BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27266_g1_i1 len=1912 path=[1890:0-1911]

Length=1912
                                                                      Score     E

ref|XP_011090419.1|  PREDICTED: cytochrome P450 84A1-like               768   0.0      
emb|CDP01938.1|  unnamed protein product                                761   0.0      
ref|XP_009616607.1|  PREDICTED: cytochrome P450 84A1-like               758   0.0      
gb|AAT39511.1|  ferulate 5-hydroxylase                                  756   0.0      Camptotheca acuminata
gb|AAS92625.1|  coniferylalcohol 5-hydroxylase                          756   0.0      Centaurium erythraea
ref|XP_006340697.1|  PREDICTED: cytochrome P450 84A1-like               756   0.0      
ref|XP_011100951.1|  PREDICTED: cytochrome P450 84A1-like               753   0.0      
ref|XP_004232458.1|  PREDICTED: cytochrome P450 84A1                    753   0.0      
gb|AAD37433.1|AF150881_1  ferulate-5-hydroxylase                        753   0.0      Solanum lycopersicum x Solanum peruvianum
gb|AJD25204.1|  cytochrome P450 CYP84A60                                752   0.0      
gb|EYU31149.1|  hypothetical protein MIMGU_mgv1a004547mg                751   0.0      
ref|XP_006383141.1|  cytochrome P450 family protein                     749   0.0      
ref|XP_011028697.1|  PREDICTED: cytochrome P450 84A1-like               748   0.0      
ref|XP_007046764.1|  Ferulic acid 5-hydroxylase 1                       748   0.0      
ref|XP_007203643.1|  hypothetical protein PRUPE_ppa004260mg             747   0.0      
ref|XP_004287841.1|  PREDICTED: cytochrome P450 84A1-like               746   0.0      
gb|ACC63881.1|  coniferyl aldehyde 5-hydroxylase                        746   0.0      Populus trichocarpa [western balsam poplar]
gb|AGR44939.1|  ferulate 5-hydroxylase protein                          744   0.0      
emb|CAB65335.1|  ferulate-5-hydroxylase                                 741   0.0      Populus trichocarpa [western balsam poplar]
gb|ACU45738.1|  ferulate 5-hydroxylase                                  741   0.0      
ref|XP_009588689.1|  PREDICTED: cytochrome P450 84A1-like               739   0.0      
ref|XP_010033459.1|  PREDICTED: cytochrome P450 84A1-like               740   0.0      
ref|XP_009346304.1|  PREDICTED: cytochrome P450 84A1-like               739   0.0      
dbj|BAI47545.1|  coniferaldehyde 5-hydroxylase                          738   0.0      Eucalyptus globulus subsp. globulus
ref|XP_003517196.1|  PREDICTED: cytochrome P450 84A1-like               738   0.0      
gb|AEO21428.1|  coniferylaldehyde 5-hydroxylase                         737   0.0      
ref|XP_008241781.1|  PREDICTED: cytochrome P450 84A1                    737   0.0      
gb|KHG11872.1|  Cytochrome P450 protein                                 736   0.0      
emb|CAN73481.1|  hypothetical protein VITISV_026695                     735   0.0      Vitis vinifera
ref|XP_002272644.1|  PREDICTED: cytochrome P450 84A1                    736   0.0      Vitis vinifera
dbj|BAI47544.1|  coniferaldehyde 5-hydroxylase                          736   0.0      Eucalyptus globulus subsp. globulus
gb|AGJ84132.1|  putative ferulate 5-hydroxylase                         735   0.0      
ref|XP_009763889.1|  PREDICTED: cytochrome P450 84A1-like               735   0.0      
ref|XP_007157951.1|  hypothetical protein PHAVU_002G111900g             735   0.0      
ref|XP_009789924.1|  PREDICTED: cytochrome P450 84A1-like               732   0.0      
ref|XP_002310288.1|  cytochrome P450 family protein                     732   0.0      Populus trichocarpa [western balsam poplar]
gb|ACC63880.1|  coniferyl aldehyde 5-hydroxylase                        731   0.0      Populus trichocarpa [western balsam poplar]
gb|ABC69407.1|  CYP84A14v2                                              729   0.0      Nicotiana tabacum [American tobacco]
ref|XP_011025901.1|  PREDICTED: cytochrome P450 84A1-like               728   0.0      
gb|AFZ78544.1|  coniferaldehyde 5-hydroxylase                           728   0.0      
gb|AAD48912.1|AF139532_1  aldehyde 5-hydroxylase                        727   0.0      Liquidambar styraciflua [American sweet gum]
gb|AJD25205.1|  cytochrome P450 CYP84A61                                727   0.0      
ref|XP_010113394.1|  Cytochrome P450 84A1                               724   0.0      
gb|ABS53040.1|  Cald5H                                                  724   0.0      Leucaena leucocephala [cassie]
ref|XP_006466893.1|  PREDICTED: cytochrome P450 84A1-like               724   0.0      
ref|XP_006425557.1|  hypothetical protein CICLE_v10025382mg             724   0.0      
ref|XP_009338655.1|  PREDICTED: cytochrome P450 84A1-like               724   0.0      
gb|KDO71086.1|  hypothetical protein CISIN_1g010226mg                   723   0.0      
ref|XP_009378215.1|  PREDICTED: cytochrome P450 84A1-like               723   0.0      
ref|XP_010679832.1|  PREDICTED: cytochrome P450 84A1                    723   0.0      
gb|AAW50817.1|  ferulate-5-hydroxylase                                  722   0.0      Broussonetia papyrifera [aka]
ref|XP_003612110.1|  Cytochrome P450                                    720   0.0      
ref|XP_008372753.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    719   0.0      
ref|XP_008337913.1|  PREDICTED: cytochrome P450 84A1-like               719   0.0      
gb|ABB02162.1|  ferulate 5-hydroxylase                                  719   0.0      Medicago sativa [alfalfa]
gb|KHG17821.1|  Cytochrome P450 protein                                 718   0.0      
gb|ABC68398.1|  cytochrome P450 monooxygenase CYP84A16                  718   0.0      Glycine max [soybeans]
ref|XP_004512097.1|  PREDICTED: cytochrome P450 84A1-like               718   0.0      
gb|KDP46687.1|  hypothetical protein JCGZ_06475                         716   0.0      
gb|EYU24083.1|  hypothetical protein MIMGU_mgv1a025005mg                715   0.0      
gb|ABB02161.1|  ferulate 5-hydroxylase                                  715   0.0      Medicago sativa [alfalfa]
ref|XP_010029715.1|  PREDICTED: cytochrome P450 84A1-like               716   0.0      
gb|ACJ85732.1|  unknown                                                 714   0.0      Medicago truncatula
ref|XP_010263873.1|  PREDICTED: cytochrome P450 84A1-like               712   0.0      
ref|XP_003547953.1|  PREDICTED: cytochrome P450 84A1-like               712   0.0      
ref|XP_003537622.1|  PREDICTED: cytochrome P450 84A1-like               709   0.0      
ref|XP_010526785.1|  PREDICTED: cytochrome P450 84A1                    709   0.0      
ref|XP_006412017.1|  hypothetical protein EUTSA_v10024928mg             704   0.0      
dbj|BAM66576.1|  ferulate-5-hydroxylase                                 703   0.0      
ref|XP_009138414.1|  PREDICTED: cytochrome P450 84A1-like               701   0.0      
ref|XP_006283399.1|  hypothetical protein CARUB_v10004440mg             701   0.0      
gb|AAG14963.1|AF214009_1  cytochrome p450-dependent monooxygenase       697   0.0      Brassica napus [oilseed rape]
ref|XP_007156106.1|  hypothetical protein PHAVU_003G259200g             692   0.0      
gb|ABG73616.1|  ferulate-5-hydroxylase                                  692   0.0      Brassica napus [oilseed rape]
gb|AAG14961.1|AF214007_1  cytochrome p450-dependent monooxygenase       692   0.0      Brassica napus [oilseed rape]
ref|XP_002274902.1|  PREDICTED: cytochrome P450 84A1-like               692   0.0      Vitis vinifera
gb|AAG14962.1|AF214008_1  cytochrome p450-dependent monooxygenase       692   0.0      Brassica napus [oilseed rape]
ref|XP_010531068.1|  PREDICTED: cytochrome P450 84A1-like               690   0.0      
ref|XP_004134878.1|  PREDICTED: cytochrome P450 84A1-like               690   0.0      
gb|KFK30256.1|  hypothetical protein AALP_AA7G237600                    689   0.0      
ref|XP_009145966.1|  PREDICTED: cytochrome P450 84A1                    686   0.0      
ref|XP_010446813.1|  PREDICTED: cytochrome P450 84A1                    686   0.0      
gb|ABL07485.1|  cytochrome P450                                         686   0.0      Isatis tinctoria [woad]
emb|CAC26936.1|  ferulate-5-hydroxylase                                 685   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_195345.1|  ferulic acid 5-hydroxylase 1                          685   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CAC26932.1|  ferulate-5-hydroxylase                                 685   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867029.1|  ferulate-5-hydroxylase                             684   0.0      
ref|XP_010271496.1|  PREDICTED: cytochrome P450 84A1-like               682   0.0      
ref|XP_009378429.1|  PREDICTED: cytochrome P450 84A1-like               681   0.0      
ref|XP_004509332.1|  PREDICTED: cytochrome P450 84A1-like               681   0.0      
ref|XP_010437364.1|  PREDICTED: cytochrome P450 84A1-like               680   0.0      
ref|XP_010432189.1|  PREDICTED: cytochrome P450 84A1-like               679   0.0      
gb|AEV93477.1|  ferulate 5-hydroxylase                                  679   0.0      
gb|AID69231.1|  ferulate-5-hydroxylase                                  679   0.0      
ref|XP_007199246.1|  hypothetical protein PRUPE_ppa022388mg             679   0.0      
ref|XP_008236853.1|  PREDICTED: cytochrome P450 84A1-like               677   0.0      
emb|CAN74838.1|  hypothetical protein VITISV_002617                     676   0.0      Vitis vinifera
ref|XP_007042040.1|  Ferulic acid 5-hydroxylase 1                       676   0.0      
ref|XP_002275191.1|  PREDICTED: cytochrome P450 84A1-like               675   0.0      Vitis vinifera
emb|CAN60361.1|  hypothetical protein VITISV_036388                     675   0.0      Vitis vinifera
emb|CBI37999.3|  unnamed protein product                                676   0.0      
ref|XP_003607058.1|  Ferulate 5-hydroxylase                             666   0.0      
ref|XP_003629360.1|  Ferulate 5-hydroxylase                             665   0.0      
emb|CBI38004.3|  unnamed protein product                                662   0.0      
ref|XP_008440792.1|  PREDICTED: cytochrome P450 84A1-like               659   0.0      
gb|AGC29946.1|  CYP84A52                                                658   0.0      
ref|XP_006487364.1|  PREDICTED: cytochrome P450 84A1-like               658   0.0      
ref|XP_006423464.1|  hypothetical protein CICLE_v10028122mg             659   0.0      
gb|KDO49907.1|  hypothetical protein CISIN_1g009497mg                   658   0.0      
ref|XP_002313762.1|  cytochrome P450 family protein                     656   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004292435.1|  PREDICTED: cytochrome P450 84A1-like               654   0.0      
ref|XP_008391587.1|  PREDICTED: cytochrome P450 84A1-like               655   0.0      
ref|XP_011092843.1|  PREDICTED: cytochrome P450 84A1-like               655   0.0      
emb|CDX72582.1|  BnaC07g46040D                                          653   0.0      
ref|XP_010550444.1|  PREDICTED: cytochrome P450 84A1-like               653   0.0      
ref|XP_011047458.1|  PREDICTED: cytochrome P450 84A1-like               652   0.0      
ref|XP_006409197.1|  hypothetical protein EUTSA_v10022643mg             652   0.0      
ref|XP_010672525.1|  PREDICTED: cytochrome P450 84A1-like               642   0.0      
ref|XP_009384541.1|  PREDICTED: cytochrome P450 84A1-like               641   0.0      
gb|KFK40191.1|  hypothetical protein AALP_AA3G341800                    639   0.0      
ref|XP_009150750.1|  PREDICTED: cytochrome P450 84A1-like               638   0.0      
emb|CDX75562.1|  BnaA01g01400D                                          635   0.0      
ref|XP_010933756.1|  PREDICTED: cytochrome P450 84A1-like               635   0.0      
ref|XP_008448126.1|  PREDICTED: cytochrome P450 84A1-like               634   0.0      
ref|XP_007156105.1|  hypothetical protein PHAVU_003G259100g             632   0.0      
emb|CDX69213.1|  BnaC01g02400D                                          632   0.0      
ref|XP_006411697.1|  hypothetical protein EUTSA_v10027317mg             632   0.0      
ref|XP_010919382.1|  PREDICTED: cytochrome P450 84A1                    632   0.0      
gb|KHG17003.1|  Cytochrome P450 protein                                 632   0.0      
ref|XP_010467614.1|  PREDICTED: cytochrome P450 84A1-like               630   0.0      
ref|XP_004148555.1|  PREDICTED: cytochrome P450 84A1-like               630   0.0      
ref|XP_010919383.1|  PREDICTED: cytochrome P450 84A1-like               630   0.0      
ref|XP_004164845.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    629   0.0      
ref|XP_008791650.1|  PREDICTED: cytochrome P450 84A1-like               628   0.0      
ref|XP_002886147.1|  hypothetical protein ARALYDRAFT_319761             626   0.0      
ref|XP_010490429.1|  PREDICTED: cytochrome P450 84A1-like               625   0.0      
ref|XP_008796879.1|  PREDICTED: cytochrome P450 84A1-like               624   0.0      
emb|CDX72721.1|  BnaC07g47430D                                          623   0.0      
ref|XP_009384087.1|  PREDICTED: cytochrome P450 84A1-like               615   0.0      
ref|XP_009101907.1|  PREDICTED: cytochrome P450 84A1-like               615   0.0      
ref|XP_010527150.1|  PREDICTED: cytochrome P450 84A1-like               609   0.0      
ref|XP_002868879.1|  hypothetical protein ARALYDRAFT_912358             607   0.0      
dbj|BAO37287.1|  ferulate-5-hydroxylase                                 605   0.0      
ref|XP_010436199.1|  PREDICTED: cytochrome P450 84A1-like               605   0.0      
ref|XP_006829159.1|  hypothetical protein AMTR_s00001p00269980          605   0.0      
ref|XP_008453715.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    604   0.0      
ref|XP_010444886.1|  PREDICTED: cytochrome P450 84A1-like               603   0.0      
ref|XP_006661950.1|  PREDICTED: cytochrome P450 84A1-like               603   0.0      
ref|XP_010450987.1|  PREDICTED: cytochrome P450 84A1-like               602   0.0      
ref|XP_010490942.1|  PREDICTED: cytochrome P450 84A4-like               598   0.0      
emb|CDY29219.1|  BnaA06g25380D                                          596   0.0      
emb|CDY20907.1|  BnaC06g01270D                                          595   0.0      
ref|XP_010423591.1|  PREDICTED: cytochrome P450 84A4                    596   0.0      
ref|NP_196053.2|  cytochrome P450 84A4                                  595   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873144.1|  hypothetical protein ARALYDRAFT_487214             595   0.0      
ref|XP_003571958.1|  PREDICTED: cytochrome P450 84A1-like               592   0.0      
gb|AFZ78545.1|  coniferaldehyde 5-hydroxylase                           583   0.0      
ref|XP_010456392.1|  PREDICTED: cytochrome P450 84A4-like               585   0.0      
gb|AGR85825.1|  ferulate-5-hydroxylase                                  580   0.0      
ref|XP_006286043.1|  hypothetical protein CARUB_v10007572mg             584   0.0      
gb|EYU40391.1|  hypothetical protein MIMGU_mgv1a006014mg                578   0.0      
emb|CDP05522.1|  unnamed protein product                                576   0.0      
gb|ACG29306.1|  cytochrome P450 CYP84A33v1                              577   0.0      Zea mays [maize]
ref|XP_008664759.1|  PREDICTED: cytochrome P450 84A1-like               576   0.0      
ref|XP_009403617.1|  PREDICTED: cytochrome P450 84A1-like               575   0.0      
ref|XP_004982626.1|  PREDICTED: cytochrome P450 84A1-like               575   0.0      
emb|CBI17416.3|  unnamed protein product                                568   0.0      
gb|KFK24882.1|  hypothetical protein AALP_AA8G037000                    570   0.0      
ref|NP_001065043.1|  Os10g0512400                                       570   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ACG29763.1|  cytochrome P450 CYP84A34                                567   0.0      Zea mays [maize]
emb|CAC26920.1|  ferulate-5-hydroxylase                                 564   0.0      Arabidopsis lyrata subsp. petraea
gb|ABC59101.1|  cytochrome P450 monooxygenase CYP84A17                  558   0.0      Medicago truncatula
ref|XP_002464383.1|  hypothetical protein SORBIDRAFT_01g017270          561   0.0      Sorghum bicolor [broomcorn]
ref|XP_009411495.1|  PREDICTED: cytochrome P450 84A1                    559   0.0      
emb|CDY22397.1|  BnaA06g37190D                                          553   0.0      
ref|NP_001141478.1|  putative cytochrome P450 superfamily protein       553   0.0      Zea mays [maize]
gb|ACG29136.1|  cytochrome P450 CYP84A33v2                              552   0.0      Zea mays [maize]
emb|CDM81337.1|  unnamed protein product                                545   0.0      
ref|XP_008791649.1|  PREDICTED: cytochrome P450 84A1-like               523   4e-178   
gb|KFK40190.1|  hypothetical protein AALP_AA3G341800                    520   1e-176   
dbj|BAJ95312.1|  predicted protein                                      521   3e-175   
emb|CDM80985.1|  unnamed protein product                                517   7e-174   
ref|NP_001048732.1|  Os03g0112900                                       512   7e-172   Oryza sativa Japonica Group [Japonica rice]
gb|ABU53977.1|  coniferyl aldehyde 5 hydroxylase                        503   6e-171   Leucaena leucocephala [cassie]
ref|XP_002450575.1|  hypothetical protein SORBIDRAFT_05g007210          504   8e-169   Sorghum bicolor [broomcorn]
emb|CAE47054.1|  ferulate-5-hydroxylase                                 493   1e-166   Arabidopsis lyrata subsp. petraea
emb|CAE47052.1|  ferulate-5-hydroxylase                                 492   1e-166   Arabidopsis lyrata subsp. petraea
emb|CAE47053.1|  ferulate-5-hydroxylase                                 492   2e-166   Arabidopsis lyrata subsp. petraea
emb|CAE47051.1|  ferulate-5-hydroxylase                                 492   2e-166   Arabidopsis lyrata subsp. petraea
emb|CAE47043.1|  ferulate-5-hydroxylase                                 492   2e-166   Arabidopsis halleri subsp. halleri
ref|XP_002461434.1|  hypothetical protein SORBIDRAFT_02g002630          498   4e-166   Sorghum bicolor [broomcorn]
dbj|BAJ92908.1|  predicted protein                                      493   2e-164   
emb|CAE47058.1|  ferulate-5-hydroxylase                                 483   3e-163   Arabidopsis lyrata subsp. petraea
gb|AFK29443.1|  ferulate-5-hydroxylase                                  483   5e-163   
emb|CAE47057.1|  ferulate-5-hydroxylase                                 482   1e-162   Arabidopsis lyrata subsp. petraea
emb|CAE47059.1|  ferulate-5-hydroxylase                                 482   1e-162   Arabidopsis lyrata subsp. petraea
gb|EMT18242.1|  Cytochrome P450 84A1                                    488   1e-162   
gb|AFK29445.1|  ferulate-5-hydroxylase                                  481   3e-162   
gb|EPS73804.1|  ferulate 5-hydroxylase                                  479   2e-161   
ref|XP_003562202.1|  PREDICTED: cytochrome P450 84A1-like               462   3e-152   
ref|XP_003562195.1|  PREDICTED: cytochrome P450 84A1-like               451   1e-147   
gb|EEE65665.1|  hypothetical protein OsJ_21269                          430   2e-140   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001174774.1|  Os06g0349700                                       430   8e-140   
gb|EMT32980.1|  Cytochrome P450 84A1                                    426   1e-138   
gb|ADR31587.1|  cytochrome P450                                         409   6e-135   
gb|ADR31576.1|  cytochrome P450                                         409   6e-135   
emb|CDX72583.1|  BnaC07g46050D                                          390   4e-127   
ref|XP_004168594.1|  PREDICTED: cytochrome P450 84A1-like               382   4e-124   
gb|EMT06970.1|  Cytochrome P450 84A1                                    383   5e-124   
ref|XP_010099912.1|  Cytochrome P450 71A1                               386   3e-123   
ref|XP_002280620.1|  PREDICTED: cytochrome P450 CYP736A12               385   7e-123   Vitis vinifera
ref|XP_002305459.1|  cytochrome P450 family protein                     383   7e-123   Populus trichocarpa [western balsam poplar]
ref|XP_009336569.1|  PREDICTED: cytochrome P450 CYP736A12-like          383   1e-121   
ref|XP_010027781.1|  PREDICTED: cytochrome P450 CYP736A12-like          380   9e-121   
ref|XP_002276487.1|  PREDICTED: cytochrome P450 CYP736A12               378   4e-120   Vitis vinifera
ref|XP_010099909.1|  Flavonoid 3'-monooxygenase                         377   1e-119   
ref|XP_006428071.1|  hypothetical protein CICLE_v10027549mg             377   1e-119   
ref|XP_004301061.1|  PREDICTED: cytochrome P450 71A1-like               376   3e-119   
ref|XP_009337209.1|  PREDICTED: cytochrome P450 CYP736A12-like          376   3e-119   
gb|ACM89788.1|  cytochrome P450 monooxygenase CYP736B                   376   4e-119   Vitis arizonica x Vitis rupestris
ref|XP_009346975.1|  PREDICTED: cytochrome P450 CYP736A12-like          375   6e-119   
ref|XP_010027875.1|  PREDICTED: cytochrome P450 CYP736A12-like          375   7e-119   
gb|AAL66194.1|AF386512_1  cytochrome P450                               375   9e-119   Pyrus communis
ref|XP_010030392.1|  PREDICTED: cytochrome P450 CYP736A12-like          374   1e-118   
emb|CAD37906.1|  ferulate-5-hydroxylase                                 367   1e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004304846.1|  PREDICTED: cytochrome P450 71A1-like               374   2e-118   
gb|ACM89789.1|  cytochrome P450 monooxygenase CYP736B                   374   2e-118   Vitis arizonica x Vitis rupestris
emb|CAD37901.1|  ferulate-5-hydroxylase                                 367   2e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007208656.1|  hypothetical protein PRUPE_ppa022041mg             373   3e-118   
ref|XP_008440670.1|  PREDICTED: cytochrome P450 CYP736A12-like          373   3e-118   
gb|KDP39257.1|  hypothetical protein JCGZ_01014                         373   4e-118   
emb|CAD37925.1|  ferulate-5-hydroxylase                                 366   4e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002512986.1|  ferulate-5-hydroxylase, putative                   366   6e-118   Ricinus communis
ref|XP_002522721.1|  cytochrome P450, putative                          372   8e-118   Ricinus communis
gb|ACN40196.1|  unknown                                                 373   9e-118   Picea sitchensis
ref|XP_008227122.1|  PREDICTED: cytochrome P450 CYP736A12-like          371   2e-117   
ref|XP_002275826.1|  PREDICTED: cytochrome P450 CYP736A12               371   3e-117   Vitis vinifera
ref|XP_004153472.1|  PREDICTED: cytochrome P450 71B13-like              370   4e-117   
gb|EMS53883.1|  Cytochrome P450 84A1                                    365   4e-117   
