
Sbjct  290   RGKIVLCAAVGSLSGIEKGEEVKKAGGAAMILKNEEEQGYTTFATIHVLPATHVSYLDGL  349

Query  1051  KILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILA  872
             KI+ YI +TS P+AT SFKGT  GDK+AP VA+FSSRGP   S GILKPDIIGPGVNILA
Sbjct  350   KIINYITSTSTPVATISFKGTRIGDKHAPVVASFSSRGPYTVSQGILKPDIIGPGVNILA  409

Query  871   PW---PTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTAD  701
              W   P  V   P++ STFNIISGTSMSCPHL+GVAALLKS+HPDWSPA IKSA+MTTAD
Sbjct  410   AWIKPPAGV--IPSATSTFNIISGTSMSCPHLAGVAALLKSAHPDWSPAAIKSAIMTTAD  467

Query  700   ILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREV  521
             ++N G NPIQ++ L  A + SIG+GHVNPSKANDPGLVYD +P+DY+PYLCGLNYT+++V
Sbjct  468   LVNLGNNPIQDEKLNPADLLSIGSGHVNPSKANDPGLVYDIQPQDYVPYLCGLNYTDQQV  527

Query  520   GVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPG  341
               I+  +V+C+  +SI EA+LNYPSFSI L S+AQTYTRTVTNVGEA+S YTVE+    G
Sbjct  528   SSIVNKKVHCT--LSIAEAELNYPSFSIDLGSSAQTYTRTVTNVGEANSTYTVEVIGVEG  585

Query  340   VKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             V ++++P  L+FS +NQKL+Y VTF  S+    S      QG ++W S K+ VRSPI+
Sbjct  586   VALSIKPSILKFSALNQKLSYEVTFKRSTSTDSS------QGYIKWSSAKYSVRSPIS  637



>gb|EYU39034.1| hypothetical protein MIMGU_mgv1a019276mg, partial [Erythranthe 
guttata]
Length=688

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/690 (59%), Positives = 500/690 (72%), Gaps = 25/690 (4%)
 Frame = -1

Query  2314  TYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAA  2135
             TYIV V LP  R+   S       L+ WY SFLPTT        SR+             
Sbjct  1     TYIVHVNLPTGRVLADSDG-----LKSWYTSFLPTTTTTADDASSRL-------------  42

Query  2134  KLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLD  1955
              LS EEVKEM  KDGF+ A  ++ LPLHTTH+P FLGL QN+GFWR S+YG+GVIIG+ D
Sbjct  43    -LSPEEVKEMEKKDGFVFARRQKKLPLHTTHTPSFLGLHQNLGFWRGSNYGEGVIIGLFD  101

Query  1954  SGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-SERERSVFdddghgth  1778
             +GIA  HPSF D+ MPPPPA WKG CE N + CNNK+IGAR+  S   R   DD+GHGTH
Sbjct  102   TGIAPGHPSFDDKDMPPPPAEWKGKCEFNSSTCNNKLIGARNLVSGPTRPPVDDEGHGTH  161

Query  1777  tagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGV  1598
             TA TAAGNFV+GANV+G ANGTA G+AP AHLA+YKVC+E GC++++ILAAMD AIEDGV
Sbjct  162   TASTAAGNFVQGANVFGMANGTAVGIAPRAHLAMYKVCSEDGCAEADILAAMDAAIEDGV  221

Query  1597  DIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGAS  1418
              +LSLSLGG S+ F  D IA+GA++A++KGIFVS SAGN GPFN SLSNEAPW+LTVGAS
Sbjct  222   HVLSLSLGGGSADFFADGIAIGAFAAIQKGIFVSCSAGNSGPFNASLSNEAPWILTVGAS  281

Query  1417  TVDRKLSATVVLGNRQQ--FHGETAFQPKDFNSS-LLSLVFPGQNTSDESSSPYCDSESL  1247
             T+DR++ AT +LGNR    + G++ FQP DF+S   L LV  G N +   ++  C   SL
Sbjct  282   TIDRRIVATAILGNRNMDGYDGQSLFQPSDFSSDKYLPLVDAGANGN--GTAGICGPGSL  339

Query  1246  RNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDIT  1067
              N DV+GKIV+C  GG + R  KG+ VK+A G  MIL+  E     T A AHVLPA  ++
Sbjct  340   DNIDVKGKIVLCERGGGIARIAKGQTVKDAGGAAMILMNDELDAYITIADAHVLPATHVS  399

Query  1066  YADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPG  887
             Y  G+KI AYI++TS P AT  F+GT  G    P VA+FSSRGP+  SPGILKPDIIGPG
Sbjct  400   YDAGEKIRAYISSTSTPTATILFQGTDIGYPMDPIVASFSSRGPSLASPGILKPDIIGPG  459

Query  886   VNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTT  707
             V+ILA WP SVDN  N K+TFN+ISGTSMSCPHLSG+AALLKS+HPDWSPA IKSA+MTT
Sbjct  460   VSILAAWPVSVDNYTNEKATFNMISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIMTT  519

Query  706   ADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNR  527
             A  +N G  PI ++  + A +F++GAGHVNP+ ANDPGLVYD + EDY+PYLCGL YT+ 
Sbjct  520   AAQVNVGGGPIDDERYLNADIFALGAGHVNPTSANDPGLVYDLQSEDYIPYLCGLGYTDT  579

Query  526   EVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEP  347
             E+  I+Q  V+CS + SIPEAQLNYPSFS+ L    +TYTRTVTNVGEA+S Y++EI   
Sbjct  580   EIQAIVQKPVSCSNITSIPEAQLNYPSFSVELGPAKKTYTRTVTNVGEANSTYSLEIILA  639

Query  346   PGVKVNVEPRELQFSKVNQKLTYNVTFSLS  257
              GV ++V P  L F +VNQK++Y ++FS S
Sbjct  640   KGVDISVTPDTLSFGEVNQKMSYEISFSKS  669



>ref|XP_002509669.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF51056.1| Cucumisin precursor, putative [Ricinus communis]
Length=767

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/743 (54%), Positives = 527/743 (71%), Gaps = 25/743 (3%)
 Frame = -1

Query  2344  STATIASK-LETYIVRVELPHsristqsssssSVDLEHWYKSFLP-TTVAGGGYGESRMV  2171
             +T TI  K L+TYIV V  P  R  +Q       DL++W+KSFL  +T +     + RM+
Sbjct  35    TTETIEKKNLQTYIVHVNQPEGRTFSQPE-----DLKNWHKSFLSFSTASSEEEQQQRML  89

Query  2170  FMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDS  1991
             + Y+N++ GF+A+L+ EEVK M    GF+SA  ER L L TTH+P FLGL Q MG W+DS
Sbjct  90    YSYQNIISGFSARLTQEEVKAMEEITGFVSACLERKLRLQTTHTPSFLGLHQQMGLWKDS  149

Query  1990  SYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERER  1811
              +GKGVIIG+LD G+   HPSFSDEGMP PPA+WKG CE N + CNNK+IGAR+F+   +
Sbjct  150   DFGKGVIIGILDGGVYPSHPSFSDEGMPLPPAKWKGRCEFNASECNNKLIGARTFNLAAK  209

Query  1810  SV--------FdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVC---  1664
             ++         D DGHGTHTA TAAG FV  ++V G+A GTA G+AP AHLAIYKVC   
Sbjct  210   TMKGAPTEPPIDVDGHGTHTASTAAGGFVYNSDVLGNAKGTAVGMAPFAHLAIYKVCFGD  269

Query  1663  -NEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASA  1487
              N+  C +S++LA +D A++DGVD+LSLSLG +S  F +D+IA+G+++A++KGIFVS SA
Sbjct  270   PND-DCPESDVLAGLDAAVDDGVDVLSLSLGDVSMPFFQDNIAIGSFAAIQKGIFVSCSA  328

Query  1486  GNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLV  1307
             GN GP   +LSNEAPW+LTVGAST+DR++ A   LGN ++  GE+  QP +F ++LL +V
Sbjct  329   GNSGPSKSTLSNEAPWILTVGASTIDRRIVAIAKLGNGEELDGESVSQPSNFPTTLLPIV  388

Query  1306  FPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEP  1127
             + G N+  +S+  +C   +L   +V+ K+V+C  GG + R  KG+ VKNA G  MIL+  
Sbjct  389   YAGMNSKPDSA--FCGEGALEGMNVKDKVVMCERGGGIGRIAKGDEVKNAGGAAMILVND  446

Query  1126  EEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFS  947
             E  G +T A AHVLPA  +++A G KI AYIN+T  PMAT  FKGT+ GD ++P V +FS
Sbjct  447   ETNGFSTIADAHVLPATHVSFAAGLKIKAYINSTKTPMATILFKGTVIGDSSSPAVTSFS  506

Query  946   SRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAAL  767
             SRGP+  SPGILKPDIIGPGV+ILA WP  +DN  N+K TFNI+SGTSMSCPHLSG+AAL
Sbjct  507   SRGPSLASPGILKPDIIGPGVSILAAWPFPLDNNTNTKLTFNIMSGTSMSCPHLSGIAAL  566

Query  766   LKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLV  587
             LKSSHP WSPA IKSA++TTADILN    PI ++    A  F+ GAGHVNPS+ANDPGLV
Sbjct  567   LKSSHPYWSPAAIKSAIVTTADILNMEGKPIVDETHQPADFFATGAGHVNPSRANDPGLV  626

Query  586   YDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYT  407
             YD +P+DY+PYLCGLNYT+ +V +I    ++CS + +I E QLNYPSFS+ L    QT+ 
Sbjct  627   YDIQPDDYIPYLCGLNYTDEQVSIIAHRPISCSTIQTIAEGQLNYPSFSVTL-GPPQTFI  685

Query  406   RTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPP  227
             RTVTNVG A+S +   I  PPGV V+V+P  L FSK+NQK TY++TFS +   A+++   
Sbjct  686   RTVTNVGYANSVFAATITSPPGVAVSVKPSRLYFSKLNQKATYSITFSHTGYGAKTS--E  743

Query  226   VVQGALRWKSVKHHVRSPIAAKL  158
               QG + W S K+ V SPI+ + 
Sbjct  744   FGQGYITWVSDKYFVGSPISVRF  766



>gb|KDP25556.1| hypothetical protein JCGZ_20712 [Jatropha curcas]
Length=744

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/725 (55%), Positives = 504/725 (70%), Gaps = 20/725 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S LETYIV +  P     T+S       LE WY+SF+P         + R++  Y +V+ 
Sbjct  37    SNLETYIVLLLKPEGVDFTESKY-----LESWYQSFMPADTFSSD--QPRLIHSYHHVVT  89

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAAKL+AE  K +  K+  + A P+R++ LHTTH+P FLGLQQN+G W+ S+YGKGVII
Sbjct  90    GFAAKLTAEAAKAIERKEEVVLARPQRMVTLHTTHTPSFLGLQQNLGLWKQSNYGKGVII  149

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT-ACNNKVIGARSFSERERSVFdddg  1790
             GV+DSGI  DHPSFS EGMPPPPA+WKG CELN   +CNNK+IGAR+F      + D   
Sbjct  150   GVVDSGITADHPSFSGEGMPPPPAKWKGKCELNGKLSCNNKLIGARNFDTNSNDLVDRAE  209

Query  1789  hgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCS-DSEILAAMDTA  1613
             HGTHTA TAAG+ V+G + +G ANGTA GVAPLAHLA+YK+      + +SE+LAAMD A
Sbjct  210   HGTHTASTAAGSPVQGVSYFGQANGTAVGVAPLAHLAMYKISGRDDMTGESELLAAMDAA  269

Query  1612  IEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWML  1433
             +ED VD+LSLS G  S  F++D IA+ AY+A  KGIFVS SAGNEGP   +LSNEAPW+L
Sbjct  270   VEDSVDVLSLSCGNGSRLFYDDVIAIAAYAATRKGIFVSVSAGNEGPNYRTLSNEAPWLL  329

Query  1432  TVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSE  1253
             TVGASTVDR +  TV+LGN ++ +GE+ FQPK F   LL LV+ G N   ++SS  C+  
Sbjct  330   TVGASTVDRAIRVTVLLGNNEELNGESLFQPKSFRPKLLRLVYAGAN--GKTSSASCEKG  387

Query  1252  SLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAID  1073
             SL+N +V+GKIV+C  G   D   KG+ VK+  G  MI++  E  G   +   HVLPA  
Sbjct  388   SLKNVNVKGKIVLCEGGS--DTIPKGQEVKDNGGAAMIVMNHENEGFDITPVYHVLPASH  445

Query  1072  ITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIG  893
             ++YA G  I AYIN+T +P AT  FKGT+ G + AP VA FSSRGP+  SPGILKPDIIG
Sbjct  446   VSYAAGSAIKAYINSTPSPKATILFKGTVVGLQEAPQVAWFSSRGPSIASPGILKPDIIG  505

Query  892   PGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMM  713
             PGV ILA WP S DN  N    F ++SGTSM+CPHLSG+AALLKS HPDWSPA IKSA+M
Sbjct  506   PGVRILAAWPHSADNTTNR---FEMLSGTSMACPHLSGIAALLKSVHPDWSPAAIKSAIM  562

Query  712   TTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYT  533
             TTA++ N G  PI N     +++F +GAGHVNPS+AN+PGL+YD +P+DY+PYLCGL Y+
Sbjct  563   TTANLYNFGGQPITNDQFFPSTLFDVGAGHVNPSRANNPGLIYDIQPKDYIPYLCGLGYS  622

Query  532   NREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIF  353
             ++ V +I+Q +V CS    IPEAQLNYPSFSI+L S+ Q YTRTVTNVG   S Y +EI 
Sbjct  623   DKHVRIIVQKKVKCSKRTRIPEAQLNYPSFSIVLGSSPQRYTRTVTNVGPPHSVYFLEIV  682

Query  352   EPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSP  173
              P GV + V P ++ FSKVNQK TY+VTF  + K   S      QG L W    + VRSP
Sbjct  683   APNGVDIMVTPHKIIFSKVNQKATYSVTFRKNGKGNGS----YAQGYLNWVGEGYIVRSP  738

Query  172   IAAKL  158
             IA +L
Sbjct  739   IAIQL  743



>ref|XP_008437722.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=764

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/747 (55%), Positives = 524/747 (70%), Gaps = 36/747 (5%)
 Frame = -1

Query  2341  TATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLP----TTVAGGGYGESRM  2174
             T  + SKL+TYIV VE P  R+  +SS+     +E WY SF+P    TTV      + ++
Sbjct  36    TTPLQSKLQTYIVHVEQPKIRLVGESSND---HIESWYMSFIPKSTETTVE-----QPQL  87

Query  2173  VFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRD  1994
             ++ YRNVM GF+A+L+ E+VK M  KDGFISA PE I+ LHTTH+P +LGL Q  G W++
Sbjct  88    LYSYRNVMSGFSARLTIEQVKAMEKKDGFISAMPETIMSLHTTHTPEYLGLNQQFGIWKN  147

Query  1993  SSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSE--  1820
             S++GKGVI+GVLD+GI  +HPSF+DEGM PPPA+WKG CE N + CNNK+IGAR+F+   
Sbjct  148   SNFGKGVIVGVLDTGIHPNHPSFNDEGMSPPPAKWKGKCEFNSSLCNNKLIGARTFNLGN  207

Query  1819  ---RERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGC  1649
                 E S  D+ GHGTHTA TAAG FV  A   G+A G AAG+APLAHLAIYKVC+   C
Sbjct  208   NFLMEESPNDEKGHGTHTASTAAGAFVEDAEALGNAKGKAAGIAPLAHLAIYKVCSGKRC  267

Query  1648  SDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPF  1469
               S++ A +D AI+DGVD+LS+SLG  S  F +D+IA+  + A++KGIFVS+SAGN GP 
Sbjct  268   PSSDVFAGIDAAIDDGVDVLSISLGSRSVPFFKDNIAVATFGAIQKGIFVSSSAGNSGPL  327

Query  1468  NGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNT  1289
             N +LSN+APW+LTVGAST++R++ A   LGN +Q+ GE+ +QP DF S  L LV+ G   
Sbjct  328   NSTLSNDAPWILTVGASTINRRIVAVAKLGNGEQYEGESLYQPNDFPSKFLPLVYAGNR-  386

Query  1288  SDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGIT  1109
              +  +  +C   SL N DV+GK+VVC   G + R  KG  VKNA G  MILI  EE G +
Sbjct  387   -ENKTYAFCGEGSLENMDVKGKVVVCEGKGGVGRVAKGLVVKNAGGAAMILINQEEDGFS  445

Query  1108  TSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKN---APTVAAFSSRG  938
             T + AHVLPA  ++Y  G  I +YIN++ NP A+ SFKGT+ GD +   AP++A+FSSRG
Sbjct  446   TLSEAHVLPATHVSYKAGVLIKSYINSSQNPTASISFKGTVIGDGDDFSAPSMASFSSRG  505

Query  937   PNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKS  758
             P   SPGILKPDI GPGVNILA WP  +DN  N+KSTFN+ISGTSMSCPHLSG+AAL+KS
Sbjct  506   PCLPSPGILKPDITGPGVNILAAWPFPLDNDTNTKSTFNVISGTSMSCPHLSGIAALIKS  565

Query  757   SHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDT  578
              HP+WSPA IKSA+MTTA+I      PI +Q L  A+ F++GAGHVNPSKA DPGLVYD 
Sbjct  566   VHPNWSPAAIKSAIMTTANIKTPQGEPITDQDLQPANFFAMGAGHVNPSKAADPGLVYDI  625

Query  577   KPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTV  398
             +P+DY+PYLCGL Y + EV +I+   V C  V+SI E  LNYPSFS+ L    QT+ RTV
Sbjct  626   QPDDYIPYLCGL-YKDEEVSIIVHRTVICGLVLSIREGDLNYPSFSVAL-GGLQTFKRTV  683

Query  397   TNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVV-  221
             TNVGEA+S YT  +  P GV + V PR+L FS+VNQ +T+ VTF+      R     +V 
Sbjct  684   TNVGEANSVYTAIVEAPLGVSMTVMPRKLFFSRVNQTMTFTVTFN------RIRWVKIVG  737

Query  220   ---QGALRW--KSVKHHVRSPIAAKLV  155
                +G L+W  KS K+ VRSP++ K +
Sbjct  738   EFGEGYLKWVSKSKKYVVRSPVSVKFI  764



>gb|KCW72062.1| hypothetical protein EUGRSUZ_E00506, partial [Eucalyptus grandis]
Length=730

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/732 (55%), Positives = 509/732 (70%), Gaps = 20/732 (3%)
 Frame = -1

Query  2329  ASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVM  2150
             +S L TYI++V+ P  +  T        DL+  Y+SFLPT  A     E RMV  YRNV+
Sbjct  4     SSSLSTYIIQVQKPKDKDLTTLE-----DLDTLYRSFLPTAAASSNQ-EQRMVHSYRNVL  57

Query  2149  KGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVI  1970
              GFAAKL+AEE K +  KD  +   PE+ L LHTTH+P FLGL Q +G W DS+YGKG+I
Sbjct  58    SGFAAKLTAEEAKAIREKDRVLHVRPEKALSLHTTHTPNFLGLHQGVGLWNDSNYGKGMI  117

Query  1969  IGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERS------  1808
             IGVLD+GI  DHPSFSDEGMPPPPA+WKG C+ N T+CNNK+IGARSF+    +      
Sbjct  118   IGVLDTGIFPDHPSFSDEGMPPPPAKWKGRCDFNGTSCNNKLIGARSFTSSSTTHAQAVP  177

Query  1807  VFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILA  1628
              +D +GHGTHT+ TAAG FVR A+  G A GTA G+APLAHLA+YKVC+  GC +S+ILA
Sbjct  178   PYDGEGHGTHTSSTAAGAFVRDASALGHAKGTATGMAPLAHLAMYKVCDANGCLESDILA  237

Query  1627  AMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNE  1448
              +DTAIEDGVD+LSLSLGG+S  F +DSIA+GA++A +KGIFVS SAGN GP +G+LSNE
Sbjct  238   GLDTAIEDGVDVLSLSLGGISQPFFDDSIAIGAFAATQKGIFVSCSAGNSGPSDGTLSNE  297

Query  1447  APWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSP  1268
             APW+LTVGAS++DR + AT  LGN Q+F GET +QP DF  +LL L++ G N   + SS 
Sbjct  298   APWILTVGASSIDRTIKATAHLGNGQEFDGETLYQPHDFPPTLLPLIYAGVN--GDPSSA  355

Query  1267  YCDSESLR-NADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAH  1091
              C   SL   +D++GK+VVC  G    R  KG+ VKNA G  MIL+     G TT   AH
Sbjct  356   LCLPGSLGGRSDLQGKVVVCDIGDGRGRVAKGQEVKNAGGAAMILVNGPIEGYTTLVDAH  415

Query  1090  VLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGIL  911
             VLPA+ ++Y  G  I  Y++    P  T  FKGT+ G   AP V+ FSSRGPN +SPGIL
Sbjct  416   VLPAVHVSYVAGMAIKDYLSTAQAPAGTILFKGTLIGRSVAPAVSFFSSRGPNFQSPGIL  475

Query  910   KPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAM  731
             KPDIIGPGVNI+A WP  +DN  N K  FN+ISGTSMSCPHLSGVAALLKS+HPDWSPA 
Sbjct  476   KPDIIGPGVNIIAGWPFPLDNSTNLKHAFNVISGTSMSCPHLSGVAALLKSAHPDWSPAA  535

Query  730   IKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYL  551
             IKSA++TTA   N  + PI +Q L  A +F+ GAGHVNPSKA DPGL+YD  P+DY+ YL
Sbjct  536   IKSAILTTATTSNLERRPIVDQTLHPADIFATGAGHVNPSKAVDPGLIYDVGPQDYIAYL  595

Query  550   CGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQT--YTRTVTNVGEAS  377
             CGL YT+ E+  I+Q  V CS++ SIP+ QLNYPS S+  E +  T   TRTV NVG A 
Sbjct  596   CGLGYTDSEIETIVQETVTCSSIPSIPDYQLNYPSISVRFEGSVNTVSVTRTVRNVGPAK  655

Query  376   SFYTVEIFEP-PGVK-VNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRW  203
             S Y + + +P  G+  + V P +L+F++VNQ ++Y V F+ S     +   P  QGA+ W
Sbjct  656   SRYILSLIDPIMGLDSIGVSPGDLEFTEVNQTVSYTVDFTRSVD-WNTTATPFAQGAITW  714

Query  202   KSVKHHVRSPIA  167
              S +H VR+P+A
Sbjct  715   VSGQHSVRTPVA  726



>ref|XP_003611191.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES94149.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/724 (57%), Positives = 519/724 (72%), Gaps = 21/724 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S L TYIV V+ P  +            L  WY S LP T A     + R++F YRN++ 
Sbjct  44    SSLLTYIVHVKKPSLQSKE--------SLHGWYHSLLPET-ATKTQNQQRIIFSYRNIVD  94

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFA KL+ EE K +   +  +S   E++  LHTTH+  FLGLQQN   W +S+ GKG+II
Sbjct  95    GFAVKLTPEEAKALEENEEVLSTRLEKMYSLHTTHTSSFLGLQQNQDLWGNSNQGKGIII  154

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA---CNNKVIGARSFSERERSVFdd  1796
             G++D+GI   HPSFSDEGMP PPA+W G CE  FT    CN K+IGAR+F       +DD
Sbjct  155   GIVDTGITLSHPSFSDEGMPSPPAKWNGHCE--FTGERICNKKIIGARTFVNSSLP-YDD  211

Query  1795  dghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDT  1616
              GHGTHTA TAAG  V+GANV+G+ANGTA G+AP AHLAIYKVCN  GC++S ILA MD 
Sbjct  212   VGHGTHTASTAAGRPVQGANVFGNANGTAIGMAPYAHLAIYKVCNIYGCTESSILAGMDA  271

Query  1615  AIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWM  1436
             A++D VD+LSLSLGG SS F ED IALGA+SA++KGIFVS SA N GPF G+LSNEAPW+
Sbjct  272   AVDDDVDVLSLSLGGPSSPFFEDGIALGAFSAIQKGIFVSCSAANSGPFYGTLSNEAPWI  331

Query  1435  LTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQ-NTSDESSSPYCD  1259
             LTVGAST+DRK+ A   LG+  ++ GE+ FQPKDF S+LL LV+ G  NTSD+S + +C 
Sbjct  332   LTVGASTIDRKIEAVAKLGDGTEYLGESVFQPKDFASTLLPLVYAGSINTSDDSIA-FCG  390

Query  1258  SESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPA  1079
               +++  DV+GKIVVC  GGF+ R  KG+AVK+A G  MIL+  E       A  HVLPA
Sbjct  391   PIAMKKVDVKGKIVVCEQGGFVGRVAKGQAVKDAGGAAMILLNSEGEDFNPIADVHVLPA  450

Query  1078  IDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDI  899
             + ++Y+ G  I  YIN+TS PMAT  FKGT+ G+ NAP VA+FSSRGP++ SPGILKPDI
Sbjct  451   VHVSYSAGLNIQDYINSTSTPMATILFKGTVIGNPNAPQVASFSSRGPSKASPGILKPDI  510

Query  898   IGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSA  719
             +GPG+NILA WP S+D   NS S+FNIISGTSMSCPHLSG+AALLK+SHPDWSPA IKSA
Sbjct  511   LGPGLNILAGWPISLD---NSTSSFNIISGTSMSCPHLSGIAALLKNSHPDWSPAAIKSA  567

Query  718   MMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLN  539
             +MTTA+ +N    PI +Q ++ A VF+ GAGHVNPSKANDPGLVYD +  DY+PYLCGLN
Sbjct  568   IMTTANQVNLQGKPILDQRILPADVFATGAGHVNPSKANDPGLVYDIETNDYVPYLCGLN  627

Query  538   YTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVE  359
             YT+R+VGVILQ +V CS V SIP+AQLNYPS SI L +T+Q Y+RT+TNVG  ++ Y V 
Sbjct  628   YTDRQVGVILQQKVKCSDVKSIPQAQLNYPSISIRLGNTSQFYSRTLTNVGPVNTTYNVV  687

Query  358   IFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVR  179
             I  P  V ++V P ++ F+++ QK+TY V F    K  R +   + QG+++W S K+ V 
Sbjct  688   IDVPLAVGMSVRPSQITFTEMKQKVTYWVDFIPEDKENRGDN-FIAQGSIKWVSAKYSVS  746

Query  178   SPIA  167
              PIA
Sbjct  747   IPIA  750



>ref|XP_007158429.1| hypothetical protein PHAVU_002G152500g [Phaseolus vulgaris]
 gb|ESW30423.1| hypothetical protein PHAVU_002G152500g [Phaseolus vulgaris]
Length=765

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/728 (57%), Positives = 513/728 (70%), Gaps = 15/728 (2%)
 Frame = -1

Query  2332  IASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNV  2153
             + + L TYIVRV+           S  S+DL  WY S LP++       ++R+ F+YRNV
Sbjct  43    VPNSLLTYIVRVK--KGDEGGDGDSLGSMDLHSWYHSLLPSSTRSD-QKQNRITFLYRNV  99

Query  2152  MKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGF-WRDSSYGKG  1976
             M GF+ +L+ EE   +  K+  +S  PER   LHTTH+P FLGLQQ +G  W +S  GKG
Sbjct  100   MDGFSVELTPEEADALQEKEEVVSVRPERTFSLHTTHTPSFLGLQQGLGGLWSNSDSGKG  159

Query  1975  VIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN-FTACNNKVIGARSFSERERSVF-  1802
             +IIG+LD+GI  DHPSFSDEGMP PPA+WKG+CE +    CNNK+IGAR F +   S   
Sbjct  160   IIIGILDTGITPDHPSFSDEGMPFPPAKWKGLCEFSGRRTCNNKLIGARHFIKSSNSSLP  219

Query  1801  -dddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAA  1625
              D  GHGTHTA TA G FV+GANV+G+A GTA G+AP AHLAIYKVC+  GCS+S ILA 
Sbjct  220   LDHVGHGTHTASTATGRFVQGANVFGNAKGTAVGMAPDAHLAIYKVCDIFGCSESAILAG  279

Query  1624  MDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEA  1445
             MDTAIEDGVD+LSLS+GG S    +D IALGA+SA++KGIFVS SAGN GP   +LSNEA
Sbjct  280   MDTAIEDGVDVLSLSIGGRSGPLFDDPIALGAFSAIQKGIFVSCSAGNSGPGYTTLSNEA  339

Query  1444  PWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPY  1265
             PW+LTVGAST+DR++ A   LGN Q F+GE+ FQP +F S+LL LV+ G  +   SSS  
Sbjct  340   PWILTVGASTIDRRIVAAAKLGNGQVFNGESVFQPNNFTSTLLPLVYAG--SIGNSSSSL  397

Query  1264  CDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVL  1085
             C   SL N DV+GK+V+C  GGF+ R  KG+ VKNA G  MIL+   +      A  HVL
Sbjct  398   CAPGSLENVDVKGKVVLCEVGGFIRRVSKGQEVKNAGGVAMILMNSLKEDFNPFADVHVL  457

Query  1084  PAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKP  905
             PA  ++Y  G  I +YIN+TS P AT  F GT+ G  +AP V +FSSRGP+  SPGILKP
Sbjct  458   PATHVSYPAGLAIKSYINSTSTPTATILFGGTVIGSVSAPAVTSFSSRGPSFASPGILKP  517

Query  904   DIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIK  725
             DIIGPG NILA WP S+DN   S   FNI+SGTSMSCPHLSG+AALLK+SHPDWSPA IK
Sbjct  518   DIIGPGQNILAAWPVSLDNNVPS---FNILSGTSMSCPHLSGIAALLKNSHPDWSPAAIK  574

Query  724   SAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCG  545
             SA+MT+A+ +N G   I ++ L+ A VF+ GAGHVNP KANDPGLVYD +P DY+PYLCG
Sbjct  575   SAIMTSANAVNLGGKSILDERLLPADVFATGAGHVNPLKANDPGLVYDIEPNDYIPYLCG  634