ref|XP_011100886.1|  PREDICTED: cytochrome P450 CYP736A12-like          371   4e-117   
ref|XP_004299223.1|  PREDICTED: cytochrome P450 71A1-like               370   5e-117   
gb|AAF78943.1|AF267140_1  ferulate-5-hydroxylase                        363   7e-117   Arabidopsis thaliana [mouse-ear cress]
gb|KDP35215.1|  hypothetical protein JCGZ_09374                         370   9e-117   
ref|XP_009767392.1|  PREDICTED: cytochrome P450 CYP736A12-like          369   1e-116   
ref|XP_007159747.1|  hypothetical protein PHAVU_002G263700g             368   4e-116   
ref|XP_008234579.1|  PREDICTED: cytochrome P450 CYP736A12-like          367   5e-116   
ref|XP_008240284.1|  PREDICTED: cytochrome P450 CYP736A12-like          367   8e-116   
ref|XP_011013422.1|  PREDICTED: cytochrome P450 CYP736A12-like          367   8e-116   
gb|KHN20714.1|  Cytochrome P450 71D10                                   367   1e-115   
ref|XP_009608339.1|  PREDICTED: cytochrome P450 CYP736A12-like          366   2e-115   
ref|XP_004291274.1|  PREDICTED: cytochrome P450 71A1-like               366   3e-115   
ref|XP_011046010.1|  PREDICTED: flavonoid 3'-monooxygenase-like         366   3e-115   
ref|XP_007209911.1|  hypothetical protein PRUPE_ppa004377mg             366   4e-115   
ref|XP_010027782.1|  PREDICTED: cytochrome P450 CYP736A12-like          365   5e-115   
ref|XP_010061478.1|  PREDICTED: cytochrome P450 71D9-like               365   5e-115   
ref|XP_003531375.1|  PREDICTED: cytochrome P450 750A1-like isofor...    365   7e-115   
ref|XP_007214404.1|  hypothetical protein PRUPE_ppa026628mg             365   7e-115   
ref|XP_007221131.1|  hypothetical protein PRUPE_ppa019068mg             364   8e-115   
ref|XP_009337201.1|  PREDICTED: cytochrome P450 CYP736A12-like          365   1e-114   
ref|XP_004144428.1|  PREDICTED: flavonoid 3'-monooxygenase-like         364   1e-114   
ref|XP_010663579.1|  PREDICTED: cytochrome P450 CYP736A12-like          364   1e-114   
gb|KDO37182.1|  hypothetical protein CISIN_1g010699mg                   364   2e-114   
ref|XP_011025622.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    363   2e-114   
ref|XP_007048087.1|  Cytochrome P450                                    364   2e-114   
ref|XP_006428070.1|  hypothetical protein CICLE_v10026966mg             363   3e-114   
ref|XP_002310008.2|  hypothetical protein POPTR_0007s06270g             363   4e-114   Populus trichocarpa [western balsam poplar]
ref|XP_002532045.1|  flavonoid 3-hydroxylase, putative                  363   5e-114   Ricinus communis
ref|XP_003531374.1|  PREDICTED: cytochrome P450 71A1-like               362   5e-114   
gb|AFK79031.1|  cytochrome P450 CYP736A54                               362   5e-114   
gb|AES59944.2|  cytochrome P450 family 71 protein                       362   5e-114   
gb|AGE09596.1|  FAH1-like protein                                       352   6e-114   
ref|XP_004153471.1|  PREDICTED: cytochrome P450 71A1-like               362   6e-114   
ref|XP_002275691.1|  PREDICTED: cytochrome P450 CYP736A12 isoform X1    362   6e-114   Vitis vinifera
ref|XP_003596030.1|  Cytochrome P450                                    361   7e-114   
ref|XP_003589693.1|  Cytochrome P450                                    362   7e-114   
gb|ABN09213.1|  ferulate-5-hydroxylase                                  354   9e-114   Linum usitatissimum
ref|XP_008374739.1|  PREDICTED: cytochrome P450 CYP736A12-like          362   1e-113   
ref|XP_010541895.1|  PREDICTED: cytochrome P450 CYP736A12-like          362   1e-113   
gb|ABK25581.1|  unknown                                                 362   1e-113   Picea sitchensis
ref|XP_009337257.1|  PREDICTED: cytochrome P450 CYP736A12-like          362   1e-113   
ref|XP_010917481.1|  PREDICTED: cytochrome P450 71A1-like               362   1e-113   
ref|XP_008227118.1|  PREDICTED: cytochrome P450 CYP736A12-like          361   2e-113   
gb|KDP39254.1|  hypothetical protein JCGZ_01011                         362   2e-113   
gb|KHN29102.1|  Cytochrome P450 71A1                                    361   2e-113   
ref|XP_008779328.1|  PREDICTED: cytochrome P450 71A1-like               362   2e-113   
emb|CBI21489.3|  unnamed protein product                                363   2e-113   
ref|XP_002523467.1|  cytochrome P450, putative                          361   3e-113   
ref|XP_006452560.1|  hypothetical protein CICLE_v10008075mg             360   3e-113   
emb|CAN69565.1|  hypothetical protein VITISV_033534                     360   3e-113   
ref|XP_003630098.1|  Cytochrome P450                                    360   4e-113   
ref|XP_008374738.1|  PREDICTED: cytochrome P450 CYP736A12-like          361   4e-113   
ref|XP_004504031.1|  PREDICTED: cytochrome P450 750A1-like              360   4e-113   
ref|XP_007211842.1|  hypothetical protein PRUPE_ppa004664mg             360   4e-113   
ref|XP_003529194.2|  PREDICTED: cytochrome P450 71D11-like              361   4e-113   
ref|XP_008347028.1|  PREDICTED: cytochrome P450 CYP736A12-like          360   5e-113   
ref|XP_006452553.1|  hypothetical protein CICLE_v10008076mg             360   5e-113   
ref|XP_010094781.1|  Cytochrome P450 71D8                               360   6e-113   
ref|XP_007036492.1|  Cytochrome P450 superfamily protein                360   7e-113   
ref|XP_002511968.1|  flavonoid 3-hydroxylase, putative                  360   7e-113   
ref|XP_006428066.1|  hypothetical protein CICLE_v10025445mg             359   8e-113   
ref|XP_009617817.1|  PREDICTED: cytochrome P450 CYP736A12-like          359   1e-112   
ref|XP_006493867.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    358   2e-112   
ref|XP_008440671.1|  PREDICTED: cytochrome P450 CYP736A12-like          358   2e-112   
ref|XP_002310015.1|  cytochrome P450 family protein                     358   2e-112   
gb|EYU31074.1|  hypothetical protein MIMGU_mgv1a005121mg                358   2e-112   
ref|XP_011015794.1|  PREDICTED: flavonoid 3'-monooxygenase-like         358   2e-112   
ref|XP_002310011.2|  hypothetical protein POPTR_0007s06310g             358   3e-112   
ref|XP_006354722.1|  PREDICTED: cytochrome P450 71A1-like               358   3e-112   
ref|XP_008792870.1|  PREDICTED: cytochrome P450 71A1-like               358   3e-112   
ref|XP_010916488.1|  PREDICTED: cytochrome P450 71A1-like               359   3e-112   
emb|CDP01387.1|  unnamed protein product                                357   4e-112   
gb|KEH34013.1|  cytochrome P450 family 71 protein                       358   4e-112   
emb|CDP12933.1|  unnamed protein product                                357   4e-112   
gb|EYU24035.1|  hypothetical protein MIMGU_mgv1a020942mg                357   5e-112   
dbj|BAP15886.1|  cytochrome P450 71AU50                                 357   5e-112   
ref|XP_011035092.1|  PREDICTED: flavonoid 3'-monooxygenase-like         358   5e-112   
ref|XP_007213194.1|  hypothetical protein PRUPE_ppa026652mg             357   6e-112   
ref|XP_008364815.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    357   7e-112   
gb|AJD25258.1|  cytochrome P450 CYP736A123                              357   8e-112   
ref|XP_010644547.1|  PREDICTED: premnaspirodiene oxygenase-like         357   8e-112   
gb|KHG00772.1|  Cytochrome P450                                         357   9e-112   
ref|XP_008227094.1|  PREDICTED: cytochrome P450 CYP736A12-like          357   9e-112   
ref|XP_002310014.1|  cytochrome P450 family protein                     357   9e-112   
ref|XP_006367702.1|  PREDICTED: cytochrome P450 71A1-like               358   1e-111   
ref|XP_008360900.1|  PREDICTED: cytochrome P450 CYP736A12-like          357   1e-111   
gb|KEH34016.1|  cytochrome P450 family 71 protein                       355   1e-111   
ref|XP_004162312.1|  PREDICTED: cytochrome P450 750A1-like              356   1e-111   
ref|XP_009378500.1|  PREDICTED: cytochrome P450 CYP736A12-like          356   1e-111   
ref|XP_002310007.2|  cytochrome P450 family protein                     356   2e-111   
gb|EYU31078.1|  hypothetical protein MIMGU_mgv1a004963mg                356   2e-111   
ref|XP_004488758.1|  PREDICTED: cytochrome P450 71A1-like               356   2e-111   
ref|XP_007212357.1|  hypothetical protein PRUPE_ppa014572mg             356   2e-111   
ref|XP_009795889.1|  PREDICTED: premnaspirodiene oxygenase-like         356   2e-111   
ref|XP_007159750.1|  hypothetical protein PHAVU_002G263900g             355   2e-111   
ref|XP_003600328.1|  Cytochrome P450                                    355   2e-111   
ref|XP_010033730.1|  PREDICTED: cytochrome P450 71A1-like               356   2e-111   
ref|XP_008440675.1|  PREDICTED: cytochrome P450 CYP736A12-like          355   3e-111   
ref|XP_003532846.1|  PREDICTED: cytochrome P450 750A1-like              355   3e-111   
ref|XP_009337234.1|  PREDICTED: cytochrome P450 CYP736A12-like          355   3e-111   
ref|XP_010036875.1|  PREDICTED: cytochrome P450 CYP736A12-like          355   3e-111   
ref|XP_003600322.1|  Cytochrome P450                                    355   3e-111   
ref|XP_004303698.1|  PREDICTED: flavonoid 3'-monooxygenase-like         355   3e-111   
ref|XP_004143494.1|  PREDICTED: cytochrome P450 750A1-like              355   4e-111   
ref|XP_002324180.2|  hypothetical protein POPTR_0018s05370g             355   4e-111   
ref|XP_003528941.2|  PREDICTED: cytochrome P450 750A1-like              368   4e-111   
gb|AFO67627.1|  ferulate 5-hydroxylase                                  345   4e-111   
ref|XP_007153133.1|  hypothetical protein PHAVU_003G009500g             355   5e-111   
ref|XP_009594272.1|  PREDICTED: premnaspirodiene oxygenase-like         355   5e-111   
ref|XP_006381618.1|  hypothetical protein POPTR_0006s14370g             355   6e-111   
ref|XP_004165407.1|  PREDICTED: flavonoid 3'-monooxygenase-like         355   6e-111   
ref|XP_004253509.1|  PREDICTED: cytochrome P450 CYP736A12-like          354   7e-111   
ref|XP_004237615.1|  PREDICTED: cytochrome P450 CYP736A12-like          354   7e-111   
ref|XP_010932407.1|  PREDICTED: cytochrome P450 71A1-like               355   7e-111   
ref|XP_002310005.2|  hypothetical protein POPTR_0007s06240g             354   7e-111   
ref|XP_007214747.1|  hypothetical protein PRUPE_ppa025066mg             355   7e-111   
gb|AFO67633.1|  ferulate 5-hydroxylase                                  345   7e-111   
ref|XP_004231934.1|  PREDICTED: premnaspirodiene oxygenase-like         354   8e-111   
gb|KHN32022.1|  Cytochrome P450 71A1                                    355   8e-111   
gb|AFO67643.1|  ferulate 5-hydroxylase                                  345   8e-111   
ref|XP_003516583.1|  PREDICTED: cytochrome P450 71D8-like               354   9e-111   
ref|XP_009372714.1|  PREDICTED: cytochrome P450 CYP736A12-like          354   9e-111   
ref|XP_003600330.1|  Cytochrome P450                                    354   9e-111   
ref|XP_009782203.1|  PREDICTED: cytochrome P450 CYP736A12-like          354   9e-111   
gb|KEH34017.1|  cytochrome P450 family 71 protein                       354   1e-110   
ref|XP_009337218.1|  PREDICTED: cytochrome P450 CYP736A12-like          355   1e-110   
gb|AFO67629.1|  ferulate 5-hydroxylase                                  344   1e-110   
ref|XP_003524281.2|  PREDICTED: cytochrome P450 71A1-like isoform X1    353   1e-110   
gb|AFO67678.1|  ferulate 5-hydroxylase                                  344   1e-110   
gb|AFO67638.1|  ferulate 5-hydroxylase                                  344   1e-110   
gb|AFO67632.1|  ferulate 5-hydroxylase                                  344   1e-110   
ref|XP_004237368.1|  PREDICTED: cytochrome P450 CYP736A12-like          353   1e-110   
gb|AFO67668.1|  ferulate 5-hydroxylase                                  344   1e-110   
emb|CDP18035.1|  unnamed protein product                                353   1e-110   
gb|AFO67653.1|  ferulate 5-hydroxylase                                  344   1e-110   
gb|AFO67664.1|  ferulate 5-hydroxylase                                  344   2e-110   
ref|XP_002310016.2|  hypothetical protein POPTR_0007s06370g             353   2e-110   
ref|XP_006452551.1|  hypothetical protein CICLE_v10010293mg             353   2e-110   
ref|XP_009345818.1|  PREDICTED: cytochrome P450 71D9-like               353   2e-110   
ref|XP_008385983.1|  PREDICTED: cytochrome P450 CYP736A12-like          353   2e-110   
gb|AFO67628.1|  ferulate 5-hydroxylase                                  344   2e-110   
emb|CDP08465.1|  unnamed protein product                                353   2e-110   
ref|XP_011071969.1|  PREDICTED: flavonoid 3'-monooxygenase-like         353   2e-110   
gb|KDP20096.1|  hypothetical protein JCGZ_05865                         353   2e-110   
gb|AFO67652.1|  ferulate 5-hydroxylase                                  343   2e-110   
ref|XP_003611886.1|  Cytochrome P450                                    353   3e-110   
ref|XP_011100884.1|  PREDICTED: cytochrome P450 CYP736A12-like          353   3e-110   
ref|XP_004143566.1|  PREDICTED: cytochrome P450 750A1-like              353   3e-110   
ref|XP_004162326.1|  PREDICTED: cytochrome P450 750A1-like              353   3e-110   
ref|XP_010273844.1|  PREDICTED: cytochrome P450 71A1-like               353   3e-110   
gb|AFO67624.1|  ferulate 5-hydroxylase                                  343   3e-110   
gb|AFO67642.1|  ferulate 5-hydroxylase                                  343   3e-110   
ref|XP_006380462.1|  hypothetical protein POPTR_0007s06410g             352   4e-110   
gb|AFO67646.1|  ferulate 5-hydroxylase                                  343   4e-110   
gb|EYU31075.1|  hypothetical protein MIMGU_mgv1a005090mg                352   4e-110   
ref|XP_008460602.1|  PREDICTED: cytochrome P450 CYP736A12-like          353   4e-110   
ref|XP_008385982.1|  PREDICTED: cytochrome P450 CYP736A12-like          352   4e-110   
gb|AFO67649.1|  ferulate 5-hydroxylase                                  343   5e-110   
gb|AFO67683.1|  ferulate 5-hydroxylase                                  343   6e-110   
gb|AFO67660.1|  ferulate 5-hydroxylase                                  343   6e-110   
gb|KDP39256.1|  hypothetical protein JCGZ_01013                         352   6e-110   
ref|XP_011082374.1|  PREDICTED: premnaspirodiene oxygenase-like         352   6e-110   
ref|XP_009333922.1|  PREDICTED: cytochrome P450 71A3-like               352   6e-110   
ref|XP_004506686.1|  PREDICTED: cytochrome P450 71D9-like               352   7e-110   
gb|ABR16821.1|  unknown                                                 352   8e-110   
gb|AFO67682.1|  ferulate 5-hydroxylase                                  342   8e-110   
gb|AFO67673.1|  ferulate 5-hydroxylase                                  342   8e-110   
ref|XP_011073878.1|  PREDICTED: premnaspirodiene oxygenase-like         352   1e-109   
gb|AFO67679.1|  ferulate 5-hydroxylase                                  342   1e-109   
ref|XP_002275714.2|  PREDICTED: cytochrome P450 CYP736A12-like          351   1e-109   
ref|XP_004252382.1|  PREDICTED: cytochrome P450 CYP736A12               351   1e-109   
ref|XP_008228182.1|  PREDICTED: cytochrome P450 71A1-like               352   1e-109   
ref|XP_008227138.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    352   1e-109   
gb|AFO67665.1|  ferulate 5-hydroxylase                                  342   1e-109   
gb|AFO67626.1|  ferulate 5-hydroxylase                                  342   1e-109   
ref|XP_008460308.1|  PREDICTED: cytochrome P450 71A1-like               351   2e-109   
gb|KHG19088.1|  Premnaspirodiene oxygenase                              349   2e-109   
gb|AFO67670.1|  ferulate 5-hydroxylase                                  341   2e-109   
gb|EYU21317.1|  hypothetical protein MIMGU_mgv1a004638mg                351   2e-109   
gb|AFO67676.1|  ferulate 5-hydroxylase                                  341   2e-109   
ref|XP_008246006.1|  PREDICTED: cytochrome P450 71D11-like              351   2e-109   
ref|XP_004237505.1|  PREDICTED: cytochrome P450 CYP736A12-like          350   2e-109   
gb|AFO67625.1|  ferulate 5-hydroxylase                                  341   2e-109   
ref|XP_007020549.1|  Cytochrome P450                                    350   2e-109   
ref|XP_008385787.1|  PREDICTED: cytochrome P450 71D11-like              351   2e-109   
ref|XP_004237435.1|  PREDICTED: cytochrome P450 CYP736A12-like          350   3e-109   
ref|XP_004168558.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    350   3e-109   
ref|XP_007152786.1|  hypothetical protein PHAVU_004G159500g             350   3e-109   
ref|XP_007152790.1|  hypothetical protein PHAVU_004G159900g             350   3e-109   
gb|KHM99028.1|  Cytochrome P450 71D11                                   350   3e-109   
ref|XP_003600327.1|  Cytochrome P450                                    350   4e-109   
ref|XP_007036499.1|  Cytochrome P450, putative                          350   4e-109   
ref|XP_008342571.1|  PREDICTED: cytochrome P450 71A1-like               350   4e-109   
ref|XP_004506715.1|  PREDICTED: cytochrome P450 71D9-like               350   5e-109   
dbj|BAP94456.1|  flavonoid 3'-hydroxylas                                350   5e-109   
gb|AFO67640.1|  ferulate 5-hydroxylase                                  340   5e-109   
ref|XP_006605460.1|  PREDICTED: cytochrome P450 71D11-like              350   6e-109   
ref|XP_007020554.1|  Cytochrome P450 71D10, putative                    351   6e-109   
ref|XP_007036496.1|  Cytochrome P450 superfamily protein, putativ...    350   7e-109   
ref|XP_002516270.1|  flavonoid 3-hydroxylase, putative                  350   7e-109   
ref|XP_008463991.1|  PREDICTED: cytochrome P450 71A1-like               349   9e-109   
ref|XP_003611883.1|  Cytochrome P450                                    349   1e-108   
gb|AFO67647.1|  ferulate 5-hydroxylase                                  339   1e-108   
ref|XP_010911404.1|  PREDICTED: cytochrome P450 71A1-like               348   1e-108   
ref|XP_009337244.1|  PREDICTED: cytochrome P450 CYP736A12-like          349   1e-108   
gb|ADE80941.1|  flavonoid 3'-hydroxylase                                349   1e-108   
ref|XP_003534173.2|  PREDICTED: cytochrome P450 750A1-like              362   1e-108   
ref|XP_010064672.1|  PREDICTED: cytochrome P450 71D11-like              348   1e-108   
ref|XP_009615258.1|  PREDICTED: cytochrome P450 CYP736A12-like          348   1e-108   
ref|XP_008241040.1|  PREDICTED: cytochrome P450 93A3-like               349   1e-108   
ref|XP_004148565.1|  PREDICTED: flavonoid 3'-monooxygenase-like         349   1e-108   
ref|XP_008385924.1|  PREDICTED: premnaspirodiene oxygenase-like         348   2e-108   
gb|KDO58402.1|  hypothetical protein CISIN_1g010334mg                   348   2e-108   
ref|XP_006354704.1|  PREDICTED: cytochrome P450 750A1-like              348   2e-108   
ref|XP_006469495.1|  PREDICTED: premnaspirodiene oxygenase-like         348   2e-108   
emb|CAC24711.1|  cytochrome P450                                        348   2e-108   
ref|XP_006346619.1|  PREDICTED: cytochrome P450 71A1-like               348   2e-108   
ref|XP_003530005.1|  PREDICTED: cytochrome P450 71A1-like               348   2e-108   
ref|XP_003600339.1|  Cytochrome P450                                    348   2e-108   
ref|XP_009770688.1|  PREDICTED: cytochrome P450 CYP736A12-like          348   2e-108   
ref|XP_008393300.1|  PREDICTED: cytochrome P450 CYP736A12-like          348   2e-108   
ref|XP_007036495.1|  Cytochrome P450 superfamily protein, putativ...    349   2e-108   
ref|XP_007215252.1|  hypothetical protein PRUPE_ppa004436mg             348   3e-108   
ref|XP_006452554.1|  hypothetical protein CICLE_v10008073mg             348   3e-108   
ref|XP_003555570.2|  PREDICTED: cytochrome P450 71D11-like              349   3e-108   
ref|XP_007152789.1|  hypothetical protein PHAVU_004G159800g             347   3e-108   
ref|XP_008385725.1|  PREDICTED: cytochrome P450 CYP736A12-like          348   4e-108   
ref|XP_008440668.1|  PREDICTED: cytochrome P450 CYP736A12-like          348   4e-108   
ref|XP_006447873.1|  hypothetical protein CICLE_v10017726mg             347   4e-108   
ref|XP_002521317.1|  flavonoid 3-hydroxylase, putative                  347   5e-108   
ref|XP_004295868.1|  PREDICTED: cytochrome P450 71D11-like              347   5e-108   
ref|XP_004506687.1|  PREDICTED: cytochrome P450 71D11-like              347   6e-108   
gb|KEH34025.1|  cytochrome P450 family 71 protein                       347   6e-108   
ref|XP_006854384.1|  hypothetical protein AMTR_s00039p00175330          347   6e-108   
ref|XP_008778632.1|  PREDICTED: cytochrome P450 71A1-like               347   6e-108   
ref|XP_009607200.1|  PREDICTED: cytochrome P450 CYP736A12-like          346   8e-108   
ref|XP_008799325.1|  PREDICTED: cytochrome P450 71A1-like               347   8e-108   
ref|XP_008241038.1|  PREDICTED: cytochrome P450 93A3-like               347   8e-108   
gb|KHM99473.1|  Cytochrome P450 71D11                                   345   9e-108   
ref|XP_006363549.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    346   9e-108   
gb|KHG02344.1|  Cytochrome P450                                         347   9e-108   
ref|XP_004252295.1|  PREDICTED: cytochrome P450 CYP736A12-like          346   1e-107   
gb|ABK24537.1|  unknown                                                 347   1e-107   
ref|XP_009341741.1|  PREDICTED: cytochrome P450 71A1-like               346   1e-107   
dbj|BAM28971.1|  flavonoid 3'-hydroxylase                               347   1e-107   
ref|XP_010243385.1|  PREDICTED: cytochrome P450 71A1-like               347   1e-107   
ref|XP_006437055.1|  hypothetical protein CICLE_v10033811mg             346   1e-107   
ref|XP_006437054.1|  hypothetical protein CICLE_v10033669mg             346   2e-107   
ref|XP_011078642.1|  PREDICTED: cytochrome P450 CYP736A12-like          346   2e-107   
ref|XP_004237154.1|  PREDICTED: cytochrome P450 CYP736A12-like          346   2e-107   
ref|XP_004288989.1|  PREDICTED: flavonoid 3'-monooxygenase-like         346   2e-107   
ref|XP_006447773.1|  hypothetical protein CICLE_v10014947mg             346   2e-107   
ref|XP_009347232.1|  PREDICTED: cytochrome P450 71D11-like              346   2e-107   
ref|XP_009401319.1|  PREDICTED: cytochrome P450 71A1-like               346   2e-107   
ref|XP_007203496.1|  hypothetical protein PRUPE_ppa024661mg             346   2e-107   
gb|KDP26294.1|  hypothetical protein JCGZ_22279                         346   2e-107   
gb|KEH34024.1|  cytochrome P450 family 71 protein                       346   2e-107   
ref|XP_008242245.1|  PREDICTED: flavonoid 3'-monooxygenase-like         346   2e-107   
ref|XP_009770873.1|  PREDICTED: cytochrome P450 CYP736A12-like          345   2e-107   
ref|XP_011079634.1|  PREDICTED: cytochrome P450 71A1-like               345   2e-107   
ref|XP_010264863.1|  PREDICTED: cytochrome P450 71A1-like               345   2e-107   



>ref|XP_011090419.1| PREDICTED: cytochrome P450 84A1-like [Sesamum indicum]
Length=521

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/531 (75%), Positives = 458/531 (86%), Gaps = 13/531 (2%)
 Frame = +3

Query  93    MEKHNII-YVLEALEAHKHMVIYFVIPflflfllsrlrrKPYPPGPKGWPLIGNMNLMDH  269
             MEK  +I ++L+ALEA K ++I+F+I  LFLF+LSR RRKPYPPGP+GWP+IGNM ++D 
Sbjct  1     MEKKMMIAHLLQALEA-KPLLIFFIISLLFLFVLSRFRRKPYPPGPRGWPVIGNMGMIDQ  59

Query  270   YSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSY  449
              +HRGLA LA+QYGG+LHL +GSLHMV VS PD AR+VLQ QDNIFSNRPA VAI YL+Y
Sbjct  60    LTHRGLANLAKQYGGILHLGIGSLHMVAVSKPDVAREVLQLQDNIFSNRPATVAIRYLTY  119

Query  450   DRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGE  629
             DRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESWDSVRDEVD+ VRTVAM+ G+AVNIGE
Sbjct  120   DRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWDSVRDEVDDMVRTVAMSTGTAVNIGE  179

Query  630   LIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLN  809
             L+FGLTRNI YRAAFGSS  S +GQD+FIKILQEFSKLFGAFN++DF P+L   D QGLN
Sbjct  180   LVFGLTRNIIYRAAFGSS--SHEGQDDFIKILQEFSKLFGAFNIADFIPWLGWMDPQGLN  237

Query  810   PRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSD--EM  983
              RLAKARA+LDGFID IIDDH+    +RR    G   SG+  +TDMVDELLAFYSD  E 
Sbjct  238   SRLAKARASLDGFIDSIIDDHM----QRRKPEVG---SGEARDTDMVDELLAFYSDDDEA  290

Query  984   KVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELT  1163
             KV++++DLQ++IKLTRDNIK IIMDVMFGGTETVASAIEWAMAELM++PE+LK++QQEL 
Sbjct  291   KVSEAEDLQSSIKLTRDNIKAIIMDVMFGGTETVASAIEWAMAELMRSPEDLKKVQQELA  350

Query  1164  DTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAII  1343
             + VG  RKVEE D +KLT+L+CCLKE LRLHPPIPLLLHETA    V+GY+IPA+SR II
Sbjct  351   NVVGPTRKVEEPDFDKLTYLRCCLKEVLRLHPPIPLLLHETAADAVVSGYHIPAKSRVII  410

Query  1344  NAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFEL  1523
             NAWAI RD+ SWED DSF+P RFL EG PDFKGSNFEFIPFGSGRRSCPGMQLGLYA E+
Sbjct  411   NAWAIGRDQTSWEDADSFRPARFLGEGAPDFKGSNFEFIPFGSGRRSCPGMQLGLYALEV  470

Query  1524  AVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQLH  1676
             AVAHL HCFTWELPDGMKPS+LDM DVFGLTAP+ATRL  +P+PRL C+L+
Sbjct  471   AVAHLLHCFTWELPDGMKPSELDMGDVFGLTAPRATRLTAVPSPRLLCRLY  521



>emb|CDP01938.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/520 (75%), Positives = 445/520 (86%), Gaps = 10/520 (2%)
 Frame = +3

Query  117   VLEALEAHKHMVIYFVIPflflfllsrlrrKPYPPGPKGWPLIGNMNLMDHYSHRGLAKL  296
             +++AL+    M++  + P  FLFLLSR R KP+PPGP+G PLIGNM +++  SHRGLAKL
Sbjct  4     LVQALDTET-MLLLLIFPLAFLFLLSRFRSKPHPPGPRGLPLIGNMMMVNQLSHRGLAKL  62

Query  297   AEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMAFAH  476
             A QYGGL  LKMG L+MV VS P+ ARQVLQ QDNIFSNRPA +AISYL+YDRADMAFAH
Sbjct  63    AHQYGGLCRLKMGFLNMVAVSSPEAARQVLQVQDNIFSNRPATIAISYLTYDRADMAFAH  122

Query  477   YGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGLTRNI  656
             YGPFWRQMRKLCV+KLFSRRRAESWDSVRDEVD+ ++  A N GSA+N+GEL+FGLTRNI
Sbjct  123   YGPFWRQMRKLCVMKLFSRRRAESWDSVRDEVDDMIKYAASNTGSAINLGELVFGLTRNI  182

Query  657   TYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAA  836
              YRAAFGSS S  +GQDEFI+ILQEFS+LFGAFN++DF P+L   DLQGLN RL KARA+
Sbjct  183   IYRAAFGSSCS--EGQDEFIQILQEFSRLFGAFNLADFIPWLYWLDLQGLNKRLLKARAS  240

Query  837   LDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNA  1016
             LDGFID IIDDHI      +NK +G  V GD   +DMVDELLAFYS+E KV++S+DLQN+
Sbjct  241   LDGFIDSIIDDHI----EAKNKRNGLAVEGD---SDMVDELLAFYSEEAKVSESEDLQNS  293

Query  1017  IKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEE  1196
             IKLTRD+IK IIMDVMFGGTETVASAIEWAMAELMK+PE+LK++QQEL D VGL RKVEE
Sbjct  294   IKLTRDHIKAIIMDVMFGGTETVASAIEWAMAELMKSPEDLKKVQQELKDVVGLHRKVEE  353

Query  1197  SDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKNS  1376
             SDL+KLT+ KCC KE LRLHPPIPLLLHETAE  EV GY IPA+SR +INAWAI RDK+S
Sbjct  354   SDLDKLTYFKCCQKEVLRLHPPIPLLLHETAENAEVAGYQIPAKSRVLINAWAIGRDKDS  413

Query  1377  WEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTW  1556
             WED D FKP RFLK+G+PD+KGSNFEFIPFGSGRRSCPGMQLGLYA ++AVAHL HCFTW
Sbjct  414   WEDADKFKPSRFLKDGVPDYKGSNFEFIPFGSGRRSCPGMQLGLYALDMAVAHLLHCFTW  473

Query  1557  ELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQLH  1676
             ELPDGMKPS+LDMDDVFGLTAP+ATRLV +PTPRL C L+
Sbjct  474   ELPDGMKPSELDMDDVFGLTAPRATRLVAVPTPRLLCPLY  513



>ref|XP_009616607.1| PREDICTED: cytochrome P450 84A1-like [Nicotiana tomentosiformis]
Length=527

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/530 (73%), Positives = 450/530 (85%), Gaps = 6/530 (1%)
 Frame = +3

Query  87    LYMEKHNIIYVLEALEAHKHMVIYFVIPflflfllsrlrrKPYPPGPKGWPLIGNMNLMD  266
             + M+ +    +LEAL+A   M+ +FVIP  FLFLLS+ RRK  PPGP GWPLIGNM +MD
Sbjct  4     MIMQNNMSTTLLEALQAMP-MLFFFVIPLFFLFLLSKSRRKRLPPGPTGWPLIGNMMMMD  62

Query  267   HYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLS  446
               +HRGLAKLA++YGG+ HLKMG +H +VVSGPDEARQVLQ  D IFSNRPA VAISYL+
Sbjct  63    QLTHRGLAKLAQKYGGVFHLKMGYVHKIVVSGPDEARQVLQEHDVIFSNRPATVAISYLT  122

Query  447   YDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIG  626
             YDRADMAFA YG FWRQMRKLCV+KLFSR+RAESWDSVRDEVD+ VR V  N G+AVN+G
Sbjct  123   YDRADMAFADYGLFWRQMRKLCVMKLFSRKRAESWDSVRDEVDSMVRIVTTNTGTAVNLG  182

Query  627   ELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGL  806
             EL+F LTRNI YRAAFG+   S  GQDEFIKI+QEFSKLFGAFN++DF P+L     Q L
Sbjct  183   ELVFSLTRNIIYRAAFGTC--SEDGQDEFIKIMQEFSKLFGAFNIADFIPWLGWVGKQSL  240

Query  807   NPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMK  986
             N RLAKARA+LDGFID IIDDHI+  R++ N N   +  GD  ETDMVDELLAFYS+E K
Sbjct  241   NIRLAKARASLDGFIDSIIDDHIM--RKKANVNGRTDDGGD-RETDMVDELLAFYSEEAK  297