Query  544   LNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYT  365
             LNYT+ EVG+IL   V+CS V SIP+AQLNYPSFSI L ST+Q YTRT+TNVG AS  Y 
Sbjct  635   LNYTDEEVGLILNQNVDCSQVKSIPQAQLNYPSFSIRLGSTSQFYTRTLTNVGAASVTYN  694

Query  364   VEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKS--VK  191
             VEI  P GV +++ P E+ F++V QK+TY+V F    K  R N  P  QG++RW S   K
Sbjct  695   VEIEAPLGVGISISPAEITFTEVKQKVTYSVGFVPEDKKNRGNH-PFSQGSIRWVSGNGK  753

Query  190   HHVRSPIA  167
             + V  PIA
Sbjct  754   YSVSIPIA  761



>gb|EYU29361.1| hypothetical protein MIMGU_mgv1a026567mg [Erythranthe guttata]
Length=725

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/751 (57%), Positives = 527/751 (70%), Gaps = 37/751 (5%)
 Frame = -1

Query  2389  FLRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPT  2210
             FL +  IL++     +    A  L+ YIV V+   S            +LE +Y SFLPT
Sbjct  6     FLALICILNL-----NQFLKAENLDVYIVHVDPAQSD-----------NLETFYDSFLPT  49

Query  2209  TV----AGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTH  2042
                         + R++  YRNV  GFAAKLSA EV+ M  K GF+SA PER+LPLHTTH
Sbjct  50    NTNLEADSAVIDQPRILHRYRNVFSGFAAKLSAAEVEAMRQKKGFVSARPERMLPLHTTH  109

Query  2041  SPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT  1862
             SP FLGL QN G W +S+YGKGVIIGVLD+GI  +HPSFSDEGMPPPPARWKG C+L   
Sbjct  110   SPSFLGLSQNTGLWENSNYGKGVIIGVLDTGITPEHPSFSDEGMPPPPARWKGKCQLRVR  169

Query  1861  -ACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAH  1685
              +CNNK+IGAR +    +S  D DGHGTHTAGTAAGNFV GA ++G+ANGTAAG+AP AH
Sbjct  170   GSCNNKLIGARYY--FGKSPIDVDGHGTHTAGTAAGNFVGGAALFGNANGTAAGIAPHAH  227

Query  1684  LAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGI  1505
             +AIY+ C   GC +S I AAMD AI+DGVD+LS+SLGG  + +  D IA+GAY AM++GI
Sbjct  228   VAIYQACQPEGCPESAIAAAMDAAIDDGVDVLSMSLGGGFAPYPNDVIAIGAYRAMQRGI  287

Query  1504  FVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNS  1325
              VS SAGNEGP + +L+N+APW++TVGAST DRK+  T  LGN ++ HGETA   K F+S
Sbjct  288   VVSCSAGNEGPDSETLTNQAPWIMTVGASTTDRKILVTASLGNGEKIHGETA---KGFHS  344

Query  1324  -SLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGR  1148
                  LV P  N +  +   YCD++     DVRGKIV+C  GG   R  K EAVK+A G 
Sbjct  345   IKKKKLVHPRSNLTGTT---YCDTD-FGIDDVRGKIVMCDGGGAKSRTEKAEAVKSAGGA  400

Query  1147  GMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNA  968
              +IL+  E  G TT    + LPAI I Y DG KI AY+N+TS P AT +FKGT+ GD  A
Sbjct  401   AIILVNDELAGDTTMVGVYPLPAIQIGYTDGLKIQAYLNSTSKPKATIAFKGTVLGDNRA  460

Query  967   PTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPH  788
             P VA FSSRGPN  SPGILKPDIIGPG NILA WP S+   PN+  TF +ISGTSMSCPH
Sbjct  461   PVVAPFSSRGPNIASPGILKPDIIGPGFNILAAWPNSI--FPNT--TFYMISGTSMSCPH  516

Query  787   LSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSK  608
             LSGVAALLKS+HPDWSPA+IKSA+MTTAD  N   NPI+N  +  A +F+IG+GHVNP++
Sbjct  517   LSGVAALLKSAHPDWSPAVIKSAIMTTADFTNRAGNPIENDKMQPAELFAIGSGHVNPTQ  576

Query  607   ANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILE  428
             ANDPGLVYD  P+DY+PYLCG+N+T++EV V++Q  V+CS V SI ++QLNYPSFSIIL 
Sbjct  577   ANDPGLVYDISPDDYIPYLCGMNFTDKEVSVVVQRNVDCSDVNSIIDSQLNYPSFSIILG  636

Query  427   STAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKA  248
             ST Q+YTRTVTNVG+A++ + VEI  P GV V VEP  L F ++ QKL+YNVTF+ S  A
Sbjct  637   STPQSYTRTVTNVGKANASFDVEIVSPDGVIVRVEPERLWFWELGQKLSYNVTFTRS--A  694

Query  247   ARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
             A        +G ++W S  H VRSPI+   V
Sbjct  695   ADGATKKNGEGFIKWNSADHSVRSPISVVFV  725



>ref|XP_004249616.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=721

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/746 (54%), Positives = 510/746 (68%), Gaps = 38/746 (5%)
 Frame = -1

Query  2398  NMKFLRMFLILSVLIG---FCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWY  2228
             ++KF+   L   +L     F    T  S LETYIV +E P    S         DL  W+
Sbjct  2     DLKFISTILCFVLLHSSKTFGDHFTNQSDLETYIVYLESPDQLFSNSK------DLLLWH  55

Query  2227  KSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             +SFLPT         SR+++ YR+V  GFAA LS++EVKEM  K GF+SA P+R+  LH+
Sbjct  56    QSFLPTN----SNHSSRILYSYRHVFNGFAAMLSSDEVKEMEKKPGFLSARPDRLFQLHS  111

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             THSP FLGL QN+G W  S+ GKGVIIG+LDSGI   HPSF+D GMP PP +WKG CE N
Sbjct  112   THSPSFLGLHQNVGLWNASNSGKGVIIGILDSGIDPQHPSFNDNGMPNPPLKWKGKCEFN  171

Query  1867  FTACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLA  1688
              T CN K+IGAR+F +      D+ GHGTHT+ TAAGNFV GAN YG+ANGTA G+AP A
Sbjct  172   VTNCNKKLIGARNFVQPGEFPIDEYGHGTHTSSTAAGNFVDGANFYGNANGTAVGIAPRA  231

Query  1687  HLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKG  1508
             H+A+YKVC  I C    IL  +D AIEDGVDI+ +  G     F++D+IA+  YSAMEKG
Sbjct  232   HVAMYKVCGGILCRVWMILVGIDVAIEDGVDIIVVPFGLGHPPFYDDAIAISTYSAMEKG  291

Query  1507  IFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFN  1328
             IFVS SAGN+GP +G++ N APW+LTVGAST DRK+SA  VLGN  ++ GE+AFQP +F+
Sbjct  292   IFVSCSAGNKGPDSGTVMNGAPWILTVGASTTDRKISAVAVLGNGSEYEGESAFQPTNFS  351

Query  1327  SSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGR  1148
               LL LV  G+           D ESL  ++V+GKIV+C       R  KG  VKNA G 
Sbjct  352   RKLLPLV-NGE-----------DCESLNRSNVKGKIVLCYISVHPSRYSKGARVKNAGGA  399

Query  1147  GMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNA  968
             GMILI  +  G TT +  +V+P   + Y DGQ+I+ Y+ +TS P+ T SF+GT  GDK+A
Sbjct  400   GMILINKKNRGSTTFSDYYVVPTAQVGYNDGQEIINYVKSTSTPVGTISFRGTTFGDKHA  459

Query  967   PTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPH  788
             PTV  +SSRGP   S GILKPDIIGPG+NILA W       P     F+I+SGTS+SCP 
Sbjct  460   PTVTYYSSRGPFMPSQGILKPDIIGPGLNILAAWSI-----PKEGQIFHILSGTSISCPL  514

Query  787   LSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSK  608
             L+GVAALLKS+HPDWSPA IKSA+MTTADI+N   +PIQ++ L  A + +IG+GHVNPS+
Sbjct  515   LAGVAALLKSAHPDWSPAAIKSAIMTTADIINLRNDPIQDETLEPADLLTIGSGHVNPSR  574

Query  607   ANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILE  428
             ANDPGLVYD +PEDY PYLCGLNYT+ ++ +I+  +V+C+   SIP+++LNYPSFSI  +
Sbjct  575   ANDPGLVYDIQPEDYFPYLCGLNYTDDQISLIVSKKVHCTT--SIPQSELNYPSFSIPTK  632

Query  427   STAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKA  248
             S+ QTYTRTVTNVGEASS YTV++F   GV+V V+P+ L+F+ +NQK +YNVT       
Sbjct  633   SSPQTYTRTVTNVGEASSSYTVKVFGLKGVEVTVQPKILKFTALNQKASYNVTVKSLDVT  692

Query  247   ARSNMPPVVQGALRWKSVKHHVRSPI  170
               S      QG + W S +H VRSPI
Sbjct  693   GHS------QGYIIWSSDRHSVRSPI  712



>ref|XP_002275381.2| PREDICTED: subtilisin-like protease SDD1 [Vitis vinifera]
Length=1076

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/727 (56%), Positives = 516/727 (71%), Gaps = 21/727 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S+L+TYIV ++ P   +  +S      +LE WYKSFLP  +A     E RMV+ YRNV+ 
Sbjct  366   SRLKTYIVHLKEPEGGVFAESE-----NLEGWYKSFLPARIASSKQQE-RMVYSYRNVLT  419

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFAA+L+ EE KEM  K+GF+SA PE+I  LHTTHSP FLGL +  G W+ S+ GKGVII
Sbjct  420   GFAARLTEEEAKEMEAKEGFVSARPEKIYHLHTTHSPSFLGLHKRSGLWKGSNLGKGVII  479

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA-CNNKVIGARSFSERERSV--Fdd  1796
             GV+DSGI   HPSF DEGMPPPPA+W G+CE N +  C+NKVIGAR+F    + +  FD+
Sbjct  480   GVMDSGILPSHPSFGDEGMPPPPAKWTGLCEFNKSGGCSNKVIGARNFESGSKGMPPFDE  539

Query  1795  dghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDT  1616
              GHG+HTA  AAGNFV+ ANV G+A GTAAGVAP AHLAIYK+C + GC+ ++ILAA D 
Sbjct  540   GGHGSHTASIAAGNFVKHANVLGNAKGTAAGVAPGAHLAIYKICTDEGCAGADILAAFDA  599

Query  1615  AIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWM  1436
             AI DGVD+LS+S+G  S+ F++D+IA+GA++A+ KGI VS SAGN GP + S+ N APW+
Sbjct  600   AIADGVDVLSVSVGQKSTPFYDDAIAVGAFAAIRKGILVSCSAGNYGPTSASVGNAAPWI  659

Query  1435  LTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPY-CD  1259
             LTVGAST+DR + A+V LGN ++F GE+ FQP D+      LV+          SPY C 
Sbjct  660   LTVGASTIDRSIRASVKLGNGEKFDGESLFQPSDYPPEFFPLVY----------SPYFCS  709

Query  1258  SESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPA  1079
             + ++  ADV GK+V+C + G      KG  VK A G  MI+   +  G TT A  HVLPA
Sbjct  710   AGTVNVADVEGKVVLCDSDGKTSITDKGRVVKQAGGVAMIVANSDLAGSTTIALEHVLPA  769

Query  1078  IDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDI  899
               ++Y+ G  I AYI++TS+P A+ +F+GTI G+ +AP V  FS+RGP+  +PGILKPDI
Sbjct  770   SHVSYSAGLSIKAYISSTSHPTASIAFEGTIIGEPSAPEVIFFSARGPSLATPGILKPDI  829

Query  898   IGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSA  719
             IGPG+NILA WPT + N   SK TFN++SGTSMSCPHLSGVAAL+KSSHPDWSPA IKSA
Sbjct  830   IGPGMNILAAWPTPLHNNSPSKLTFNLLSGTSMSCPHLSGVAALIKSSHPDWSPAAIKSA  889

Query  718   MMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLN  539
             +MTTADILN   +PI +Q    AS+F+IGAGHVNP +ANDPGL+YD +P+DY+PYLCGL 
Sbjct  890   IMTTADILNLKDSPILDQTEHPASIFAIGAGHVNPLRANDPGLIYDIQPDDYIPYLCGLG  949

Query  538   YTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVE  359
             Y + +VG+I    V CS   SIPEAQLNYPSFSI L S A+ + RTVTNVG+ +S YTV 
Sbjct  950   YNDTQVGLITLRTVRCSEESSIPEAQLNYPSFSIALRSKARRFQRTVTNVGKPTSSYTVH  1009

Query  358   IFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVR  179
             I  PPGV V V+P +L F+K NQK TY VTF  SS    +      QG L+W S  H  R
Sbjct  1010  IAAPPGVDVTVKPHKLHFTKRNQKKTYTVTFKRSSSGVITGE-QYAQGFLKWVSATHSAR  1068

Query  178   SPIAAKL  158
             SPIA K 
Sbjct  1069  SPIAVKF  1075


 Score =   216 bits (551),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 129/170 (76%), Gaps = 2/170 (1%)
 Frame = -1

Query  760  SSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYD  581
            S+HP+WSPA IKSA+MTTAD +NH   PI +Q    A +F++GAGHVNPS+ANDPGL+YD
Sbjct  171  STHPEWSPAAIKSAIMTTADEVNHENKPIMDQTHQPADIFAVGAGHVNPSRANDPGLIYD  230

Query  580  TKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILES--TAQTYT  407
             +PEDY+ YLCGL Y++ +VG+++  RVNCS   +IPEAQLNYPS SI L S  T Q +T
Sbjct  231  IQPEDYIHYLCGLGYSDSQVGIVVNRRVNCSEESTIPEAQLNYPSSSIALGSSTTTQEFT  290

Query  406  RTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLS  257
            RT TNVG   S Y +EIF PPGV V+V+P +L F+++NQK TY V F ++
Sbjct  291  RTATNVGAVDSTYIIEIFAPPGVNVSVKPDKLDFTRLNQKKTYAVMFRIA  340


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 43/72 (60%), Gaps = 1/72 (1%)
 Frame = -1

Query  1177  GEAVKNASGRGMILIEPEEYGITTSA-TAHVLPAIDITYADGQKILAYINATSNPMATFS  1001
             G  VKNA G  +IL   +  G +TS   A +LPA  ++Y+ G KI AYIN+T+ P AT  
Sbjct  103   GNEVKNAGGVAIILPNNKYRGFSTSEINADILPATHLSYSSGLKIKAYINSTTKPTATIE  162

Query  1000  FKGTITGDKNAP  965
             FKGTI G    P
Sbjct  163   FKGTIIGISTHP  174



>ref|XP_010108074.1| Subtilisin-like protease SDD1 [Morus notabilis]
 gb|EXC17806.1| Subtilisin-like protease SDD1 [Morus notabilis]
Length=798

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/749 (56%), Positives = 525/749 (70%), Gaps = 35/749 (5%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGES----RMVFMYR  2159
             S L+TYIV V+ P        S     DL+ WY++FLP+T        S    R+V  Y+
Sbjct  53    SSLKTYIVHVKKPQISGVLSVSDQ---DLKAWYQTFLPSTTPTIATTRSSHYPRLVHAYK  109

Query  2158  NVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGK  1979
             NV+ GFAA+L+A+EVK M  KDGF+SA  E+I  LHTTH+P FLGL Q +G W DS  G+
Sbjct  110   NVVSGFAARLTADEVKAMEKKDGFVSAREEKIYSLHTTHTPKFLGLFQGLGLWNDSRLGE  169

Query  1978  GVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSV--  1805
             GVI+G+LD+GI  DHPSFSDEG+PPPPA+W+G C+   T CNNK+IGAR F    +S   
Sbjct  170   GVIVGLLDTGIWPDHPSFSDEGLPPPPAKWRGKCDFTGTECNNKLIGARDFVTSTKSTGT  229

Query  1804  --------FdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYK-------  1670
                     FD +GHGTHT+ TAAGNFV GAN +G ANGTAAG+AP AHLA+Y+       
Sbjct  230   KSPSGQPPFDLEGHGTHTSSTAAGNFVSGANAFGMANGTAAGIAPRAHLAMYRQENEEYL  289

Query  1669  -----VCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGI  1505
                  VC E GCS+++ILAA+D AIEDGVD+LSLSLGG S+ F+ DSIA+GA++A++KGI
Sbjct  290   QYLCPVCAE-GCSEADILAALDAAIEDGVDVLSLSLGGGSAPFYFDSIAIGAFAAIQKGI  348

Query  1504  FVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNS  1325
              VS SAGNEGP   +LSNEAPW+LTVGASTVDRK+ A  +LGN +   GE+  Q   F+S
Sbjct  349   IVSCSAGNEGPDYFTLSNEAPWILTVGASTVDRKIKADAILGNGEVLEGESLNQLAPFDS  408

Query  1324  SL-LSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGR  1148
             S    L++PG   S   S  YC   SL++ DV+GKIV C  GG + R  KG  VK+A G 
Sbjct  409   SKPYPLIYPG--ASGNESVKYCAPGSLQSLDVKGKIVACDRGGGIARIDKGTEVKSAGGI  466

Query  1147  GMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNA  968
              MIL+  +  G +T A AHVLPA  +++A   KI AYI ++S+P+AT  FKGT+ GD +A
Sbjct  467   AMILMNEKIDGFSTLADAHVLPATHVSFAASLKIKAYIKSSSSPLATILFKGTVIGDSHA  526

Query  967   PTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNS-KSTFNIISGTSMSCP  791
             P V +FSSRGP+  S GILKPDIIGPGV+ILA WP SVDN   S K+TFN+ISGTSMSCP
Sbjct  527   PVVTSFSSRGPSEASIGILKPDIIGPGVSILAAWPVSVDNSTTSGKATFNMISGTSMSCP  586

Query  790   HLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPS  611
             HLSGVAALLKSSHP+WSPA IKSA++TTAD+ N G   I ++    A VF+ GAGHVNPS
Sbjct  587   HLSGVAALLKSSHPEWSPATIKSAILTTADVSNLGGGAILDEKASPADVFATGAGHVNPS  646

Query  610   KANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL  431
             KAN+PGL+YD +PEDY+PYLCGLNYT+ +V  I Q  V CS V SIPE+QLNYP+F+++L
Sbjct  647   KANNPGLIYDIEPEDYIPYLCGLNYTDDQVSTITQTTVKCSEVQSIPESQLNYPTFTVLL  706

Query  430   ESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSK  251
              +   +YTRTVTNVGEA+S YT++++ P G  +NV P +L F++VNQK  Y +     S 
Sbjct  707   GNERLSYTRTVTNVGEANSEYTLDVYPPVGTGINVTPNKLTFTEVNQKAEYKIEIIQVSG  766

Query  250   AARSNMPPVVQGALRWKSVKHHVRSPIAA  164
               RS   P  QG L WKS K+ VRS I A
Sbjct  767   PGRSTN-PFEQGYLVWKSDKYSVRSQITA  794



>ref|XP_007210332.1| hypothetical protein PRUPE_ppa002068mg [Prunus persica]
 gb|EMJ11531.1| hypothetical protein PRUPE_ppa002068mg [Prunus persica]
Length=721

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/750 (52%), Positives = 501/750 (67%), Gaps = 45/750 (6%)
 Frame = -1

Query  2377  FLILSVLIGFCS----------TATIASKLETYIVRVELPHsristqsssssSVDLEHWY  2228
             FL L  L  FC           T T  S L+TYIV V  P  R+  Q+      DL+ W+
Sbjct  6     FLTLIFLFSFCCVNAQQNDLFPTTTKWSNLQTYIVHVRKPEGRVFAQTE-----DLKSWH  60

Query  2227  KSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             +SFLP         + RM++ Y+ V+ GFAA+L+ E+V+ M   DGF++A PER+    T
Sbjct  61    ESFLPAITTASSDEQPRMLYSYQEVISGFAARLTQEQVRAMKEMDGFVAAHPERVFRRKT  120

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             TH+P FLGL Q  G W++S++GKGVIIGVLD GI  +HPSFS  G+PPPPA+WKG C+ N
Sbjct  121   THTPNFLGLHQQKGIWKESNFGKGVIIGVLDGGIEPNHPSFSGAGIPPPPAKWKGRCDFN  180

Query  1867  FTACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLA  1688
              + CNNK+IGAR+F+   +++              A N + G   + ++  TAAG     
Sbjct  181   ASDCNNKLIGARAFNLAAQAL--------KGDQPEAPNDIDGHGTHTAS--TAAGAF---  227

Query  1687  HLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKG  1508
                           ++++L     A++DGVD++S+SLG  S  F  DS A+G+++A++KG
Sbjct  228   ------------VQNADVLGNAKAAVQDGVDVISISLGEDSVPFFNDSTAIGSFAAIQKG  275

Query  1507  IFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFN  1328
             IFVS SAGN GPFNG+LSNEAPW+LTVGAST+DR++ AT  LGN ++F GE+ FQPKDF 
Sbjct  276   IFVSCSAGNSGPFNGTLSNEAPWILTVGASTIDRRIVATAKLGNGEEFDGESLFQPKDFP  335

Query  1327  SSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGR  1148
             S+LL LV+ G N   +++S  C   SL+   V+GK+V+C  GG + R  KGE VKNA G 
Sbjct  336   STLLPLVYAGVN--GKANSALCAEGSLKGLSVKGKVVLCERGGGIGRIAKGEEVKNAGGA  393

Query  1147  GMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNA  968
              MIL+  E  G +TSA  HVLPA  +++A G KI AYIN+T+ P AT  FKGT+ GD + 
Sbjct  394   AMILVNEETDGFSTSADVHVLPATHVSHAAGLKIKAYINSTATPTATILFKGTVIGDSST  453

Query  967   PTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPH  788
             P VA+FSSRGP+  SPGILKPDIIGPGV+ILA WP  VDN  NSK  FNIISGTSMSCPH
Sbjct  454   PAVASFSSRGPSLASPGILKPDIIGPGVSILAAWPFPVDNTTNSKVNFNIISGTSMSCPH  513

Query  787   LSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSK  608
             LSG+AALLKSSHP WSPA IKSA+MT+AD+LN    PI ++ L  A V + G GHVNPSK
Sbjct  514   LSGIAALLKSSHPYWSPAAIKSAIMTSADLLNLEGKPIPDETLQPADVLATGVGHVNPSK  573

Query  607   ANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILE  428
             ANDPGLVYD +P+DY+PYLCGL Y + EV +++   + CS V SIPE +LNYPSFS+ L 
Sbjct  574   ANDPGLVYDIQPDDYIPYLCGLGYKDDEVSILVHRPIKCSKVSSIPEGELNYPSFSVAL-  632

Query  427   STAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKA  248
               +QT+TRTVTNVGEA S Y V++  P  V V++ P+ L FSKVNQKL+Y+VTF  S   
Sbjct  633   GPSQTFTRTVTNVGEAYSSYAVKVNAPEEVYVSINPKTLYFSKVNQKLSYSVTF--SRIG  690

Query  247   ARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
             +R       QG L W S KH VRSPI+ KL
Sbjct  691   SRGKAGEFTQGFLTWVSAKHVVRSPISVKL  720



>gb|AES94150.2| subtilisin-like serine protease [Medicago truncatula]
Length=758

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/730 (56%), Positives = 514/730 (70%), Gaps = 21/730 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S L TYIV VE P  +            L+ WY S LP         + R++F Y+NVM 
Sbjct  44    SSLLTYIVHVEKPSLQSKE--------SLDGWYNSLLPAATIKT-QNQQRVIFSYQNVMN  94

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFA KL+ EE K +  K+  +S  PE IL LHTTH+P FLGLQQ+ G W +S+ GKG+II
Sbjct  95    GFAVKLTPEEAKALEEKEEVLSIRPENILSLHTTHTPSFLGLQQSQGLWINSNLGKGIII  154

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA---CNNKVIGARSF-SERERSV-F  1802
             G+LD+GI+  HPSFSDEGMP PPA+W G CE  FT    CN K+IGAR+F ++   S+ F
Sbjct  155   GILDTGISLSHPSFSDEGMPSPPAKWNGHCE--FTGERICNKKLIGARNFVTDTNLSLPF  212

Query  1801  dddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAM  1622
             DD GHGTHTA TAAG  V+GANV+G+A GTA G+AP AHLAIYKVC+  GC +S  LA M
Sbjct  213   DDVGHGTHTASTAAGRLVQGANVFGNAKGTATGMAPDAHLAIYKVCSSSGCPESATLAGM  272

Query  1621  DTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAP  1442
             D A+EDGVD+LS+SL G ++ F ED IALGA+SA +KGIFVS SAGN GP  G+ SNEAP
Sbjct  273   DAAVEDGVDVLSISLNGPTNPFFEDVIALGAFSANQKGIFVSCSAGNFGPDYGTTSNEAP  332

Query  1441  WMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYC  1262
             W+LTVGAST DRK+ A   LGN +++ GE+ FQPK+F S+LL LV+ G     ++S  +C
Sbjct  333   WILTVGASTTDRKIEAIAKLGNGEKYIGESVFQPKEFASTLLPLVYAGSVNISDNSIAFC  392

Query  1261  DSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGIT-TSATAHVL  1085
                S++N DV+GK+V+C  GG + +  K +AVK+A G  MIL+  +  G    S     L
Sbjct  393   GPISMKNIDVKGKVVLCEEGGLVSQAAKAQAVKDAGGSAMILMNSKLQGFDPKSDVQDNL  452

Query  1084  PAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKP  905
             PA  ++Y+ G  I  YIN+TS PMAT  F GT+ G+ NAP VA FSSRGPN+ESPGILKP
Sbjct  453   PAALVSYSAGLSIKDYINSTSTPMATILFNGTVIGNPNAPQVAYFSSRGPNQESPGILKP  512

Query  904   DIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIK  725
             DIIGPGVNILA W  S+DN   +   +NIISGTSMSCPHLSG+AALLK+SHPDWSPA IK
Sbjct  513   DIIGPGVNILAAWHVSLDN---NIPPYNIISGTSMSCPHLSGIAALLKNSHPDWSPAAIK  569

Query  724   SAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCG  545
             SA+MTTA  +N     I +Q L  A +F+ GAGHVNPSKANDPGLVYD +P DY+PYLCG
Sbjct  570   SAIMTTAYEVNLQGKAILDQRLKPADLFATGAGHVNPSKANDPGLVYDIEPNDYVPYLCG  629

Query  544   LNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYT  365
             LNYT+R VG+ILQ +V CS + SIP+AQLNYPSFSI+L ST+Q YTRTVTNVG  +  Y 
Sbjct  630   LNYTDRHVGIILQQKVKCSDIKSIPQAQLNYPSFSILLGSTSQFYTRTVTNVGPINMTYN  689

Query  364   VEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHH  185
             VEI  P  V ++++P ++ F++  QK+TY+V F+  +   R +   + QG+++W S K+ 
Sbjct  690   VEIDVPLAVDISIKPAQITFTEKKQKVTYSVAFTPENIVNRGDK-EISQGSIKWVSGKYT  748

Query  184   VRSPIAAKLV  155
             VR PI+   V
Sbjct  749   VRIPISVIFV  758



>ref|XP_003611192.1| Subtilisin-like serine protease [Medicago truncatula]
Length=753

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/730 (56%), Positives = 514/730 (70%), Gaps = 21/730 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S L TYIV VE P  +            L+ WY S LP         + R++F Y+NVM 
Sbjct  39    SSLLTYIVHVEKPSLQSKE--------SLDGWYNSLLPAATIKT-QNQQRVIFSYQNVMN  89

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFA KL+ EE K +  K+  +S  PE IL LHTTH+P FLGLQQ+ G W +S+ GKG+II
Sbjct  90    GFAVKLTPEEAKALEEKEEVLSIRPENILSLHTTHTPSFLGLQQSQGLWINSNLGKGIII  149

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA---CNNKVIGARSF-SERERSV-F  1802
             G+LD+GI+  HPSFSDEGMP PPA+W G CE  FT    CN K+IGAR+F ++   S+ F
Sbjct  150   GILDTGISLSHPSFSDEGMPSPPAKWNGHCE--FTGERICNKKLIGARNFVTDTNLSLPF  207

Query  1801  dddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAM  1622
             DD GHGTHTA TAAG  V+GANV+G+A GTA G+AP AHLAIYKVC+  GC +S  LA M
Sbjct  208   DDVGHGTHTASTAAGRLVQGANVFGNAKGTATGMAPDAHLAIYKVCSSSGCPESATLAGM  267

Query  1621  DTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAP  1442
             D A+EDGVD+LS+SL G ++ F ED IALGA+SA +KGIFVS SAGN GP  G+ SNEAP
Sbjct  268   DAAVEDGVDVLSISLNGPTNPFFEDVIALGAFSANQKGIFVSCSAGNFGPDYGTTSNEAP  327

Query  1441  WMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYC  1262
             W+LTVGAST DRK+ A   LGN +++ GE+ FQPK+F S+LL LV+ G     ++S  +C
Sbjct  328   WILTVGASTTDRKIEAIAKLGNGEKYIGESVFQPKEFASTLLPLVYAGSVNISDNSIAFC  387

Query  1261  DSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGIT-TSATAHVL  1085
                S++N DV+GK+V+C  GG + +  K +AVK+A G  MIL+  +  G    S     L
Sbjct  388   GPISMKNIDVKGKVVLCEEGGLVSQAAKAQAVKDAGGSAMILMNSKLQGFDPKSDVQDNL  447

Query  1084  PAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKP  905
             PA  ++Y+ G  I  YIN+TS PMAT  F GT+ G+ NAP VA FSSRGPN+ESPGILKP
Sbjct  448   PAALVSYSAGLSIKDYINSTSTPMATILFNGTVIGNPNAPQVAYFSSRGPNQESPGILKP  507