Query  987   VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTD  1166
             V +S+DLQNAI+LT+DNIK IIMDVMFGGTETVASAIEWAMAELM++P++LK++QQEL +
Sbjct  298   VTESEDLQNAIRLTKDNIKAIIMDVMFGGTETVASAIEWAMAELMRSPDDLKKVQQELAN  357

Query  1167  TVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIIN  1346
              VGL+RKVEESD EKLT+LKCCLKETLRLHPPIPLLLHETAE + V+GY+IPA+S  IIN
Sbjct  358   VVGLNRKVEESDFEKLTYLKCCLKETLRLHPPIPLLLHETAEESTVSGYHIPAKSHVIIN  417

Query  1347  AWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELA  1526
             ++AI RDKNSWEDP+++KP RFLKEG+PDFKG NFEF+PFGSGRRSCPGMQLGLYA E+A
Sbjct  418   SFAIGRDKNSWEDPETYKPSRFLKEGVPDFKGGNFEFLPFGSGRRSCPGMQLGLYALEMA  477

Query  1527  VAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQLH  1676
             VAHL HCFTWELPDGMKPS+L MDD+FGLTAP+A RLV +P+PRL C L+
Sbjct  478   VAHLLHCFTWELPDGMKPSELKMDDIFGLTAPRANRLVAVPSPRLLCPLY  527



>gb|AAT39511.1| ferulate 5-hydroxylase [Camptotheca acuminata]
Length=514

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/489 (77%), Positives = 422/489 (86%), Gaps = 11/489 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGP G PL+GNM +MD  +HRGLAKLA+QYGG+ HL+MG LHMV VS P+ ARQVLQ
Sbjct  37    PYPPGPNGLPLVGNMMMMDQLTHRGLAKLAKQYGGIFHLRMGFLHMVAVSSPEIARQVLQ  96

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPA +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDE
Sbjct  97    VQDNIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDE  156

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD+ VR V  + G +VNIGEL+F LTR+I YRAAFGSS  S +GQDEFIKILQEFSKLFG
Sbjct  157   VDSMVRVVVSHTGKSVNIGELVFSLTRDIIYRAAFGSS--SHEGQDEFIKILQEFSKLFG  214

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P L   D QGLN RL +ARA+LDGFID IIDDHI +  RRRN      V  D
Sbjct  215   AFNIADFIPGLGWVDPQGLNARLVQARASLDGFIDSIIDDHI-EKHRRRNV-----VDSD  268

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
             G   DMVD+LLAFYSDE KV +SDDLQNAI+LTRDNIK IIMDVMFGGTETVASAIEWAM
Sbjct  269   G---DMVDDLLAFYSDEAKVTESDDLQNAIRLTRDNIKAIIMDVMFGGTETVASAIEWAM  325

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AELMK+PE+LKR+QQEL + VGLDR++EESD +KLT+LKC LKETLRLHPPIPLLLHETA
Sbjct  326   AELMKSPEDLKRVQQELAEVVGLDRRLEESDFDKLTYLKCALKETLRLHPPIPLLLHETA  385

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E TEV GYYIPARSR +INAWAI RDKNSW++P++FKP RFLKEG+PDFKGSNFEFIPFG
Sbjct  386   EDTEVAGYYIPARSRVMINAWAIGRDKNSWDEPETFKPSRFLKEGVPDFKGSNFEFIPFG  445

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLYA E+AVAHL HCFTW LPDGMKPS+LD DDVFGLTAP+AT  V +P
Sbjct  446   SGRRSCPGMQLGLYALEMAVAHLLHCFTWTLPDGMKPSELDTDDVFGLTAPRATLFVAVP  505

Query  1650  TPRLNCQLH  1676
             +PRL C L+
Sbjct  506   SPRLLCPLY  514



>gb|AAS92625.1| coniferylalcohol 5-hydroxylase [Centaurium erythraea]
Length=519

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/490 (76%), Positives = 425/490 (87%), Gaps = 9/490 (2%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             KPYPPGP+GWPLIGNM +MD  +HRGLAKLA +YGG+LHL+MG +H V VS PD ARQVL
Sbjct  39    KPYPPGPRGWPLIGNMTMMDQLTHRGLAKLAGKYGGILHLRMGFVHTVAVSSPDIARQVL  98

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             Q QDNIFSNRPA +AISYL+YDRADMAFA YGPFWRQMRKLCV+KLFSR+RAESWDSVRD
Sbjct  99    QVQDNIFSNRPATIAISYLTYDRADMAFADYGPFWRQMRKLCVMKLFSRKRAESWDSVRD  158

Query  567   EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLF  746
             EV+     VA N GS VNIGE++FGLT+++ YRAAFG+S  S +GQDEFIKILQEFSKLF
Sbjct  159   EVERMTHIVATNIGSPVNIGEMVFGLTKDVIYRAAFGTS--SHEGQDEFIKILQEFSKLF  216

Query  747   GAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSG  926
             GAFN++DF P+LS FD QGLN RL KARA+LDGFID IIDDH+      R K   G  S 
Sbjct  217   GAFNLADFIPWLSWFDPQGLNKRLEKARASLDGFIDSIIDDHM-----NRKKIKSG--SN  269

Query  927   DGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
             D  E+DMVDELL F+SDE KV +S+DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA
Sbjct  270   DVVESDMVDELLVFFSDEAKVLESEDLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWA  329

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             MAELM+ P++LKR+QQEL+D VGL RKV+ESD EKLT+ KCCLKETLRLHPPIPLLLHET
Sbjct  330   MAELMRNPDDLKRVQQELSDVVGLHRKVQESDFEKLTYFKCCLKETLRLHPPIPLLLHET  389

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AEA+E+ GY IPA+SR +INAWAI RDK+SW+DPD+F+P RFL+EG+PDFKGSNFEFIPF
Sbjct  390   AEASEIAGYRIPAKSRVMINAWAIGRDKDSWKDPDTFRPARFLEEGVPDFKGSNFEFIPF  449

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLYA E+AVAHL HCFTWELPDGMKPS+LDM DVFGLTAP+A+RLV +
Sbjct  450   GSGRRSCPGMQLGLYALEVAVAHLLHCFTWELPDGMKPSELDMGDVFGLTAPRASRLVAV  509

Query  1647  PTPRLNCQLH  1676
             P+PRL C L+
Sbjct  510   PSPRLLCPLY  519



>ref|XP_006340697.1| PREDICTED: cytochrome P450 84A1-like [Solanum tuberosum]
Length=522

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/526 (74%), Positives = 450/526 (86%), Gaps = 10/526 (2%)
 Frame = +3

Query  93    MEKHNIIYVLEALEAHKHMVIYFVIPflflfllsrlrrKPYPPGPKGWPLIGNMNLMDHY  272
             M  +NI   LEAL+A   ++ +F+IP  FL+L S  RRK YPPGP GWPLIGNM +MD  
Sbjct  4     MVLNNINSTLEALQAQPMLLFFFIIPLFFLYLFSTSRRKRYPPGPLGWPLIGNMMMMDQL  63

Query  273   SHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYD  452
             +HRGLAKLA++YGG+ HLKMG +H +V+SGP+EARQVLQ QDNI+SNRP  VAISYL+YD
Sbjct  64    THRGLAKLAQKYGGVFHLKMGYVHKIVISGPEEARQVLQVQDNIYSNRPKTVAISYLTYD  123

Query  453   RADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGEL  632
             RADMAFA YGPFWRQMRKLCV+KLFSR+RAESWDSVRDEVD+ V+ V  N G+++N+GEL
Sbjct  124   RADMAFADYGPFWRQMRKLCVMKLFSRKRAESWDSVRDEVDSMVKIVTTNTGTSINLGEL  183

Query  633   IFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNP  812
             +F LTRNI YRAAFG+S  S +GQD+FIKILQEFSKLFGAFN++DF P+L     QGLN 
Sbjct  184   VFCLTRNIIYRAAFGTS--SDEGQDDFIKILQEFSKLFGAFNMADFIPWLRWIGQQGLNV  241

Query  813   RLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDG-AETDMVDELLAFYSDEMKV  989
             RLAKARA+LDGFID IIDDHI   R++ N      ++ DG  E+DMVDELLAFYS+E KV
Sbjct  242   RLAKARASLDGFIDSIIDDHI--ERKKANV-----INDDGYRESDMVDELLAFYSEETKV  294

Query  990   NDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDT  1169
             N+S+DLQN+I+LTRDNIK IIMDVMFGGTETVASAIEWAMAELMK+PE+LK++QQEL + 
Sbjct  295   NESEDLQNSIRLTRDNIKAIIMDVMFGGTETVASAIEWAMAELMKSPEDLKKVQQELANV  354

Query  1170  VGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINA  1349
             VGL+RKV+ESD EKLT+LKCCLKETLRLHPPIPLLLHETAE + V+GYYIPA+S  IIN+
Sbjct  355   VGLNRKVDESDFEKLTYLKCCLKETLRLHPPIPLLLHETAEESTVSGYYIPAKSHVIINS  414

Query  1350  WAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAV  1529
             +AI RDKNSWEDPDSFKP RFLKEG+PDFKG NFEF+PFGSGRRSCPGMQLGLYA E+AV
Sbjct  415   FAIGRDKNSWEDPDSFKPSRFLKEGVPDFKGGNFEFLPFGSGRRSCPGMQLGLYALEMAV  474

Query  1530  AHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNC  1667
             AHL HCFTWELPDGMKPS+L MDD+FGLTAP A RLV +PTPRL C
Sbjct  475   AHLLHCFTWELPDGMKPSELKMDDIFGLTAPLANRLVAVPTPRLLC  520



>ref|XP_011100951.1| PREDICTED: cytochrome P450 84A1-like [Sesamum indicum]
Length=520

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/530 (72%), Positives = 443/530 (84%), Gaps = 12/530 (2%)
 Frame = +3

Query  93    MEKHNIIYVLEALEAHKHMVIYFVIPflf--lfllsrlrrKPYPPGPKGWPLIGNMNLMD  266
             M    +I +L+ALEA K  +I+F+IP LF  +      RRKPYPPGPKGWP+IGNM +MD
Sbjct  1     MIDKKMITLLQALEA-KPFLIFFIIPLLFLFVLSRRSYRRKPYPPGPKGWPVIGNMPIMD  59

Query  267   HYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLS  446
               +HRGLAKLA+QYGG+ HL+MG LHMV +S PD ARQVLQ  DNIFSNRPAN+AISYL+
Sbjct  60    QLTHRGLAKLAKQYGGVFHLRMGFLHMVAISSPDAARQVLQVHDNIFSNRPANIAISYLT  119

Query  447   YDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIG  626
             YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESWDSVRDEVD  +R V  N G AVNIG
Sbjct  120   YDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWDSVRDEVDGMIRAVTENTGRAVNIG  179

Query  627   ELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGL  806
             EL+FGLT+NI YRAAFGSS  S + QDEFI+ILQEFSKLFGAFN++DF P+L   D QGL
Sbjct  180   ELVFGLTKNIIYRAAFGSS--SHEDQDEFIRILQEFSKLFGAFNIADFIPWLGWMDPQGL  237

Query  807   NPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMK  986
             N R+AKARA+LDGFID IIDDH+     ++ K+   E      + DMVDELLAFYSDE K
Sbjct  238   NKRMAKARASLDGFIDSIIDDHM-----QKKKSASDETVV--VDADMVDELLAFYSDEAK  290

Query  987   VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTD  1166
             V++S+DL N+IKLTR+NIK IIMDVMFGGTETVASAIEWAMAELM++PE+LK++Q+ELT+
Sbjct  291   VSESEDLHNSIKLTRNNIKAIIMDVMFGGTETVASAIEWAMAELMRSPEDLKKVQEELTN  350

Query  1167  TVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIIN  1346
              VGL R VEE D +KL +L+CCLKE LRLHPPIPLLLHETAE   V+GY+IPA+SR +IN
Sbjct  351   VVGLARNVEEPDFDKLIYLRCCLKEVLRLHPPIPLLLHETAEDATVSGYHIPAKSRVMIN  410

Query  1347  AWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELA  1526
             AWAI RD++SWED + FKP RFL++G+PDFKGSNFEFIPFGSGRRSCPGMQLGLYA E+A
Sbjct  411   AWAIGRDESSWEDAEEFKPARFLRDGVPDFKGSNFEFIPFGSGRRSCPGMQLGLYALEMA  470

Query  1527  VAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQLH  1676
             VAHL HCFTWELPDGMKP++LDM DVFGLTAP+A RLV +P PRL CQL+
Sbjct  471   VAHLLHCFTWELPDGMKPNELDMSDVFGLTAPRAERLVAVPRPRLLCQLY  520



>ref|XP_004232458.1| PREDICTED: cytochrome P450 84A1 [Solanum lycopersicum]
Length=524

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/529 (73%), Positives = 451/529 (85%), Gaps = 9/529 (2%)
 Frame = +3

Query  93    MEKHNIIYVLEALEAHKHMVIYFVIPflflfllsrlrrKPYPPGPKGWPLIGNMNLMDHY  272
             M  +NI  +LEAL+A+  ++ +F+IP  FL+L S  RRK YPPGP GWPLIGNM +MD  
Sbjct  4     MVLNNINSILEALQANPILIFFFIIPLFFLYLFSMSRRKRYPPGPLGWPLIGNMMIMDQL  63

Query  273   SHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYD  452
             +HRGLAKLA++YGG+ HLKMG +H +V+SGP+EARQVLQ QDNI+SNRP  VAISYL+YD
Sbjct  64    THRGLAKLAQKYGGVFHLKMGYVHKIVISGPEEARQVLQVQDNIYSNRPKTVAISYLTYD  123

Query  453   RADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGEL  632
             RADMAFA YGPFWRQMRKLCV+KLFSR+RAESWDSVRDEVD+ V+ V  N G+++N+GEL
Sbjct  124   RADMAFADYGPFWRQMRKLCVMKLFSRKRAESWDSVRDEVDSMVKIVTTNTGTSINLGEL  183

Query  633   IFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNP  812
             +F LTRNI YRAAFG+S  S +GQD+FIKILQEFSKLFGAFN++DF P+L     QGLN 
Sbjct  184   VFCLTRNIIYRAAFGTS--SDEGQDDFIKILQEFSKLFGAFNMADFIPWLGWIGKQGLNV  241

Query  813   RLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDG-AETDMVDELLAFYSDEMKV  989
             RLAKARA+LDGFID IIDDHI     R+   H   ++ DG  E+DMVDELLAFYS+E KV
Sbjct  242   RLAKARASLDGFIDTIIDDHI----ERKKAIH--VINDDGYRESDMVDELLAFYSEETKV  295

Query  990   NDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDT  1169
             N+S+DLQNAI+LTRDNIK IIMDVMFGGTETVASAIEWAMAELMK+PE+LK++QQEL + 
Sbjct  296   NESEDLQNAIRLTRDNIKAIIMDVMFGGTETVASAIEWAMAELMKSPEDLKKVQQELANV  355

Query  1170  VGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINA  1349
             VGL+RKV+ESD E LT+LKCCLKETLRLHPPIPLLLHETAE + V+GY+IPA S  IIN+
Sbjct  356   VGLNRKVDESDFENLTYLKCCLKETLRLHPPIPLLLHETAEESTVSGYFIPANSHVIINS  415

Query  1350  WAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAV  1529
             +AI RDKNSWEDPDSFKP RFLKEG+ DFKG NFEF+PFGSGRRSCPGMQLGLYA E+AV
Sbjct  416   FAIGRDKNSWEDPDSFKPSRFLKEGVADFKGGNFEFLPFGSGRRSCPGMQLGLYALEMAV  475

Query  1530  AHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQLH  1676
             AHL HCFTWELPDGMKPS+L MDD+FGLTAP A RLV +PTPRL C+L+
Sbjct  476   AHLLHCFTWELPDGMKPSELKMDDIFGLTAPLANRLVAVPTPRLLCKLY  524



>gb|AAD37433.1|AF150881_1 ferulate-5-hydroxylase [Solanum lycopersicum x Solanum peruvianum]
Length=521

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/529 (73%), Positives = 452/529 (85%), Gaps = 9/529 (2%)
 Frame = +3

Query  93    MEKHNIIYVLEALEAHKHMVIYFVIPflflfllsrlrrKPYPPGPKGWPLIGNMNLMDHY  272
             M  +NI  +LEAL+A+  ++ +F+IP  FL+L S  RRK YPPGP GWPLIGNM +MD  
Sbjct  1     MVLNNINSILEALQANPILIFFFIIPLFFLYLFSTSRRKRYPPGPLGWPLIGNMMIMDQL  60

Query  273   SHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYD  452
             +HRGLAKLA++YGG+ HLKMG +H +V+SGP+EARQVLQ QDNI+SNRP  VAISYL+YD
Sbjct  61    THRGLAKLAQKYGGVFHLKMGYVHKIVISGPEEARQVLQVQDNIYSNRPKTVAISYLTYD  120

Query  453   RADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGEL  632
             RADMAFA YGPFWRQMRKLCV+KLFSR+RAESWDSVRDEVD+ V+ V  N G+++N+GEL
Sbjct  121   RADMAFADYGPFWRQMRKLCVMKLFSRKRAESWDSVRDEVDSMVKIVTTNAGTSINLGEL  180

Query  633   IFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNP  812
             +F LTRNI YRAAFG+S  S +GQD+FIKILQEFSKLFGAFN++DF P+L     QGLN 
Sbjct  181   VFCLTRNIIYRAAFGTS--SDEGQDDFIKILQEFSKLFGAFNMADFIPWLGWIGKQGLNV  238

Query  813   RLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDG-AETDMVDELLAFYSDEMKV  989
             RLAKARA+LDGFID IIDDHI     R+   H   ++ DG  E+DMVDELLAFYS+E KV
Sbjct  239   RLAKARASLDGFIDTIIDDHI----ERKKAIH--VINDDGYRESDMVDELLAFYSEETKV  292

Query  990   NDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDT  1169
             N+S+DLQNAI+LTRDNIK IIMDVMFGGTETVASAIEWAMAELMK+PE+LK++QQEL + 
Sbjct  293   NESEDLQNAIRLTRDNIKAIIMDVMFGGTETVASAIEWAMAELMKSPEDLKKVQQELANV  352

Query  1170  VGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINA  1349
             VGL+RKV+ESD E LT+LKCCLKETLRLHPPIPLLLHETAE + V+GYYIPA S  IIN+
Sbjct  353   VGLNRKVDESDFENLTYLKCCLKETLRLHPPIPLLLHETAEESTVSGYYIPANSHVIINS  412

Query  1350  WAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAV  1529
             +AI RDKNSWEDPDSFKP RFLKEG+ DFKG NFEF+PFGSGRRSCPGMQLGLYA E+AV
Sbjct  413   FAIGRDKNSWEDPDSFKPSRFLKEGVADFKGGNFEFLPFGSGRRSCPGMQLGLYALEMAV  472