Query  904   DIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIK  725
             DIIGPGVNILA W  S+DN   +   +NIISGTSMSCPHLSG+AALLK+SHPDWSPA IK
Sbjct  508   DIIGPGVNILAAWHVSLDN---NIPPYNIISGTSMSCPHLSGIAALLKNSHPDWSPAAIK  564

Query  724   SAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCG  545
             SA+MTTA  +N     I +Q L  A +F+ GAGHVNPSKANDPGLVYD +P DY+PYLCG
Sbjct  565   SAIMTTAYEVNLQGKAILDQRLKPADLFATGAGHVNPSKANDPGLVYDIEPNDYVPYLCG  624

Query  544   LNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYT  365
             LNYT+R VG+ILQ +V CS + SIP+AQLNYPSFSI+L ST+Q YTRTVTNVG  +  Y 
Sbjct  625   LNYTDRHVGIILQQKVKCSDIKSIPQAQLNYPSFSILLGSTSQFYTRTVTNVGPINMTYN  684

Query  364   VEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHH  185
             VEI  P  V ++++P ++ F++  QK+TY+V F+  +   R +   + QG+++W S K+ 
Sbjct  685   VEIDVPLAVDISIKPAQITFTEKKQKVTYSVAFTPENIVNRGDK-EISQGSIKWVSGKYT  743

Query  184   VRSPIAAKLV  155
             VR PI+   V
Sbjct  744   VRIPISVIFV  753



>ref|XP_003611190.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES94148.1| subtilisin-like serine protease [Medicago truncatula]
Length=754

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/728 (56%), Positives = 517/728 (71%), Gaps = 21/728 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S L TYIV V  P  +            L  WY S LP         + R++F YRN++ 
Sbjct  44    SSLLTYIVHVNKPSLQSKE--------SLHGWYHSLLPQATTET-QNQQRIIFSYRNIVA  94

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFA KL+ EE K +   +  +S  PE+I  LHTTH+P FLGLQQN   W +S+ GKG+II
Sbjct  95    GFAVKLTPEEAKVLEENEEVLSIRPEKIFSLHTTHTPSFLGLQQNQELWGNSNQGKGIII  154

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA---CNNKVIGARSFSERERSVFdd  1796
             G+LD+GI   HPSFSDEGMP PPA+W G CE  FT    CN K+IGAR+        +D 
Sbjct  155   GMLDTGITLSHPSFSDEGMPSPPAKWNGHCE--FTGERICNKKIIGARNIVNSSLP-YDY  211

Query  1795  dghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDT  1616
              GHGTHTA TAAG  V+GANV+G+ANGTA G+AP AHLAIYKVC   GC++S ILA MD 
Sbjct  212   VGHGTHTASTAAGRPVKGANVFGNANGTAIGMAPYAHLAIYKVCGVFGCAESVILAGMDV  271

Query  1615  AIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWM  1436
             A++DGVD+LSLSLG  S+SF E  IALGA+SA++KGIFVS SAGN GPF+G+L+NEAPW+
Sbjct  272   AVDDGVDVLSLSLGQPSTSFFESGIALGAFSAIQKGIFVSCSAGNSGPFHGTLANEAPWI  331

Query  1435  LTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQ-NTSDESSSPYCD  1259
             LTVGAST+DRK+ A   LG+  ++ GE+ FQPKDF S+LL LV+ G  NTSD+  + +C+
Sbjct  332   LTVGASTIDRKIEAVAKLGDGTEYLGESVFQPKDFASTLLPLVYAGAINTSDDFIA-FCN  390

Query  1258  SESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPA  1079
               S+ N DV+GK+VVC   G ++R  KG+AVK+A G  MIL+  E+      A  HVLPA
Sbjct  391   PFSMENVDVKGKVVVCEQDGSVERVAKGQAVKDAGGAAMILLNGEDEAFNPIADVHVLPA  450

Query  1078  IDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDI  899
             + ++Y+ G  I  YIN+TS PMAT  FKGT+ G+  +P VA+FSSRGP++ SPGILKPDI
Sbjct  451   VHVSYSAGLSIKDYINSTSTPMATILFKGTVIGNPLSPQVASFSSRGPSKTSPGILKPDI  510

Query  898   IGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSA  719
             IGPG+NILA WP S+D   NS S+FNII+GTSMSCPHLSG+AALLK+SHPDWSPA IKSA
Sbjct  511   IGPGLNILAGWPISLD---NSTSSFNIIAGTSMSCPHLSGIAALLKNSHPDWSPAAIKSA  567

Query  718   MMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLN  539
             +MTTA+ +N    PI +Q L+ A VF+ GAGHVNPSKANDPGLVYD +  DY+PYLCGLN
Sbjct  568   IMTTANHVNLHGKPILDQRLLPADVFATGAGHVNPSKANDPGLVYDIETNDYVPYLCGLN  627

Query  538   YTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVE  359
             YT+ +VG+ILQ +V CS V SIP+AQLNYPS SI L +T+Q Y+RT+TNVG  ++ Y V 
Sbjct  628   YTDIQVGIILQQKVKCSDVKSIPQAQLNYPSISIRLGNTSQFYSRTLTNVGPVNTTYNVV  687

Query  358   IFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVR  179
             I  P  V+++V P ++ F++V QK+TY V F    K  R +   + QG+++W S K+ V 
Sbjct  688   IDVPVAVRMSVRPSQITFTEVKQKVTYWVDFIPEDKENRGDN-FIAQGSIKWISAKYSVS  746

Query  178   SPIAAKLV  155
              PIA   V
Sbjct  747   IPIAVVFV  754



>ref|XP_006464862.1| PREDICTED: subtilisin-like protease SDD1-like [Citrus sinensis]
Length=744

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/732 (55%), Positives = 506/732 (69%), Gaps = 23/732 (3%)
 Frame = -1

Query  2329  ASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVA---GGGYGESRMVFMYR  2159
             A+ L+TYIVRV+ P     +        DLE WY SFLP TV+      + +SR+++ Y+
Sbjct  27    ANVLQTYIVRVQKPEQGTFSTEK-----DLERWYHSFLPATVSKSPADDHHQSRILYCYK  81

Query  2158  NVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGK  1979
             NVM GFAA+L+AEEVK M  K GFISA  E  L  HTT+SP FLGL QN G W+DS+ GK
Sbjct  82    NVMSGFAARLTAEEVKAMETKKGFISAHVETYLGTHTTNSPKFLGLNQNSGLWKDSNLGK  141

Query  1978  GVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-SERERSVF  1802
             GVIIGV+DSG+  DHPSFSDEGMPPPPA+WKG CEL    CNNKVIG R+F S       
Sbjct  142   GVIIGVIDSGVKPDHPSFSDEGMPPPPAKWKGKCELEGATCNNKVIGVRNFLSSIGEPAV  201

Query  1801  dddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCS--DSEILA  1628
             DD GHGTHTA TAAGNFV GAN +G ANGTA G+APLAHLAIYK  N        S I A
Sbjct  202   DDMGHGTHTASTAAGNFVSGANTFGLANGTAVGMAPLAHLAIYKTGNGKHQEGFQSRIAA  261

Query  1627  AMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNE  1448
             A++ A++DGVD++S+S G    +F++D IA  A++A+  GIFVS +AGN+GP   S +N 
Sbjct  262   AIEAAVQDGVDVISISYGSPPLAFYDDPIASAAFTAVRNGIFVSCAAGNKGPDPSSSTNG  321

Query  1447  APWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSP  1268
             APW+LTVGAST DR + A+  LGN   +  E  F   +F S  L LV+PG      SS+ 
Sbjct  322   APWILTVGASTTDRSIVASAQLGNHATYDVEILFMLVNFTSMQLPLVYPG---GRNSSAA  378

Query  1267  YCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHV  1088
             +C   SL N DV+GK+VVC   G + R      VK A G  MILI  +    +     HV
Sbjct  379   FCLPGSLNNIDVKGKVVVCERDGNMRRNETEYYVKEAGGAAMILISDKFDAYSAILETHV  438

Query  1087  LPAIDITYADGQKILAYINATSNPMATFSFKGTITGDK-NAPTVAAFSSRGPNRESPGIL  911
             LPA+ + YA G+ I AYIN+T +P      +   TG+K +AP VA+ S+RGPN+ SPGIL
Sbjct  439   LPAVQVGYATGESIKAYINSTPSPTVAILLR---TGNKKSAPEVASLSARGPNKVSPGIL  495

Query  910   KPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAM  731
             KPDIIGPGV+ILA WP+S +N   +K+TF I  GTSMSCPHLSG+AALLKS+HPDWSPA 
Sbjct  496   KPDIIGPGVSILAAWPSSQENITKTKATFEIADGTSMSCPHLSGIAALLKSTHPDWSPAA  555

Query  730   IKSAMMTTADILN-HGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPY  554
             IKSA+MTTADI+N  G+  I N +L+ A +F++GAGHVNPSK NDPGL+YD +P+DY+PY
Sbjct  556   IKSAIMTTADIVNLEGKPIINNYNLLPADLFAVGAGHVNPSKTNDPGLIYDIQPDDYVPY  615

Query  553   LCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASS  374
             LCGLNYT+++V  I+ H V CS V SI EA+LNYPSFSI L S+ QTY RT+TNVGEA+S
Sbjct  616   LCGLNYTDQQVQTIVDHDVQCSKVPSIAEAELNYPSFSIKLGSSPQTYNRTITNVGEANS  675

Query  373   FYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSV  194
              YT +I  P GV+++V+P E+ F++ NQK+TY++TF+ S K + S      QG L W S 
Sbjct  676   SYTHQIVAPEGVEISVQPNEISFTERNQKVTYSITFTRSQKTSAS----YAQGYLSWVST  731

Query  193   KHHVRSPIAAKL  158
             +H VRSPIA   
Sbjct  732   QHTVRSPIAVSF  743



>ref|XP_006427879.1| hypothetical protein CICLE_v10027438mg, partial [Citrus clementina]
 gb|ESR41119.1| hypothetical protein CICLE_v10027438mg, partial [Citrus clementina]
Length=731

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/732 (55%), Positives = 505/732 (69%), Gaps = 23/732 (3%)
 Frame = -1

Query  2329  ASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVA---GGGYGESRMVFMYR  2159
             A+ L+TYIVRV+ P     +        DLE WY SFLP TV+      + +SR+++ Y+
Sbjct  14    ANVLQTYIVRVQKPEQGTFSTEK-----DLERWYHSFLPATVSKSPADDHHQSRILYCYK  68

Query  2158  NVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGK  1979
             NVM GFAA+L+AEEVK M  K GFISA  E  L  HTT+SP FLGL QN G W+DS+ GK
Sbjct  69    NVMSGFAARLTAEEVKAMETKKGFISAHVETYLGTHTTNSPKFLGLNQNSGLWKDSNLGK  128

Query  1978  GVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-SERERSVF  1802
             GVIIGV+DSG+  DHPSFSDEGMPPPPA+WKG CEL    CNNKVIG R+F S       
Sbjct  129   GVIIGVIDSGVKPDHPSFSDEGMPPPPAKWKGKCELEGATCNNKVIGVRNFLSSIGEPAV  188

Query  1801  dddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCS--DSEILA  1628
             DD GHGTHTA TAAGNFV GAN +G ANGTA G+APLAHLAIYK  N        S I A
Sbjct  189   DDMGHGTHTASTAAGNFVSGANTFGLANGTAVGMAPLAHLAIYKTGNGKHQEGFQSRIAA  248

Query  1627  AMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNE  1448
             A++ A++DGVD++ +S G    +F++D IA  A++A+  GIFVS +AGN+GP   S +N 
Sbjct  249   AIEAAVQDGVDVIWISYGSPPLAFYDDPIASAAFTAVRNGIFVSCAAGNKGPDPSSSTNG  308

Query  1447  APWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSP  1268
             APW+LTVGAST DR + A+  LGN   +  E  F   +F S  L LV+PG      SS+ 
Sbjct  309   APWILTVGASTTDRSIVASAQLGNHATYDVEILFMLVNFTSMQLPLVYPG---GRNSSAA  365

Query  1267  YCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHV  1088
             +C   SL N DV+GK+VVC   G + R      VK A G  MILI  +    +     HV
Sbjct  366   FCLPGSLNNIDVKGKVVVCERDGNMRRNETEYYVKEAGGAAMILISDKFDAYSAILETHV  425

Query  1087  LPAIDITYADGQKILAYINATSNPMATFSFKGTITGDK-NAPTVAAFSSRGPNRESPGIL  911
             LPA+ + YA G+ I AYIN+T +P      +   TG+K +AP VA+ S+RGPN+ SPGIL
Sbjct  426   LPAVQVGYATGESIKAYINSTPSPTVAILLR---TGNKKSAPEVASLSARGPNKVSPGIL  482

Query  910   KPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAM  731
             KPDIIGPGV+ILA WP+S +N   +K+TF I  GTSMSCPHLSG+AALLKS+HPDWSPA 
Sbjct  483   KPDIIGPGVSILAAWPSSQENITKTKATFEIADGTSMSCPHLSGIAALLKSTHPDWSPAA  542

Query  730   IKSAMMTTADILN-HGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPY  554
             IKSA+MTTADI+N  G+  I N +L+ A +F++GAGHVNPSK NDPGL+YD +P+DY+PY
Sbjct  543   IKSAIMTTADIVNLEGKPIINNYNLLPADLFAVGAGHVNPSKTNDPGLIYDIQPDDYVPY  602

Query  553   LCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASS  374
             LCGLNYT+++V  I+ H V CS V SI EA+LNYPSFSI L S+ QTY RT+TNVGEA+S
Sbjct  603   LCGLNYTDQQVQTIVDHDVQCSKVPSIAEAELNYPSFSIKLGSSPQTYNRTITNVGEANS  662

Query  373   FYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSV  194
              YT +I  P GV+++V+P E+ F++ NQK+TY++TF+ S K + S      QG L W S 
Sbjct  663   SYTHQIVAPEGVEISVQPNEISFTERNQKVTYSITFTRSQKTSAS----YAQGYLSWVST  718

Query  193   KHHVRSPIAAKL  158
             +H VRSPIA   
Sbjct  719   QHTVRSPIAVSF  730



>gb|EYU29564.1| hypothetical protein MIMGU_mgv1a023796mg [Erythranthe guttata]
Length=738

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/753 (56%), Positives = 522/753 (69%), Gaps = 41/753 (5%)
 Frame = -1

Query  2377  FLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTT--V  2204
             FL +  ++ F +    A  L  YIV VE   S            DLE +Y SFLPTT  V
Sbjct  6     FLFIICILNF-NQFLKAENLGVYIVHVEPTQSD-----------DLETFYNSFLPTTSNV  53

Query  2203  AGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLG  2024
                   + R+++ YR+V  GFAAKLSA  V EM  K GFISA PER++ LHTTHSP FLG
Sbjct  54    TSNSEDQPRILYRYRHVFSGFAAKLSAAHVDEMRKKKGFISARPERMMHLHTTHSPNFLG  113

Query  2023  LQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA----C  1856
             L QN G W++SSYGKG+IIG++D+GI  DHPS +D+G+PPPPA+WKG CE  FT+    C
Sbjct  114   LNQNTGLWKNSSYGKGIIIGLVDTGITPDHPSLNDQGVPPPPAKWKGKCE--FTSPRWTC  171

Query  1855  NNKVIGARSFSERERSVFdddghg-----thtagtaaGNFVRGANVYGSANGTAAGVAPL  1691
             NNK+IGAR F  R   +F           THT+G AAGNFV GA+ YG+A GTA+G APL
Sbjct  172   NNKLIGARYF-YRSPPLFVTPLIDQIGHGTHTSGIAAGNFVGGADFYGNARGTASGTAPL  230

Query  1690  AHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslg-gmssSFHEDSIALGAYSAME  1514
             AH+AIY+ C    C  S I AA+D AIEDGVD+LS+SLG  +   F +D +A+G + AME
Sbjct  231   AHVAIYQPCTGSHCGSSGIAAAIDAAIEDGVDVLSMSLGGALHLHFADDIMAIGTFRAME  290

Query  1513  KGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKD  1334
             +GI VS SAGN+GP N +L NEAPW++TVGAST DRK++   VLGN ++  GET      
Sbjct  291   RGIVVSCSAGNDGPKNKTLYNEAPWIMTVGASTTDRKITVNAVLGNGEELEGETG---TG  347

Query  1333  FNS-SLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFL-DRRGKGEAVKN  1160
             F S   L LV+P  N  D   S   D     N D++GKIVVC    +L  R  +G  VK 
Sbjct  348   FPSIEKLDLVYPRSN--DTGMSRCFDGH--FNTDIKGKIVVCEGMKYLVTRVQQGITVKG  403

Query  1159  ASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITG  980
             A G  MIL+  +  G TT    HVLPA+ ITYAD  K+ AY+N+TSNP AT SF+GTI G
Sbjct  404   AGGAAMILLNNKFDGDTTFEEPHVLPAMQITYADSLKLKAYLNSTSNPTATMSFQGTIIG  463

Query  979   DKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDN-KPNSKS-TFNIISGT  806
             +  AP VA FSSRGP+  SPGILKPDIIGPGVNIL+ WP SVDN K ++KS TFN+ISGT
Sbjct  464   NNRAPVVATFSSRGPSVPSPGILKPDIIGPGVNILSSWPASVDNSKTDTKSPTFNMISGT  523

Query  805   SMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAG  626
             SMSCPHLSGVAALLKS HPDWSPA IKSA+MTTAD +N   NPI+++ L  A+VF+IG+G
Sbjct  524   SMSCPHLSGVAALLKSVHPDWSPAAIKSAIMTTADSVNLQGNPIEDEQLQPANVFAIGSG  583

Query  625   HVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPS  446
             HVNPS+ANDPGLVYD  P+DY+PYLCGLNYTN+EVG+I+  +V+CS   +IPEAQLNYPS
Sbjct  584   HVNPSRANDPGLVYDIMPDDYIPYLCGLNYTNQEVGIIVARKVDCSKEKTIPEAQLNYPS  643

Query  445   FSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTF  266
             FSII  S+ QTYTRT+TNVG+A+S Y VEI  P GV V VEP++L F K+  K +Y+VTF
Sbjct  644   FSIIFGSSPQTYTRTLTNVGKANSSYDVEIGSPDGVNVKVEPKKLVFPKLGDKSSYSVTF  703

Query  265   SLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             + ++K     M    QG +RW + ++ VRSPIA
Sbjct  704   TRTNKGV---MNSSTQGFIRWHTAEYSVRSPIA  733



>ref|XP_006358145.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=647

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/656 (59%), Positives = 490/656 (75%), Gaps = 22/656 (3%)
 Frame = -1

Query  2131  LSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDS  1952
             LS++EVKEM  K GF+SA P+R+L L TTH+P FLGL QN+G W  S+ GKGVIIG+LDS
Sbjct  2     LSSDEVKEMELKPGFVSARPQRVLELDTTHTPSFLGLHQNVGLWNASNSGKGVIIGLLDS  61

Query  1951  GIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVFdddghgthta  1772
             GI   HPSF+D GMPPPPA+WKG CE N  ACNNK+IGAR+F     S  D +GHGTHT+
Sbjct  62    GITPKHPSFNDNGMPPPPAKWKGKCEFNSNACNNKLIGARNFVTTSTSPLDVEGHGTHTS  121

Query  1771  gtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDI  1592
              TAAGNFV GAN+ G+ANGTA G+AP AHLA+Y+VC++  C +S ILA +D AIEDGVD+
Sbjct  122   STAAGNFVDGANLLGNANGTAVGIAPRAHLAMYRVCDDGVCQESYILAGLDAAIEDGVDV  181

Query  1591  lslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTV  1412
             LS+SLGGM   F++D++A+GAYSA++KGIFVS SAGN+GP  G+L N APW+LTV A+T 
Sbjct  182   LSISLGGMPVPFYDDALAIGAYSAIQKGIFVSCSAGNKGPAVGTLKNGAPWILTVAATTT  241

Query  1411  DRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADV  1232
             DRK+ A  VLGN  ++ GE+A+QP +F+   L LV               D ESL   DV
Sbjct  242   DRKIRAVAVLGNGAKYVGESAYQPTNFSGKWLPLVNAN------------DCESLFTIDV  289

Query  1231  RGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQ  1052
             +GKIV+C T G L R  KGEAVKNA G  MIL+  ++ G TT A  HVLPA  ++Y +G 
Sbjct  290   KGKIVLCDTSGDLSRIEKGEAVKNAGGAAMILVTEKKRGYTTIADVHVLPATQVSYFNGL  349

Query  1051  KILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILA  872
             KI+ Y+ +TS+P+AT SFKGT  G+K+ PTVA+FSSRGP   SPGILKPDI GPGVNILA
Sbjct  350   KIINYMKSTSSPVATISFKGTEFGNKHVPTVASFSSRGPFSPSPGILKPDISGPGVNILA  409

Query  871   PWPTSVDNK--PNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADI  698
              WPTSV       + STFNIISGTSM+CPHL+GVAALLKS+HPDWSPA IKSA+MTTADI
Sbjct  410   AWPTSVGEMIISATSSTFNIISGTSMACPHLAGVAALLKSAHPDWSPAAIKSAIMTTADI  469

Query  697   LNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVG  518
             +N  ++PI+++ L  A++F+IG+G+VNPS+A+DPGL+YD  PEDY+PYLCGL YT+++V 
Sbjct  470   INLKKHPIEDERLNPANLFTIGSGNVNPSRASDPGLIYDIHPEDYVPYLCGLKYTDQQVS  529

Query  517   VILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGV  338
              I++ +V+C++  SI EA+LNYPSFSI  +S AQTYTRTVTNVGEA+S YTVE+    GV
Sbjct  530   SIVRRKVHCTS--SIAEAELNYPSFSISSKSGAQTYTRTVTNVGEANSTYTVEVCGLNGV  587

Query  337   KVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPI  170
             KV V P  L+FS +NQK +YNVT       + S      QG + W S ++ VRSPI
Sbjct  588   KVAVNPITLKFSALNQKASYNVTVKHLKHRSHS------QGYITWSSGRYSVRSPI  637



>gb|KHN34450.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=688

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/687 (56%), Positives = 495/687 (72%), Gaps = 19/687 (3%)
 Frame = -1

Query  2185  ESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMG  2006
             + RM++ Y NVM GFAA+L+ EE+  +  KDGFISA PERIL   TT++P FLGLQ+  G
Sbjct  11    QPRMIYSYLNVMSGFAARLTEEELIAVEKKDGFISARPERILHRQTTNTPQFLGLQKQTG  70

Query  2005  FWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF  1826
              W++S++GKG+IIGVLD+GI   HPSFSD GM PPP +WKG CE+N TACNNK+IG R+F
Sbjct  71    LWKESNFGKGIIIGVLDTGITPGHPSFSDAGMSPPPPKWKGRCEINVTACNNKLIGVRTF  130

Query  1825  SERER------SVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVC  1664
             +   +      +  DD GHGTHTA TAAG FV  A V G+A GTA+G+AP AHLAIY+VC
Sbjct  131   NHVAKLIKGAEAAIDDFGHGTHTASTAAGAFVDHAEVLGNAEGTASGIAPYAHLAIYRVC  190

Query  1663  NEIGCSDSEILAAMDTAIEDGVDIlslslggmssS-FHEDSIALGAYSAMEKGIFVSASA  1487
             +++ C +S+ILAA+D A+EDGVD+LS+SLG   +  F +  IA+G ++AM+KGIFVS +A
Sbjct  191   SKV-CRESDILAALDAAVEDGVDVLSISLGSKRAKPFFDHGIAIGTFAAMQKGIFVSCAA  249

Query  1486  GNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLV  1307
             GN+GP  GS+ N APW+LTVGAS ++R ++AT  LGN Q+F GE+ FQP DF+ +LL L 
Sbjct  250   GNDGPLPGSVINGAPWILTVGASNINRSIAATAKLGNGQEFDGESIFQPSDFSPTLLPLA  309

Query  1306  FPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEP  1127
             + G N   E +  +C + SL + D RGK+V+C  GG +++  KG+ VK A G  MIL+  
Sbjct  310   YAGMNGKQEDA--FCGNGSLNDIDFRGKVVLCEKGGGIEKIAKGKEVKRAGGAAMILMND  367

Query  1126  EEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFS  947
             E+ G + +   HVLP   ++Y  G KI AYI +T+ P AT  FKGTI G+  AP V +FS
Sbjct  368   EKSGFSLNIDVHVLPTTHVSYDAGLKIKAYIYSTATPTATILFKGTIIGNSLAPVVTSFS  427

Query  946   SRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAAL  767
              RGP+  SPGILKPDIIGPG+NILA WP  ++N   SKSTFNI+SGTSMSCPHLSGVAAL
Sbjct  428   GRGPSLPSPGILKPDIIGPGLNILAAWPFPLNNNTASKSTFNIMSGTSMSCPHLSGVAAL  487

Query  766   LKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLV  587
             LKSSHP WSPA IKSA+MT+ADI++H +  I  + L  A VF+ G+G+VNPS+ANDPGLV
Sbjct  488   LKSSHPHWSPAAIKSAIMTSADIISHERKHIVGETLQPADVFATGSGYVNPSRANDPGLV  547

Query  586   YDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYT  407
             YD KP+DY+PYLCGL Y + EV +I    + CS   SI E +LNYPSFS++L+S  QT+T
Sbjct  548   YDIKPDDYIPYLCGLGYKDTEVEIIAGRTIKCSETSSIREGELNYPSFSVVLDS-PQTFT  606

Query  406   RTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFS---LSSKAARSN  236
             RTVTNVGEA+S Y V +  P GV V V+P +L FS+ NQK TY+VTFS   L  +  +  
Sbjct  607   RTVTNVGEANSSYVVTVSAPDGVDVKVQPNKLYFSEANQKETYSVTFSRIELDDETVK--  664

Query  235   MPPVVQGALRWKSVKHHVRSPIAAKLV  155
                 VQG L+W S KH VRSPI+   V
Sbjct  665   ---YVQGFLQWVSAKHTVRSPISISFV  688



>gb|EYU29561.1| hypothetical protein MIMGU_mgv1a018614mg, partial [Erythranthe 
guttata]
Length=692

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/706 (58%), Positives = 502/706 (71%), Gaps = 32/706 (5%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTV------AGGGYGESRMVFMYR  2159
             L+ YIV V+                DLE +Y SFLPT              + R+++ YR
Sbjct  2     LDVYIVHVDHAQISD----------DLETFYDSFLPTNTNLAAASTNSTTDQPRILYRYR  51

Query  2158  NVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGK  1979
             +V+ GFAAKLSA +V+ M +  GF+SA PER+L LHTTHSP FLGL QN G W++SSYGK
Sbjct  52    HVISGFAAKLSAADVEVMRHMKGFVSARPERMLHLHTTHSPNFLGLNQNTGLWKNSSYGK  111

Query  1978  GVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCEL--NFTACNNKVIGARSF---SERE  1814
             G+IIG++DSGI  DHPS +D GMP PPA+WKG C+      ACNNK+IGAR F   S  E
Sbjct  112   GIIIGMVDSGILPDHPSLADRGMPLPPAKWKGKCDFISRKWACNNKLIGARYFYHNSGTE  171

Query  1813  RSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEI  1634
               + D  GHGTHT+G AAGNFV GA  +G+A GTA+G+AP AH+A+Y+ C    C++S +
Sbjct  172   PPLIDQIGHGTHTSGIAAGNFVEGAGFFGNAGGTASGIAPFAHVAMYQPCKYHNCTESNV  231

Query  1633  LAAMDTAIEDGVDIlslslg-gmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSL  1457
              AAMD AIEDGVD+LS+SLG      F +D +A+GA+ A+EKGI VS SAGN+GP + SL
Sbjct  232   AAAMDAAIEDGVDVLSMSLGGAYLHRFPDDIMAIGAFRAIEKGIVVSCSAGNDGPKSKSL  291

Query  1456  SNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNS-SLLSLVFPGQNTSDE  1280
             SNEAPW++TVGAST++RK+ AT +LGN ++  GET      F S   L LV+P    +  
Sbjct  292   SNEAPWIMTVGASTINRKIVATAMLGNGEELEGETG---TGFPSIGKLHLVYPRSFYTRV  348

Query  1279  SSSPYCDSESLRNADVRGKIVVCMTGGFLDRR-GKGEAVKNASGRGMILIEPEEYGITTS  1103
             SS  Y       N DVRGKIV+C +G  +  R  +G  VK A G  MILI  +  G TT 
Sbjct  349   SSCVY-----RFNTDVRGKIVLCDSGDHISNRVEQGRTVKKAGGAAMILINYKSDGDTTF  403

Query  1102  ATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRES  923
                HVLPA+ I Y DG K+ AY+N+TS P AT SFKGT+ G   AP V AFSSRGPN+ S
Sbjct  404   DDPHVLPAMQIGYIDGLKLKAYVNSTSTPTATMSFKGTVIGSGRAPVVPAFSSRGPNKVS  463

Query  922   PGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDW  743
             PGILKPDIIGPGVNILA WP SV+NK N KSTFNI+ GTSMSCPHLSGVAALLKS+HPDW
Sbjct  464   PGILKPDIIGPGVNILAAWPVSVENKTNIKSTFNILYGTSMSCPHLSGVAALLKSAHPDW  523

Query  742   SPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDY  563
             SPA IKSA+MTTAD LN   NPI+N+HL  ASVF+IG+GHVNPS+ANDPGLVYD  P+DY
Sbjct  524   SPAAIKSAIMTTADHLNLKGNPIENEHLKPASVFAIGSGHVNPSRANDPGLVYDILPDDY  583

Query  562   LPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGE  383
             +PYLCGLNYTN+EVG+I++ +V+CS   SIPEAQLNYPSFSII  ST QTYTRT+TNVG+
Sbjct  584   IPYLCGLNYTNQEVGIIVKCKVDCSKKKSIPEAQLNYPSFSIIFGSTPQTYTRTLTNVGK  643