Query  1530  AHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQLH  1676
             AHL HCFTWELPDGMKPS+L+MDD+FGLTAP A RLV +PTPRL C+++
Sbjct  473   AHLLHCFTWELPDGMKPSELNMDDMFGLTAPLANRLVAVPTPRLLCEIY  521



>gb|AJD25204.1| cytochrome P450 CYP84A60 [Salvia miltiorrhiza]
Length=517

 Score =   752 bits (1942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/490 (75%), Positives = 418/490 (85%), Gaps = 10/490 (2%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K YPPGP GWP+IGNM LM   +HRGLA+LA++YGG+LHL+MG LHMV VS PD ARQVL
Sbjct  38    KRYPPGPPGWPVIGNMGLMGQLTHRGLARLAKKYGGILHLRMGFLHMVAVSSPDAARQVL  97

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             Q QDNIFSNRPA +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESWDSVRD
Sbjct  98    QAQDNIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKLCVIKLFSRKRAESWDSVRD  157

Query  567   EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLF  746
             EVD+ VR VA + G+ VNIGEL+FGLTRNITYRAAFGSS  S +GQDEFI+ILQE SKLF
Sbjct  158   EVDDMVRAVATSSGTVVNIGELVFGLTRNITYRAAFGSS--SHEGQDEFIQILQEISKLF  215

Query  747   GAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSG  926
             GAFN+SDF PFL   D QG+N RL K RA LDGFID IIDDH+ + R         E   
Sbjct  216   GAFNISDFIPFLGWIDPQGINGRLIKVRAQLDGFIDTIIDDHMQKAR--------PEEGT  267

Query  927   DGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
             +  E+DMVDELLAFYSDE KV++S+DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA
Sbjct  268   EPVESDMVDELLAFYSDEAKVSESEDLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWA  327

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             M ELM++PE+LKR+QQEL D VGL RKVEE D EKL+FL+CCLKE LRLHPPIPLLLHET
Sbjct  328   MTELMRSPEDLKRVQQELADVVGLARKVEEPDFEKLSFLRCCLKEVLRLHPPIPLLLHET  387

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AE   V+GY+IPA+SR +INAWAI RD+ +WED ++F P RFL+EG  DFKG NFEFIPF
Sbjct  388   AEDAVVSGYHIPAKSRVMINAWAIGRDEGAWEDAEAFNPSRFLREGAADFKGGNFEFIPF  447

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLYA E+AVAHL HCFTWELPDGMKP+++DMDDVFGLTAP+ATRL+ +
Sbjct  448   GSGRRSCPGMQLGLYALEVAVAHLLHCFTWELPDGMKPAEMDMDDVFGLTAPRATRLMAV  507

Query  1647  PTPRLNCQLH  1676
             PTPRL CQL+
Sbjct  508   PTPRLLCQLY  517



>gb|EYU31149.1| hypothetical protein MIMGU_mgv1a004547mg [Erythranthe guttata]
Length=521

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/491 (75%), Positives = 424/491 (86%), Gaps = 9/491 (2%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             KPYPPGP+GWP+IGNM L    +HRGLA+LAE+YGG+ HL++G LH+V VS PDEARQVL
Sbjct  39    KPYPPGPRGWPVIGNMGLTGQLTHRGLARLAEKYGGIFHLRIGFLHIVAVSSPDEARQVL  98

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             Q QD IFSNRPAN+AISYL+YDRADMAFAHYGPFWRQMRKLCVVKLFSR+RAESWDSVRD
Sbjct  99    QAQDGIFSNRPANIAISYLTYDRADMAFAHYGPFWRQMRKLCVVKLFSRKRAESWDSVRD  158

Query  567   EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLF  746
             EVD  +R VA+     VN+GEL+FGLTRNI YRAAFG+S  S +GQD FI+ILQEFSKLF
Sbjct  159   EVDGMIRAVAVGSAGPVNVGELVFGLTRNIIYRAAFGTS--SHEGQDNFIEILQEFSKLF  216

Query  747   GAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSG  926
             GAFN++DF PFL   D QGLN RL  ARA+LDGFID IID+H+ + ++  N NHG EV  
Sbjct  217   GAFNIADFIPFLGWMDPQGLNKRLVNARASLDGFIDSIIDEHMHKKKKPEN-NHGPEV--  273

Query  927   DGAETDMVDELLAFYSD-EMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEW  1103
                ++DMVDELLAFYSD E KV++++DL N+IKLTRDNIK IIMDVMFGGTETVASAIEW
Sbjct  274   ---DSDMVDELLAFYSDDETKVSEAEDLHNSIKLTRDNIKAIIMDVMFGGTETVASAIEW  330

Query  1104  AMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhE  1283
             AMAELM++P++LKR+QQEL   VG  RKVEESD EKLT+L+CCLKE LRLHPPIPLLLHE
Sbjct  331   AMAELMRSPQDLKRVQQELMTVVGPARKVEESDFEKLTYLRCCLKEVLRLHPPIPLLLHE  390

Query  1284  TAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIP  1463
             T+E   V+GY++PARSR +INAWAI RDK++WED DSFKP+RFLK+G+PDFKGSNFEFIP
Sbjct  391   TSEDAVVSGYHVPARSRVMINAWAIGRDKSAWEDADSFKPERFLKDGVPDFKGSNFEFIP  450

Query  1464  FGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVV  1643
             FGSGRRSCPGMQLGLYA E+AVAHL HCFTWELPDGMKP++LDMDDVFGLTAP+ATRL  
Sbjct  451   FGSGRRSCPGMQLGLYALEMAVAHLLHCFTWELPDGMKPAELDMDDVFGLTAPRATRLTA  510

Query  1644  IPTPRLNCQLH  1676
             +PTPRL C L+
Sbjct  511   VPTPRLLCPLY  521



>ref|XP_006383141.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP60938.1| cytochrome P450 family protein [Populus trichocarpa]
Length=513

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/488 (75%), Positives = 420/488 (86%), Gaps = 11/488 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG+PLIG+M+LMD  +HRGLAKLA+QYGGL H++MG LHMV VS P+ ARQVLQ
Sbjct  37    PYPPGPKGFPLIGSMHLMDQLTHRGLAKLAKQYGGLFHMRMGYLHMVAVSSPEVARQVLQ  96

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPAN+AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDE
Sbjct  97    VQDNIFSNRPANIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDE  156

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD+ V+TV  N G  VN+GELIF LT NITYRAAFG+     +GQDEFIKILQEFSKLFG
Sbjct  157   VDSMVKTVESNIGKPVNVGELIFTLTMNITYRAAFGAK---NEGQDEFIKILQEFSKLFG  213

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN+SDF P+L   D QGL  RL KAR ALD FID IIDDHI   ++R+  N+  E    
Sbjct  214   AFNISDFIPWLGWIDPQGLTARLVKARKALDKFIDHIIDDHI---QKRKQNNYSEE----  266

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
              AETDMVD++L FYS+E KVN+SDDLQNAIKLTRDNIK IIMDVMFGGTETVASAIEWAM
Sbjct  267   -AETDMVDDMLTFYSEETKVNESDDLQNAIKLTRDNIKAIIMDVMFGGTETVASAIEWAM  325

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AEL+K+PE++KR+QQEL D VGL+R+VEESD +KLTF KC LKETLRLHPPIPLLLHET+
Sbjct  326   AELLKSPEDIKRVQQELADVVGLERRVEESDFDKLTFFKCTLKETLRLHPPIPLLLHETS  385

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E  EV GYY+P ++R +INA+AI RDKNSWEDPDSFKP RFL+ G+PDFKG++FEFIPFG
Sbjct  386   EDAEVAGYYVPKKTRVMINAYAIGRDKNSWEDPDSFKPSRFLEPGVPDFKGNHFEFIPFG  445

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLYA +LAVAHL HCFTWELPDGMKPS+LDM D+FGLTAP+ATRLV +P
Sbjct  446   SGRRSCPGMQLGLYALDLAVAHLLHCFTWELPDGMKPSELDMTDMFGLTAPRATRLVAVP  505

Query  1650  TPRLNCQL  1673
               R+ C L
Sbjct  506   RKRVVCPL  513



>ref|XP_011028697.1| PREDICTED: cytochrome P450 84A1-like [Populus euphratica]
Length=514

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/488 (75%), Positives = 420/488 (86%), Gaps = 11/488 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG+PLIG+M+LMD  +HRGLAKLA+QYGGL H++MG LHMV VS P+ ARQVLQ
Sbjct  38    PYPPGPKGFPLIGSMHLMDQLTHRGLAKLAKQYGGLFHMRMGYLHMVTVSSPEIARQVLQ  97

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPAN+AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDE
Sbjct  98    VQDNIFSNRPANIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDE  157

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD+ V+T+  N G  VN+GELIF LT NITYRAAFG+     +GQDEFIKILQEFSKLFG
Sbjct  158   VDSMVKTIESNIGKPVNVGELIFTLTMNITYRAAFGAI---NEGQDEFIKILQEFSKLFG  214

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN+SDF P+L   D QGL  RL KAR ALD FID IIDDHI   ++R+  N+  E    
Sbjct  215   AFNISDFIPWLGWIDPQGLTARLVKARRALDKFIDHIIDDHI---QKRKQNNYSEE----  267

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
              AETDMVD++L FYS+E KVN+SDDLQNAIKLTRDNIK IIMDVMFGGTETVASAIEWAM
Sbjct  268   -AETDMVDDMLTFYSEETKVNESDDLQNAIKLTRDNIKAIIMDVMFGGTETVASAIEWAM  326

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AEL+K+PE++KR+QQEL D VGL R+VEESD +KLTFLKC LKETLRLHPPIPLLLHET+
Sbjct  327   AELLKSPEDIKRVQQELADVVGLQRRVEESDFDKLTFLKCTLKETLRLHPPIPLLLHETS  386

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E  EV GYY+P ++R +INA+AI RDKNSWEDPDSFKP RFL+ G+PDFKG++FEFIPFG
Sbjct  387   EDAEVAGYYVPKKTRVMINAYAIGRDKNSWEDPDSFKPSRFLEPGVPDFKGNHFEFIPFG  446

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLYA +LAVAHL HCFTWELPDGMKPS+LDM D+FGLTAP+ATRLV +P
Sbjct  447   SGRRSCPGMQLGLYALDLAVAHLLHCFTWELPDGMKPSELDMTDMFGLTAPRATRLVAVP  506

Query  1650  TPRLNCQL  1673
               R+ C L
Sbjct  507   RKRVVCPL  514



>ref|XP_007046764.1| Ferulic acid 5-hydroxylase 1 [Theobroma cacao]
 gb|EOX90921.1| Ferulic acid 5-hydroxylase 1 [Theobroma cacao]
Length=519

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/489 (75%), Positives = 419/489 (86%), Gaps = 10/489 (2%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             KP+PPGPKG PLIGNM +MD  +HRGLA+LA++YGG+ HLKMG LHMV +S P+ ARQVL
Sbjct  40    KPFPPGPKGLPLIGNMMMMDQLTHRGLARLAQKYGGIFHLKMGFLHMVAISNPEMARQVL  99

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             Q QDNIFSNRPA +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRD
Sbjct  100   QVQDNIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRD  159

Query  567   EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLF  746
             EV+  ++ V+ N G A+N+GELIF LT+NITYRAAFG S  S +GQ+EFIKILQEFSKLF
Sbjct  160   EVETLIKAVSANTGKAINVGELIFNLTKNITYRAAFGCS--SQEGQEEFIKILQEFSKLF  217

Query  747   GAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSG  926
             GAFN++DF P+L   D QGLN RL  AR ALD FID IIDDHI    ++R +N G     
Sbjct  218   GAFNIADFIPWLGWADPQGLNTRLENARHALDKFIDTIIDDHI----QKRKRNDGC----  269

Query  927   DGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
             D  +TDMVD+LLAFYS+E KVN+S+DLQN+IK TRDNIK IIMDVMFGGTETVASAIEWA
Sbjct  270   DEGDTDMVDDLLAFYSEEAKVNESEDLQNSIKFTRDNIKAIIMDVMFGGTETVASAIEWA  329

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             + ELM++PE+LKR+QQEL D VGLDR+VEESD +KLTFLKC LKETLRLHPPIPLLLHET
Sbjct  330   LTELMRSPEDLKRVQQELADVVGLDRQVEESDFDKLTFLKCTLKETLRLHPPIPLLLHET  389

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AE   V GY IPA+SR +INAWAI RDKNSWEDPD+FKP RFLKEG+PDFKGSNFEFIPF
Sbjct  390   AEDAVVAGYQIPAKSRVMINAWAIGRDKNSWEDPDTFKPSRFLKEGVPDFKGSNFEFIPF  449

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLYA +LAVAH+ HCFTWELPDGMKPS+LDM DVFGLTAP+ATRL+ I
Sbjct  450   GSGRRSCPGMQLGLYALDLAVAHMLHCFTWELPDGMKPSELDMSDVFGLTAPRATRLIAI  509

Query  1647  PTPRLNCQL  1673
             P  RL C L
Sbjct  510   PKKRLLCPL  518



>ref|XP_007203643.1| hypothetical protein PRUPE_ppa004260mg [Prunus persica]
 gb|EMJ04842.1| hypothetical protein PRUPE_ppa004260mg [Prunus persica]
Length=519

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/524 (72%), Positives = 438/524 (84%), Gaps = 13/524 (2%)
 Frame = +3

Query  117   VLEALEAHKHMVIYFVIP----flflfllsrlrrKPYPPGPKGWPLIGNMNLMDHYSHRG  284
             +L+AL+  + M ++F+IP       +FL    RR PYPPGP G P+IGNM +MD  +HRG
Sbjct  4     LLQALQPLQPMTLFFIIPFLFLSGLVFLYRSRRRSPYPPGPTGLPIIGNMLMMDQLTHRG  63

Query  285   LAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADM  464
             LAKLA+QYGG+ HL+MG LHMV +S PD ARQVLQ QDNIFSNRPA +AISYL+YDRADM
Sbjct  64    LAKLAKQYGGIFHLRMGFLHMVGISNPDVARQVLQVQDNIFSNRPATIAISYLTYDRADM  123

Query  465   AFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGL  644
             AFAHYGPFWRQMRKLCV+KLFSR+RAESWD+VRDEVD  VRTVA+  GSAVNIGEL+F L
Sbjct  124   AFAHYGPFWRQMRKLCVMKLFSRKRAESWDAVRDEVDTAVRTVAVQAGSAVNIGELVFSL  183

Query  645   TRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAK  824
             T+NI YRAAFG+S  S +GQDEFI ILQEFSKLFGAFN++DF P L   D QGLN RLA+
Sbjct  184   TKNIIYRAAFGTS--SEEGQDEFIGILQEFSKLFGAFNIADFIPCLGWVDPQGLNNRLAR  241

Query  825   ARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVNDSDD  1004
             AR +LD FID IIDDHI + ++++++        +G ETDMVDELLAFYSDE KVN+SDD
Sbjct  242   ARQSLDRFIDSIIDDHIQKKKKKKSEG------SNGGETDMVDELLAFYSDEAKVNESDD  295

Query  1005  -LQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLD  1181
              LQNAI LTRDNIK IIMDVMFGGTETVASAIEWAMAELM+ PE LKR+QQEL D VGLD
Sbjct  296   NLQNAINLTRDNIKAIIMDVMFGGTETVASAIEWAMAELMRNPEELKRVQQELADVVGLD  355

Query  1182  RKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIA  1361
             R+ EE D EKLT+LKC LKETLRLHPPIPLLLHETAE  EV GY+IP +SR +IN+WAI 
Sbjct  356   RRPEEGDFEKLTYLKCALKETLRLHPPIPLLLHETAEDAEVAGYHIPKKSRVMINSWAIG  415

Query  1362  RDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLF  1541
             RDK+SWED +SFKP RFLKEG+PDFKGSNFEF+PFGSGRRSCPGMQLGLY+ ELAV HL 
Sbjct  416   RDKDSWEDAESFKPSRFLKEGVPDFKGSNFEFLPFGSGRRSCPGMQLGLYSLELAVGHLL  475

Query  1542  HCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             HCFTWELPDGMKPS+LDM+DVFGLTAP+A+RL+ +P+ R+ C L
Sbjct  476   HCFTWELPDGMKPSELDMNDVFGLTAPRASRLIAVPSKRVVCPL  519



>ref|XP_004287841.1| PREDICTED: cytochrome P450 84A1-like [Fragaria vesca subsp. vesca]
Length=516

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/522 (72%), Positives = 435/522 (83%), Gaps = 13/522 (2%)
 Frame = +3

Query  117   VLEALEAHKHMVIYFVIPflflfllsrlrrK--PYPPGPKGWPLIGNMNLMDHYSHRGLA  290
             V +AL+    + +  +IP +FL  +    RK  PYPPGPKG P+IGNM +MD  +HRGLA
Sbjct  5     VQQALQQPAPIALLSIIPVIFLLGVLFRSRKCLPYPPGPKGLPIIGNMTMMDQLTHRGLA  64

Query  291   KLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMAF  470
             KLA++YGG+LHL+MG LHMV VS  D AR+VLQ QDNIFSNRPA +AISYL+YDRADMAF
Sbjct  65    KLAKEYGGILHLRMGFLHMVAVSSADVAREVLQVQDNIFSNRPATIAISYLTYDRADMAF  124

Query  471   AHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGLTR  650
             AHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDEVD TVR VA N GSAVNIGEL+F LT+
Sbjct  125   AHYGPFWRQMRKLCVMKLFSRKRAESWESVRDEVDTTVRVVAANTGSAVNIGELVFSLTK  184

Query  651   NITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKAR  830
             NITYRAAFG+S  S +GQDEFI ILQEFSKLFGAFN++DF P L   D QGLN RLAKAR
Sbjct  185   NITYRAAFGTS--SNEGQDEFIGILQEFSKLFGAFNIADFIPGLGWLDPQGLNKRLAKAR  242

Query  831   AALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVNDSDD-L  1007
              +LD FID IIDDH+ + ++  N + G        ETDMVD+LLAFYS+E KVN+S+D L
Sbjct  243   ESLDKFIDTIIDDHLQKKKKTGNLDEG--------ETDMVDDLLAFYSEEAKVNESEDNL  294

Query  1008  QNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRK  1187
             QNAI LTRDNIK IIMDVMFGGTETVASAIEWAM+ELM++PE+LK++QQEL D VGLDR+
Sbjct  295   QNAINLTRDNIKAIIMDVMFGGTETVASAIEWAMSELMRSPEDLKKVQQELVDVVGLDRR  354

Query  1188  VEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARD  1367
             +EESDLEKLT+LKC LKE LRLHPPIPLLLHET+E  EV GY IP +SR +INAWAI RD
Sbjct  355   IEESDLEKLTYLKCTLKEVLRLHPPIPLLLHETSEDAEVAGYSIPKKSRVMINAWAIGRD  414

Query  1368  KNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHC  1547
              NSWED + FKP RFLKEG+PDFKGSNFEFIPFGSGRRSCPGMQLGLYA ELAV HL HC
Sbjct  415   NNSWEDAECFKPSRFLKEGVPDFKGSNFEFIPFGSGRRSCPGMQLGLYALELAVGHLLHC  474