Query  382   ASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAA  245
             A+S Y VEI    GV V VEP +L F K+  K +Y+VTF+ ++K A
Sbjct  644   ANSSYDVEIVSSHGVNVKVEPHKLMFPKLGDKSSYSVTFTRTTKEA  689



>ref|XP_006446036.1| hypothetical protein CICLE_v10018202mg [Citrus clementina]
 gb|ESR59276.1| hypothetical protein CICLE_v10018202mg [Citrus clementina]
Length=745

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/725 (53%), Positives = 505/725 (70%), Gaps = 30/725 (4%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGE-----SRMVFMYRN  2156
             L+TYI+ V+ P              DL+ WY+SFLP               SRM++ Y+N
Sbjct  40    LQTYIIYVQKPEQG-----------DLDSWYRSFLPEATISNSSDHDRNQSSRMLYFYKN  88

Query  2155  VMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKG  1976
             V+ GFAA+L+AEEVK M  K GFISA  E  L LHTTH+P FLGL ++ GFW+DS++GKG
Sbjct  89    VISGFAARLTAEEVKAMETKKGFISARVENTLHLHTTHTPNFLGLHRSSGFWKDSNFGKG  148

Query  1975  VIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-SERERSVFd  1799
             VIIGVLD+GI   HPSF+DEGMPPPPA+W+G CEL    CNNK+IG R+F   ++ S  D
Sbjct  149   VIIGVLDTGITPGHPSFNDEGMPPPPAKWRGKCELVGATCNNKLIGVRNFFCGKDGSAID  208

Query  1798  ddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCN-EIGCSDSEILAAM  1622
               GHGTHTA TAAGNFV GAN++G ANGTA G+APLAHLA+YKVCN  + C +S ++A +
Sbjct  209   YTGHGTHTASTAAGNFVHGANIFGQANGTAVGMAPLAHLAVYKVCNPNVYCPESAVIAGI  268

Query  1621  DTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAP  1442
             D AIEDGVD+LSLS G   S F+++ IA   + A+ +GIFVS +AGN GP + +L N+AP
Sbjct  269   DAAIEDGVDVLSLSFGLGLSQFYDNGIAKATFEAIRRGIFVSIAAGNSGPNHYTLVNDAP  328

Query  1441  WMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYC  1262
             WMLTVGAST+DR ++ +V LGN++ + GE  +Q  D  S  L LV+P  +  + S++ +C
Sbjct  329   WMLTVGASTIDRGITISVRLGNQETYDGEALWQWTDIPSKRLPLVYP--DARNHSTTTFC  386

Query  1261  DSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLP  1082
               E+L++ DV+GK+V+C  G        G+ V NA G  MIL+  E +G +T    + LP
Sbjct  387   SPETLKSVDVKGKVVLCQRGA------SGDDVLNAGGAAMILMNDELFGDSTLIQRNSLP  440

Query  1081  AIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPD  902
              + +++A  + I AYIN+TS+P A    KGT+ G  +AP V AFS RGP+R SPGILKPD
Sbjct  441   NVRVSHAVSESIKAYINSTSSPTAALVMKGTVIGAGSAPQVVAFSGRGPSRISPGILKPD  500

Query  901   IIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKS  722
             IIGPG+NI+A W T+VD   N   TF+I+SGTSM+CPHLSGVAALLKS+HP+WS A IKS
Sbjct  501   IIGPGLNIIAAWKTTVDPLANRVYTFDIVSGTSMACPHLSGVAALLKSAHPNWSHAAIKS  560

Query  721   AMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGL  542
             AMMTTAD +N    PI +   + A ++++GAG VNPSKANDPGLVYD +P+DY+PYLCGL
Sbjct  561   AMMTTADTVNLEGKPILDCTRLPADLYAVGAGQVNPSKANDPGLVYDIQPDDYIPYLCGL  620

Query  541   NYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTV  362
             NYT+ +V  I+   V C+ V SIPEA+LNYPSFSI L  + QTY RTVTNVG+A SFYT 
Sbjct  621   NYTDEQVQSIVDREVQCAKVSSIPEAELNYPSFSIKLGYSPQTYHRTVTNVGKAKSFYTR  680

Query  361   EIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHV  182
             +I  P GV++ V+P  + F+  NQK+TY+VTF+ +     S+     Q  L W S K+ V
Sbjct  681   QIVAPEGVEITVQPHNISFAAKNQKVTYSVTFTRTGNTNASS----AQAYLSWVSDKYTV  736

Query  181   RSPIA  167
             +SPIA
Sbjct  737   KSPIA  741



>ref|XP_006493680.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
 gb|KDO64849.1| hypothetical protein CISIN_1g045720mg [Citrus sinensis]
Length=745

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/725 (53%), Positives = 505/725 (70%), Gaps = 30/725 (4%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGE-----SRMVFMYRN  2156
             L+TYI+ V+ P              DL+ WY+SFLP               SRM++ Y+N
Sbjct  40    LQTYIIYVQKPEQG-----------DLDSWYRSFLPEATISNSSDHDRNQSSRMLYFYKN  88

Query  2155  VMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKG  1976
             V+ GFAA+L+AEEVK M  K GFISA  E  L LHTTH+P FLGL ++ GFW+DS++GKG
Sbjct  89    VISGFAARLTAEEVKAMETKKGFISARVENTLHLHTTHTPNFLGLHRSSGFWKDSNFGKG  148

Query  1975  VIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-SERERSVFd  1799
             VIIGVLD+GI   HPSF+DEGMPPPPA+W+G CEL    CNNK+IG R+F   ++ S  D
Sbjct  149   VIIGVLDTGITPGHPSFNDEGMPPPPAKWRGKCELVGATCNNKLIGVRNFFCGKDGSAID  208

Query  1798  ddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCN-EIGCSDSEILAAM  1622
               GHGTHTA TAAGNFV GAN++G ANGTA G+APLAHLA+YKVCN  + C +S ++A +
Sbjct  209   YTGHGTHTASTAAGNFVHGANIFGQANGTAVGMAPLAHLAVYKVCNPNVYCPESAVIAGI  268

Query  1621  DTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAP  1442
             D AIEDGVD+LSLS G   S F+++ IA   + A+ +GIFVS +AGN GP + +L N+AP
Sbjct  269   DAAIEDGVDVLSLSFGLGLSQFYDNGIAKATFEAIRRGIFVSIAAGNSGPNHYTLVNDAP  328

Query  1441  WMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYC  1262
             WMLTVGAST+DR ++ +V LGN++ + GE  +Q  D  S  L LV+P  +  + S++ +C
Sbjct  329   WMLTVGASTIDRGITISVRLGNQETYDGEALWQWTDIPSKRLPLVYP--DARNHSTTTFC  386

Query  1261  DSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLP  1082
               E+L++ DV+GK+V+C  G        G+ V NA G  MIL+  E +G +T    + LP
Sbjct  387   SPETLKSVDVKGKVVLCQRGA------SGDDVLNAGGAAMILMNDELFGDSTLIQRNSLP  440

Query  1081  AIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPD  902
              + +++A  + I AYIN+TS+P A    KGT+ G  +AP V AFS RGP+R SPGILKPD
Sbjct  441   NVRVSHAVSESIKAYINSTSSPTAALVMKGTVIGGGSAPQVVAFSGRGPSRISPGILKPD  500

Query  901   IIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKS  722
             IIGPG+NI+A W T+VD   N   TF+I+SGTSM+CPHLSGVAALLKS+HP+WS A IKS
Sbjct  501   IIGPGLNIIAAWKTTVDPLANRVYTFDIVSGTSMACPHLSGVAALLKSAHPNWSHAAIKS  560

Query  721   AMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGL  542
             AMMTTAD +N    PI +   + A ++++GAG VNPSKANDPGLVYD +P+DY+PYLCGL
Sbjct  561   AMMTTADTVNLEGKPILDCTRLPADLYAVGAGQVNPSKANDPGLVYDIQPDDYIPYLCGL  620

Query  541   NYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTV  362
             NYT+ +V  I+   V C+ V SIPEA+LNYPSFSI L  + QTY RTVTNVG+A SFYT 
Sbjct  621   NYTDEQVQSIVDREVQCAKVSSIPEAELNYPSFSIKLGYSPQTYHRTVTNVGKAKSFYTR  680

Query  361   EIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHV  182
             ++  P GV++ V+P  + F+  NQK+TY+VTF+ +     S+     Q  L W S K+ V
Sbjct  681   QMVAPEGVEITVQPHNISFAAKNQKVTYSVTFTRTGNTNASS----AQAYLSWVSDKYTV  736

Query  181   RSPIA  167
             +SPIA
Sbjct  737   KSPIA  741



>gb|EYU28960.1| hypothetical protein MIMGU_mgv1a018215mg, partial [Erythranthe 
guttata]
Length=715

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/711 (58%), Positives = 507/711 (71%), Gaps = 29/711 (4%)
 Frame = -1

Query  2245  DLEHWYKSFLPTTV------AGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFI  2084
             DL+ +Y SFLPT        A     + R+++ YR+V  GFAAKLSA  V EM  K GFI
Sbjct  11    DLDTFYDSFLPTNTNVTTIAASNSDDQPRILYRYRHVFSGFAAKLSAAHVDEMRKKKGFI  70

Query  2083  SAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPP  1904
             SA PER++ LHTTHSP FLGL QN G W++SSYGKG+IIG++D+GI  DHPS +D+G+PP
Sbjct  71    SARPERMMHLHTTHSPNFLGLNQNTGLWKNSSYGKGIIIGLVDTGITPDHPSLNDQGVPP  130

Query  1903  PPARWKGVCELNFTA----CNNKVIGARSFSERE----RSVFdddghgthtagtaaGNFV  1748
             PPA+WKG CE  FT+    CNNK+IGAR F        + + D  GHGTHT+G AAGNFV
Sbjct  131   PPAKWKGKCE--FTSPRWTCNNKLIGARYFYRSPPLFVQPLIDQIGHGTHTSGIAAGNFV  188

Query  1747  RGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslg-g  1571
              GA+ YG+A GTA+G APLAH+AIY+ C    C  S I AA+D AIEDGVD+LS+SLG  
Sbjct  189   GGADFYGNARGTASGTAPLAHVAIYQPCTGSHCGSSGIAAAIDAAIEDGVDVLSMSLGGA  248

Query  1570  mssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSAT  1391
             +   F +D +A+G + AME+GI VS SAGN+GP N +L NEAPW++TVGAST DRK++  
Sbjct  249   LHLHFADDIMAIGTFRAMERGIVVSCSAGNDGPKNKTLYNEAPWIMTVGASTTDRKITVN  308

Query  1390  VVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVC  1211
              VLGN ++  GET           L LV+P  N  D   S   D     N D++GKIVVC
Sbjct  309   AVLGNGEELEGETGTGFPAIGK--LDLVYPRSN--DTGMSRCFDGH--FNTDIKGKIVVC  362

Query  1210  MTGGFL-DRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYI  1034
                 +L  R  +G  VK A G  MILI  +  G TT    HVLPA+ ITYAD  K+ AY+
Sbjct  363   EGMKYLVTRVQQGITVKGAGGAAMILINNKFDGDTTFEEPHVLPAMQITYADSLKLKAYL  422

Query  1033  NATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSV  854
             N+TSNP AT SFKGT+ G+  AP VA FSSRGP+  SPGILKPDIIGPGVNIL+ WP SV
Sbjct  423   NSTSNPTATMSFKGTVIGNNRAPVVATFSSRGPSVPSPGILKPDIIGPGVNILSSWPASV  482

Query  853   DN-KPNSKS-TFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQN  680
             DN K ++KS TFN+ISGTSMSCPHLSGVAALLKS HPDWSPA IKSA+MTTAD +N    
Sbjct  483   DNSKTDTKSPTFNMISGTSMSCPHLSGVAALLKSVHPDWSPAAIKSAIMTTADSVNLEGK  542

Query  679   PIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHR  500
             PI+++ L  ASVF+IG+GHVNPS+AN+PGLVYD  P+DY+PYLCGLNYTN+E+G+I+  +
Sbjct  543   PIEDEQLQPASVFAIGSGHVNPSRANNPGLVYDIMPDDYIPYLCGLNYTNQEIGIIVGRK  602

Query  499   VNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEP  320
             V+CS   SIPEAQLNYPSFSII  ST QTYTRT+TNVG+A+S Y VEI  P GV V VEP
Sbjct  603   VDCSEEKSIPEAQLNYPSFSIIFGSTPQTYTRTLTNVGKANSSYVVEIASPDGVIVKVEP  662

Query  319   RELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             ++L F K+  K +Y+VTF+ ++K   +N     QG +RW + ++ VRSPIA
Sbjct  663   QKLVFPKLGDKSSYSVTFTRTNKGVMNN---TTQGFIRWHTAEYSVRSPIA  710



>gb|KCW87517.1| hypothetical protein EUGRSUZ_B03965 [Eucalyptus grandis]
Length=743

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/739 (54%), Positives = 508/739 (69%), Gaps = 17/739 (2%)
 Frame = -1

Query  2356  IGFCSTATIA---SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYG  2186
             I  C+ +++A   S L TYIV V  P  +           DL   Y+SFLP T AG    
Sbjct  9     IHLCAPSSVADASSSLSTYIVHVRQPMDKHFATMG-----DLHTLYRSFLPATAAGSNQ-  62

Query  2185  ESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMG  2006
             E RMV  Y++V+ GF AKL+AEE + +  KDG +   PE+ L LHTTH+P FLGL + +G
Sbjct  63    EQRMVHSYQHVLSGFTAKLTAEEAEAIQEKDGVLYVRPEKALSLHTTHTPDFLGLHRGVG  122

Query  2005  FWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF  1826
              W+DS++GKGVIIGVLD+GI   H SFSDEGMPPPPA+WKG C+ N TACN K+IGARSF
Sbjct  123   LWKDSNFGKGVIIGVLDTGIFPGHSSFSDEGMPPPPAKWKGRCDFNSTACNKKLIGARSF  182

Query  1825  SERERSV--FdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIG  1652
                  +   +D  GHG+HT+GTAAG FVR A+  G+A GTA G+APLAHLA+Y+VCN  G
Sbjct  183   VSVGNTATPYDGVGHGSHTSGTAAGAFVRNASALGNARGTAVGMAPLAHLAMYQVCNPSG  242

Query  1651  CSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGP  1472
             C + ++LA MD AIEDGVD+LSLSLGG S  F +DSIAL ++SA +KGIFVS SAGN GP
Sbjct  243   CLEGDVLAGMDAAIEDGVDVLSLSLGGQSQRFSDDSIALSSFSATQKGIFVSCSAGNLGP  302

Query  1471  FNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQN  1292
              N +LSNEAPW+LTVGAS++DR +  TV LGN Q+F GET +QP DF+  LL LV+PG N
Sbjct  303   SNFTLSNEAPWILTVGASSIDRSIKTTVRLGNGQEFDGETLYQPHDFHPVLLPLVYPGVN  362

Query  1291  TSDESSSPYCDSESLRN-ADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYG  1115
                + S+  C   SL + +D+RGK+VVC  G       KG+ VKNA G  MIL+     G
Sbjct  363   --GDGSAALCLPGSLESRSDLRGKVVVCDAGDGTGGVAKGQEVKNAGGAAMILVNNPTAG  420

Query  1114  ITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGP  935
              TTS   HVLPA+ + Y  G++I  Y++  S PMAT  FKGT  G   APTV+ FSSRGP
Sbjct  421   YTTSPELHVLPAVHVRYIAGREIKGYLSTASAPMATILFKGTHIGISVAPTVSFFSSRGP  480

Query  934   NRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSS  755
             N +SPGILKPDIIGPGVNILA W   +D   + + TFNIISGTSMSCPHLSGVAALLKS+
Sbjct  481   NYQSPGILKPDIIGPGVNILAAWAFPLDYSIDRRHTFNIISGTSMSCPHLSGVAALLKSA  540

Query  754   HPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTK  575
             HPDWSPA IKSA++TTA  LN    PI +Q L  A++F+ GAG++NPSKA DPGL+YD  
Sbjct  541   HPDWSPAAIKSAIITTAATLNMEGRPIVDQTLHPANIFTTGAGYINPSKAVDPGLIYDIA  600

Query  574   PEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQ--TYTRT  401
             P+DY+PYLCGLNYT+ EV +I++  V CS++ SIP+ QLNYPS S+    +    + TRT
Sbjct  601   PQDYIPYLCGLNYTDYEVELIVKKVVKCSSIRSIPDYQLNYPSISLKFTGSVSKVSVTRT  660

Query  400   VTNVGEASSFYTVEIFEPPGV-KVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPV  224
             V NVG A S Y   I    G+  ++V P +L+F+ VNQ  ++ V F+       +   P+
Sbjct  661   VRNVGPAKSRYRSVIDPILGLDSISVYPSDLEFANVNQTASFRVDFTRRVGRNATATLPL  720

Query  223   VQGALRWKSVKHHVRSPIA  167
              QGA+ W S +H VR+P+A
Sbjct  721   AQGAITWISAQHSVRTPVA  739



>ref|XP_006358907.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=645

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/653 (61%), Positives = 490/653 (75%), Gaps = 12/653 (2%)
 Frame = -1

Query  2107  MGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPS  1928
             M  KDGF+SA  E+IL LHTTH+P FLGL +N+GFW++S+YGKGVIIGVLD+GI   HPS
Sbjct  1     MEKKDGFVSARVEKILALHTTHTPNFLGLYRNVGFWQESNYGKGVIIGVLDTGITPSHPS  60

Query  1927  FSDEGMPPPPARWKGVCEL--NFTACNNKVIGARSF-SERERSVFdddghgthtagtaaG  1757
             FSDE MP PPA+WKG CE   N T CN K+IGAR+  S      FD++GHGTHT+ TAAG
Sbjct  61    FSDENMPSPPAKWKGKCEFTGNVT-CNKKIIGARNLVSGSSDPPFDEEGHGTHTSSTAAG  119

Query  1756  NFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslsl  1577
             NFV  A+++G+ANGTAAG+APLAH+A+YKVC E GCSD +ILAA+D AI+DGVD+LSLS+
Sbjct  120   NFVDDASLFGNANGTAAGMAPLAHIAMYKVCTE-GCSDVDILAALDAAIDDGVDVLSLSI  178

Query  1576  ggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLS  1397
             GG S  F+EDSIA GA++AM+KGIFVSASAGNEGP N +LSNEAPW+LTVGAST DRK+ 
Sbjct  179   GGFSDPFYEDSIATGAFAAMQKGIFVSASAGNEGPLNSTLSNEAPWILTVGASTHDRKIV  238

Query  1396  ATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIV  1217
             AT VLGN Q++ GE++FQP  F  +LL LV+PG   SD+ ++  C S SL N DV+GK+V
Sbjct  239   ATAVLGNGQEYDGESSFQPTSFPHTLLPLVYPG--LSDQEAA-LCSSGSLNNTDVKGKVV  295

Query  1216  VCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAY  1037
             VC  GG + R  K + VK+A G  MIL   E  G  T A AHVLPA  + Y  G+ I AY
Sbjct  296   VCDRGGGVARLEKSQTVKDAGGAAMILANLEIDGDGTFADAHVLPATHVGYTAGESIKAY  355

Query  1036  INATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTS  857
             IN+TS P A   FKGT  G K++P+V++FSSRGPN  SPGI+KPDIIGPGVN+LA WP S
Sbjct  356   INSTSTPSAGILFKGTSIGFKSSPSVSSFSSRGPNLASPGIVKPDIIGPGVNVLAAWPVS  415

Query  856   VDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNP  677
             V+NK  +  TFNIISGTSMSCPHLSG+AALLKS+HPDWSPA IKSA+MTTAD  N    P
Sbjct  416   VENKTGTDLTFNIISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIMTTADQFNLEGQP  475

Query  676   IQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRV  497
             I +Q  + A +F+ GAGHVNPSKA+DPGL+YD K E+Y+ YLCGL Y ++++ +++Q  +
Sbjct  476   ILDQRGLPADIFATGAGHVNPSKASDPGLIYDIKVENYIQYLCGLGYKDKDIELLVQQTI  535

Query  496   NCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPR  317
              CS   SI EA+LNYPSFSIIL    Q YTRTVTNVG+ASS YTV I +  GV V VEP 
Sbjct  536   KCSLQSSISEAELNYPSFSIILGPQTQNYTRTVTNVGDASSTYTVNITQIQGVDVVVEPA  595

Query  316   ELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
              L F++VNQ+ TY+V+F+ +           VQGAL W S K+ VR PI+ KL
Sbjct  596   TLVFTQVNQQATYSVSFTQTGLITDR----FVQGALSWISNKYVVRIPISVKL  644



>ref|XP_004147599.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN50169.1| hypothetical protein Csa_5G157280 [Cucumis sativus]
Length=734

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/734 (55%), Positives = 527/734 (72%), Gaps = 22/734 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             + L+TYIV V+ P   I   +     +DL++WY SFLP T+      +SR+++ YR+V+ 
Sbjct  11    TNLQTYIVHVKQPEVEILGDT-----IDLQNWYTSFLPETIEASSNEQSRLLYSYRHVIS  65

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GF+A+L+ E+VK M  KDGFISA PE  L LHTTH+P +LGL Q+ G W++S++GKGVII
Sbjct  66    GFSARLTKEQVKTMEEKDGFISAMPETTLNLHTTHTPEYLGLNQHFGLWKNSNFGKGVII  125

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERE-----RSVF  1802
             GVLD+GI  +HPSF+DEGMP PPA+WKG CE   + CNNK+IGAR+F+        +S  
Sbjct  126   GVLDTGIHPNHPSFNDEGMPSPPAKWKGRCEFGASICNNKLIGARTFNLANNVSIGKSPN  185

Query  1801  dddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAM  1622
             D++GHGTHTA TAAG FV+GA   G+A G A G+APLAH+A+YKVC+  GCS S+ILAA+
Sbjct  186   DENGHGTHTASTAAGTFVKGAEALGNARGKAVGMAPLAHIAVYKVCSPKGCSSSDILAAL  245

Query  1621  DTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAP  1442
             D AI+DGVD+LSLSLG  S+ F +D+IA+GA++A++KGIFVS SAGN GP   +L+NEAP
Sbjct  246   DAAIDDGVDVLSLSLGAPSTPFFKDTIAVGAFAAIKKGIFVSCSAGNSGPSKNTLANEAP  305

Query  1441  WMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYC  1262
             W+LTVGAST+DRK+ A   L + + F GE+ FQP+DF+S  L LV+ G+  S    S YC
Sbjct  306   WILTVGASTIDRKIVALAKLESGKVFTGESLFQPRDFSSKFLPLVYAGK--SGIEGSEYC  363

Query  1261  DSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLP  1082
                SL   +V GKIVVC  GG + R  KG  VKN  G  MIL+  +  G +T A AHVLP
Sbjct  364   VEGSLEKLNVTGKIVVCERGGGIGRIAKGLVVKNGGGAAMILVNQKPDGFSTLAEAHVLP  423

Query  1081  AIDITYADGQKILAYINATSNPMATFSFKGTITGDKN---APTVAAFSSRGPNRESPGIL  911
                ++Y DG KI  YIN++ NP A+ SF+GT+ G++    +P +A+FSSRGP + SPGIL
Sbjct  424   TTHLSYEDGLKIKEYINSSHNPKASISFEGTLLGNRATTFSPAMASFSSRGPCQASPGIL  483

Query  910   KPDIIGPGVNILAPW--PTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSP  737
             KPDI GPGVNILA W  P + +   N+KSTFN+ISGTSMSCPHLSG+AAL+KS+HP+WSP
Sbjct  484   KPDITGPGVNILAAWPFPLNNNTNTNTKSTFNVISGTSMSCPHLSGIAALIKSNHPNWSP  543

Query  736   AMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLP  557
             A IKSA+MT+AD+ N    PI +Q L  A+ F++G+GHVNPSKA +PGLVYD +P+DY+P
Sbjct  544   AAIKSAIMTSADVRNPQGKPIVDQDLKPANFFAMGSGHVNPSKAANPGLVYDIQPDDYVP  603

Query  556   YLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEAS  377
             YLC L YT+ +V +I++ +V CS V  I E  LNYPSF++ L + +Q + RTVTNVG+A+
Sbjct  604   YLCHL-YTDAQVSIIVRRQVTCSTVSRIREGDLNYPSFAVSLGADSQAFNRTVTNVGDAN  662

Query  376   SFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFS-LSSKAARSNMPPVVQGALRWK  200
             S Y   +  P GV V V PR L+FSK+N+KLTY+VTFS +     RS      +G L W 
Sbjct  663   SVYYAIVKAPAGVSVRVTPRNLKFSKLNEKLTYSVTFSRIDFVRTRSEFS---EGYLIWV  719

Query  199   SVKHHVRSPIAAKL  158
             S KH VRSPI+ KL
Sbjct  720   SNKHIVRSPISVKL  733



>gb|EYU28633.1| hypothetical protein MIMGU_mgv1a023843mg [Erythranthe guttata]
Length=720

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/698 (59%), Positives = 502/698 (72%), Gaps = 26/698 (4%)
 Frame = -1

Query  2245  DLEHWYKSFLPTT--VAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAP  2072
             DLE +Y SFLPTT  V      + R+++ YR+V  GFAAKLS  +V+ M  K GFISA P
Sbjct  39    DLETFYDSFLPTTSNVTSNSDDQPRILYRYRHVFSGFAAKLSTADVEAMRQKKGFISAQP  98

Query  2071  ERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPAR  1892
             ER+L LHTTHSP FLGL QN G W+ S+YGKGVIIG++DS +A  HPSFSD GMPPPPA+
Sbjct  99    ERMLQLHTTHSPNFLGLNQNTGLWKKSNYGKGVIIGMVDSAVAASHPSFSDAGMPPPPAK  158

Query  1891  WKGVCE-LNFTACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANG  1715
             WKGVC+      CNNK+IG R    +  S  +++GHGTHT  TAAGNFV GA  +G+ANG
Sbjct  159   WKGVCDSFGTPPCNNKLIGVRFSLPQFPSSENENGHGTHTMSTAAGNFVAGAGFFGNANG  218

Query  1714  TAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssS-FHEDSIA  1538
             TAAGVAPLAHLAIY+ C  I C ++ +  A+DTAI DGVDI+S+SLGG S   F +D IA
Sbjct  219   TAAGVAPLAHLAIYESCGSISCPNTAVADAIDTAIGDGVDIISISLGGGSHRGFFDDVIA  278

Query  1537  LGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHG  1358
             +GAY AM++GI VS SAGN+      LSN APW++TVGAST+DRK++ATVVLGN ++  G
Sbjct  279   VGAYRAMQRGIVVSCSAGNDD--RARLSNGAPWIMTVGASTMDRKITATVVLGNGEEIEG  336

Query  1357  ETAFQPKDFNSS-LLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRG  1181
             ET    K F S+  L LV+P Q                ++  VRGKIVVC     L+R  
Sbjct  337   ETG---KGFPSTEKLELVYPRQFPP-------------KDDFVRGKIVVCENAVGLERIN  380

Query  1180  KGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFS  1001
              GE VK A G  MIL+  ++ G TT    HVLPA+ I YA+G KI+AY+N+TSNP A  S
Sbjct  381   IGEDVKYAGGAAMILLNTQDLGDTTFDDPHVLPALQIGYAEGLKIIAYLNSTSNPTAKLS  440

Query  1000  FKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFN  821
             FKGT+ G    P VAAFSSRGP++ SPGILKPDIIGPGVNILA WP S++N+ ++K  FN
Sbjct  441   FKGTVIGGGRDPVVAAFSSRGPSKVSPGILKPDIIGPGVNILAAWPVSLENRTDTKPAFN  500

Query  820   IISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVF  641
             IISGTSMSCPHLSGVAALLKS+HPDWSPA+IKSA+MTTA  +N   NPI+++ L  A+VF
Sbjct  501   IISGTSMSCPHLSGVAALLKSAHPDWSPAVIKSAIMTTAYQVNLKGNPIEDEQLQPATVF  560

Query  640   SIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQ  461
              IG+GHVNPS+A+DPGLVYD  P+DY+PY+CGLNYTN++VG+I+   V+CS   SIPEAQ
Sbjct  561   DIGSGHVNPSRADDPGLVYDILPDDYVPYVCGLNYTNQQVGIIVGRNVDCSKEKSIPEAQ  620

Query  460   LNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLT  281
             LNYPSFSII  ST QTYTRT+TNVG+  S Y VEI  P  V V VEP++L F K+  K +
Sbjct  621   LNYPSFSIIFGSTTQTYTRTLTNVGKPDSSYDVEIVSPDNVIVKVEPKKLVFPKLGDKSS  680

Query  280   YNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             YNVTF+ ++K     M    QG +RW S  + VRSPIA
Sbjct  681   YNVTFTRTTKEV---MNSTTQGFIRWYSADYSVRSPIA  715



>ref|XP_010058211.1| PREDICTED: subtilisin-like protease SDD1 [Eucalyptus grandis]
Length=763

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/761 (53%), Positives = 517/761 (68%), Gaps = 29/761 (4%)
 Frame = -1

Query  2386  LRMFLILSVLI-------GFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWY  2228
             L +F++  + I       G  + A   S L  YI++V  P              DL+ +Y
Sbjct  13    LTIFILHLICIQSISPANGAIAGADTRSSLSAYIIQVRKPTDIHLATIE-----DLDTFY  67

Query  2227  KSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             +SFLP T A     E  +V  YR+V+ GFAAKL+AEE K +  KDG ++  PE+ L LHT
Sbjct  68    RSFLPATAASSNQ-ERGIVHSYRHVLSGFAAKLTAEEAKAIREKDGVLAVRPEKALSLHT  126

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             THSP FLGL Q +G W+DS++GKGVIIGVLD+G+  DH SFSD+ +PPPPA+WKG C+ +
Sbjct  127   THSPDFLGLHQGVGLWKDSNFGKGVIIGVLDTGVFPDHSSFSDKNVPPPPAKWKGRCDFD  186

Query  1867  FTACNNKVIGARSFSERERSV------FdddghgthtagtaaGNFVRGANVYGSANGTAA  1706
              T+CNNK+IGARSF     +V      +D +GHGTHT+ TAAG FVR AN  G+ANGTA+
Sbjct  187   GTSCNNKLIGARSFISSSNTVAQADPPYDSEGHGTHTSSTAAGAFVRNANALGNANGTAS  246

Query  1705  GVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAY  1526
             G+APLAHLAIY+VC+ +GCS+ +ILA +D A EDGVD+LSLSLGG S  F+ D IA GA+
Sbjct  247   GIAPLAHLAIYQVCSSLGCSEGDILAGLDAATEDGVDVLSLSLGGNSQPFYSDLIATGAF  306

Query  1525  SAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAF  1346
             +A +KGI VS SAGN GP +G+LSNEAPW+LTVGAS++DR + AT  LGN ++F GET +
Sbjct  307   AATQKGILVSCSAGNSGPSSGTLSNEAPWILTVGASSIDRSIKATARLGNGKEFDGETLY  366

Query  1345  QPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRN-ADVRGKIVVCMTGGFLDRRGKGEA  1169
             QP+DF+   L LV+ G+    + SS YC + SL N + +RGK+VVC   G   RR KG+ 
Sbjct  367   QPRDFDPVPLPLVYAGEK--GDPSSAYCLTGSLGNRSGLRGKVVVCDNDG-TGRRDKGQE  423

Query  1168  VKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGT  989
             V++A G  MIL+   + G TT A  HVLPA+ ++YA G  I  YI+  S P AT  FKGT
Sbjct  424   VQDAGGVAMILVNSIDGGYTTFADRHVLPAVHVSYAAGSDIKQYISTASAPKATILFKGT  483

Query  988   -ITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIIS  812
              I G    P V +FSSRGPN +SPGILKPDIIGPG+NILA WP  + N  + K  F ++S
Sbjct  484   HINGRSADPAVTSFSSRGPNAQSPGILKPDIIGPGLNILAGWPFPLGNSTDKKRAFAVLS  543

Query  811   GTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIG  632
             GTSMSCPHLSGVAALLKS+HPDWSPA IKSA++TTA   N    PI ++ L  A +F+ G
Sbjct  544   GTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIITTATTSNLKGQPIVDETLRPADIFATG  603

Query  631   AGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNY  452
             AGHVNPSKA DPGL+YDT P+DY+PYLCGL+YT+ E+  I++  V CS++ SIP+ QLNY
Sbjct  604   AGHVNPSKAVDPGLIYDTAPQDYIPYLCGLDYTDSEIERIVKENVKCSSIRSIPDYQLNY  663

Query  451   PSFSIILESTAQ--TYTRTVTNVGEASSFYTVEIFEPPGVK-VNVEPRELQFSKVNQKLT  281
             PS S+  + +A   + TRTV NVG A S Y   I    G+  + V+PR+L F+K NQ  +
Sbjct  664   PSISVSFDGSATKVSVTRTVRNVGPAQSRYRSVIDPIKGLDLIGVQPRDLVFTKANQTAS  723

Query  280   YNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
             Y V F+ S KA  +   P   GA+ W S KH VR+P+  + 
Sbjct  724   YRVDFTRSGKAKPAT--PYAWGAVTWVSAKHSVRTPVVVRF  762



>ref|XP_010046741.1| PREDICTED: subtilisin-like protease SDD1 [Eucalyptus grandis]
Length=761

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/727 (55%), Positives = 502/727 (69%), Gaps = 14/727 (2%)
 Frame = -1

Query  2329  ASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVM  2150
             +S L TYIV V  P  +           DL   Y+SFLP T AG    E RMV  Y++V+
Sbjct  39    SSSLSTYIVHVRQPMDKHFATMG-----DLHTLYRSFLPATAAGSNQ-EQRMVHSYQHVL  92

Query  2149  KGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVI  1970
              GF AKL+AEE + +  KDG +   PE+ L LHTTH+P FLGL + +G W+DS++GKGVI
Sbjct  93    SGFTAKLTAEEAEAIQEKDGVLYVRPEKALSLHTTHTPDFLGLHRGVGLWKDSNFGKGVI  152

Query  1969  IGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSV--Fdd  1796
             IGVLD+GI   H SFSDEGMPPPPA+WKG C+ N TACN K+IGARSF     +   +D 
Sbjct  153   IGVLDTGIFPGHSSFSDEGMPPPPAKWKGRCDFNSTACNKKLIGARSFVSVGNTATPYDG  212

Query  1795  dghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDT  1616
              GHG+HT+GTAAG FVR A+  G+A GTA G+APLAHLA+Y+VCN  GC + ++LA MD 
Sbjct  213   VGHGSHTSGTAAGAFVRNASALGNARGTAVGMAPLAHLAMYQVCNPSGCLEGDVLAGMDA  272

Query  1615  AIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWM  1436
             AIEDGVD+LSLSLGG S  F +DSIAL ++SA +KGIFVS SAGN GP N +LSNEAPW+
Sbjct  273   AIEDGVDVLSLSLGGQSQRFSDDSIALSSFSATQKGIFVSCSAGNLGPSNFTLSNEAPWI  332

Query  1435  LTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDS  1256
             LTVGAS++DR +  TV LGN Q+F GET +QP DF+  LL LV+PG N   + S+  C  
Sbjct  333   LTVGASSIDRSIKTTVRLGNGQEFDGETLYQPHDFHPVLLPLVYPGVN--GDGSAALCLP  390

Query  1255  ESLRN-ADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPA  1079
              SL + +D+RGK+VVC  G       KG+ VKNA G  MIL+     G TTS   HVLPA
Sbjct  391   GSLESRSDLRGKVVVCDAGDGTGGVAKGQEVKNAGGAAMILVNNPTAGYTTSPELHVLPA  450

Query  1078  IDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDI  899
             + + Y  G++I  Y++  S PMAT  FKGT  G   APTV+ FSSRGPN +SPGILKPDI
Sbjct  451   VHVRYIAGREIKGYLSTASAPMATILFKGTHIGISVAPTVSFFSSRGPNYQSPGILKPDI  510

Query  898   IGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSA  719
             IGPGVNILA W   +D   + + TFNIISGTSMSCPHLSGVAALLKS+HPDWSPA IKSA
Sbjct  511   IGPGVNILAAWAFPLDYSIDRRHTFNIISGTSMSCPHLSGVAALLKSAHPDWSPAAIKSA  570

Query  718   MMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLN  539
             ++TTA  LN    PI +Q L  A++F+ GAG++NPSKA DPGL+YD  P+DY+PYLCGLN
Sbjct  571   IITTAATLNMEGRPIVDQTLHPANIFTTGAGYINPSKAVDPGLIYDIAPQDYIPYLCGLN  630

Query  538   YTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQ--TYTRTVTNVGEASSFYT  365
             YT+ EV +I++  V CS++ SIP+ QLNYPS S+    +    + TRTV NVG A S Y 
Sbjct  631   YTDYEVELIVKKVVKCSSIRSIPDYQLNYPSISLKFTGSVSKVSVTRTVRNVGPAKSRYR  690

Query  364   VEIFEPPGV-KVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKH  188
               I    G+  ++V P +L+F+ VNQ  ++ V F+       +   P+ QGA+ W S +H
Sbjct  691   SVIDPILGLDSISVYPSDLEFANVNQTASFRVDFTRRVGRNATATLPLAQGAITWISAQH  750

Query  187   HVRSPIA  167
              VR+P+A
Sbjct  751   SVRTPVA  757



>ref|XP_004166925.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease-like 
[Cucumis sativus]
Length=733

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/734 (55%), Positives = 526/734 (72%), Gaps = 23/734 (3%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             + L+TYIV V+ P   I   +     +DL++WY SFLP T+      +SR+++ YR+V+ 
Sbjct  11    TNLQTYIVHVKQPEVEILGDT-----IDLQNWYTSFLPETIEASSNEQSRLLYSYRHVIS  65

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GF+A+L+ E+VK M  KDGFISA PE  L LHTTH+P +LGL Q+ G W++S++GKGVII
Sbjct  66    GFSARLTKEQVKTMEEKDGFISAMPETTLNLHTTHTPEYLGLNQHFGLWKNSNFGKGVII  125

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERE-----RSVF  1802
             GVLD+GI  +HPSF+DEGMP PPA+WKG CE   + CNNK+IGAR+F+        +S  
Sbjct  126   GVLDTGIHPNHPSFNDEGMPSPPAKWKGRCEFGASICNNKLIGARTFNLANNVSIGKSPN  185

Query  1801  dddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAM  1622
             D++GHGTHTA TAAG FV+GA   G+A G A G+APLAH+A+YKVC+  GCS S+ILAA+
Sbjct  186   DENGHGTHTASTAAGTFVKGAEALGNARGKAVGMAPLAHIAVYKVCSPKGCSSSDILAAL  245

Query  1621  DTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAP  1442
             D AI+DGVD+LSLSLG  S+ F +D+IA+GA++A++KGIFVS SAGN GP   +L+NEAP
Sbjct  246   DAAIDDGVDVLSLSLGAPSTPFFKDTIAVGAFAAIKKGIFVSCSAGNSGPSKNTLANEAP  305

Query  1441  WMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYC  1262
             W+LTVGAST+DRK+ A   L + + F GE+ FQP+DF+S  L LV+ G+  S    S YC
Sbjct  306   WILTVGASTIDRKIVALAKLESGKVFTGESLFQPRDFSSKFLPLVYAGK--SGIEGSEYC  363

Query  1261  DSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLP  1082
                SL   +V GKIVVC  GG + R  KG  VKN  G  MIL+  +  G +T A AHVLP
Sbjct  364   VEGSLEKLNVTGKIVVCERGGGIGRIAKGLVVKNGGGAAMILVNQKPDGFSTLAEAHVLP  423

Query  1081  AIDITYADGQKILAYINATSNPMATFSFKGTITGDKN---APTVAAFSSRGPNRESPGIL  911
                ++Y DG KI  YIN++ NP A+ SF+GT+ G++    +P +A+FSSRGP + SPGIL
Sbjct  424   TTHLSYEDGLKIKEYINSSHNPKASISFEGTLLGNRATTFSPAMASFSSRGPCQASPGIL  483

Query  910   KPDIIGPGVNILAPW--PTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSP  737
             KPDI GPGVNILA W  P + +   N+KSTFN+ISGTSMSCPHLSG+AAL+KS+HP+WSP
Sbjct  484   KPDITGPGVNILAAWPFPLNNNTNTNTKSTFNVISGTSMSCPHLSGIAALIKSNHPNWSP  543

Query  736   AMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLP  557
             A IKSA+MT+AD+ N    PI +Q L  A+ F++G+GHVNPSKA +PGLVYD +P+DY+P
Sbjct  544   AAIKSAIMTSADVRNPQGKPIVDQDLKPANFFAMGSGHVNPSKAANPGLVYDIQPDDYVP  603

Query  556   YLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEAS  377
             YLC L YT+ +V +I++ +V CS V  I E  LNYPSF++ L   +Q + RTVTNVG+A+
Sbjct  604   YLCHL-YTDAQVSIIVRRQVTCSTVSRIREGDLNYPSFAVSL-GASQAFNRTVTNVGDAN  661

Query  376   SFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKA-ARSNMPPVVQGALRWK  200
             S Y   +  P GV V V PR L+FSK+N+KLTY+VTFS       RS +    +G L W 
Sbjct  662   SVYYAIVKAPAGVSVRVTPRNLKFSKLNEKLTYSVTFSRXDFVRTRSELS---EGYLIWV  718

Query  199   SVKHHVRSPIAAKL  158
             S KH VRSPI+ KL
Sbjct  719   SNKHIVRSPISVKL  732



>ref|XP_004512194.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=763

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/729 (56%), Positives = 512/729 (70%), Gaps = 33/729 (5%)
 Frame = -1

Query  2326  SKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMK  2147
             S L TYIV V+ P+   S +       +L  WY S LP +       + R++F Y+N++ 
Sbjct  63    SSLLTYIVHVKKPNYFQSKE-------NLHGWYHSLLPASTKT--QNQKRIIFAYQNIVD  113

Query  2146  GFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVII  1967
             GFA KL+  E K +  K+  +S  PE+IL LHTTHSP FLGLQQN   W++S+ GKG+II
Sbjct  114   GFAVKLTPNEAKALEEKEEVVSTRPEKILSLHTTHSPSFLGLQQNQELWKNSNLGKGIII  173

Query  1966  GVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT-ACNNKVIGARSF-SERERSV-Fdd  1796
             G+LD+GI   HPS SD GM PP A+W G CE N    CNNK+IGARSF +    S+ FDD
Sbjct  174   GILDTGIFPFHPSSSDAGMSPP-AKWNGHCEFNGERICNNKIIGARSFITGTNLSLPFDD  232

Query  1795  dghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDT  1616
              GHGTHTA TAAG  V+GANV+G+ANGTA G+AP AHLAIYKVC+  GC++S I+A MD+
Sbjct  233   VGHGTHTASTAAGRPVQGANVFGNANGTAVGMAPDAHLAIYKVCSIKGCTESSIIAGMDS  292

Query  1615  AIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWM  1436
                         LGG S+ F ED IALGA+SA++KGIFVS SA N GP  G+LSNEAPW+
Sbjct  293   ------------LGGPSTPFFEDGIALGAFSAIQKGIFVSCSAANSGPEYGTLSNEAPWI  340

Query  1435  LTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQ-NTSDESSSPYCD  1259
             LTVGAST+DRK+ A   LGN  ++ GE+ FQPKDF S+LL LV+ G  NTSD+S + +CD
Sbjct  341   LTVGASTIDRKIEAIAKLGNGIEYLGESVFQPKDFESTLLPLVYAGAINTSDDSIA-FCD  399

Query  1258  SESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPA  1079
               S++N DV+GK+V+C  GGF+ R  KG+AVK+A G  MIL+  E          HVLPA
Sbjct  400   PISMKNVDVKGKVVLCEQGGFVSRVAKGQAVKDAGGSAMILVNSEREAFNPITDVHVLPA  459

Query  1078  IDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDI  899
             + ++Y+ G  I  YIN+TS P AT  F+GT+ G+  AP VA+FSSRGP++ SPGILKPDI
Sbjct  460   VHVSYSSGLSIKDYINSTSTPEATILFQGTVIGNPLAPQVASFSSRGPSKSSPGILKPDI  519

Query  898   IGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSA  719
             IGPG+NILA W  S+D   NS   FNI+SGTSMSCPHL G+AALLK+SHPDWSPA IKSA
Sbjct  520   IGPGMNILAGWYVSLD---NSTPPFNIVSGTSMSCPHLGGIAALLKNSHPDWSPAAIKSA  576

Query  718   MMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLN  539
             +MTTA+++N     I +Q  + A VF+ GAGHVNP KANDPGLVYD +P DY+PYLCGLN
Sbjct  577   IMTTANVVNLQGTAILDQRHLPADVFATGAGHVNPLKANDPGLVYDIEPNDYVPYLCGLN  636

Query  538   YTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVE  359
             YT+R+VGVILQ +V CS V SI +AQLNYPSFSI L ST+Q YTRT+TNVG  ++ Y+VE
Sbjct  637   YTDRQVGVILQQKVKCSDVKSISQAQLNYPSFSIRLGSTSQFYTRTLTNVGPVNTTYSVE  696

Query  358   IFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAAR-SNMPPVVQGALRWKSVKHHV  182
             I  P  V ++V P ++ F++V QK+TY V F    K  R  NM  + QG+++W S K+ V
Sbjct  697   IDVPLAVGMSVSPAQITFTEVKQKVTYWVDFIPEDKKNRGDNM--IAQGSIKWVSEKYSV  754

Query  181   RSPIAAKLV  155
               PIA   V
Sbjct  755   SIPIAIVFV  763



>ref|XP_006339269.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=733

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/754 (53%), Positives = 521/754 (69%), Gaps = 42/754 (6%)
 Frame = -1

Query  2398  NMKFLRMFLILSVLIG---FCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWY  2228
             ++KF+  FL   +L          T  S LETYI+ +E     +S+        DL  W+
Sbjct  2     DLKFISTFLCFVLLHSSKTLGDNFTNQSDLETYIIHLEFHDQVLSSSK------DLHLWH  55

Query  2227  KSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             +SFLPT         SR+++ YR+V  GFAA LS++EV+EM  K GF++A P+RI  +HT
Sbjct  56    QSFLPTN----SNHSSRILYTYRHVFNGFAAILSSDEVREMEKKPGFVTARPQRIFQMHT  111

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             THSP FLGL QN+G W  S+ GKGVIIG+LDSGI   HPSF+D GMP PP +WKG CE N
Sbjct  112   THSPSFLGLHQNVGLWNASNSGKGVIIGLLDSGIDPQHPSFNDNGMPNPPLKWKGKCEFN  171

Query  1867  FTA-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPL  1691
              T  CN K+IGAR+F++   S  D+ GHGTHT+ TAAGN V GA+++G+ANGTA G+AP 
Sbjct  172   VTTYCNKKLIGARNFADGATSPSDEAGHGTHTSSTAAGNIVDGASIFGNANGTAVGIAPR  231

Query  1690  AHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssS--FHEDSIALGAYSAM  1517
             AH+A+YKVC    C +  ++A  D AI DGVD++S+S+G        ++D+IA+GAY AM
Sbjct  232   AHVAMYKVCYGYTCEEYRMIAGFDAAIGDGVDVISVSIGFEHYRPPLYDDTIAIGAYRAM  291

Query  1516  EKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPK  1337
             EKGIFVS SAGN GP +G+++N APW+LTVGAST DRK+SA  VLGN  ++ GE+AFQP 
Sbjct  292   EKGIFVSCSAGNSGPGSGTVANGAPWILTVGASTTDRKISAVAVLGNGAEYEGESAFQPT  351

Query  1336  DFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNA  1157
             +F+  LL LV  G+           D ESL ++ ++GKIV+C T G+  R  KG  VK  
Sbjct  352   NFSRKLLPLV-NGE-----------DCESLFSS-LKGKIVLCDTSGYTSRNEKGGNVKKV  398

Query  1156  SGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGD  977
              G GMIL+  +  G TT +    +P   ++Y DGQ+I+ Y+ +TS P+A  +FKGT  GD
Sbjct  399   DGAGMILMNEKYRGSTTFSEYDAVPTTQVSYKDGQEIIHYMKSTSTPVAMITFKGTKIGD  458

Query  976   KNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKP-----NSKSTFNIIS  812
             K+APTVA FSSRGP  +S GILKPDIIGPGVNILA WPT ++ +      +S STFNI+S
Sbjct  459   KHAPTVAYFSSRGPFVKSQGILKPDIIGPGVNILAAWPTPIEGETISASSSSSSTFNILS  518

Query  811   GTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIG  632
             GTSMSCPHL+GVAALLKS+HPDWSPA IKSA+MTTAD++N G+N IQ++ L  A + +IG
Sbjct  519   GTSMSCPHLAGVAALLKSAHPDWSPAAIKSAIMTTADLVNLGKNLIQDETLEPADLLTIG  578

Query  631   AGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNY  452
             +GHVNPS+ANDPGL+YD +PEDY+PYLCGLNYT+ +V  I+  +++C +   IP+++LNY
Sbjct  579   SGHVNPSRANDPGLIYDIQPEDYIPYLCGLNYTDDQVSSIVNKKIHCKS--RIPQSELNY  636

Query  451   PSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNV  272
             PSFSI  +S+AQTYTRT TNVGEA S Y V++F   GV+V V P  L+F+ +NQK ++NV
Sbjct  637   PSFSIPKKSSAQTYTRTATNVGEAISAYKVKVFGLKGVEVTVNPIILKFTALNQKASFNV  696

Query  271   TFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPI  170
             T         S      QG + W   ++ VRSPI
Sbjct  697   TVKSLDLTGHS------QGYIVWSFDRYSVRSPI  724



>ref|XP_010910929.1| PREDICTED: subtilisin-like protease SDD1 [Elaeis guineensis]
Length=759

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/735 (55%), Positives = 510/735 (69%), Gaps = 31/735 (4%)
 Frame = -1

Query  2329  ASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVM  2150
             AS+L TY+V V+      S  +  ++S D E WY SFLP T A       RMV MY NV 
Sbjct  37    ASELRTYVVHVQ-----PSLSTVFATSTDRETWYNSFLPKTPA-------RMVHMYTNVA  84

Query  2149  KGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVI  1970
              GFAA+LS  E+++M  K GF+ A P+R+  L TTH+P FLGLQ N GFW D++YGKGVI
Sbjct  85    SGFAARLSEHELEDMKKKPGFLHAYPDRLYSLQTTHTPEFLGLQLNSGFWNDANYGKGVI  144

Query  1969  IGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-----SERERSV  1805
             +G+LD+GI  DHPSFS +GMPPPPA+WKG C+ N + CNNK+IGAR+F     + + R V
Sbjct  145   VGMLDTGIFPDHPSFSGDGMPPPPAKWKGRCDFNASLCNNKLIGARTFISGAMAMKGRGV  204

Query  1804  -----FdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDS  1640
                   DD GHGTHTA TAAG  V GANV G+A GTAAG+APLAHLAIYKVC+E GC+DS
Sbjct  205   AAAPPVDDVGHGTHTASTAAGARVAGANVLGNAKGTAAGMAPLAHLAIYKVCSEFGCADS  264

Query  1639  EILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGS  1460
             +ILAAMD A+ DGVD+LSLS+GG S  F++DSIA+G + A++ G+FVS +AGN GP   S
Sbjct  265   DILAAMDAAVADGVDVLSLSIGGDSVPFYQDSIAIGGFGAIKNGVFVSCAAGNSGPNVSS  324

Query  1459  LSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDE  1280
             LSNEAPW+LTV AST+DR +  TV LGN  +F+GE+ +QP+ +N +   LV+ G     +
Sbjct  325   LSNEAPWLLTVAASTMDRNIRVTVKLGNGLEFNGESLYQPEWYNPTFYPLVYAGAGPKPD  384

Query  1279  SSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSA  1100
             +   +C + SL   DV+GKIV+C  GG + R  KG  V+ A G G+IL      G +T A
Sbjct  385   AI--FCGNGSLDGLDVKGKIVLCDRGGDIARIDKGVTVQGAGGVGLILTNGRLDGYSTLA  442

Query  1099  TAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESP  920
               HVLPA  I Y+DG KI +YI+A+SNP  +F FKGTI G   AP + +FSSRGP+  SP
Sbjct  443   DPHVLPASHIGYSDGVKIKSYISASSNPTVSFIFKGTILGTSPAPAITSFSSRGPSLASP  502

Query  919   GILKPDIIGPGVNILAPWPTSV--DNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPD  746
             GILKPDI GPGV++LA WP  V      ++  TFNIISGTSMS PHLSG+AALLK+ HPD
Sbjct  503   GILKPDITGPGVSVLAAWPFDVGPSTVNSTGPTFNIISGTSMSTPHLSGIAALLKAVHPD  562

Query  745   WSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPED  566
             W PA IKSA+MTTADIL+    PI N+  + A++F++GAGHVNP KANDPGLVYD   +D
Sbjct  563   WPPAAIKSAIMTTADILDRSGEPIVNEQYLPANLFAVGAGHVNPVKANDPGLVYDLSADD  622

Query  565   YLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL--ESTAQTYTRTVTN  392
             Y+PYLCGL YT+ +V  I++  VNC  V +I EA+LNYPS S+ L   +T  T  RTV N
Sbjct  623   YIPYLCGLGYTSTQVTAIVRRSVNCLVVKNITEAELNYPSISVSLGAATTFITVERTVKN  682

Query  391   VGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGA  212
             VGEA S Y VE+  P GV+V+V P +LQFS+VNQ++ + VT S SS    +      QG 
Sbjct  683   VGEAMSEYLVEVDTPYGVEVSVSPVKLQFSEVNQEMKFYVTLSASSSRGGARFS---QGY  739

Query  211   LRWKSVKHHVRSPIA  167
             L W S K  VRSPI+
Sbjct  740   LNWVSEKRMVRSPIS  754



>ref|XP_011081071.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=694

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/700 (56%), Positives = 496/700 (71%), Gaps = 10/700 (1%)
 Frame = -1

Query  2242  LEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERI  2063
             +E WY SFLP   A       RM+  YRNV+ GFAA+LS  EV +M  KDGF+SA P++ 
Sbjct  1     MESWYNSFLPKPTANSADYSLRMIHSYRNVITGFAARLSPLEVSQMEKKDGFVSARPQKT  60

Query  2062  LPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKG  1883
               LHTTH+P FLGL +N+G W+ S+YGKGVI+GV+D+GI+  H SFSDEGMPPPPA+WKG
Sbjct  61    YTLHTTHAPSFLGLHENVGAWQISNYGKGVIVGVIDTGISPGHLSFSDEGMPPPPAKWKG  120

Query  1882  VCELNFTACNNKVIGARSFSERERSV--FdddghgthtagtaaGNFVRGANVYGSANGTA  1709
              CELN T CNNK+IGAR+F      +   D +GHGT TA TAAGNFV GANV G+ANGTA
Sbjct  121   KCELNGTMCNNKLIGARNFVSHLSGLPPIDQEGHGTLTASTAAGNFVSGANVLGNANGTA  180

Query  1708  AGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGA  1529
             AG+APLAHLA+YK C+   C +S+ILAAMD A+EDGVD++S SLG    +F EDS+A+ A
Sbjct  181   AGMAPLAHLAVYKACSLDVCGESDILAAMDAAVEDGVDVISASLGRGPINFSEDSVAIAA  240

Query  1528  YSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETA  1349
             + A+++GIFVS SA N GP + +L+NE PW+LTVGAST+DR + A  VLGN  +F GE+ 
Sbjct  241   FGAIQRGIFVSCSADNGGPNSSTLANEFPWVLTVGASTIDRSIRAIAVLGNGDEFDGESL  300

Query  1348  FQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEA  1169
             FQPKDF  +LL LV P    ++  +  YC   SL + DV+GK+V+C+ GG + R  KG+ 
Sbjct  301   FQPKDFQPTLLPLVDPSAGGNETVA--YCMPGSLNDTDVKGKVVLCVGGGGVSRIVKGQT  358

Query  1168  VKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGT  989
             VK+A G  MI+             AHVLPA  ++YA GQ I AYIN+TS P AT  FKGT
Sbjct  359   VKDAGGAAMIVSNDAVTAYDIKPDAHVLPAAHVSYAAGQNIKAYINSTSTPTATIIFKGT  418

Query  988   ITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPN--SKSTFNII  815
             + G K+AP VA+FSSRGP+  SPGILKPDIIGPGV+ILA    S+DN  N  + + F+++
Sbjct  419   VIGTKSAPMVASFSSRGPSLSSPGILKPDIIGPGVSILAARYMSMDNTTNDSTNANFSMV  478

Query  814   SGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSI  635
             SGTS+SCPHLSG+AAL+KS+HPDWSPA IKSA+MT+A   N   + I ++ L+ A VF++
Sbjct  479   SGTSISCPHLSGIAALVKSAHPDWSPAAIKSALMTSATQANLNGSLIADERLLPADVFTV  538

Query  634   GAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLN  455
             GAGHVNP KA DPGLVYD  PEDY+ YLCGL YT +E+ +I +  ++C     IPEAQLN
Sbjct  539   GAGHVNPPKAIDPGLVYDISPEDYISYLCGLGYTEKEITIITKRIISCRGR-GIPEAQLN  597

Query  454   YPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYN  275
             YPSFSI L     TYTRT TNVG A S Y ++I   PGV + V+PR L F++VNQK+TY 
Sbjct  598   YPSFSIQLGRNGSTYTRTATNVGAAESTYYLKIESIPGVDIVVKPRVLSFTEVNQKMTYQ  657

Query  274   VTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
             + FS S+    +     VQG++ W S KH VRS I+ K +
Sbjct  658   IFFSRSAAPVNATY---VQGSIAWISPKHIVRSSISVKFI  694



>emb|CDP09844.1| unnamed protein product [Coffea canephora]
Length=754

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/727 (57%), Positives = 503/727 (69%), Gaps = 20/727 (3%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGF  2141
             L TYIV + LP    STQ +     DLE WY+SFLP    G     SRMV  +R+V  GF
Sbjct  41    LTTYIVHLRLPAGDNSTQLN-----DLESWYQSFLPKNTTGLN-DASRMVHSFRHVFTGF  94

Query  2140  AAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGV  1961
             AAKLS EEVKEM  K+GF+ A PE+ L L TTHSP FLGL  N  F      G+GVIIG+
Sbjct  95    AAKLSPEEVKEMEKKEGFLDARPEKTLNLQTTHSPKFLGLYTNSQFQWQYGRGEGVIIGI  154

Query  1960  LDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-SERERSVFdddghg  1784
             +DSGI   HPSFSDEGM PPP  WKG CE   T CN K+IGAR     +     D+ GHG
Sbjct  155   IDSGITPGHPSFSDEGMQPPPPSWKGKCEFVGTGCNKKLIGARDLLGPKPGQPLDEIGHG  214

Query  1783  thtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIG-CSDSEILAAMDTAIE  1607
             THTA TAAGNFV GANV   ANGTAAG+AP AHL+IY+ C   G C++S I+AAMD AI+
Sbjct  215   THTASTAAGNFVEGANVMRQANGTAAGMAPRAHLSIYRACYPSGMCTESAIVAAMDFAIQ  274

Query  1606  DGVDIlslslggmssS-FHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLT  1430
             D V +LS+SLGG S   F +D IALGA+ A +KGIFVS SA N GP NGSLSNEAPW+LT
Sbjct  275   DNVTMLSMSLGGPSKLPFFDDPIALGAFQANKKGIFVSCSASNSGPENGSLSNEAPWILT  334

Query  1429  VGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSES  1250
             VGAST+DR + AT +LGN  +F G++ +QP DF  +LL LV+ G N   ++ +  C   S
Sbjct  335   VGASTIDRDIRATALLGNGDEFDGQSIYQPTDFPPNLLPLVYLGMN--GDTFAALCTKNS  392