Query  1548  FTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             F+WELPDGMKPS+L+M+DVFGLTAP+A+RL+ +PT R+ C L
Sbjct  475   FSWELPDGMKPSELEMNDVFGLTAPRASRLIAVPTKRVVCPL  516



>gb|ACC63881.1| coniferyl aldehyde 5-hydroxylase [Populus trichocarpa]
Length=513

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/488 (75%), Positives = 419/488 (86%), Gaps = 11/488 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG+PLIG+M+LMD  +HRGLAKLA+QYGGL H++MG LHMV VS P+ ARQVLQ
Sbjct  37    PYPPGPKGFPLIGSMHLMDQLTHRGLAKLAKQYGGLFHMRMGYLHMVAVSSPEVARQVLQ  96

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPAN+AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDE
Sbjct  97    VQDNIFSNRPANIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDE  156

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD+ V+TV  N G  VN+GELIF LT NITYRAAFG+     +GQDEFIKILQEFSKLFG
Sbjct  157   VDSMVKTVESNIGKPVNVGELIFTLTMNITYRAAFGAK---NEGQDEFIKILQEFSKLFG  213

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN+SDF P+L   D QGL  RL KAR ALD FID IIDDHI   ++R+  N+  E    
Sbjct  214   AFNISDFIPWLGWIDPQGLTARLVKARKALDKFIDHIIDDHI---QKRKQNNYSEE----  266

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
              AETDMVD++L FYS+E KVN+SDDLQNAIKLTRDNIK IIMDVMFGGTETVASAIEWAM
Sbjct  267   -AETDMVDDMLTFYSEETKVNESDDLQNAIKLTRDNIKAIIMDVMFGGTETVASAIEWAM  325

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AEL+K+PE++KR+QQEL D VGL+R+VEESD +KL F KC LKETLRLHPPIPLLLHET+
Sbjct  326   AELLKSPEDIKRVQQELADVVGLERRVEESDFDKLPFFKCTLKETLRLHPPIPLLLHETS  385

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E  EV GYY+P ++R +INA+AI RDKNSWEDPDSFKP RFL+ G+PDFKG++FEFIPFG
Sbjct  386   EDAEVAGYYVPKKTRVMINAYAIGRDKNSWEDPDSFKPSRFLEPGVPDFKGNHFEFIPFG  445

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLYA +LAVAHL HCFTWELPDGMKPS+LDM D+FGLTAP+ATRLV +P
Sbjct  446   SGRRSCPGMQLGLYALDLAVAHLLHCFTWELPDGMKPSELDMTDMFGLTAPRATRLVAVP  505

Query  1650  TPRLNCQL  1673
               R+ C L
Sbjct  506   RKRVVCPL  513



>gb|AGR44939.1| ferulate 5-hydroxylase protein [Pyrus x bretschneideri]
Length=516

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/489 (75%), Positives = 419/489 (86%), Gaps = 11/489 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG PLIGNM +MD  +HRGLAKLA+QYGG+ HL+MG LHMV VS PD ARQVLQ
Sbjct  38    PYPPGPKGLPLIGNMLMMDQLTHRGLAKLAKQYGGIFHLRMGFLHMVAVSNPDVARQVLQ  97

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPA +AISYL+YDRADMAFA+YGPFWRQMRKLCV+KLFSR+RAESW+SVRDE
Sbjct  98    VQDNIFSNRPATIAISYLTYDRADMAFAYYGPFWRQMRKLCVMKLFSRKRAESWESVRDE  157

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD+ VRTV ++ GSAVNIGEL+F LT+NI YRAAFG+S  S +GQDEFI ILQEFSKLFG
Sbjct  158   VDSAVRTVTVHVGSAVNIGELVFSLTKNIIYRAAFGTS--SQEGQDEFIAILQEFSKLFG  215

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P L   D QGLN RLAKAR +LD FID IIDDH+ + +  +  N G      
Sbjct  216   AFNIADFIPSLGWVDPQGLNNRLAKARESLDRFIDTIIDDHMEKKKNNKGLNDG------  269

Query  930   GAETDMVDELLAFYSDEMKVNDSDD-LQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
               ETDMVDELLAFYS+E KVN+S+D LQ+AIKLTRDNIK IIMDVMFGGTETVASAIEWA
Sbjct  270   --ETDMVDELLAFYSEEAKVNESEDNLQSAIKLTRDNIKAIIMDVMFGGTETVASAIEWA  327

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             M+ELMK+PE+LKR+QQEL D VGLDR+ EE+D EKLT+LKC LKETLRL PPIPLLLHET
Sbjct  328   MSELMKSPEDLKRVQQELADVVGLDRRPEETDFEKLTYLKCALKETLRLRPPIPLLLHET  387

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             +E   V GY IP RSR +INAWAI RDK+SWED +SFKP RFLKEG+PDFKGSNFEFIPF
Sbjct  388   SEDAVVAGYRIPKRSRVMINAWAIGRDKDSWEDAESFKPSRFLKEGVPDFKGSNFEFIPF  447

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLYA E+AVAHL HCFTWELPDGMKPS+LDM+DVFGLTAP+A+RL+ +
Sbjct  448   GSGRRSCPGMQLGLYALEMAVAHLLHCFTWELPDGMKPSELDMNDVFGLTAPRASRLIAV  507

Query  1647  PTPRLNCQL  1673
             P+ R+ C L
Sbjct  508   PSKRVVCPL  516



>emb|CAB65335.1| ferulate-5-hydroxylase [Populus trichocarpa]
Length=513

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/488 (75%), Positives = 418/488 (86%), Gaps = 11/488 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG+PLIG+M+LMD  + RGLAKLA+QYGGL H++MG LHMV  S P+ ARQVLQ
Sbjct  37    PYPPGPKGFPLIGSMHLMDQLTDRGLAKLAKQYGGLFHMRMGYLHMVAGSSPEVARQVLQ  96

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDN+FSNRPAN+AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDE
Sbjct  97    VQDNMFSNRPANIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDE  156

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD+ V+TV  N G  VN+GELIF LT NITYRAAFG+     +GQDEFIKILQEFSKLFG
Sbjct  157   VDSMVKTVESNIGKPVNVGELIFTLTMNITYRAAFGAK---NEGQDEFIKILQEFSKLFG  213

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN+SDF P+L   D QGL  RL KAR ALD FID IIDDHI   ++R+  N+  E    
Sbjct  214   AFNISDFIPWLGWIDPQGLTARLVKARKALDKFIDHIIDDHI---QKRKQNNYSEE----  266

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
              AETDMVD++L FYS+E KVN+SDDLQNAIKLTRDNIK IIMDVMFGGTETVASAIEWAM
Sbjct  267   -AETDMVDDMLTFYSEETKVNESDDLQNAIKLTRDNIKAIIMDVMFGGTETVASAIEWAM  325

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AEL+K+PE++KR+QQEL D VGL+R+VEESD +KLTF KC LKETLRLHPPIPLLLHET+
Sbjct  326   AELLKSPEDIKRVQQELADVVGLERRVEESDFDKLTFFKCTLKETLRLHPPIPLLLHETS  385

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E  EV GYY+P ++R +INA+AI RDKNSWEDPDSFKP RFL+ G+PDFKG++FEFIPFG
Sbjct  386   EDAEVAGYYVPKKTRVMINAYAIGRDKNSWEDPDSFKPSRFLEPGVPDFKGNHFEFIPFG  445

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLYA +LAVAHL HCFTWELPDGMKPS+LDM D+FGLTAP+ATRLV +P
Sbjct  446   SGRRSCPGMQLGLYALDLAVAHLLHCFTWELPDGMKPSELDMTDMFGLTAPRATRLVAVP  505

Query  1650  TPRLNCQL  1673
               R+ C L
Sbjct  506   RKRVVCPL  513



>gb|ACU45738.1| ferulate 5-hydroxylase [Eucalyptus globulus]
Length=529

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/490 (75%), Positives = 419/490 (86%), Gaps = 8/490 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             P+PPGP+G P+IGNM +M   +HRGLA LA++YGG+ HL+MG LHMV VS PD ARQVLQ
Sbjct  47    PFPPGPRGLPVIGNMLMMGELTHRGLASLAKKYGGIFHLRMGFLHMVAVSSPDVARQVLQ  106

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
               D IFSNRPA +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDE
Sbjct  107   VHDGIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDE  166

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD  VRTVA + G+AVNIGEL+F LTR+I YRAAFG+S  S +GQDEFI ILQEFSKLFG
Sbjct  167   VDTMVRTVAGSEGTAVNIGELVFELTRDIIYRAAFGTS--STEGQDEFISILQEFSKLFG  224

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P+LS  D QGL  RL KAR +LDGFID IIDDH+    ++RNK   G   GD
Sbjct  225   AFNIADFIPYLSWIDPQGLTARLVKARQSLDGFIDHIIDDHM---DKKRNKTSSG--GGD  279

Query  930   G-AETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
                +TDMVD+LLAFYSDE KVN+SDDLQN+I+LTRDNIK IIMDVMFGGTETVASAIEWA
Sbjct  280   QEVDTDMVDDLLAFYSDEAKVNESDDLQNSIRLTRDNIKAIIMDVMFGGTETVASAIEWA  339

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             MAELM++PE+LK++QQEL D VGLDR+VEESD EKLT+LKCCLKETLRLHPPIPLLLHET
Sbjct  340   MAELMRSPEDLKKVQQELADVVGLDRRVEESDFEKLTYLKCCLKETLRLHPPIPLLLHET  399

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AE   ++GY IPARSR +INAWAI RD  SW +PD FKP RFL+ GMPD+KGSNFEFIPF
Sbjct  400   AEDAVISGYRIPARSRVMINAWAIGRDPGSWTEPDKFKPSRFLESGMPDYKGSNFEFIPF  459

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLYA ++AVAHL HCFTWELPDGMKPS++DM DVFGLTAP++TRLV +
Sbjct  460   GSGRRSCPGMQLGLYALDMAVAHLLHCFTWELPDGMKPSEMDMGDVFGLTAPRSTRLVAV  519

Query  1647  PTPRLNCQLH  1676
             PTPRL   L+
Sbjct  520   PTPRLVGALY  529



>ref|XP_009588689.1| PREDICTED: cytochrome P450 84A1-like [Nicotiana tomentosiformis]
Length=507

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/490 (72%), Positives = 417/490 (85%), Gaps = 14/490 (3%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K +PPGPKGWP+IGNM +MD  +HRGLAKLA++YGG+LHLKMG+LH+  VS PDEARQVL
Sbjct  32    KKFPPGPKGWPIIGNMMIMDQLTHRGLAKLAKKYGGILHLKMGNLHITAVSSPDEARQVL  91

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             Q QD +FSNRPA +A+ YLSYDRADMAFAHYGPFWRQMRKLCV+KLFSRRRAESWDSVRD
Sbjct  92    QLQDTVFSNRPATIAVKYLSYDRADMAFAHYGPFWRQMRKLCVMKLFSRRRAESWDSVRD  151

Query  567   EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLF  746
             EVD+  R VA + G +VNIGEL+FGL++NI YRAAFG+SP     +DE +KI+QEFSKLF
Sbjct  152   EVDSMTRVVATSNGLSVNIGELVFGLSKNIIYRAAFGTSPGE---EDELLKIMQEFSKLF  208

Query  747   GAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSG  926
             GAFN++DF P+L   D QG+N R+ KARA+LD FID IIDDHI    +R+N+        
Sbjct  209   GAFNLADFIPWLGWVDPQGINTRMVKARASLDCFIDTIIDDHI----QRKNEK-------  257

Query  927   DGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
             D  + DMVDELLAFY +E KV DSDDLQNAI+LTRDNIK IIMDVMFGG ETVASA+EWA
Sbjct  258   DDRDNDMVDELLAFYDEEAKVTDSDDLQNAIRLTRDNIKAIIMDVMFGGIETVASAVEWA  317

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             MAELMK+PE+LKR+QQELT+ VGL RKVEE+D +KLT+LKCC+KETLRLHP IP+L+HE 
Sbjct  318   MAELMKSPEDLKRVQQELTNIVGLHRKVEETDFDKLTYLKCCIKETLRLHPVIPVLIHEA  377

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             A    V+G+YIPA++R +IN WAI RDKNSWEDPD+FKP RFLKEG+ DFKG NFEF+PF
Sbjct  378   AADATVSGHYIPAKARVLINVWAIGRDKNSWEDPDTFKPSRFLKEGVADFKGGNFEFLPF  437

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             G+GRRSCPGMQLGL+AFE+ +AHL HCFTWELPDGMKPSD+DMDD+FGLTAPKATRLV +
Sbjct  438   GAGRRSCPGMQLGLFAFEMTLAHLLHCFTWELPDGMKPSDVDMDDIFGLTAPKATRLVAV  497

Query  1647  PTPRLNCQLH  1676
             P+PRL C L+
Sbjct  498   PSPRLLCPLY  507



>ref|XP_010033459.1| PREDICTED: cytochrome P450 84A1-like [Eucalyptus grandis]
 gb|KCW53098.1| hypothetical protein EUGRSUZ_J02393 [Eucalyptus grandis]
Length=529

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/489 (74%), Positives = 418/489 (85%), Gaps = 6/489 (1%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             P+PPGP+G P+IGNM +M   +HRGLA L+++YGG+ HL+MG LHMV VS PD ARQVLQ
Sbjct  47    PFPPGPRGLPVIGNMLMMGELTHRGLASLSKKYGGIFHLRMGFLHMVAVSSPDVARQVLQ  106

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
               D IFSNRPA +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDE
Sbjct  107   VHDGIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDE  166

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD  VRTVA + G+AVNIGEL+F LTR+I YRAAFG+S  S +GQDEFI ILQEFSKLFG
Sbjct  167   VDTMVRTVAGSEGTAVNIGELVFELTRDIIYRAAFGTS--STEGQDEFISILQEFSKLFG  224

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P+LS  D QGL  RL KAR +LDGFID IIDDH+    ++RNK   G    D
Sbjct  225   AFNIADFIPYLSWIDPQGLTARLVKARQSLDGFIDHIIDDHM---DKKRNKTSSGGGDQD  281

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
               +TDMVD+LLAFYSDE KVN+SDDLQN+I+LTRDNIK IIMDVMFGGTETVASAIEWAM
Sbjct  282   -VDTDMVDDLLAFYSDEAKVNESDDLQNSIRLTRDNIKAIIMDVMFGGTETVASAIEWAM  340

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AELM++PE+LK++QQEL D VGLDR+VEESD EKLT+LKCCLKETLRLHPPIPLLLHETA
Sbjct  341   AELMRSPEDLKKVQQELADVVGLDRRVEESDFEKLTYLKCCLKETLRLHPPIPLLLHETA  400

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E   ++GY IPARSR +INAWAI RD  SW +PD FKP RFL+ GMPD+KGSNFEFIPFG
Sbjct  401   EDAVISGYRIPARSRVMINAWAIGRDPGSWTEPDKFKPSRFLEPGMPDYKGSNFEFIPFG  460

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLYA ++AVAHL HCFTWELPDGMKPS++DM DVFGLTAP++TRLV +P
Sbjct  461   SGRRSCPGMQLGLYALDMAVAHLLHCFTWELPDGMKPSEMDMGDVFGLTAPRSTRLVAVP  520

Query  1650  TPRLNCQLH  1676
             TPRL   L+
Sbjct  521   TPRLVGALY  529



>ref|XP_009346304.1| PREDICTED: cytochrome P450 84A1-like [Pyrus x bretschneideri]
Length=517

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/489 (75%), Positives = 421/489 (86%), Gaps = 10/489 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG PLIGNM +MD  +HRGLAKLA+QYGG+ HL+MG LHMV VS PD ARQVLQ
Sbjct  38    PYPPGPKGLPLIGNMLMMDQLTHRGLAKLAKQYGGIFHLRMGFLHMVAVSNPDVARQVLQ  97

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPA +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDE
Sbjct  98    VQDNIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDE  157

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD  VRTV ++ GSAVNIGEL+F LT+NI YRAAFG+S  S +GQDEFI ILQEFSKLFG
Sbjct  158   VDTAVRTVTVHVGSAVNIGELVFSLTKNIIYRAAFGTS--SQEGQDEFIAILQEFSKLFG  215

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P L   D QGLN RLAKAR +LD FID IIDDH+ + +      + GE    
Sbjct  216   AFNIADFIPSLGWVDPQGLNNRLAKARESLDRFIDTIIDDHMEKKKNNNKGLNDGE----  271

Query  930   GAETDMVDELLAFYSDEMKVNDSDD-LQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
                TDMVD+LLAFYS+E KVN+S+D LQNAIKLTRDNIK IIMDVMFGGTETVASAIEWA
Sbjct  272   ---TDMVDDLLAFYSEEAKVNESEDNLQNAIKLTRDNIKAIIMDVMFGGTETVASAIEWA  328

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             M+ELMK+PE+LKR+QQEL + VGLDR+ EE+D EKLT+LKC LKETLRLHPPIPLLLHET
Sbjct  329   MSELMKSPEDLKRVQQELFNVVGLDRRPEEADFEKLTYLKCALKETLRLHPPIPLLLHET  388

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             +E   V+GY+IP +SR +INAWAI RDK+SWEDP+SFKP RFLK+G+PDFKGSNFEFIPF
Sbjct  389   SEDAVVSGYHIPKQSRVMINAWAIGRDKDSWEDPESFKPSRFLKDGVPDFKGSNFEFIPF  448

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLYA E+AVAH+ HCFTWELPDGMKPS+LDM+DVFGLTAP+A+RLV +
Sbjct  449   GSGRRSCPGMQLGLYALEMAVAHMLHCFTWELPDGMKPSELDMNDVFGLTAPRASRLVAV  508

Query  1647  PTPRLNCQL  1673
             P+ R+ C L
Sbjct  509   PSKRVVCPL  517



>dbj|BAI47545.1| coniferaldehyde 5-hydroxylase [Eucalyptus globulus subsp. globulus]
Length=529

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/489 (74%), Positives = 417/489 (85%), Gaps = 6/489 (1%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             P+PPGP+G P+IGNM +M   +HRGLA LA++YGG+ HL+MG LHMV VS PD ARQVLQ
Sbjct  47    PFPPGPRGLPVIGNMLMMGELTHRGLASLAKKYGGIFHLRMGFLHMVAVSSPDVARQVLQ  106

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
               D IFSNRPA +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDE
Sbjct  107   VHDGIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDE  166

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD  VRTVA + G+AVNIGEL+F LTR+I YRAAFG+S  S +GQDEFI ILQEFSKLFG
Sbjct  167   VDTMVRTVAGSEGTAVNIGELVFELTRDIIYRAAFGTS--STEGQDEFISILQEFSKLFG  224

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P+LS  D QGL  RL KAR +LDGFID IIDDH+    ++RNK   G    D
Sbjct  225   AFNIADFIPYLSWIDPQGLTARLVKARQSLDGFIDHIIDDHM---DKKRNKTSSGGGDQD  281