Query  1249  LRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDI  1070
             L+ A V+GK+V+C T   +    +G+ VK+A G  MI++  E  G T  A  HVLPA  +
Sbjct  393   LKKAGVKGKVVLCETSDLMATVEQGQNVKDAGGAAMIIMNQEIEGYTIIADLHVLPATHV  452

Query  1069  TYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGP  890
             ++A GQ I AYIN+T  P AT  FKGTI G KNAP VA+FSSRGPN  SPGILKPDIIGP
Sbjct  453   SFAAGQAIKAYINSTCMPRATILFKGTILGVKNAPAVASFSSRGPNNASPGILKPDIIGP  512

Query  889   GVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMT  710
             GVNILA WP SV+N  N+ STFNI+SGTSMSCPHL+G+AALLKS+HP+WSPA IKSA+MT
Sbjct  513   GVNILAAWPESVENITNTSSTFNILSGTSMSCPHLTGIAALLKSAHPNWSPAAIKSAIMT  572

Query  709   TADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTN  530
             TA  +N     I N+ +  A VF+ GAGHVNP +A DPGL YD +P+DY+PYLCGL YT+
Sbjct  573   TASFVNRNDGHILNEQMFPADVFATGAGHVNPPRAIDPGLTYDIQPDDYIPYLCGLGYTD  632

Query  529   REVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFE  350
              ++  I+Q  V CSA+  I EA+LNYPSF+I L+S+ QTY R VTNVGEA S Y V+I +
Sbjct  633   DQIMKIVQSPVKCSAIHRIQEAELNYPSFAIQLKSSKQTYKRVVTNVGEALSTYYVDIDK  692

Query  349   PPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPP---VVQGALRWKSVKHHVR  179
               GV+++V+PR L F KVNQK+TY ++F       R NM       QGA+ W S KH VR
Sbjct  693   IQGVEIDVQPRVLNFRKVNQKITYQISFR------RLNMSVGNWYEQGAITWNSEKHRVR  746

Query  178   SPIAAKL  158
             SPI+ K 
Sbjct  747   SPISVKF  753



>ref|XP_008804041.1| PREDICTED: subtilisin-like protease SDD1 [Phoenix dactylifera]
Length=761

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/744 (53%), Positives = 516/744 (69%), Gaps = 31/744 (4%)
 Frame = -1

Query  2356  IGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESR  2177
             +GF +    AS+L+TY+V V+ P       +  ++S D E WYKSFLP T A       R
Sbjct  30    VGFITVGAEASELQTYVVHVQPP-----LSTVFATSTDREMWYKSFLPETPA-------R  77

Query  2176  MVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWR  1997
             MV MY NV  GFAA+L+ +E++++  K GF+ A P+R+  L TTH+P FLGLQ N G W+
Sbjct  78    MVHMYTNVASGFAARLTEQELEDIKKKPGFVHAYPDRLYSLQTTHTPEFLGLQLNRGVWK  137

Query  1996  DSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSER  1817
             D++YG+GVI+GVLD+GI  DHPSFS +G+PPPPA+WKG C+ N + CNNK+IGARSF   
Sbjct  138   DANYGEGVIVGVLDTGIFPDHPSFSGDGVPPPPAKWKGRCDFNASLCNNKLIGARSFISG  197

Query  1816  ERSV----------FdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKV  1667
               ++           DD+GHGTHTA TAAG  V GANV G+A GTA+G+APLAHLAIYKV
Sbjct  198   AMAMKGRGTAATPPVDDEGHGTHTASTAAGARVAGANVLGNAKGTASGMAPLAHLAIYKV  257

Query  1666  CNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASA  1487
             C E GC+DS+ILAAMD A+ DG D+LSLSLGG S  F+ D IA+GA+ A++ G+FVS +A
Sbjct  258   CAEDGCADSDILAAMDAAVGDGADVLSLSLGGDSVPFYIDGIAIGAFGAIKNGVFVSCAA  317

Query  1486  GNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLV  1307
             GN GP   SLSNEAPW+LTV AST+DR +  TV LGN Q+F+GE+ +QP+ +  +   LV
Sbjct  318   GNSGPNASSLSNEAPWILTVAASTMDRNIRVTVKLGNGQEFNGESLYQPQMYTPTFYPLV  377

Query  1306  FPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEP  1127
             + G     +++  +C + SL   DV+GKIV+C  GG + R  KG  V++A G G++L   
Sbjct  378   YAGAGPKPDAA--FCGNGSLDGLDVKGKIVLCQRGGDVARIAKGITVQSAGGVGLVLTNG  435

Query  1126  EEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFS  947
                G +T A AHVLPA  + Y+DG KI +YI A+SNP A+F FKGT+ G   AP + +FS
Sbjct  436   PLDGYSTLADAHVLPASYVGYSDGVKIKSYIAASSNPTASFIFKGTVLGVSPAPAITSFS  495

Query  946   SRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKP--NSKSTFNIISGTSMSCPHLSGVA  773
             SRGP+  SPGILKPDI GPGV++LA WP  V      ++  TFNIISGTSMS PHLSG+A
Sbjct  496   SRGPSLASPGILKPDITGPGVSVLAAWPFQVGPPTFISTGPTFNIISGTSMSTPHLSGIA  555

Query  772   ALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPG  593
             AL+K++HPDWSPA IKSA+MTTADIL+H   PI N+  + A++F++GAGHVNP KA+DPG
Sbjct  556   ALVKAAHPDWSPAAIKSAIMTTADILDHSGKPIVNEQHLPANLFALGAGHVNPVKADDPG  615

Query  592   LVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIIL--ESTA  419
             LVYD    DY+PYLCGL YT+ +V  I +  VNC  + +I EA+LNYPS S+ L   +T+
Sbjct  616   LVYDLSAGDYIPYLCGLGYTSSQVTTIARQHVNCLLIKNITEAELNYPSISVSLGAATTS  675

Query  418   QTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARS  239
              T  RTV NVGEA S Y+ ++  P GV V+V P +LQFS+VNQ++ + VTFS S      
Sbjct  676   ITVERTVKNVGEAMSEYSADVDAPYGVAVSVSPAKLQFSEVNQEMKFYVTFSASRSGGGV  735

Query  238   NMPPVVQGALRWKSVKHHVRSPIA  167
                   QG L W S K  VRSPI+
Sbjct  736   RFS---QGYLNWVSEKRMVRSPIS  756



>ref|XP_010918673.1| PREDICTED: subtilisin-like protease SDD1 [Elaeis guineensis]
Length=760

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/767 (53%), Positives = 523/767 (68%), Gaps = 40/767 (5%)
 Frame = -1

Query  2401  PNMKFLRMFLILSVL-------IGFCSTATIASKLETYIVRVELPHsristqsssssSVD  2243
             P +  L  F++LS         +   +  T AS+L+TY+V V+ P     T +   +S D
Sbjct  7     PTLLHLAFFILLSPCSVAARNHVRVSTVGTKASELQTYVVHVQPP-----TSTVFGTSTD  61

Query  2242  LEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERI  2063
              E WYKSFLP T A       R+V MY NV  GFAA+L+  E+++M  K GF+ A P+R+
Sbjct  62    RETWYKSFLPETPA-------RIVHMYTNVASGFAARLTELELEDMKKKPGFLHAYPDRL  114

Query  2062  LPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKG  1883
               L TTH+P FLGLQ N G W D++YGKGVI+G+LD+GI  DHPSFS +GMPPPPA+WKG
Sbjct  115   YSLQTTHTPEFLGLQLNSGIWNDANYGKGVIVGMLDTGIFPDHPSFSGDGMPPPPAKWKG  174

Query  1882  VCELNFTACNNKVIGARSF-----SERERSV-----FdddghgthtagtaaGNFVRGANV  1733
              C+ N + CNNK+IGAR+F     + + R V      DD GHGTHTA TAAG  V GANV
Sbjct  175   RCDFNASLCNNKLIGARTFISGAMAMKGRGVAVTPPVDDVGHGTHTASTAAGARVAGANV  234

Query  1732  YGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFH  1553
              G+ANGTA+G+APLAHLA+YKVC E GC++S+ILA MD A+ DGVD+LSLSLGG S  F+
Sbjct  235   LGNANGTASGMAPLAHLAMYKVCTEDGCAESDILAGMDAAVADGVDVLSLSLGGNSVPFY  294

Query  1552  EDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNR  1373
              DSIA+G + A++ GIFVS +AGN GP   SLSNEAPW+LTV AST+DR +  TV LGN 
Sbjct  295   NDSIAIGGFGAIKNGIFVSCAAGNSGPNASSLSNEAPWLLTVAASTMDRNIRVTVKLGNG  354

Query  1372  QQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFL  1193
              +F+GE+ +QP+ +  +   LV+ G     ++   +C + SL   DV+GK+V+C  GG +
Sbjct  355   LEFNGESVYQPQMYTPTFYPLVYAGAGPKPDAI--FCGNGSLDGLDVKGKMVLCQRGGGI  412

Query  1192  DRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPM  1013
              R  KG  V++A G G IL      G +T    HVLPA  + Y+DG KI +YI+ +SNP 
Sbjct  413   ARIDKGVTVESAGGVGFILANGPLDGYSTITDPHVLPASHVGYSDGVKIKSYISTSSNPT  472

Query  1012  ATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSK  833
             A+F FKGTI G   AP + +FSSRGP+  SPGILKPDI GPGV++LA WP++V   P   
Sbjct  473   ASFIFKGTILGISPAPAITSFSSRGPSLASPGILKPDITGPGVSVLAAWPSNV-GPPTVN  531

Query  832   ST---FNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQH  662
             ST   FNIISGTSMS PHLSG+AALLK++HPDWSPA IKSA+MTTADIL+   +PI N+ 
Sbjct  532   STGPTFNIISGTSMSTPHLSGIAALLKAAHPDWSPAAIKSAIMTTADILDRSGDPIVNEQ  591

Query  661   LVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAV  482
              + A++F++GAGHVNP KANDPGLVYD   +DY+ YLCGL YT+ +V  I++  VNC  +
Sbjct  592   HLPANLFAVGAGHVNPVKANDPGLVYDLSADDYISYLCGLGYTSSQVTAIVRQSVNCLVI  651

Query  481   ISIPEAQLNYPSFSIIL--ESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQ  308
              +I EA+LNYPS S+ L   +T+ T  RTV NVGEA S Y+ +I  P GV V+V P +LQ
Sbjct  652   KNITEAELNYPSISVSLGPATTSITVERTVKNVGEAMSVYSADIDTPYGVAVSVSPMKLQ  711

Query  307   FSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             FS+VNQ++ + VTFS SS    +   P   G L W S K  VRSPI+
Sbjct  712   FSEVNQEMKFYVTFSASSSRGAARFSP---GYLNWASEKRMVRSPIS  755



>gb|EPS72026.1| serine protease, partial [Genlisea aurea]
Length=708

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/728 (55%), Positives = 501/728 (69%), Gaps = 25/728 (3%)
 Frame = -1

Query  2329  ASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVM  2150
             A+ L+TYIV VE              + DLE WY SF+P +      G SR+++ YR++ 
Sbjct  2     AATLKTYIVHVE----------PCVETQDLESWYDSFIPESNPSTESG-SRIIYRYRHIF  50

Query  2149  KGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVI  1970
              GFAA+L+ EEVK M  K GFISAA ER+L LHTTH+P FLGL +N+GFW +SSYG+GV+
Sbjct  51    SGFAARLTPEEVKVMEGKKGFISAAEERVLQLHTTHTPSFLGLGRNLGFWNESSYGEGVV  110

Query  1969  IGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF---SERERSVFd  1799
             IG+LD+GI  DHPSFSDEG+PPPP +WKG CEL    CN K+IGAR+F   S    +  D
Sbjct  111   IGLLDTGINADHPSFSDEGVPPPPKKWKGRCELGGGVCNRKLIGARAFGVGSGLTNTPAD  170

Query  1798  ddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMD  1619
             + GHGTHT+ TAAGNFV GAN  GSANGT+ G+AP AH+A+Y+VC   GC +S+I A +D
Sbjct  171   EQGHGTHTSSTAAGNFVPGANFLGSANGTSIGIAPRAHIAMYRVCFTDGCQESDIAAGLD  230

Query  1618  TAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPW  1439
              AI+DGVDILS+SLGG S+ +  D IA+G++ A+EKGIFVS SAGN GP   SLSNEAPW
Sbjct  231   AAIDDGVDILSISLGGNSAVYDVDPIAIGSFRAVEKGIFVSCSAGNSGPTTQSLSNEAPW  290

Query  1438  MLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCD  1259
             +LTVGAST DRKL AT VLG+  +  GE+ FQ  D  + L     P  N S      +C 
Sbjct  291   ILTVGASTTDRKLVATAVLGSGVELVGESGFQ-TDSTADL-----PLINPSTSGGFSFCG  344

Query  1258  SESLR-NADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLP  1082
              + L   ++V GKIV+C  GG +    KGE V+ A G+GMIL+  E    T    AHV+P
Sbjct  345   PDDLGPTSNVEGKIVICQVGGNIQSVDKGEYVRQAGGKGMILVNSEIAAYTLFDYAHVIP  404

Query  1081  AIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPD  902
             A  ++Y D  KI  Y+N+TSNP A   F+GT  GDK AP +A FSSRGP ++SPGILKPD
Sbjct  405   ATHVSYEDSLKIEGYLNSTSNPTARIVFEGTKMGDKFAPFLAFFSSRGPGKQSPGILKPD  464

Query  901   IIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKS  722
             IIGPGVNILA W  SV    N+   +NIISGTSMSCPHL+GV ALLKS+HPDWSPA IKS
Sbjct  465   IIGPGVNILAGWHESVRKDTNTTPFYNIISGTSMSCPHLAGVVALLKSAHPDWSPAAIKS  524

Query  721   AMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGL  542
             A+MTTAD LN G +PI ++  +    FS+G+GHVNPSKA+DPGLVYD   EDY+PYLCGL
Sbjct  525   AIMTTADQLNLGGDPILDERHLPPPPFSVGSGHVNPSKASDPGLVYDLSTEDYVPYLCGL  584

Query  541   NYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTV  362
             NYT   +  I+Q RV+C+  IS  EA+LNYPSF++ + S   TY+RTVTNVGE  + YTV
Sbjct  585   NYTADAIQKIVQRRVSCANAIS--EAELNYPSFTVAVGSAPATYSRTVTNVGEGKASYTV  642

Query  361   EIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHV  182
             EI  P GV V V P  L F ++ QKL Y+VTFS S  ++        QG + W S K+ V
Sbjct  643   EIGAPDGVSVVVTPETLDFMEIGQKLNYSVTFSSSGGSSGGAG--YSQGFISWNSGKYSV  700

Query  181   RSPIAAKL  158
             RSPI A +
Sbjct  701   RSPIVAAI  708



>gb|EYU28634.1| hypothetical protein MIMGU_mgv1a024623mg, partial [Erythranthe 
guttata]
Length=699

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/731 (55%), Positives = 505/731 (69%), Gaps = 51/731 (7%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTV------AGGGYGESRMVFMYR  2159
             L+ YIV V+                DLE +Y SFLPT              + R+++ YR
Sbjct  2     LDVYIVHVDHAQISN----------DLETFYDSFLPTNTNLAAASTNSTIDKPRILYRYR  51

Query  2158  NVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGK  1979
             +V+ GFAAKLS  +V+ M +  GF+SA PE++LPLHTTHSP FLGL QN G W++S+YGK
Sbjct  52    HVISGFAAKLSEADVEAMRHMKGFVSARPEKMLPLHTTHSPNFLGLNQNTGLWKNSNYGK  111

Query  1978  GVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFT--ACNNKVIGARSFSERERSV  1805
             GVIIG++D G+   HPSFSD GMPPPPA+WKG C+      ACN K+IGAR F   E S 
Sbjct  112   GVIIGLVDIGVEPSHPSFSDAGMPPPPAKWKGECKFRAGKGACNKKLIGAR-FLIDELSP  170

Query  1804  FdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAA  1625
               D       +  A  NFV GA  +G+ANGTAAGVAPLAH+A+Y+ CN  GC +S I AA
Sbjct  171   LTDGHGMHTASTAAG-NFVGGAGFFGNANGTAAGVAPLAHVAVYQACNAYGCGESSIAAA  229

Query  1624  MDTAIEDGVDIlslslggmssSFHEDSI-ALGAYSAMEKGIFVSASAGNEGPFNGSLSNE  1448
             +D AI+DGVDILS+SLG     +  D + A+GAY AM++GI VS SAGN G     L+N 
Sbjct  230   IDAAIDDGVDILSMSLGDRFYRYFSDGVLAIGAYRAMQRGIIVSCSAGNGG--KRGLANG  287

Query  1447  APWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSS-LLSLVFPGQNTSDESSS  1271
             APW++TVGAST+DRK++ATVVLGN ++  GET    K F S+  L LV+P      ++S 
Sbjct  288   APWIMTVGASTIDRKITATVVLGNGEEIEGETG---KGFPSTGKLELVYPWPFYPGDTS-  343

Query  1270  PYCDSESLRNADVRGKIVVCMTGGFLDRRGK---GEAVKNASGRGMILIEPEEYGITTSA  1100
                         +RGK+VV       +++GK   G+ VK+A G  MILI   + G TT  
Sbjct  344   ------------IRGKMVVRE-----NQKGKSDSGQVVKDAGGAAMILINTYDQGDTTFD  386

Query  1099  TAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESP  920
               HVLPA+ I YADG KI+AY+N TSNP AT SFKGT+ G   AP VAAFSSRGPN+ SP
Sbjct  387   DPHVLPALQIGYADGLKIIAYLNLTSNPTATMSFKGTVIGGGRAPVVAAFSSRGPNKASP  446

Query  919   GILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWS  740
             GILKPDIIGPGVNILA WP  V+NK ++KSTFNIISGTSMSCPHLSGVAALL+S+HPDWS
Sbjct  447   GILKPDIIGPGVNILAAWPFCVENKTDTKSTFNIISGTSMSCPHLSGVAALLRSAHPDWS  506

Query  739   PAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYL  560
             PA IKSA+MTTA   N   NPI+++ L  A+VF+IG+GHVNPS+ANDPGLVYD  P+DYL
Sbjct  507   PAAIKSAIMTTAYQENLKGNPIEDESLQPANVFAIGSGHVNPSRANDPGLVYDILPDDYL  566

Query  559   PYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEA  380
              YLCGLNY N+EV +++  +V+CS   SIPEAQLNYPSFSI+L ST QTYTRT+TNVG+A
Sbjct  567   QYLCGLNYPNQEVSILVGRKVDCSKEKSIPEAQLNYPSFSIVLGSTPQTYTRTLTNVGKA  626

Query  379   SSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWK  200
             +S Y V+I  P GV V VEP++L F K+  K +Y+VTF+ ++K A ++     QG +RW 
Sbjct  627   NSSYDVKIVSPDGVNVKVEPKKLVFPKLGDKSSYSVTFTRTTKGAINS---TTQGFIRWY  683

Query  199   SVKHHVRSPIA  167
             +  + VRSPIA
Sbjct  684   TADYSVRSPIA  694



>ref|XP_008437177.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=754

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/738 (54%), Positives = 520/738 (70%), Gaps = 20/738 (3%)
 Frame = -1

Query  2341  TATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMY  2162
             ++T  + L+TYIV V+ P            ++DL++WY SFLP T+      + R+++ Y
Sbjct  26    SSTSNTNLQTYIVHVKQP-----VLEILGDTIDLQNWYTSFLPETIEASSDEQPRLLYSY  80

Query  2161  RNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYG  1982
             R+VM GF+A+L+ E+VK M  KDGFISA PE  L LHTTH+P +LGL ++ G W++S++G
Sbjct  81    RHVMSGFSARLTKEQVKAMEEKDGFISAMPETTLNLHTTHTPEYLGLNKHFGLWKNSNFG  140

Query  1981  KGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVF  1802
             KGVIIGVLD+GI  +HPSF+DEGM  PPA+WKG CE   + CNNK+IGAR+F+     V 
Sbjct  141   KGVIIGVLDTGIHPNHPSFNDEGMSSPPAKWKGRCEFGASICNNKLIGARTFNLANNFVI  200

Query  1801  ddd-----ghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSE  1637
                     GHGTHTA TAAG FV+GA   G+A G A G+APLAH+A+YKVC+  GCS S+
Sbjct  201   GKSPNDENGHGTHTASTAAGTFVKGAEALGNARGKAVGMAPLAHIAMYKVCSPNGCSSSD  260

Query  1636  ILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSL  1457
             ILAA+D AI+DGVD+LSLSLG  S+ F  D+IA+GA++A++KGIFVS SAGN GP   +L
Sbjct  261   ILAALDAAIDDGVDVLSLSLGAPSTPFFRDTIAMGAFAAIKKGIFVSCSAGNSGPSKNTL  320

Query  1456  SNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDES  1277
             +NEAPW+LTVGAST+DRK+ A   LG+ + + GE+ FQP++F S  L LV+ G+  S   
Sbjct  321   ANEAPWILTVGASTIDRKIVALAKLGSGEVYTGESLFQPRNFPSKFLPLVYAGK--SGIE  378

Query  1276  SSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSAT  1097
              S YC   SL   +V GK+VVC  GG + R  KG  VKN  G  MILI  +  G +T A 
Sbjct  379   GSEYCIQGSLEKLNVTGKVVVCERGGGISRVAKGLVVKNGGGAAMILINQKPEGFSTLAE  438

Query  1096  AHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKN---APTVAAFSSRGPNRE  926
             AHVLP   ++Y DG KI AYIN++ NP A+ SFKGT+ G++    +P +A+FSSRGP + 
Sbjct  439   AHVLPTTHLSYEDGLKIKAYINSSHNPKASISFKGTLLGNRATTFSPAMASFSSRGPCQA  498

Query  925   SPGILKPDIIGPGVNILAPWPTSV--DNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSH  752
             SPGILKPDI GPGVNILA WP  +  +   N+KSTFN+ISGTSMSCPHLSG+AAL+KS H
Sbjct  499   SPGILKPDITGPGVNILAAWPFPLNNNTNTNTKSTFNVISGTSMSCPHLSGIAALIKSYH  558

Query  751   PDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKP  572
             P+WSPA IKSA+MT+AD+ N    PI +Q L  A+ F++G+GHVNPSKA +PGLVYD +P
Sbjct  559   PNWSPAAIKSAIMTSADVRNPQGKPIMDQDLKPANFFAMGSGHVNPSKAANPGLVYDIQP  618

Query  571   EDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTN  392
             +DY+PYLC L YT+ +V +I++ +V CS V  I E  LNYPSF++ L + +QT+ RTVTN
Sbjct  619   DDYIPYLCHL-YTDAQVSIIVRKQVTCSTVPRIREGDLNYPSFAVSLGAGSQTFNRTVTN  677

Query  391   VGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGA  212
             VG+A+S Y   +  P GV V V P  L+FSK+N+K+TY+VTFS       ++     +G 
Sbjct  678   VGDANSVYYPIVEAPAGVSVKVTPSNLKFSKLNEKVTYSVTFSRIDFVRTTS--EFSEGY  735

Query  211   LRWKSVKHHVRSPIAAKL  158
             L W S K  VRSPI+ KL
Sbjct  736   LIWVSKKLMVRSPISVKL  753



>ref|XP_006468883.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=747

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/744 (53%), Positives = 512/744 (69%), Gaps = 26/744 (3%)
 Frame = -1

Query  2359  LIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYG--  2186
             + G  +  +    L+TY+V V+ P     ++      +DLE WY SFLP T +       
Sbjct  21    IAGISNVESDIDDLQTYMVYVQKPRHGNFSKE-----IDLESWYHSFLPATFSSNSIDDD  75

Query  2185  -ESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNM  2009
              +SRMV  YR+V+ GFAA+L+AEEVK M  K+GFISA  E  L LHTTH+P FLGL QN 
Sbjct  76    RQSRMVHCYRHVISGFAARLTAEEVKAMETKNGFISARVENTLQLHTTHTPNFLGLHQNS  135

Query  2008  GFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA-CNNKVIGAR  1832
             GFW+DS+ GKGVIIGVLDSGI   HPSFSD+ MPPPPA+W+G CE    A CNNK+IGAR
Sbjct  136   GFWKDSNLGKGVIIGVLDSGITPTHPSFSDKDMPPPPAKWRGKCEFAGGAGCNNKIIGAR  195

Query  1831  SFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIG  1652
             +F        DD GHGTHT+ TAAG FV GAN  G ANGTA G+APLAHLA+YK C++  
Sbjct  196   NFYNLSLPPIDDGGHGTHTSSTAAGTFVNGANRLGEANGTAVGMAPLAHLAMYKTCDDYA  255

Query  1651  --CSDSEILAAMDTAIEDGVDIlslslgg---mssSFHEDSIALGAYSAMEKGIFVSASA  1487
               C +S + AA+D AIEDGVD+LSLS+G        FH ++IA+  + A++KGIFVS SA
Sbjct  256   DNCPESSVSAALDAAIEDGVDVLSLSIGLGPHQHKEFHANAIAIATFKAVKKGIFVSISA  315

Query  1486  GNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLV  1307
             GN GP   S+ N+APWMLTVGAST DR +  +V LGN++ + GE+  Q  D     L LV
Sbjct  316   GNWGPRTFSVVNDAPWMLTVGASTTDRGIVTSVQLGNQKTYDGESLLQGTDTPFEQLPLV  375

Query  1306  FPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEP  1127
             +P   T + S++  C  E+L++ DV+GK+V+C     +D     + V +A G  MIL+  
Sbjct  376   YP--VTKNASATTNCPPETLKSIDVKGKVVLCQLS--VDP----QDVLDAGGAAMILMNN  427

Query  1126  EEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFS  947
             E  G +  A + VLP + ++Y  G+ I AYIN+TS+P A    KGT+ G K AP VAAFS
Sbjct  428   ELIGDSIVAGSTVLPHVRVSYTVGESIKAYINSTSSPTAALVVKGTVIGRKTAPEVAAFS  487

Query  946   SRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAAL  767
             SRGP+  SPGILKPDIIGPGVNI+A W T+V+   N++ TF+IISGTSMSCPHLSG+AAL
Sbjct  488   SRGPSTVSPGILKPDIIGPGVNIIAAWLTAVEPITNTEYTFDIISGTSMSCPHLSGIAAL  547

Query  766   LKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLV  587
             LKS+HPDWSPA IKSA+MTTAD +N    PI +++ + A +F++GAGHVNPSKANDPGL+
Sbjct  548   LKSAHPDWSPAAIKSAIMTTADTVNLEGKPILDRNHLPADLFAVGAGHVNPSKANDPGLI  607

Query  586   YDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYT  407
             YD +P+DY+PYLCGLNYT+++V  I+   V CS V SI EA+LNYPSFSI L S+ QTY 
Sbjct  608   YDIQPDDYIPYLCGLNYTDQQVQGIVGGDVQCSKVSSIAEAELNYPSFSIRLGSSPQTYN  667

Query  406   RTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPP  227
             RTVTNVG A+S YT +I  P GV++ V+P ++ F++ NQK+ Y+VTF+ +     S+   
Sbjct  668   RTVTNVGPANSSYTSQIVAPEGVEITVQPNKISFTEKNQKVAYSVTFTRTKNTGASS---  724

Query  226   VVQGALRWKSVKHHVRSPIAAKLV  155
               Q  L W   ++ V+SPIA   +
Sbjct  725   -AQANLSWIFGQYTVKSPIAISFI  747



>ref|XP_010058417.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=1255

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/725 (55%), Positives = 523/725 (72%), Gaps = 21/725 (3%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGF  2141
             L TYI++V  P  +    S      DL+  Y+SFLPTT A     E RMV  YR+V+ GF
Sbjct  542   LSTYIIQVRKPTDKHFATSE-----DLDALYRSFLPTT-ATSSNQEQRMVHSYRHVVSGF  595

Query  2140  AAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGV  1961
             AAKL+AEE K++ N+DG +   PER+L LHTT +P FLGL+Q +G W+DS++GKGVIIGV
Sbjct  596   AAKLTAEEAKDIRNRDGVLYVRPERVLSLHTTRTPEFLGLRQEVGLWKDSNFGKGVIIGV  655

Query  1960  LDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVF---dddg  1790
             LDSGI+  H SFS EG+PPPPA+WKG C  N T+CNNK+IGARSF+     ++   DD G
Sbjct  656   LDSGISPQHSSFSGEGLPPPPAKWKGKCIFNDTSCNNKLIGARSFAYG--GIYPPTDDVG  713

Query  1789  hgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAI  1610
             HGTHTA TAAG FV+ A+  G+A GTAAG+APLAHLAIY+VC   GC +++ILA +D AI
Sbjct  714   HGTHTASTAAGAFVKNASALGNAKGTAAGIAPLAHLAIYQVCGISGCLEADILAGLDAAI  773

Query  1609  EDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLT  1430
             EDGVD++SLS+GG S  F +D+IA G+++A++KGIFVS+SAGN GP+N SLSNEAPW+L 
Sbjct  774   EDGVDVISLSVGGDSYPFFQDAIATGSFAAIQKGIFVSSSAGNMGPYNYSLSNEAPWLLN  833

Query  1429  VGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSES  1250
             VGAST+DR++ AT  LGN ++F GET +QP+DF+S+LL LV P +N   E+SS +C   S
Sbjct  834   VGASTIDRRIKATARLGNGKEFDGETVYQPQDFDSTLLPLVDPARN--GENSSAFCFPGS  891

Query  1249  LRN-ADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAID  1073
             L++ +D++GK+VVC  G  + R  KG+ VK+A G  MIL+     G TT A  HVLPA+ 
Sbjct  892   LKDRSDLKGKVVVCSVGSGVARVDKGQEVKDAGGAAMILVNSPLEGATTLADKHVLPAVH  951

Query  1072  ITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIG  893
             + Y  G++I +Y++ TS P AT   KGT  G   AP VA+FSSRGPN +S GILKPDIIG
Sbjct  952   VGYDAGREIKSYLSTTSAPKATILLKGTDIGSSVAPVVASFSSRGPNYQSQGILKPDIIG  1011