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
               +TDMVD+LLAFYSDE KVN+SDDLQN+I+LTRDNIK IIMDVMFGGTETVASAIEWAM
Sbjct  282   -VDTDMVDDLLAFYSDEAKVNESDDLQNSIRLTRDNIKAIIMDVMFGGTETVASAIEWAM  340

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AELM++PE+LK++QQEL   VGLDR+VEESD EKLT+LKCCLKETLRLHPPIPLLLHETA
Sbjct  341   AELMRSPEDLKKVQQELAGVVGLDRRVEESDFEKLTYLKCCLKETLRLHPPIPLLLHETA  400

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E   ++GY IPARSR +INAWAI RD  SW +PD FKP RFL+ GMPD+KGSNFEFIPFG
Sbjct  401   EDAVISGYRIPARSRVMINAWAIGRDPGSWTEPDKFKPSRFLESGMPDYKGSNFEFIPFG  460

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLYA ++AVAHL HCFTWELPDGMKPS++DM DVFGLTAP++TRLV +P
Sbjct  461   SGRRSCPGMQLGLYALDMAVAHLLHCFTWELPDGMKPSEMDMGDVFGLTAPRSTRLVAVP  520

Query  1650  TPRLNCQLH  1676
             TPRL   L+
Sbjct  521   TPRLVGALY  529



>ref|XP_003517196.1| PREDICTED: cytochrome P450 84A1-like [Glycine max]
Length=515

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/489 (74%), Positives = 413/489 (84%), Gaps = 9/489 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG P+IGNM +M+  +HRGLA LA+ YGG+ HL+MG LHMV +S P  ARQVLQ
Sbjct  34    PYPPGPKGLPIIGNMLMMEQLTHRGLANLAKHYGGIFHLRMGFLHMVAISDPVAARQVLQ  93

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPA +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW SVRDE
Sbjct  94    VQDNIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWQSVRDE  153

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD  VR VA + G  VNIGEL+F LT+NI YRAAFGSS  S +GQDEFIKILQEFSKLFG
Sbjct  154   VDAAVRAVASSVGKPVNIGELVFNLTKNIIYRAAFGSS--SQEGQDEFIKILQEFSKLFG  211

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P+L C D QGLN RLA+AR ALD FIDKIID+H+      + KN       D
Sbjct  212   AFNIADFIPYLGCVDPQGLNSRLARARGALDSFIDKIIDEHV-----HKMKNDKSSEIVD  266

Query  930   GAETDMVDELLAFYSDEMKVN-DSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
             G ETDMVDELLAFYS+E K+N +SDDLQN+I+LT+DNIK IIMDVMFGGTETVASAIEWA
Sbjct  267   G-ETDMVDELLAFYSEEAKLNNESDDLQNSIRLTKDNIKAIIMDVMFGGTETVASAIEWA  325

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             MAELM++PE+ KR+QQEL D VGLDR+ EESD EKLT+LKC LKETLRLHPPIPLLLHET
Sbjct  326   MAELMRSPEDQKRVQQELADVVGLDRRAEESDFEKLTYLKCALKETLRLHPPIPLLLHET  385

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AE   V GY +P ++R +INAWAI RDKNSWE+P+SFKP RFLK G+PDFKGSNFEFIPF
Sbjct  386   AEDATVGGYLVPKKARVMINAWAIGRDKNSWEEPESFKPARFLKPGVPDFKGSNFEFIPF  445

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGM LGLYA ELAVAHL HCFTWELPDGMKPS++DM DVFGLTAP++TRL+ +
Sbjct  446   GSGRRSCPGMVLGLYALELAVAHLLHCFTWELPDGMKPSEMDMGDVFGLTAPRSTRLIAV  505

Query  1647  PTPRLNCQL  1673
             PT R+ C L
Sbjct  506   PTKRVVCPL  514



>gb|AEO21428.1| coniferylaldehyde 5-hydroxylase [Glycine max]
Length=515

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/489 (74%), Positives = 414/489 (85%), Gaps = 9/489 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG P+IGNM +M+  +HRGLA LA+ YGG+ HL+MG LHMV +S P  ARQVLQ
Sbjct  34    PYPPGPKGLPIIGNMLMMEQLTHRGLANLAKHYGGIFHLRMGFLHMVAISDPVAARQVLQ  93

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPA +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW SVRDE
Sbjct  94    VQDNIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWQSVRDE  153

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD  VR VA + G  VNIGEL+F LT+NI YRAAFGSS  S +GQDEFIKILQEFSKLFG
Sbjct  154   VDAAVRAVASSVGKPVNIGELVFNLTKNIIYRAAFGSS--SQEGQDEFIKILQEFSKLFG  211

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P+L C D QGLN RLA+AR ALD FIDKIID+H+      + KN       D
Sbjct  212   AFNIADFIPYLGCVDPQGLNSRLARARGALDSFIDKIIDEHV-----HKMKNDKSSEIVD  266

Query  930   GAETDMVDELLAFYSDEMKVN-DSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
             G ETDMVDELLAFYS+E K+N +SDDLQN+I+LT+DNIK IIMDVMFGGTETVASAIEWA
Sbjct  267   G-ETDMVDELLAFYSEEAKLNNESDDLQNSIRLTKDNIKAIIMDVMFGGTETVASAIEWA  325

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             MAELM++PE+ KR+QQEL D VGLDR+ EESD EKLT+LKC LKETLRLHPPIPLLLHET
Sbjct  326   MAELMRSPEDQKRVQQELADVVGLDRRAEESDFEKLTYLKCALKETLRLHPPIPLLLHET  385

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AE   V GY++P ++R +INAWAI RDKNSWE+P++FKP RFLK G+PDFKGSNFEFIPF
Sbjct  386   AEDATVGGYFVPRKARVMINAWAIGRDKNSWEEPETFKPARFLKPGVPDFKGSNFEFIPF  445

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGM LGLYA ELAVAHL HCFTWELPDGMKPS++DM DVFGLTAP++TRL+ +
Sbjct  446   GSGRRSCPGMVLGLYALELAVAHLLHCFTWELPDGMKPSEMDMGDVFGLTAPRSTRLIAV  505

Query  1647  PTPRLNCQL  1673
             PT R+ C L
Sbjct  506   PTKRVVCPL  514



>ref|XP_008241781.1| PREDICTED: cytochrome P450 84A1 [Prunus mume]
Length=517

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/524 (73%), Positives = 435/524 (83%), Gaps = 15/524 (3%)
 Frame = +3

Query  117   VLEALEAHKHMVIYFVIP----flflfllsrlrrKPYPPGPKGWPLIGNMNLMDHYSHRG  284
             +L+AL+  + M ++F+IP       +F     RR PYPPGP G P+IGNM +MD  +HRG
Sbjct  4     LLQALQTIQPMTLFFIIPFLFLSGLVFRYRSRRRSPYPPGPTGLPIIGNMLMMDQITHRG  63

Query  285   LAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADM  464
             LAKLA+QYGG+ HL+MG LHMV +S PD ARQVLQ QDNIFSNRPA +AISYL+YDRADM
Sbjct  64    LAKLAKQYGGIFHLRMGFLHMVGISNPDVARQVLQVQDNIFSNRPATIAISYLTYDRADM  123

Query  465   AFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGL  644
             AFAHYGPFWRQMRKLCV+KLFSR+RAESWD+VRDEVD  V TVA+  GSAVNIGEL+F L
Sbjct  124   AFAHYGPFWRQMRKLCVMKLFSRKRAESWDAVRDEVDTAVLTVAVQAGSAVNIGELVFSL  183

Query  645   TRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAK  824
             T+NI YRAAFG+S  S +GQDEFI ILQEFSKLFGAFN++DF P L   D QGLN RLA+
Sbjct  184   TKNIIYRAAFGTS--SDEGQDEFIGILQEFSKLFGAFNIADFIPCLGWVDPQGLNNRLAR  241

Query  825   ARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVNDSDD  1004
             AR +LDGFID IIDDH+     ++ KN  G    +G ETDMVDELLAFYSDE KVN+SDD
Sbjct  242   ARQSLDGFIDSIIDDHM-----QKKKNSDGS---NGGETDMVDELLAFYSDEAKVNESDD  293

Query  1005  -LQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLD  1181
              LQNAI LTRDNIK IIMDVMFGGTETVASAIEWAMAELM+ P+ LKR+QQEL D VGLD
Sbjct  294   NLQNAINLTRDNIKAIIMDVMFGGTETVASAIEWAMAELMRNPDELKRVQQELADVVGLD  353

Query  1182  RKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIA  1361
             R+ EE D EKLT+LKC LKETLRLHPPIPLLLHETAE  EV GY+IP +SR +IN+WAI 
Sbjct  354   RRPEEGDFEKLTYLKCALKETLRLHPPIPLLLHETAEDAEVAGYHIPKKSRVMINSWAIG  413

Query  1362  RDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLF  1541
             RDK+SWED +SFKP RFLKEG+PDFKGSNFEFIPFGSGRRSCPGMQLGLY+ ELAV HL 
Sbjct  414   RDKDSWEDAESFKPSRFLKEGVPDFKGSNFEFIPFGSGRRSCPGMQLGLYSLELAVGHLL  473

Query  1542  HCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             HCFTWELPDGMKPS+LDM+DVFGLTAP+A+RL+ +P+ R+ C L
Sbjct  474   HCFTWELPDGMKPSELDMNDVFGLTAPRASRLIAVPSKRVVCPL  517



>gb|KHG11872.1| Cytochrome P450 protein [Gossypium arboreum]
Length=517

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/489 (74%), Positives = 417/489 (85%), Gaps = 8/489 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             P+PPGPKG P+IGNM +MD  +HRGLAKLA +YGG+ H+KMG LHMV +S P+ ARQVLQ
Sbjct  37    PFPPGPKGLPIIGNMMMMDQLTHRGLAKLAHKYGGIFHMKMGYLHMVTISNPEMARQVLQ  96

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPAN+AISYL+YDRADMAFA+YGPFWRQMRK+CV+K+FSR+RAESW+SVRDE
Sbjct  97    VQDNIFSNRPANIAISYLTYDRADMAFANYGPFWRQMRKICVMKVFSRKRAESWESVRDE  156

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             V++ V+ VA N G ++N+GELIF LT NITYRAAFGSS  +  GQ+EFIKILQEFSKLFG
Sbjct  157   VESLVKAVAANTGKSINMGELIFNLTMNITYRAAFGSS--NRHGQEEFIKILQEFSKLFG  214

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P ++ FD QGL  RL  AR ALD FID IIDDHI   ++R+     G   GD
Sbjct  215   AFNIADFIPCMTWFDPQGLTTRLKNARGALDKFIDTIIDDHI---QKRKTNIDNGSPEGD  271

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
                TDMVD+LLAFYS+E KVN+S+DLQN+IKLT+DNIK IIMDVMFGGTETVASAIEWA+
Sbjct  272   ---TDMVDDLLAFYSEEAKVNESEDLQNSIKLTKDNIKAIIMDVMFGGTETVASAIEWAL  328

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
              E+MK+PE+LKR+QQEL + VGLDR+VEESD+EKLT+LKC LKETLRLHPPIPLLLHETA
Sbjct  329   TEMMKSPEDLKRVQQELAEVVGLDRRVEESDIEKLTYLKCTLKETLRLHPPIPLLLHETA  388

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E   V GY IPA+SR +IN WAI RDK SWED +SFKP RFLKEG+PDFKGSNFEFIPFG
Sbjct  389   EDAVVAGYQIPAKSRVMINVWAIGRDKGSWEDAESFKPSRFLKEGVPDFKGSNFEFIPFG  448

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLYA +LAVAHL HCFTWELPDGMKPS+LDM DVFGLTAP+ATRL  +P
Sbjct  449   SGRRSCPGMQLGLYALDLAVAHLLHCFTWELPDGMKPSELDMSDVFGLTAPRATRLYAVP  508

Query  1650  TPRLNCQLH  1676
               RL CQL+
Sbjct  509   KKRLICQLN  517



>emb|CAN73481.1| hypothetical protein VITISV_026695 [Vitis vinifera]
Length=493

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/482 (77%), Positives = 423/482 (88%), Gaps = 10/482 (2%)
 Frame = +3

Query  228   KGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIF  407
             KG PLIG+MN+MD  +HRGLAK+A+QYGG+ HL+MG LHMV VS PD ARQVLQ QDNIF
Sbjct  21    KGLPLIGSMNMMDQLTHRGLAKIAKQYGGIFHLRMGYLHMVGVSSPDIARQVLQVQDNIF  80

Query  408   SNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVR  587
             SNRPA +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVR+EV++TVR
Sbjct  81    SNRPATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVREEVESTVR  140

Query  588   TVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSD  767
             TVA + GS VNIGEL+F LT+NI YRAAFG+S  S +GQDEFI ILQEFSKLFGAFN++D
Sbjct  141   TVASSIGSPVNIGELVFTLTKNIIYRAAFGTS--SKEGQDEFISILQEFSKLFGAFNIAD  198

Query  768   FFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDM  947
             F P+LS  D QGLN RLAKAR +LDGFID IIDDH +Q ++  N +       D  +TDM
Sbjct  199   FIPWLSWVDPQGLNARLAKARKSLDGFIDDIIDDH-MQKKKLNNDS-------DEVDTDM  250

Query  948   VDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKT  1127
             VD+LLAFYS+E KVN+S+DLQNAI+LTRDNIK IIMDVMFGGTETVASAIEWAMAE+MK+
Sbjct  251   VDDLLAFYSEEAKVNESEDLQNAIELTRDNIKAIIMDVMFGGTETVASAIEWAMAEMMKS  310

Query  1128  PENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVN  1307
             PE+LK++QQEL D VGL+R+VEESDLEKLT+LKC LKETLRLHPPIPLLLHETAE  EV 
Sbjct  311   PEDLKKVQQELADVVGLNRRVEESDLEKLTYLKCALKETLRLHPPIPLLLHETAEDAEVA  370

Query  1308  GYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSC  1487
             GY+IPARSR +INAWAI RDKNSW++P++FKP RFLK G+PDFKGSNFEFIPFGSGRRSC
Sbjct  371   GYHIPARSRVMINAWAIGRDKNSWDEPETFKPSRFLKAGVPDFKGSNFEFIPFGSGRRSC  430

Query  1488  PGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNC  1667
             PGMQLGLYA ELAV HL HCFTWELPDGMKPS+LDM DVFGLTAP+ATRLV +P+PRL C
Sbjct  431   PGMQLGLYALELAVVHLLHCFTWELPDGMKPSELDMGDVFGLTAPRATRLVAVPSPRLEC  490

Query  1668  QL  1673
              L
Sbjct  491   PL  492



>ref|XP_002272644.1| PREDICTED: cytochrome P450 84A1 [Vitis vinifera]
Length=514

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/482 (77%), Positives = 423/482 (88%), Gaps = 10/482 (2%)
 Frame = +3

Query  228   KGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIF  407
             KG PLIG+MN+MD  +HRGLAK+A+QYGG+ HL+MG LHMV VS PD ARQVLQ QDNIF
Sbjct  42    KGLPLIGSMNMMDQLTHRGLAKIAKQYGGIFHLRMGYLHMVGVSSPDIARQVLQVQDNIF  101

Query  408   SNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVR  587
             SNRPA +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVR+EV++TVR
Sbjct  102   SNRPATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVREEVESTVR  161

Query  588   TVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSD  767
             TVA + GS VNIGEL+F LT+NI YRAAFG+S  S +GQDEFI ILQEFSKLFGAFN++D
Sbjct  162   TVASSIGSPVNIGELVFTLTKNIIYRAAFGTS--SKEGQDEFISILQEFSKLFGAFNIAD  219

Query  768   FFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDM  947
             F P+LS  D QGLN RLAKAR +LDGFID IIDDH +Q ++  N +       D  +TDM
Sbjct  220   FIPWLSWVDPQGLNARLAKARKSLDGFIDDIIDDH-MQKKKLNNDS-------DEVDTDM  271

Query  948   VDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKT  1127
             VD+LLAFYS+E KVN+S+DLQNAI+LTRDNIK IIMDVMFGGTETVASAIEWAMAE+MK+
Sbjct  272   VDDLLAFYSEEAKVNESEDLQNAIELTRDNIKAIIMDVMFGGTETVASAIEWAMAEMMKS  331

Query  1128  PENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVN  1307
             PE+LK++QQEL D VGL+R+VEESDLEKLT+LKC LKETLRLHPPIPLLLHETAE  EV 
Sbjct  332   PEDLKKVQQELADVVGLNRRVEESDLEKLTYLKCVLKETLRLHPPIPLLLHETAEDAEVA  391

Query  1308  GYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSC  1487
             GY+IPARSR +INAWAI RDKNSW++P++FKP RFLK G+PDFKGSNFEFIPFGSGRRSC
Sbjct  392   GYHIPARSRVMINAWAIGRDKNSWDEPETFKPSRFLKAGVPDFKGSNFEFIPFGSGRRSC  451

Query  1488  PGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNC  1667
             PGMQLGLYA ELAV HL HCFTWELPDGMKPS+LDM DVFGLTAP+ATRLV +P+PRL C
Sbjct  452   PGMQLGLYALELAVVHLLHCFTWELPDGMKPSELDMGDVFGLTAPRATRLVAVPSPRLEC  511

Query  1668  QL  1673
              L
Sbjct  512   PL  513



>dbj|BAI47544.1| coniferaldehyde 5-hydroxylase [Eucalyptus globulus subsp. globulus]
Length=529

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/489 (74%), Positives = 416/489 (85%), Gaps = 6/489 (1%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             P+PPGP+G P+IGNM +M   +HRGLA LA++YGG+ HL+MG LHMV VS PD ARQVLQ
Sbjct  47    PFPPGPRGLPVIGNMLMMGELTHRGLASLAKKYGGIFHLRMGFLHMVAVSSPDVARQVLQ  106

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
               D IFSNRPA +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDE
Sbjct  107   VHDGIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDE  166

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD  VRTVA + G+AVNIGEL+F LTR+I YRAAFG+S  S +GQDEFI ILQEFSKLFG
Sbjct  167   VDTMVRTVAGSEGTAVNIGELVFELTRDIIYRAAFGTS--STEGQDEFISILQEFSKLFG  224

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P+LS  D QGL  RL KAR +LDGFID IIDDH+    ++RNK   G    D
Sbjct  225   AFNIADFIPYLSWIDPQGLTARLVKARQSLDGFIDHIIDDHM---DKKRNKTSSGGGDQD  281

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
               +TDMVD+LLAFYSDE KVN+SDDLQN+I+LTRDNIK IIMDVMFGGTETVASAIEWAM
Sbjct  282   -VDTDMVDDLLAFYSDEAKVNESDDLQNSIRLTRDNIKAIIMDVMFGGTETVASAIEWAM  340

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AELM++PE+LK++QQEL   VGLDR+VEESD EKLT+LKCCLKE LRLHPPIPLLLHETA
Sbjct  341   AELMRSPEDLKKVQQELAGVVGLDRRVEESDFEKLTYLKCCLKEILRLHPPIPLLLHETA  400