Query  892   PGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMM  713
             PGVNILA WP S+DN  + K +FN+ISGTSMSCPHLSGVAALLKS+HPDWSPA IKSA++
Sbjct  1012  PGVNILAAWPVSLDNSTDDKHSFNVISGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAII  1071

Query  712   TTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYT  533
             TTA   +    PI +Q L  A++F+ GAGHVNPSKA DPGL+YD +P+DY+PYLCGLNYT
Sbjct  1072  TTASTSDTKGQPILDQSLNPANIFTTGAGHVNPSKAVDPGLIYDIEPQDYIPYLCGLNYT  1131

Query  532   NREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTY--TRTVTNVGEASSFYTVE  359
             + E+ +I++ ++ CS+   IP+ QLNYPS S+  ES+   +  TR V NVG A+S Y V 
Sbjct  1132  DSEIELIVKEKITCSSTGRIPDYQLNYPSISLSFESSVTKFNVTRRVRNVGPANSSYKVV  1191

Query  358   IFEPPGVK-VNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHV  182
                  G+  + V P  L+F+KVN+  +++V F+ +  A     PP+ QGA+ W S KH V
Sbjct  1192  TDPITGLNSIGVYPSNLEFTKVNETASFSVDFTRNKTA----TPPLAQGAITWVSAKHSV  1247

Query  181   RSPIA  167
             R P+A
Sbjct  1248  RIPVA  1252


 Score =   199 bits (507),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 151/370 (41%), Positives = 201/370 (54%), Gaps = 48/370 (13%)
 Frame = -1

Query  2320  LETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGF  2141
             L TYI++V  P  +    S      DL+  Y+S LPTT A     E RMV  YR+V+ GF
Sbjct  42    LSTYIIQVRKPTDKHFATSE-----DLDALYRSCLPTT-ATSSNQEQRMVHSYRHVVSGF  95

Query  2140  AAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGV  1961
             AAKL+AEE K + N+DG +   PER+L LHTT +P FLGL+Q +G W+DS++GKGVIIGV
Sbjct  96    AAKLTAEEAKAIRNRDGVLYVRPERVLSLHTTRTPEFLGLRQEVGLWKDSNFGKGVIIGV  155

Query  1960  LDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARS--FSERERSVFdddgh  1787
             LDSGI   H SFS EG+PPP A+WKG C  N   CNNK+IGARS  + E E+  FDD GH
Sbjct  156   LDSGIYPQHSSFSGEGLPPPQAKWKGKCVFNDAYCNNKLIGARSIVYGEFEQP-FDDVGH  214

Query  1786  gthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIE  1607
             GTH A TAAG FV+ A+                                  LA  D AIE
Sbjct  215   GTHAASTAAGAFVKNASA---------------------------------LAGFDAAIE  241

Query  1606  DGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGN-----EGPFNGSLSNEAP  1442
             DGVD++SLS+GG SS F +D+IA G+++A++KG  V  + G        P  G+ +    
Sbjct  242   DGVDVISLSVGGDSSPFFDDAIAKGSFAAIQKGQEVKDAGGAAMILVNSPLEGATTLADK  301

Query  1441  WMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYC  1262
              +L       D        L      +    F+  D  +++ S +    +TS+    P  
Sbjct  302   HVLPAVHVGYDVGREIKSYLNTTSAPNATILFKGADIGTAIKSAIITTASTSNTEGQPIL  361

Query  1261  DSESLRNADV  1232
             D +SL  A++
Sbjct  362   D-QSLNPANI  370


 Score =   172 bits (437),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 122/180 (68%), Gaps = 7/180 (4%)
 Frame = -1

Query  730  IKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYL  551
            IKSA++TTA   N    PI +Q L  A++F+ GAGHVNPSKA DPGL+YD +P+DY+PYL
Sbjct  342  IKSAIITTASTSNTEGQPILDQSLNPANIFTTGAGHVNPSKAVDPGLIYDIEPKDYIPYL  401

Query  550  CGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTY--TRTVTNVGEAS  377
            CGLNYT+ E+ +I++ +V CS+  SIP+ QLNYPS S+  +ST   +  TR V NVG A+
Sbjct  402  CGLNYTDSEIELIVKEKVTCSSTGSIPDYQLNYPSISLNFDSTVTKFNVTRKVRNVGSAN  461

Query  376  SFYTVEIFEPPGVK-VNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWK  200
            S Y V I    G+  + V P  L+F+KVN+  +++V F+ +  A     PPV QGA+ WK
Sbjct  462  SSYRVVIDPITGLNSIGVYPSNLEFTKVNETASFSVDFTRNKTA----TPPVAQGAITWK  517


 Score = 60.8 bits (146),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = -1

Query  1180  KGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFS  1001
             KG+ VK+A G  MIL+     G TT A  HVLPA+ + Y  G++I +Y+N TS P AT  
Sbjct  273   KGQEVKDAGGAAMILVNSPLEGATTLADKHVLPAVHVGYDVGREIKSYLNTTSAPNATIL  332

Query  1000  FKGTITG  980
             FKG   G
Sbjct  333   FKGADIG  339



>ref|XP_006469111.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=744

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/757 (51%), Positives = 517/757 (68%), Gaps = 29/757 (4%)
 Frame = -1

Query  2389  FLRMFLILS---VLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSF  2219
              + +F I+S    + G  +  +  + L+TYIV V+ P     ++      +DLE WY SF
Sbjct  5     LISLFFIISFSPAIAGISNVESDINDLQTYIVYVQEPKHGNFSKE-----IDLESWYHSF  59

Query  2218  LPTTVAGGGYG---ESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHT  2048
             LP +++        +SRMV  YR+V+ GFAA+L+AEEVK M  K GFISA  E  L LHT
Sbjct  60    LPASISSNSIDDDHQSRMVHCYRHVISGFAARLTAEEVKVMETKSGFISAHVENTLQLHT  119

Query  2047  THSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELN  1868
             TH+P FLGL QN GFW+DS++GKGVIIGV+DSGI   HPSF D+ MPPPPA+W+G CE  
Sbjct  120   THTPRFLGLHQNSGFWKDSNFGKGVIIGVVDSGIGPTHPSFGDKDMPPPPAKWRGKCEFA  179

Query  1867  FTA-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPL  1691
               A CNNK+IGAR+F  +     D++GHGTHT+ TAAG FV GAN+ G ANGTA G+APL
Sbjct  180   GGAGCNNKIIGARNFLNKSEPPTDNEGHGTHTSSTAAGTFVNGANILGQANGTAVGMAPL  239

Query  1690  AHLAIYKVCNEIG--CSDSEILAAMDTAIEDGVDIlslslgg---mssSFHEDSIALGAY  1526
             AHLA+YK C++    C +S + AA+D AIEDGVD+LSLS+G        FH ++IA+ A+
Sbjct  240   AHLAMYKACDDYNGTCPESSVSAALDAAIEDGVDVLSLSIGLGPYQHKEFHANAIAIAAF  299

Query  1525  SAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAF  1346
              A++KGIFVS SAGN GP   S+ N+APWMLTVGAST DR +  +V LGN++ + GE+  
Sbjct  300   KAVKKGIFVSISAGNWGPKPFSVVNDAPWMLTVGASTTDRSIVTSVQLGNQETYDGESLL  359

Query  1345  QPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAV  1166
             Q  D  S  L LV+P   T + S++  C  E+L++ DV+GK+V+C+           + V
Sbjct  360   QWTDIPSEQLPLVYP--VTKNASATTNCSPETLKSIDVKGKVVLCLL------SVNPQDV  411

Query  1165  KNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTI  986
              +A G  MIL+  E  G +      VLP + ++Y  G+ I AYIN+TS+P A    KGT+
Sbjct  412   LDAGGAAMILMNNELIGDSIVVARSVLPNVRVSYMVGESIKAYINSTSSPTAALVVKGTV  471

Query  985   TGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGT  806
              G+K+AP + AFSSRGP+  SPGILKPD++GPGVNI+A W T+V+   N++  F+IISGT
Sbjct  472   IGEKSAPAIVAFSSRGPSTVSPGILKPDVVGPGVNIIAAWRTAVEPITNTEYIFDIISGT  531

Query  805   SMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAG  626
             SMSCPHLSG+AALLKS+HPDWSPA IKSA+MTTAD +N    PI +++ + A  F++GAG
Sbjct  532   SMSCPHLSGIAALLKSAHPDWSPAAIKSAIMTTADTINLEGKPILDRNHLPADPFAVGAG  591

Query  625   HVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPS  446
             HVNPSKANDPGL+YD +P+DY+PYLCGLNYT+++V  I+   V CS V SI EA LNYPS
Sbjct  592   HVNPSKANDPGLIYDIQPDDYIPYLCGLNYTDQQVQGIVGGDVQCSKVSSIAEAGLNYPS  651

Query  445   FSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTF  266
             FSI L S+ QTY RTVTNVG A+  YT +I  P GV + ++P ++ F++ NQK+ Y+VTF
Sbjct  652   FSIRLGSSPQTYNRTVTNVGPANLSYTSQIVAPEGVGITIQPDKISFTEKNQKVAYSVTF  711

Query  265   SLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
             + +     S      Q  L W S ++ V+SPIA   +
Sbjct  712   TRTKNTNTS----FTQANLSWISGRYAVKSPIAISFI  744



>ref|XP_010918181.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=757

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/765 (53%), Positives = 521/765 (68%), Gaps = 35/765 (5%)
 Frame = -1

Query  2386  LRMFLILSVLIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTT  2207
             L +  + ++L    S  + +  L+TYIV V+ P    +  S      D E WY+SFL   
Sbjct  7     LFILFLSNLLCPAISQESNSGSLQTYIVHVQQPPGAATLFSFK----DREKWYRSFLSAE  62

Query  2206  VAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFL  2027
              AG    ESRM++ Y +V+ GFAA+L+ EE+  M NK GF  A  +RILPL TTH+P FL
Sbjct  63    TAG--LRESRMIYSYSSVISGFAARLTEEELSHMKNKSGFTDAYLDRILPLQTTHTPSFL  120

Query  2026  GLQQNM-GFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNN  1850
             GL ++  G W+DS+YG+GVIIGVLD+GIA +H SFSDEGMP PPA+W+G C+ N + CNN
Sbjct  121   GLHRDAPGLWKDSNYGRGVIIGVLDTGIASNHASFSDEGMPSPPAKWEGYCKFNASNCNN  180

Query  1849  KVIGARSF----------SERER---SVFdddghgthtagtaaGNFVRGANVYGSANGTA  1709
             K+IGAR F          ++R +   S  D +GHGTHTA TAAG FV  A+V G A GTA
Sbjct  181   KLIGAREFLTGSNAMQTPTDRRKLRGSTNDTNGHGTHTASTAAGMFVNNASVNGLAKGTA  240

Query  1708  AGVAPLAHLAIYKVCNEIG-CSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALG  1532
             +GVAP AHLAIYKVC   G C++S+ILA MD A+EDGVD++SLS+GG S++F  DSIA+G
Sbjct  241   SGVAPYAHLAIYKVCTGDGSCAESDILAGMDAAVEDGVDLMSLSIGGPSTAFDRDSIAIG  300

Query  1531  AYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGET  1352
             A+ A++KGI VS +AGN+GP +G+LSNEAPW+LTVGAST+DR +  TV LG+  + +GE+
Sbjct  301   AFGAIQKGILVSCAAGNDGPEHGTLSNEAPWILTVGASTMDRLIQTTVTLGDNDEINGES  360

Query  1351  AFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGE  1172
             A++P +F+S+ L L++PG     ++   +CD+ SL + DVRGKIVVC   G++D   KGE
Sbjct  361   AYEPNNFSSTPLPLIYPGILGGRQAG--FCDNSSLDDIDVRGKIVVC-DDGWIDDVSKGE  417

Query  1171  AVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKG  992
              VKNA G GMI+      G TT +  HVLP   ++Y+DGQ+I AYIN+ S P A+ +FKG
Sbjct  418   IVKNAGGLGMIVANLMVEGFTTFSYTHVLPTSHVSYSDGQRIKAYINSASAPNASITFKG  477

Query  991   TITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIIS  812
             T+ G K AP VA FSSRGP++  P ILKPD+IGPGVN+LA WP  V     +++ FNIIS
Sbjct  478   TVIGTKPAPAVAYFSSRGPSQADPNILKPDVIGPGVNVLAAWPFEV-GASGTRARFNIIS  536

Query  811   GTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIG  632
             GTSM+ PHLSG+AALLKS HPDWSPA IKSA+MTTAD+  +  NPI ++    A  F IG
Sbjct  537   GTSMATPHLSGIAALLKSMHPDWSPAAIKSAIMTTADLTANDGNPITDETSNPADFFGIG  596

Query  631   AGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNY  452
             AGHVN  KA+DPGLVYD KP+DYL YLCGL YT+R+V +I +  V CS V S+    LNY
Sbjct  597   AGHVNVLKASDPGLVYDIKPDDYLAYLCGLRYTDRQVSIIARRAVRCSNVGSMAGKDLNY  656

Query  451   PSFSIILESTAQ---TYTRTVTNVGEASSFYTVEI-FEPPGVKVNVEPRELQFSKVNQKL  284
             PSF + L +T       TRTVTNVG ASS YTV+      GVKV+V+P  L F+K N++L
Sbjct  657   PSFMVFLNATNNYMVEVTRTVTNVGAASSTYTVQSRTSSKGVKVDVKPMVLSFTKANERL  716

Query  283   TYNVTFSLSSKAARSNMPPVVQGALRWKSVKHH--VRSPIAAKLV  155
              YNVTFS S  +         QG L W S  +   V SPI   +V
Sbjct  717   QYNVTFSSSGISGGK----YFQGYLMWISSDNSTTVGSPIVIAVV  757



>ref|XP_010051224.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=747

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/760 (53%), Positives = 517/760 (68%), Gaps = 28/760 (4%)
 Frame = -1

Query  2395  MKFLRMFLILSVL--IGFC-------STATIASKLETYIVRVELPHsristqsssssSVD  2243
             M F  +  ++ +L  + FC        T +  S L+TYIV V  P  +  ++       D
Sbjct  1     MAFAHLLCLIVLLSSLQFCLANGQSSPTRSQTSDLQTYIVHVTPPDGQRLSELK-----D  55

Query  2242  LEHWYKSFLPTTVAGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERI  2063
             LE WY SFLPT  +     E R+++ Y+NVM GFAA+L+ +EV  M +K GF++A PE+I
Sbjct  56    LESWYYSFLPTD-STTSRNERRLLYSYQNVMTGFAARLTPDEVATMQDKPGFVAAHPEQI  114

Query  2062  LPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKG  1883
               L TTHSP FLGL  N G    S+ GKG+IIG++D+G+  DH SFS +GMPPPPA+WKG
Sbjct  115   YSLQTTHSPQFLGLPLNQGSSNSSTMGKGIIIGIMDTGVTPDHTSFSGDGMPPPPAKWKG  174

Query  1882  VCELNFTACNNKVIGARSF-SERERSV----FdddghgthtagtaaGNFVRGANVYGSAN  1718
              C+   + CNNK+IGA++F S  +++V     DDDGHGTHTA TAAG  V+ AN    A 
Sbjct  175   RCDFKPSQCNNKLIGAKTFDSSAKKNVTMPPIDDDGHGTHTASTAAGASVQQANTLRMAE  234

Query  1717  GTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIA  1538
             GTA G+AP AHLAIYKVC+   C   +ILA +D A+ DGVD++S+SLGG S+ F+ D IA
Sbjct  235   GTAVGMAPYAHLAIYKVCST-DCFLGDILAGLDAALADGVDVISISLGGGSAPFYMDGIA  293

Query  1537  LGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHG  1358
             +  ++A+++G+FVS SAGN GPF+ SLSNEAPW+LTVGAST+DR + + V LGN +++ G
Sbjct  294   VATFAAVQRGVFVSCSAGNSGPFSESLSNEAPWILTVGASTIDRNIVSNVKLGNGEEYEG  353

Query  1357  ETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGK  1178
             ET +QP  F S+LL LV+PG + ++   S YC    L+++ V GKIV+C  G F+ R  +
Sbjct  354   ETIYQPS-FPSTLLPLVYPGIDGTE--GSIYCVPGQLKSSQVEGKIVLCERG-FVGRYFQ  409

Query  1177  GEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSF  998
                VK A G GMI++  E  G +T A A+VLPA  ++Y  G KI AYINAT  P AT  F
Sbjct  410   AIEVKRAGGAGMIMMNQEIDGFSTLADAYVLPASHVSYFAGNKIKAYINATRTPTATIMF  469

Query  997   KGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNI  818
             KGT+ G+  AP + +FSSRGP+  SPGILKPDIIGPGVNILA WP  + N   +K  FNI
Sbjct  470   KGTVFGNPTAPALTSFSSRGPSLISPGILKPDIIGPGVNILAAWPFPIRNDTKAKYYFNI  529

Query  817   ISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFS  638
             ISGTSMSCPHLSG+AAL+K  HPDWSPA IKSA+MTTA  LN  QNPI ++ L  A VF+
Sbjct  530   ISGTSMSCPHLSGIAALIKGIHPDWSPAAIKSAIMTTAKQLNVKQNPILDERLQPADVFA  589

Query  637   IGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQL  458
             IGAGHV+P KA DPG +YD  P+DY+PYLCGL YT+++V  I+   V CS V SIPE +L
Sbjct  590   IGAGHVDPEKAIDPGFIYDMHPDDYIPYLCGLGYTDKQVATIVHKPVKCSGVSSIPEGEL  649

Query  457   NYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTY  278
             NYPSFS+ L    QT+TRTVTNVG   S Y V +  P GV V V+P +L FSK+NQK TY
Sbjct  650   NYPSFSVNL-GPPQTFTRTVTNVGTDYSPYVVTVVPPQGVHVTVKPNKLTFSKLNQKATY  708

Query  277   NVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKL  158
             ++T  LS   +  ++    QG LRW S K+ VRSPI+ K 
Sbjct  709   SIT--LSRANSTQDVAKFTQGFLRWDSKKYSVRSPISVKF  746



>ref|XP_009775744.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=633

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/650 (58%), Positives = 477/650 (73%), Gaps = 28/650 (4%)
 Frame = -1

Query  2107  MGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPS  1928
             M  K GF+SA  +++L LHTTHSP FLGL QN+G W  S+ GKGVIIGV+D+GI   HPS
Sbjct  1     MEKKPGFVSARRQQVLQLHTTHSPDFLGLHQNVGLWNASNSGKGVIIGVIDTGITPQHPS  60

Query  1927  FSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVFdddghgthtagtaaGNFV  1748
             F+D GMPPPPA+WKG CE N T CNNK+IGAR+ ++   S  DDDGHGTHT+ TAAGNFV
Sbjct  61    FNDNGMPPPPAKWKGKCEFNLTVCNNKLIGARNLAQNATSPEDDDGHGTHTSSTAAGNFV  120

Query  1747  RGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVD-Ilslslgg  1571
              GAN+ G ANGTAAG+AP AH+ +Y+VC    C +S+ILA +D AIEDGVD I       
Sbjct  121   EGANLLGKANGTAAGIAPRAHVVMYRVCAS-KCQESDILAGLDAAIEDGVDVISISLGSL  179

Query  1570  mssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGS-LSNEAPWMLTVGASTVDRKLSA  1394
              S S ++D +A+G+YSA+EKGIFVSASAGN GP + S ++N APW+LTVGAST DRK+SA
Sbjct  180   ASMSLYDDVVAIGSYSAIEKGIFVSASAGNTGPVDDSXVTNAAPWLLTVGASTTDRKISA  239

Query  1393  TVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVV  1214
               VLGN  ++ GE+ +QP +F+  LL LV P           YC  E L   DV+GKIV+
Sbjct  240   VAVLGNGAEYEGESVYQPSNFSQKLLPLVNP----------EYC--EFLSTIDVKGKIVL  287

Query  1213  CMTG--GFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILA  1040
             C     G+   +  G+ VK+A G  MIL+  E  G TT A  HVLPA  I+YADGQKIL 
Sbjct  288   CERSNTGYPAVQ-YGQNVKDAGGAAMILMNNEWRGYTTIADVHVLPATHISYADGQKILN  346

Query  1039  YINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPT  860
             Y+ +T+ P+AT SFKGT  GDK+AP VA FSSRGP   S GI+KPDIIGPGVNILA W T
Sbjct  347   YMKSTTAPVATISFKGTRIGDKHAPAVADFSSRGP--FSIGIVKPDIIGPGVNILAAWRT  404

Query  859   SVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQN  680
             SV    ++ STFNI+SGTSM+CPHL+GVAALLKS+HPDWSPA IKSA+MTTAD +N G +
Sbjct  405   SVGEITSATSTFNILSGTSMACPHLAGVAALLKSAHPDWSPAAIKSAIMTTADFVNLGND  464

Query  679   PIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHR  500
             PIQ++   TA++ + G+GHV+PS+ANDPGL+YD +PEDY+PYLCGLNYT+++V  I++ +
Sbjct  465   PIQDERFKTANLLATGSGHVDPSRANDPGLIYDIQPEDYVPYLCGLNYTDQQVSAIVKRK  524

Query  499   VNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEP  320
             ++C++  SIPE++LNYPSFSI L+S AQTYTRTVTNVGEA+S YTV++F   GV+V V P
Sbjct  525   IHCTS--SIPESELNYPSFSIPLKSGAQTYTRTVTNVGEANSTYTVKVFGLDGVEVTVNP  582

Query  319   RELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPI  170
               L+FS +NQK +YNVT   S   A S      QG + W S ++ VRSPI
Sbjct  583   TILKFSALNQKASYNVTVKPSPLIADS------QGYITWSSDRYSVRSPI  626



>ref|XP_006446947.1| hypothetical protein CICLE_v10014389mg [Citrus clementina]
 gb|ESR60187.1| hypothetical protein CICLE_v10014389mg [Citrus clementina]
Length=744

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/744 (52%), Positives = 508/744 (68%), Gaps = 26/744 (3%)
 Frame = -1

Query  2359  LIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYG--  2186
             + G  +  +    L+TY+V V+ P     ++      +DLE WY SFLP T++       
Sbjct  18    IAGISNVESDIDDLQTYMVYVQKPKHGNFSKE-----IDLESWYHSFLPATISSNSTDDD  72

Query  2185  -ESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNM  2009
              +SRMV  YR+V+ GFAA+L+AEEVK M  K+GFISA  E  L LHTTH+P FLGL QN 
Sbjct  73    RQSRMVHCYRHVISGFAARLTAEEVKAMETKNGFISAHVENTLRLHTTHTPNFLGLHQNS  132

Query  2008  GFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA-CNNKVIGAR  1832
             GFW+DS+ GKGVIIGVLDSGI   HPSFSD+ MPPPPA+W+G CE    A CNNK+IGAR
Sbjct  133   GFWKDSNLGKGVIIGVLDSGITPTHPSFSDKDMPPPPAKWRGKCEFAGGAGCNNKIIGAR  192

Query  1831  SFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIG  1652
             +F        DD GHGTHT+ TAAG FV GAN  G ANGTA G+APLAHLA+YK C++  
Sbjct  193   NFYNLSLPPIDDGGHGTHTSSTAAGTFVNGANRLGEANGTAVGMAPLAHLAMYKACDDYA  252

Query  1651  --CSDSEILAAMDTAIEDGVDIlslslg---gmssSFHEDSIALGAYSAMEKGIFVSASA  1487
               C +S + AA+D AIEDGVD+LSLS+G        FH ++IA+  + A++KGIF+S SA
Sbjct  253   DKCPESSVSAALDAAIEDGVDVLSLSIGLGPDQHKEFHANAIAIATFKAVKKGIFISISA  312

Query  1486  GNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLV  1307
             GN GP   S+ N+APWMLTVGAST DR +  +V LGN++ + GE+  Q     S  L LV
Sbjct  313   GNWGPKPFSVVNDAPWMLTVGASTTDRSIVTSVQLGNQETYDGESLLQGTGIPSEQLPLV  372

Query  1306  FPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEP  1127
             +P   T + S++  C  E+L++ DV+GK+V+C            + V +A G  MIL+  
Sbjct  373   YP--VTKNASATTNCPPETLKSIDVKGKVVLCQL------SADPQDVLDAGGAAMILMNN  424

Query  1126  EEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFS  947
             E  G +  A + VLP   ++Y  G+ I AYIN+TS+P A    KGT+ G+K+AP + AFS
Sbjct  425   ELIGDSIVAGSTVLPHARVSYTVGESIKAYINSTSSPTAALVVKGTVIGEKSAPAIVAFS  484

Query  946   SRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAAL  767
             SRGP+  SPGILKPD++GPGVNI+A W T+V+   N++  F+IISGTSMSCPHLSG+AAL
Sbjct  485   SRGPSTVSPGILKPDVVGPGVNIIAAWRTAVEPITNTEYIFDIISGTSMSCPHLSGIAAL  544

Query  766   LKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLV  587
             LKS+HPDWSPA IKSA+MTTAD +N    PI +++ + A +F++GAGHVNPSKANDPGL+
Sbjct  545   LKSAHPDWSPAAIKSAIMTTADTINLEGKPILDRNHLPADLFAVGAGHVNPSKANDPGLI  604

Query  586   YDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYT  407
             YD +P DY+PYLCGLNYT+++V  I+   V CS V SI EA+LNYPSFSI L S  QTY 
Sbjct  605   YDIQPNDYIPYLCGLNYTDQQVQGIVGGDVQCSKVQSIAEAELNYPSFSIRLGSARQTYN  664

Query  406   RTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPP  227
             RTVTNVG A+S YT +I  P GV++ ++P ++ F+  NQK+TY+VTF+ +     S+   
Sbjct  665   RTVTNVGPANSSYTSQIVAPEGVEITIQPSKISFTGKNQKVTYSVTFTRTKNIGASS---  721

Query  226   VVQGALRWKSVKHHVRSPIAAKLV  155
               Q  L W   ++ V+SPIA   +
Sbjct  722   -AQANLSWIFGQYIVKSPIAISFI  744



>ref|XP_006339268.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=646

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/657 (57%), Positives = 478/657 (73%), Gaps = 24/657 (4%)
 Frame = -1

Query  2131  LSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDS  1952
             LS++EV EM  K GF+SA P+RI  +HTTH+P FLGL QN+G W  S+ GKGV+IG+LD 
Sbjct  2     LSSDEVTEMEKKPGFVSARPQRIFQMHTTHAPSFLGLHQNVGLWNASNSGKGVVIGILDC  61

Query  1951  GIARDHPSFSDEGMPPPPARWKGVCELNFTA-CNNKVIGARSFSERERSVFdddghgtht  1775
             GI   HPSF+D GMP PP +WKG CE N T  CN K+IGAR+F + + S  DD GHGTHT
Sbjct  62    GIDPHHPSFNDNGMPNPPLKWKGKCEFNVTTNCNKKLIGARNFVQPDLSPTDDYGHGTHT  121

Query  1774  agtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVD  1595
             + TAAGNFV GAN YG+ANGTA G+AP AH+AIYKVC+   C + +ILA +D AIEDGVD
Sbjct  122   SSTAAGNFVDGANFYGNANGTAVGIAPRAHVAIYKVCDAFYCLEYKILAGLDAAIEDGVD  181

Query  1594  Ilslslg--gmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGA  1421
             ++S+S+G   + S  ++D+IA+G YSAMEKGIFVS SAGN GP +G++ N APW+LTVGA
Sbjct  182   VISISIGFGHLRSPLYDDNIAIGTYSAMEKGIFVSCSAGNGGPRSGTVENGAPWILTVGA  241

Query  1420  STVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRN  1241
             ST DRK+SA  VLGN  ++ GE+AFQP +F+  LL LV  G N            E    
Sbjct  242   STTDRKISAVAVLGNGAEYEGESAFQPTNFSQKLLPLV-NGTNC-----------ELFNT  289

Query  1240  ADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYA  1061
             +DV+GKIV+C +   L R+     VK A G GMIL+  +  G TT +    +P   I+Y 
Sbjct  290   SDVKGKIVLCDSSSDLSRKDIARIVKKAGGAGMILMNEKYAGSTTFSEYDAVPTTQISYN  349

Query  1060  DGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVN  881
             DGQ+I  Y+ +TS P+AT +FKGT  GDK+APTVA FSSRGP  +S GILKPDIIGPGVN
Sbjct  350   DGQEITNYMKSTSTPVATITFKGTKIGDKHAPTVAYFSSRGPCMQSQGILKPDIIGPGVN  409

Query  880   ILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTAD  701
             ILA WP S+  +  S  TFNI+SGTSMSCP L+GVAALLKS+HPDWSPA IKSA+MTTAD
Sbjct  410   ILAAWPISIGGETTSL-TFNILSGTSMSCPLLAGVAALLKSAHPDWSPAAIKSAIMTTAD  468

Query  700   ILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREV  521
             I+N G +PIQ++ L  A + +IG+GHVNPS+ANDPGL+YD +PEDY+PYLCGLNYT+ +V
Sbjct  469   IINLGNDPIQDETLEPADLLTIGSGHVNPSRANDPGLIYDVQPEDYIPYLCGLNYTDDQV  528

Query  520   GVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPG  341
               I++ +V+C++  SIP+++LNYPSFSI  ES AQTYTRTVTN+GEA S YTV++F   G
Sbjct  529   SAIVRKKVHCTS--SIPQSELNYPSFSIPKESNAQTYTRTVTNIGEAISAYTVKVFGLKG  586

Query  340   VKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPI  170
             V+V V+P+ L+F+ +NQK +YNVT         S      QG + W S ++ VRSPI
Sbjct  587   VEVTVQPKILKFTALNQKASYNVTVKSLDLTGHS------QGYIVWSSDRYSVRSPI  637



>ref|XP_006446945.1| hypothetical protein CICLE_v10017946mg [Citrus clementina]
 gb|ESR60185.1| hypothetical protein CICLE_v10017946mg [Citrus clementina]
Length=744

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/744 (52%), Positives = 512/744 (69%), Gaps = 26/744 (3%)
 Frame = -1

Query  2359  LIGFCSTATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYG--  2186
             + G  +  +  + L+TYIV V+ P     ++      +DLE WY SFLP T++       
Sbjct  18    IAGISNVESDINDLQTYIVYVQEPKHGNFSKE-----IDLESWYHSFLPATISSNSIDDD  72

Query  2185  -ESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNM  2009
              +SRMV  YR+V+ GFAA+L+AEEVK M  K GFISA  E  L LHTTH+P FLGL QN 
Sbjct  73    HQSRMVHYYRHVISGFAARLTAEEVKVMETKSGFISAHVENTLQLHTTHTPRFLGLHQNS  132

Query  2008  GFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTA-CNNKVIGAR  1832
             GFW+DS++GKGVIIGV+DSGI   HPSF D+ MPPPPA+W+G CE    A CNNK+IGAR
Sbjct  133   GFWKDSNFGKGVIIGVVDSGIGPTHPSFGDKDMPPPPAKWRGKCEFAGGAGCNNKIIGAR  192

Query  1831  SFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIG  1652
             +F  +     D++GHGTHT+ TAAG FV GAN+ G ANGTA G+APLAHLA+YK C++  
Sbjct  193   NFLNKSEPPTDNEGHGTHTSSTAAGTFVNGANILGQANGTAVGMAPLAHLAMYKACDDYN  252

Query  1651  --CSDSEILAAMDTAIEDGVDIlslslgg---mssSFHEDSIALGAYSAMEKGIFVSASA  1487
               C +S + AA+D AIEDGVD+LSLS+G        FH ++IA+ A+ A++KGIFVS SA
Sbjct  253   GTCPESSVSAALDAAIEDGVDVLSLSIGLGPYQHKEFHANAIAIAAFKAVKKGIFVSISA  312

Query  1486  GNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLV  1307
             GN GP   S+ N+APWMLTVGAST DR +  +V LGN++ + GE+  Q  D  S  L LV
Sbjct  313   GNWGPKPFSVVNDAPWMLTVGASTTDRSIVTSVQLGNQETYDGESLLQWTDIPSEQLPLV  372

Query  1306  FPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEP  1127
             +P   T + S++  C  E+L++ DV+GK+V+C+           + V +A G  MIL+  
Sbjct  373   YP--VTKNASATTNCSPETLKSIDVKGKVVLCLL------SVNPQDVLDAGGAAMILMNN  424

Query  1126  EEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFS  947
             E  G +      VL  + ++Y  G+ I AYIN+TS+P A    KGT+ G+K+AP + AFS
Sbjct  425   ELIGDSIVVARSVLRNVRVSYMVGESIKAYINSTSSPTAALVVKGTVIGEKSAPAIVAFS  484

Query  946   SRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAAL  767
             SRGP+  SPGILKPD++GPGVNI+A W T+V+   N++  F+IISGTSMSCPHLSG+AAL
Sbjct  485   SRGPSTVSPGILKPDVVGPGVNIIAAWRTAVEPITNTEYIFDIISGTSMSCPHLSGIAAL  544

Query  766   LKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLV  587
             LKS+HPDWSPA IKSA+MTTAD +N    PI +++ + A  F++GAGHVNPSKANDPGL+
Sbjct  545   LKSAHPDWSPAAIKSAIMTTADTVNLEGKPILDRNHLPADPFAVGAGHVNPSKANDPGLI  604

Query  586   YDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYT  407
             YD +P+DY+PYLCGLNYT+++V  I+   V CS + SI EA+LNYPSFSI L S+ QTY 
Sbjct  605   YDIQPDDYIPYLCGLNYTDQQVQGIVGGDVQCSKMSSIAEAELNYPSFSIRLGSSPQTYN  664

Query  406   RTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPP  227
             RTVTNVG A+  YT +I  P GV++ ++P ++ F++ NQK+ Y+VTF+ +     S    
Sbjct  665   RTVTNVGPANLSYTSQIVAPEGVEITIQPDKISFTEKNQKVAYSVTFTRTKNTNTS----  720

Query  226   VVQGALRWKSVKHHVRSPIAAKLV  155
               Q  L W S ++ V+SPIA   +
Sbjct  721   FTQANLSWISGRYAVKSPIAISFI  744



>gb|KCW72066.1| hypothetical protein EUGRSUZ_E00511, partial [Eucalyptus grandis]
Length=685

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/683 (56%), Positives = 486/683 (71%), Gaps = 16/683 (2%)
 Frame = -1

Query  2185  ESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMG  2006
             E  +V  YR+V+ GFAAKL+AEE K +  KDG ++  PE+ L LHTTHSP FLGL Q +G
Sbjct  6     ERGIVHSYRHVLSGFAAKLTAEEAKAIREKDGVLAVRPEKALSLHTTHSPDFLGLHQGVG  65

Query  2005  FWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF  1826
              W+DS++GKGVIIGVLD+G+  DH SFSD+ +PPPPA+WKG C+ + T+CNNK+IGARSF
Sbjct  66    LWKDSNFGKGVIIGVLDTGVFPDHSSFSDKNVPPPPAKWKGRCDFDGTSCNNKLIGARSF  125

Query  1825  SERERSV------FdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVC  1664
                  +V      +D +GHGTHT+ TAAG FVR AN  G+ANGTA+G+APLAHLAIY+VC
Sbjct  126   ISSSNTVAQADPPYDSEGHGTHTSSTAAGAFVRNANALGNANGTASGIAPLAHLAIYQVC  185

Query  1663  NEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAG  1484
             + +GCS+ +ILA +D A EDGVD+LSLSLGG S  F+ D IA GA++A +KGI VS SAG
Sbjct  186   SSLGCSEGDILAGLDAATEDGVDVLSLSLGGNSQPFYSDLIATGAFAATQKGILVSCSAG  245

Query  1483  NEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVF  1304
             N GP +G+LSNEAPW+LTVGAS++DR + AT  LGN ++F GET +QP+DF+   L LV+
Sbjct  246   NSGPSSGTLSNEAPWILTVGASSIDRSIKATARLGNGKEFDGETLYQPRDFDPVPLPLVY  305

Query  1303  PGQNTSDESSSPYCDSESLRN-ADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEP  1127
              G+    + SS YC + SL N + +RGK+VVC   G   RR KG+ V++A G  MIL+  
Sbjct  306   AGEK--GDPSSAYCLTGSLGNRSGLRGKVVVCDNDG-TGRRDKGQEVQDAGGVAMILVNS  362

Query  1126  EEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGT-ITGDKNAPTVAAF  950
              + G TT A  HVLPA+ ++YA G  I  YI+  S P AT  FKGT I G    P V +F
Sbjct  363   IDGGYTTFADRHVLPAVHVSYAAGSDIKQYISTASAPKATILFKGTHINGRSADPAVTSF  422

Query  949   SSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAA  770
             SSRGPN +SPGILKPDIIGPG+NILA WP  + N  + K  F ++SGTSMSCPHLSGVAA
Sbjct  423   SSRGPNAQSPGILKPDIIGPGLNILAGWPFPLGNSTDKKRAFAVLSGTSMSCPHLSGVAA  482

Query  769   LLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGL  590
             LLKS+HPDWSPA IKSA++TTA   N    PI ++ L  A +F+ GAGHVNPSKA DPGL
Sbjct  483   LLKSAHPDWSPAAIKSAIITTATTSNLKGQPIVDETLRPADIFATGAGHVNPSKAVDPGL  542

Query  589   VYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQ--  416
             +YDT P+DY+PYLCGL+YT+ E+  I++  V CS++ SIP+ QLNYPS S+  + +A   
Sbjct  543   IYDTAPQDYIPYLCGLDYTDSEIERIVKENVKCSSIRSIPDYQLNYPSISVSFDGSATKV  602

Query  415   TYTRTVTNVGEASSFYTVEIFEPPGVK-VNVEPRELQFSKVNQKLTYNVTFSLSSKAARS  239
             + TRTV NVG A S Y   I    G+  + V+PR+L F+K NQ  +Y V F+ S KA  +
Sbjct  603   SVTRTVRNVGPAQSRYRSVIDPIKGLDLIGVQPRDLVFTKANQTASYRVDFTRSGKAKPA  662

Query  238   NMPPVVQGALRWKSVKHHVRSPI  170
                P   GA+ W S KH VR+P+
Sbjct  663   T--PYAWGAVTWVSAKHSVRTPV  683



>ref|XP_009768778.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=583

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/589 (64%), Positives = 458/589 (78%), Gaps = 9/589 (2%)
 Frame = -1

Query  1912  MPPPPARWKGVCELNFTA-CNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGAN  1736
             MP PPA+WKG CE NFT  CNNK+IG RSF   E S  DDDGHGTHTA TAAG FV+GAN
Sbjct  1     MPSPPAKWKGFCESNFTTKCNNKIIGLRSFRFSEGSPIDDDGHGTHTASTAAGAFVKGAN  60

Query  1735  VYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSF  1556
              +G+ANGTA GVAPLAH+AIYKVC+   CS+++ LAAMD AI+DGVDI+S SLGG ++ F
Sbjct  61    FFGNANGTAVGVAPLAHIAIYKVCSFATCSETDTLAAMDAAIDDGVDIISTSLGGGNAPF  120

Query  1555  HEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGN  1376
             H+D+ ALGAYSA E+GI VS SAGN   F+ S++N APW+LTVGAST DRKL ATV LGN
Sbjct  121   HDDTFALGAYSATERGILVSCSAGNRN-FDSSVANSAPWILTVGASTHDRKLKATVKLGN  179

Query  1375  RQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGF  1196
             +++F GETA Q K  NS+ ++L   G+N SD+ + P+C S ++ +  ++GKIV+C     
Sbjct  180   KEEFEGETADQQKTSNSTFVALYDAGKNASDQDA-PFCRSWAMTDPAIKGKIVLCRKDCC  238

Query  1195  LDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNP  1016
                  +G  VK+A G GMILI   E G+T SATAHVLPA+D+++ +G+KI AYIN+TSNP
Sbjct  239   SHTSSQGRNVKDAGGVGMILINNPEDGVTKSATAHVLPALDVSHEEGEKIKAYINSTSNP  298

Query  1015  MATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVD--NKP  842
             +A  +F+GT+ GDKNAP VA+FS+RGP+R +PGILKPDIIGPGVNILA WPT+V+  NK 
Sbjct  299   IAAITFQGTVIGDKNAPIVASFSTRGPSRANPGILKPDIIGPGVNILAAWPTTVNIPNK-  357

Query  841   NSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQH  662
             N+ S FNI+SGTSMSC HLSG+AALLKS+HP+WS + IKSA+MTTADILN  +NPI ++ 
Sbjct  358   NTNSAFNILSGTSMSCAHLSGIAALLKSAHPNWSSSAIKSAIMTTADILNLAKNPILDET  417

Query  661   LVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAV  482
             L  A++F+ GAGHVNPS+ANDPGLVYDT  EDYLPYLCGLNYTNREVG++LQ +VNCS V
Sbjct  418   LNPANIFATGAGHVNPSRANDPGLVYDTPFEDYLPYLCGLNYTNREVGLLLQRKVNCSEV  477

Query  481   ISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFS  302
              SIPEAQLNYPSFSI L ST Q YTRTVTNVG+A+S Y VEI  P GV V V+P +L FS
Sbjct  478   KSIPEAQLNYPSFSIRLRSTPQIYTRTVTNVGDATSTYKVEIVSPKGVAVKVKPSKLNFS  537

Query  301   KVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIAAKLV  155
              +NQ+LTY VTF   SK   S+   VVQG L+W S  H VRSPIA  LV
Sbjct  538   MLNQRLTYQVTF---SKTTNSSGNEVVQGFLKWTSNTHSVRSPIAVVLV  583



>ref|XP_010051225.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=761

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/733 (52%), Positives = 490/733 (67%), Gaps = 18/733 (2%)
 Frame = -1

Query  2341  TATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFMY  2162
             T +  S L+TYIV V  P  +  ++       DLE WY SFLPT  +     E R+++ Y
Sbjct  41    TRSQTSDLQTYIVHVTPPDGQRLSELK-----DLESWYYSFLPTD-STTSRNERRLLYSY  94

Query  2161  RNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYG  1982
             +NVM GFAA+L+ +EV  M +K GF++A PE+I  L TTHSP FLGL  + G    S+ G
Sbjct  95    QNVMTGFAARLTPDEVATMQDKPGFVAAHPEQIYSLQTTHSPQFLGLPLSQGSSNSSTMG  154

Query  1981  KGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSFSERERSVF  1802
             KG+IIG++D+G+  DHPSFS +GMPPPPA+WKG C+   + CNNK+IGA++F    +   
Sbjct  155   KGIIIGIMDTGVTPDHPSFSGDGMPPPPAKWKGRCDFKPSQCNNKLIGAKTFDSSAKKNV  214

Query  1801  dddghgthtagtaaGNFVRGANVYGS-----ANGTAAGVAPLAHLAIYKVCNEIGCSDSE  1637
                       GT   +   GA+V  +     A GTA G+AP AHLAIYKVC    C   +
Sbjct  215   TMPPTDDVGHGTHTASTAAGASVQQANTLRMAEGTAGGMAPYAHLAIYKVCFTTSCFLGD  274

Query  1636  ILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSL  1457
             ILA +D A+ DGVD++S+S+GG S+ F+ D IA+  ++A+++GIFVS SAGN GPF+ SL
Sbjct  275   ILAGLDAALADGVDVISISIGGGSAPFYMDGIAVATFAAVQRGIFVSCSAGNSGPFSESL  334

Query  1456  SNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDES  1277
             SNEAPW+LTVGAST+DR + +   LGN +++ GET +QP  F S+LL LV+PG + ++ S
Sbjct  335   SNEAPWILTVGASTIDRNIVSNAKLGNGEEYEGETIYQPS-FPSTLLPLVYPGIDGTEGS  393

Query  1276  SSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSAT  1097
                YC    L+++ V GKIV+C  G F+ R  +   VK A G GMI++  E  G +T A 
Sbjct  394   V--YCVPGQLKSSQVEGKIVLCERG-FVGRYFQAIEVKRAGGAGMIMMNQEIDGFSTLAD  450

Query  1096  AHVLPAIDITYADGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPG  917
             A+ LPA  ++Y  G KI AYINAT  P AT  FKGT+ G+  AP + +FSSRGP+  SPG
Sbjct  451   AYDLPASHVSYFAGNKIKAYINATRTPTATIMFKGTVFGNPTAPALTSFSSRGPSLISPG  510

Query  916   ILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSP  737
             ILKPDIIGPGVNILA WP  + N   +K  FNIISGTSMSCPHLSG+AAL+K  HPDWSP
Sbjct  511   ILKPDIIGPGVNILAAWPFPIRNDTKAKYYFNIISGTSMSCPHLSGIAALIKGIHPDWSP  570

Query  736   AMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLP  557
             A IKSA+MTTA  LN  QNPI ++ L  A VF+IGAGHV+P+KA DPG +YD  P DY+P
Sbjct  571   ATIKSAIMTTAKQLNVKQNPILDERLQPADVFAIGAGHVDPAKAIDPGFIYDMHPNDYIP  630

Query  556   YLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEAS  377
             YLCGL YT+++V  I    V CS V SIPE +LNYPSFS+ L    QT+TRTVTNVG   
Sbjct  631   YLCGLGYTDKQVATIAHKPVKCSGVSSIPEGELNYPSFSVNL-GPPQTFTRTVTNVGTDY  689

Query  376   SFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKS  197
             S Y V +  P GV V V+P +L FSK+NQK TY++T  LS   +  ++    QG LRW S
Sbjct  690   SPYVVTVVPPQGVHVTVKPNKLNFSKLNQKATYSIT--LSRANSTQDVAKFTQGFLRWDS  747

Query  196   VKHHVRSPIAAKL  158
              K+ VRSPI+ K 
Sbjct  748   KKYSVRSPISVKF  760



>ref|XP_010034346.1| PREDICTED: subtilisin-like protease SDD1 [Eucalyptus grandis]
Length=757

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/738 (54%), Positives = 504/738 (68%), Gaps = 30/738 (4%)
 Frame = -1

Query  2344  STATIASKLETYIVRVELPHsristqsssssSVDLEHWYKSFLPTTVAGGGYGESRMVFM  2165
             + A   S L TYI++V  P  +           DL+  Y+SFLPTT A     E RMV  
Sbjct  34    AVADTRSSLSTYIIQVRKPTDKHFATVE-----DLDSLYRSFLPTTAASSKQ-EQRMVHS  87

Query  2164  YRNVMKGFAAKLSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSY  1985
             Y++ + GFAAKL+AEE K +  KDG +   PE +L LHTT +P FLGL Q +GFW+DS++
Sbjct  88    YQHALSGFAAKLTAEEAKAVQEKDGVLQVHPEEVLSLHTTRTPDFLGLHQGVGFWKDSNF  147

Query  1984  GKGVIIGVLDSGIARDHPSFSDEGMPPPPARWKGVCELNFTACNNKVIGARSF-----SE  1820
             GKGVIIG+LDSG+  +HPSF+DEG+PPPPA+WKG C+ N T+CNNK+IGARSF     + 
Sbjct  148   GKGVIIGLLDSGVFPEHPSFNDEGVPPPPAKWKGRCDFNGTSCNNKLIGARSFINPINAT  207

Query  1819  RERSVFdddghgthtagtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDS  1640
             +    +DD GHGTHT+ TAAG FVR A+  G+A GTA G+APLAHLA+YKVC + GC  S
Sbjct  208   QAVPPYDDTGHGTHTSSTAAGAFVRDASALGNAKGTAVGMAPLAHLAMYKVCVDDGCPAS  267

Query  1639  EILAAMDTAIEDGVDIlslslggmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGS  1460
              ILA  D AIEDGVD+LS+SLGG S  F +D IA GA++A +KGIFVS SAGN GP+N S
Sbjct  268   SILAGFDAAIEDGVDVLSVSLGGNSKPFFKDWIAQGAFAATQKGIFVSCSAGNSGPYNTS  327

Query  1459  LSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDE  1280
             LSNEAPW+LTVGAS++DR + AT  LGN  +F GET +QP +F+ +LL L++P  +   +
Sbjct  328   LSNEAPWILTVGASSIDRSIEATARLGNGLEFDGETLYQPHNFHPALLPLIYPEIDDRIQ  387

Query  1279  SSSPYCDSESLR-NADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTS  1103
                  C   SLR  +D+RGK+VVC  G   +    G+ VK+  G  MIL+     G TT 
Sbjct  388   D----CAKGSLRFRSDIRGKVVVCDLGS-TEPVVAGQEVKDRGGVAMILVNGLTDGYTTL  442

Query  1102  ATAHVLPAIDITYADGQKILAYINATSNPMATFSFKGT-ITGDKNAPTVAAFSSRGPNRE  926
             A AHVLPA++++Y  G++I  Y N  S PMAT  FKGT I     AP VA+FSSRGPNR+
Sbjct  443   ADAHVLPAVEVSYVAGREIKRYFNTASTPMATILFKGTHIIRRSVAPAVASFSSRGPNRQ  502

Query  925   SPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPD  746
             SPGILKPDIIGPG+NILA WP  +DN  N    FN+ISGTSMSCPHLSGVAALLKS+HP+
Sbjct  503   SPGILKPDIIGPGLNILAGWPFPLDNSTN---LFNVISGTSMSCPHLSGVAALLKSTHPN  559

Query  745   WSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPED  566
             WSP  IKSA+MTTA   N    PI ++ L  A +F+ GAGH+NPSKA DPGLVYD  P+D
Sbjct  560   WSPEAIKSAIMTTATTFNMEGRPIVDETLHPADIFATGAGHINPSKAVDPGLVYDDGPQD  619

Query  565   YLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNYPSFSIILES--TAQTYTRTVTN  392
             Y+PYLCGL     ++ VI++ +VNCS++ SIP+ QLNYPS ++  +   T  + TRTV N
Sbjct  620   YIPYLCGLISNESQIEVIVKKKVNCSSIGSIPDYQLNYPSITVSFKPSVTNVSVTRTVKN  679

Query  391   VGEASSFY--TVEIFEPPGVKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMP-PVV  221
             VG A S Y   V+  + P V + V PREL F++ NQ  +Y V F   ++   S  P P  
Sbjct  680   VGPAKSRYQSVVDPIKGP-VSIGVYPRELVFTEANQTASYRVDF---TREVDSKAPSPYA  735

Query  220   QGALRWKSVKHHVRSPIA  167
             QGA+ W S +H VR+PIA
Sbjct  736   QGAITWVSARHSVRTPIA  753



>ref|XP_004249825.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=646

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/657 (56%), Positives = 475/657 (72%), Gaps = 24/657 (4%)
 Frame = -1

Query  2131  LSAEEVKEMGNKDGFISAAPERILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDS  1952
             LS++EVKEM  K GF+SA P++I  +HTTH+P FLGL QN+G W  S+ GKGVIIG+LD 
Sbjct  2     LSSDEVKEMEKKPGFVSARPQQIYQMHTTHAPSFLGLHQNVGLWNASNSGKGVIIGILDC  61

Query  1951  GIARDHPSFSDEGMPPPPARWKGVCELNFTA-CNNKVIGARSFSERERSVFdddghgtht  1775
             GI   HPSF+D GMP PP +WKG CE N T  CN K+IGAR+F + +    D+ GHGTHT
Sbjct  62    GIDPQHPSFNDNGMPKPPLKWKGKCEFNVTTYCNKKLIGARNFVQSDMFPTDNYGHGTHT  121

Query  1774  agtaaGNFVRGANVYGSANGTAAGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVD  1595
             + TAAGNFV GAN YG+ANGTA G+AP AH+A+YKVC+   C + +ILA +D AIEDGVD
Sbjct  122   SSTAAGNFVDGANFYGNANGTAVGIAPRAHVAMYKVCDAFYCLEYKILAGLDAAIEDGVD  181

Query  1594  Ilslslg--gmssSFHEDSIALGAYSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGA  1421
             ++S+S+G     S  ++D+IA+G YSAMEKGIFVS SAGN G  +G++ N APW+LTVGA
Sbjct  182   VISISIGFGHFRSPLYDDNIAIGTYSAMEKGIFVSCSAGNGGQRSGTVENGAPWILTVGA  241

Query  1420  STVDRKLSATVVLGNRQQFHGETAFQPKDFNSSLLSLVFPGQNTSDESSSPYCDSESLRN  1241
             ST DRK+SA  VLGN  ++ GE+ FQP +F+  LL LV  G N            E    
Sbjct  242   STTDRKISAVAVLGNGAEYEGESGFQPTNFSQKLLPLV-NGTNC-----------ELFNT  289

Query  1240  ADVRGKIVVCMTGGFLDRRGKGEAVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYA  1061
             +DV+GKIV+C +   L R+     VK   G GMIL+  +  G TT +    +P   I+Y 
Sbjct  290   SDVKGKIVLCDSSSVLSRKDIARIVKKTGGAGMILMNEKYAGSTTFSEHDAVPTTQISYN  349

Query  1060  DGQKILAYINATSNPMATFSFKGTITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVN  881
             DGQ+I  Y+ +TS P+AT +FKGT  GDK+APTVA FSSRGP  +S GILKPDIIGPGVN
Sbjct  350   DGQEITNYMKSTSTPVATITFKGTKIGDKHAPTVAYFSSRGPCMQSQGILKPDIIGPGVN  409

Query  880   ILAPWPTSVDNKPNSKSTFNIISGTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTAD  701
             ILA WP S+  +  S  TFNI+SGTSMSCP L+GVAALLKS+HPDWSPA IKSA+MTTAD
Sbjct  410   ILAAWPISIGGETTSL-TFNILSGTSMSCPLLAGVAALLKSAHPDWSPAAIKSAIMTTAD  468

Query  700   ILNHGQNPIQNQHLVTASVFSIGAGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREV  521
             I+N G +PIQ++ L  A + +IG+GHVNPS+ANDPGL+YD +PEDY+PYLCGLNYTN +V
Sbjct  469   IINLGNDPIQDETLEPADLLTIGSGHVNPSRANDPGLIYDIQPEDYIPYLCGLNYTNDQV  528

Query  520   GVILQHRVNCSAVISIPEAQLNYPSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPG  341
               I++ +V+C++  SIP+++LNYPSFSI  ES+ QTYTRTVTN+GEASS Y V++F   G
Sbjct  529   SAIVRKKVHCTS--SIPQSELNYPSFSIPTESSPQTYTRTVTNIGEASSSYIVKVFGLKG  586

Query  340   VKVNVEPRELQFSKVNQKLTYNVTFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPI  170
             ++V V+P+ L+F+ +NQK++YN+T         S      QG + W S +H VRSPI
Sbjct  587   IEVTVQPKILKFTALNQKMSYNLTVKSLDVTGHS------QGYIIWSSDRHSVRSPI  637



>gb|EYU29364.1| hypothetical protein MIMGU_mgv1a022867mg [Erythranthe guttata]
Length=672

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/695 (56%), Positives = 474/695 (68%), Gaps = 72/695 (10%)
 Frame = -1

Query  2242  LEHWYKSFLPTTV-AGGGYGESRMVFMYRNVMKGFAAKLSAEEVKEMGNKDGFISAAPER  2066
             LE +Y SFLPTT        + R+++ YR++  GFAAKLSA  V+ M  K GFISA PER
Sbjct  42    LETFYDSFLPTTSNVTNSDDQPRILYRYRHIFSGFAAKLSAAHVEAMRQKKGFISAQPER  101

Query  2065  ILPLHTTHSPGFLGLQQNMGFWRDSSYGKGVIIGVLDSGIARDHPSFSDEGMPPPPARWK  1886
             +L LHTTHSP FLGL QN G W+ S+YGKGVIIG++DS +A  HPSFSD GMPPPPA+WK
Sbjct  102   MLQLHTTHSPNFLGLNQNTGLWKKSNYGKGVIIGMVDSAVAASHPSFSDAGMPPPPAKWK  161

Query  1885  GVCE-LNFTACNNKVIGARSFSERERSVFdddghgthtagtaaGNFVRGANVYGSANGTA  1709
             GVC+      CNNK+IG R FS  +R     +GHGTHT  TAAGNFV GA  +G+ANGTA
Sbjct  162   GVCDSFGKPPCNNKLIGVR-FSLPQRPSRTTNGHGTHTMSTAAGNFVAGAGFFGNANGTA  220

Query  1708  AGVAPLAHLAIYKVCNEIGCSDSEILAAMDTAIEDGVDIlslslggmssSFHEDSIALGA  1529
             +GVAPLAHLAIY+                                               
Sbjct  221   SGVAPLAHLAIYE-----------------------------------------------  233

Query  1528  YSAMEKGIFVSASAGNEGPFNGSLSNEAPWMLTVGASTVDRKLSATVVLGNRQQFHGETA  1349
              SAM++GI VS SAGN G     L+N APW++TVGAST+DRK++AT+VLGN ++  GET 
Sbjct  234   -SAMQRGIVVSCSAGNSG--KSGLANGAPWIMTVGASTIDRKITATIVLGNGEEIEGETG  290

Query  1348  FQPKDFNSS-LLSLVFPGQNTSDESSSPYCDSESLRNADVRGKIVVCMTGGFLDRRGKGE  1172
                K F S+  L LV+P Q    +  S            VRGKIVVC  GG + R   GE
Sbjct  291   ---KGFPSTGKLELVYPRQFPPPKDDS------------VRGKIVVCEYGGGVSRIDIGE  335

Query  1171  AVKNASGRGMILIEPEEYGITTSATAHVLPAIDITYADGQKILAYINATSNPMATFSFKG  992
              VK+A G  MIL+  ++ G TT    HVLPA++I YADG KI AY+N+TSNP AT SFKG
Sbjct  336   VVKSAGGAAMILLNTKDLGDTTFDDPHVLPALEIGYADGLKIKAYLNSTSNPTATLSFKG  395

Query  991   TITGDKNAPTVAAFSSRGPNRESPGILKPDIIGPGVNILAPWPTSVDNKPNSKSTFNIIS  812
             T+ G   AP VAAFSSRGP+  SPGILKPDIIGPGVNILA WP S++N+ ++K  FNIIS
Sbjct  396   TVIGGGRAPVVAAFSSRGPSVPSPGILKPDIIGPGVNILAAWPVSLENRTDTKPAFNIIS  455

Query  811   GTSMSCPHLSGVAALLKSSHPDWSPAMIKSAMMTTADILNHGQNPIQNQHLVTASVFSIG  632
             GTSMSCPHLSGVAALLKS HPDWSPA+IKSA+MTTA  +N   NPI+++ L  A+VF IG
Sbjct  456   GTSMSCPHLSGVAALLKSVHPDWSPAVIKSAIMTTAYQVNLKGNPIEDEQLQPATVFDIG  515

Query  631   AGHVNPSKANDPGLVYDTKPEDYLPYLCGLNYTNREVGVILQHRVNCSAVISIPEAQLNY  452
             +GHVNPS+A+DPGLVYD  P+DY+PY+CGLNYTN++VG+I+   V+CS   SIPEAQLNY
Sbjct  516   SGHVNPSRADDPGLVYDILPDDYIPYVCGLNYTNQQVGIIVGRNVDCSKEKSIPEAQLNY  575

Query  451   PSFSIILESTAQTYTRTVTNVGEASSFYTVEIFEPPGVKVNVEPRELQFSKVNQKLTYNV  272
             PSFSII  S+ QTYTRT+TNVG+A+S Y VEI  P GV V VEP++L F K+  K +YNV
Sbjct  576   PSFSIIFGSSPQTYTRTLTNVGKANSSYDVEIVSPDGVIVKVEPKQLVFPKLGDKSSYNV  635

Query  271   TFSLSSKAARSNMPPVVQGALRWKSVKHHVRSPIA  167
             TF+ ++K A   M    QG +RW + ++ VRSPIA
Sbjct  636   TFTRTTKGA---MNGTTQGFIRWHNAEYSVRSPIA  667



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7446905696928