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E   ++GY IPARSR +INAWAI RD  SW +PD FKP RFL+ GMPD+KGSNFEFIPFG
Sbjct  401   EDAVISGYRIPARSRVMINAWAIGRDPGSWTEPDKFKPSRFLESGMPDYKGSNFEFIPFG  460

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLYA ++AVAHL HCFTWELPDGMKPS++DM DVFGLTAP++TRLV +P
Sbjct  461   SGRRSCPGMQLGLYALDMAVAHLLHCFTWELPDGMKPSEMDMGDVFGLTAPRSTRLVAVP  520

Query  1650  TPRLNCQLH  1676
             TPRL   L+
Sbjct  521   TPRLVGALY  529



>gb|AGJ84132.1| putative ferulate 5-hydroxylase [Hibiscus cannabinus]
Length=518

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/510 (73%), Positives = 436/510 (85%), Gaps = 9/510 (2%)
 Frame = +3

Query  147   MVIYFVIPflflf-llsrlrrKPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLH  323
             M + F++PFL L  L+SRLRRKP+PPGPKG P+IGNM LMD  +HRGL KLA++YGG+ H
Sbjct  16    MALLFIVPFLVLLGLVSRLRRKPFPPGPKGLPIIGNMMLMDQLTHRGLDKLAKKYGGIFH  75

Query  324   LKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMR  503
             +KMG LH V +S P+ ARQVLQ QDNIFSNRPA++AI YL+YDRADMAFAHYGPFWRQMR
Sbjct  76    MKMGYLHTVTISNPEMARQVLQVQDNIFSNRPASIAIKYLTYDRADMAFAHYGPFWRQMR  135

Query  504   KLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSS  683
             K+CV+K+FSR+RAESW+SVRDEVD+ V+ VA N G ++N+G+LIF LT+NITYRAAFGS 
Sbjct  136   KICVMKVFSRKRAESWESVRDEVDSIVKAVAANEGKSINVGDLIFNLTKNITYRAAFGSI  195

Query  684   PSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKII  863
               S +GQDEFIKILQEFS+LFGAFN++DF P+L+  D QGLN RL  AR ALD FID II
Sbjct  196   --SEEGQDEFIKILQEFSRLFGAFNIADFIPWLTWVDPQGLNTRLKNARGALDKFIDTII  253

Query  864   DDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIK  1043
             D+HI Q R+R   +  GEV     ++DMVD+LLAFYS+E KV++SDDLQN+IKLT+DNIK
Sbjct  254   DEHI-QKRKRNVDDVAGEV-----DSDMVDDLLAFYSEEAKVDESDDLQNSIKLTKDNIK  307

Query  1044  GIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFL  1223
              IIMDVMFGGTETVASAIEWA++ELMK+PE++KR+QQEL + VGLDR+VEESD+EKLTFL
Sbjct  308   AIIMDVMFGGTETVASAIEWALSELMKSPEDMKRVQQELAEVVGLDRRVEESDIEKLTFL  367

Query  1224  KCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKP  1403
             KC LKETLRLHPPIPLLLHETAE T V GY IPA+SR +INAWAI RDK+SWEDPDSFKP
Sbjct  368   KCTLKETLRLHPPIPLLLHETAEDTVVAGYQIPAKSRVMINAWAIGRDKDSWEDPDSFKP  427

Query  1404  DRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPS  1583
              RFLKEG+ DFKGSNFEFIPFGSGRRSCPGM LGLYA +LAVAHL H FTWELPDGMKPS
Sbjct  428   SRFLKEGVADFKGSNFEFIPFGSGRRSCPGMGLGLYALDLAVAHLLHSFTWELPDGMKPS  487

Query  1584  DLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             +LDM DVFGLTAP+ATRL  +P  RL C L
Sbjct  488   ELDMSDVFGLTAPRATRLYAVPKKRLICPL  517



>ref|XP_009763889.1| PREDICTED: cytochrome P450 84A1-like [Nicotiana sylvestris]
 gb|ABC69406.1| CYP84A14v1 [Nicotiana tabacum]
Length=525

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/521 (73%), Positives = 442/521 (85%), Gaps = 9/521 (2%)
 Frame = +3

Query  117   VLEALEAHKHMVIYFVIPflflfllsrlrrKPYPPGPKGWPLIGNMNLMDHYSHRGLAKL  296
             +LE L+A   M+ YF++P   LFLLS+ RRK  PPGP GWPLIGNM +MD  +HRGLAKL
Sbjct  13    LLETLQATP-MIFYFIVPLFCLFLLSKSRRKRLPPGPTGWPLIGNMMMMDQLTHRGLAKL  71

Query  297   AEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMAFAH  476
             A++YGG+ HLKMG +H +VVSGPDEARQVLQ  D IFSNRPA VAISYL+YDRADMAFA 
Sbjct  72    AQKYGGVFHLKMGYVHKIVVSGPDEARQVLQEHDIIFSNRPATVAISYLTYDRADMAFAD  131

Query  477   YGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGLTRNI  656
             YG FWRQMRKLCV+KLFSR+RAESWDSVRDE D+ VR V  N G+AVN+GEL+F LTRNI
Sbjct  132   YGLFWRQMRKLCVMKLFSRKRAESWDSVRDEADSMVRIVTTNTGTAVNLGELVFSLTRNI  191

Query  657   TYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAA  836
              YRAAFG+    GQG  EFIKI+QEFSKLFGAFN++DF P+L     Q LN RLAKARA+
Sbjct  192   IYRAAFGTCSEDGQG--EFIKIMQEFSKLFGAFNIADFIPWLGWVGKQSLNIRLAKARAS  249

Query  837   LDGFIDKIIDDHILQTRRRRN-KNHGGEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQN  1013
             LDGFID IIDDHI++ +   N KN GG+      ETDMVDELLAFYS+E KV +S+DLQN
Sbjct  250   LDGFIDSIIDDHIIRKKAYVNGKNDGGD-----RETDMVDELLAFYSEEAKVTESEDLQN  304

Query  1014  AIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVE  1193
             AI+LT+DNIK IIMDVMFGGTETVASAIEWAMAELM++PE+LK++QQEL + VGL+RKVE
Sbjct  305   AIRLTKDNIKAIIMDVMFGGTETVASAIEWAMAELMRSPEDLKKVQQELANVVGLNRKVE  364

Query  1194  ESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKN  1373
             ESD EKLT+L+CCLKETLRLHPPIPLLLHETAE + V+GY+IPA+S  IIN++AI RDKN
Sbjct  365   ESDFEKLTYLRCCLKETLRLHPPIPLLLHETAEESTVSGYHIPAKSHVIINSFAIGRDKN  424

Query  1374  SWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFT  1553
             SWEDP+++KP RFLKEG+PDFKG NFEFIPFGSGRRSCPGMQLGLYA E+AVAHL HCFT
Sbjct  425   SWEDPETYKPSRFLKEGVPDFKGGNFEFIPFGSGRRSCPGMQLGLYALEMAVAHLLHCFT  484

Query  1554  WELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQLH  1676
             WELPDGMKPS+L MDD+FGLTAP+A RLV +PTPRL C L+
Sbjct  485   WELPDGMKPSELKMDDIFGLTAPRANRLVAVPTPRLLCPLY  525



>ref|XP_007157951.1| hypothetical protein PHAVU_002G111900g [Phaseolus vulgaris]
 gb|ESW29945.1| hypothetical protein PHAVU_002G111900g [Phaseolus vulgaris]
Length=522

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/489 (74%), Positives = 415/489 (85%), Gaps = 11/489 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG P+IGNM +MD  +HRGLA LA+QYGGL HL+MG LHMV +S P+ ARQVLQ
Sbjct  43    PYPPGPKGLPIIGNMLMMDQLTHRGLATLAKQYGGLFHLRMGFLHMVAISDPETARQVLQ  102

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPA +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW SVRDE
Sbjct  103   VQDNIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWQSVRDE  162

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD  VRTVA + G  VNIGEL+F LT+NI YRAAFGS+  S +GQDEFI ILQEFSKLFG
Sbjct  163   VDAAVRTVANSAGKTVNIGELVFNLTKNIIYRAAFGST--SQEGQDEFIGILQEFSKLFG  220

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P+L   D QGLN RLA+AR ALD FIDKII++H+     ++ KN  G   G 
Sbjct  221   AFNIADFIPYLGRVDPQGLNARLARARGALDSFIDKIIEEHV-----QKKKNGNGVCDG-  274

Query  930   GAETDMVDELLAFYSDEMKVNDS-DDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
               ETDMVDELLAFY++E K+N+  +D QN+I+LT+DNIK IIMDVMFGGTETVASAIEWA
Sbjct  275   --ETDMVDELLAFYTEEAKLNNEPEDFQNSIRLTKDNIKAIIMDVMFGGTETVASAIEWA  332

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             MAELM++PE+ KR+QQEL D VGLDR+VEESD EKLTFLKC LKETLRLHPPIPLLLHET
Sbjct  333   MAELMRSPEDQKRVQQELADVVGLDRRVEESDFEKLTFLKCTLKETLRLHPPIPLLLHET  392

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AE T V GY+IP ++R +INAWAI RDKN WE+P++FKP RFL+ G+PDFKGSNFEFIPF
Sbjct  393   AEETTVGGYFIPKKARVMINAWAIGRDKNCWEEPETFKPARFLEPGVPDFKGSNFEFIPF  452

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLYA E AVAHL HCFTWELPDGMKPS+LDM DVFGLTAPKATRL+ +
Sbjct  453   GSGRRSCPGMQLGLYALESAVAHLLHCFTWELPDGMKPSELDMGDVFGLTAPKATRLLAV  512

Query  1647  PTPRLNCQL  1673
             PT R+ C L
Sbjct  513   PTKRVVCPL  521



>ref|XP_009789924.1| PREDICTED: cytochrome P450 84A1-like [Nicotiana sylvestris]
Length=509

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/490 (71%), Positives = 415/490 (85%), Gaps = 14/490 (3%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K +PPGPKGWP+IGNM +MD  +HRGLAKLA++YGG+LHLKMG L + VVS PDEARQVL
Sbjct  34    KKFPPGPKGWPIIGNMMIMDQLTHRGLAKLAQKYGGILHLKMGYLPITVVSSPDEARQVL  93

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             Q QD +FSNRPA +A+ YLSYDRADMAFAHYGPFWRQMRKLCV+KLFSRRRAESWDSVRD
Sbjct  94    QLQDTVFSNRPATIAVKYLSYDRADMAFAHYGPFWRQMRKLCVMKLFSRRRAESWDSVRD  153

Query  567   EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLF  746
             EVD+  + VA + G +VN+GEL+FG+++N  YRAAFG+SP     +DE + I+QEFSKLF
Sbjct  154   EVDSMTKVVATSTGLSVNVGELVFGVSKNTIYRAAFGTSPDK---EDELLTIMQEFSKLF  210

Query  747   GAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSG  926
             GAFN++DF P+L   D QGLN R+ KARA+LD FID IIDDHI    +R+N+        
Sbjct  211   GAFNLADFIPWLGWVDPQGLNTRMIKARASLDCFIDTIIDDHI----QRKNEK-------  259

Query  927   DGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
             D  + DMVDELLAFY DE KV DSDDLQ+A++LTRDNIKGIIMDVMFGG ETVASA+EWA
Sbjct  260   DEKDNDMVDELLAFYDDEAKVTDSDDLQDALRLTRDNIKGIIMDVMFGGIETVASAVEWA  319

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             MAELM++PE+LKR+QQELT+ VGL RKVEE+D +KLT+LKCC+KETLRLHP IP+L+HE 
Sbjct  320   MAELMRSPEDLKRVQQELTNIVGLHRKVEETDFDKLTYLKCCIKETLRLHPVIPVLIHEA  379

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             A    ++G+YIPA+SR ++N WAI RDKNSWEDPD+FKP RFLKEG+ DFKG NFEF+PF
Sbjct  380   AADATLSGHYIPAKSRVLVNVWAIGRDKNSWEDPDTFKPSRFLKEGVADFKGGNFEFLPF  439

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGL+AFE+ +AHL HCFTWELPDGMKPSD+DMDD+FGLTAPKATRLV +
Sbjct  440   GSGRRSCPGMQLGLFAFEMTLAHLLHCFTWELPDGMKPSDVDMDDIFGLTAPKATRLVAV  499

Query  1647  PTPRLNCQLH  1676
             P+PRL C L+
Sbjct  500   PSPRLLCPLY  509



>ref|XP_002310288.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE90738.1| cytochrome P450 family protein [Populus trichocarpa]
Length=514

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/489 (74%), Positives = 418/489 (85%), Gaps = 12/489 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG PL+G+M++MD  +HRGLAKLA+QYGGL H++MG LHMV VS P+ ARQVLQ
Sbjct  37    PYPPGPKGLPLVGSMHMMDQITHRGLAKLAKQYGGLFHMRMGYLHMVTVSSPEIARQVLQ  96

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPAN+AI YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDE
Sbjct  97    VQDNIFSNRPANIAIRYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDE  156

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD+ ++TV  N G  VN+GELIF LT NITYRAAFG+     +GQDEFIKILQEFSKLFG
Sbjct  157   VDSMLKTVEANIGKPVNLGELIFTLTMNITYRAAFGAK---NEGQDEFIKILQEFSKLFG  213

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN+SDF P+L   D QGL+ RL KAR ALD FID IIDDHI    ++R +N+  E    
Sbjct  214   AFNMSDFIPWLGWIDPQGLSARLVKARKALDKFIDSIIDDHI----QKRKQNNFSE----  265

Query  930   GAETDMVDELLAFYSDEM-KVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
              AETDMVD++LAFYS+E  KV++SDDLQ AI LT+DNIK IIMDVMFGGTETVASAIEW 
Sbjct  266   DAETDMVDDMLAFYSEEARKVDESDDLQKAISLTKDNIKAIIMDVMFGGTETVASAIEWV  325

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             MAELMK+PE+ KR+QQEL D VGL+R+VEESD+EKLTFLKC LKETLR+HPPIPLLLHET
Sbjct  326   MAELMKSPEDQKRVQQELADVVGLERRVEESDIEKLTFLKCALKETLRMHPPIPLLLHET  385

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             +E  EV GY+IP ++R +INA+AI RDKNSWEDPD+FKP RFLK G+PDFKG++FEFIPF
Sbjct  386   SEDAEVAGYFIPKQTRVMINAYAIGRDKNSWEDPDAFKPSRFLKPGVPDFKGNHFEFIPF  445

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLY  +LAVAHL HCFTWELPDGMKPS+LDM D+FGLTAP+ATRLV +
Sbjct  446   GSGRRSCPGMQLGLYTLDLAVAHLLHCFTWELPDGMKPSELDMTDMFGLTAPRATRLVAV  505

Query  1647  PTPRLNCQL  1673
             P+ R+ C L
Sbjct  506   PSKRVLCPL  514



>gb|ACC63880.1| coniferyl aldehyde 5-hydroxylase [Populus trichocarpa]
Length=514

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/489 (74%), Positives = 418/489 (85%), Gaps = 12/489 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG PL+G+M++MD  +HRGLAKLA+QYGGL H++MG LHMV VS P+ ARQVLQ
Sbjct  37    PYPPGPKGLPLVGSMHMMDQITHRGLAKLAKQYGGLFHMRMGYLHMVTVSSPEIARQVLQ  96

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPAN+AI YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDE
Sbjct  97    VQDNIFSNRPANIAIRYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDE  156

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD+ ++TV  N G  VN+GELIF LT NITYRAAFG+     +GQDEFIKILQEFSKLFG
Sbjct  157   VDSMLKTVEANIGKPVNLGELIFTLTMNITYRAAFGAK---NEGQDEFIKILQEFSKLFG  213

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN+SDF P+L   D QGL+ RL KAR ALD FID IIDDHI    ++R +N+  E    
Sbjct  214   AFNMSDFIPWLGWIDPQGLSARLVKARKALDKFIDSIIDDHI----QKRKQNNFSE----  265

Query  930   GAETDMVDELLAFYSDEM-KVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
              AETDMVD++LAFYS+E  KV++SDDLQ AI LT+DNIK IIMDVMFGGTETVASAIEW 
Sbjct  266   DAETDMVDDMLAFYSEEARKVDESDDLQKAISLTKDNIKAIIMDVMFGGTETVASAIEWV  325

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             MAELMK+PE+ KR+QQEL D VGL+R+VEESD+EKLTFLKC LKETLR+HPPIPLLLHET
Sbjct  326   MAELMKSPEDQKRVQQELADVVGLERRVEESDIEKLTFLKCALKETLRMHPPIPLLLHET  385

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             +E  EV GY+IP ++R +INA+AI RDKNSWEDPD+FKP RF+K G+PDFKG++FEFIPF
Sbjct  386   SEDAEVAGYFIPKQTRVMINAYAIGRDKNSWEDPDAFKPSRFMKPGVPDFKGNHFEFIPF  445

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLY  +LAVAHL HCFTWELPDGMKPS+LDM D+FGLTAP+ATRLV +
Sbjct  446   GSGRRSCPGMQLGLYTLDLAVAHLLHCFTWELPDGMKPSELDMTDMFGLTAPRATRLVAV  505

Query  1647  PTPRLNCQL  1673
             P+ R+ C L
Sbjct  506   PSKRVLCPL  514



>gb|ABC69407.1| CYP84A14v2 [Nicotiana tabacum]
Length=525

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/521 (73%), Positives = 441/521 (85%), Gaps = 9/521 (2%)
 Frame = +3

Query  117   VLEALEAHKHMVIYFVIPflflfllsrlrrKPYPPGPKGWPLIGNMNLMDHYSHRGLAKL  296
             +LE L+A   M+ YF++P   LFLLS+ RRK  PPGP GWPLIGNM +MD  +HRGLAKL
Sbjct  13    LLETLQATP-MIFYFIVPLFCLFLLSKSRRKRLPPGPTGWPLIGNMMMMDQLTHRGLAKL  71

Query  297   AEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMAFAH  476
             A++YGG+ HLKMG +H +VVSGPDEARQVLQ  D IFSNRPA VAISYL+YDRADMAFA 
Sbjct  72    AQKYGGVFHLKMGYVHKIVVSGPDEARQVLQEHDIIFSNRPATVAISYLTYDRADMAFAD  131

Query  477   YGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGLTRNI  656
             YG FWRQMRKLCV+KLFSR+RAESWDSVRDE D+ VR V  N G+AVN+GEL+F LTRNI
Sbjct  132   YGLFWRQMRKLCVMKLFSRKRAESWDSVRDEADSMVRIVTTNTGTAVNLGELVFSLTRNI  191

Query  657   TYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAA  836
              YRAAFG+    GQG  EFI+I+QEFSKLFGAFN++DF P+L     Q LN RLAKARA+
Sbjct  192   IYRAAFGTCSEDGQG--EFIEIMQEFSKLFGAFNIADFIPWLGWVGKQSLNIRLAKARAS  249

Query  837   LDGFIDKIIDDHILQTRRRRN-KNHGGEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQN  1013
             LDGFID IIDDHI++ +   N KN GG+      ETDMVDELLAFYS+E KV +S+DLQN
Sbjct  250   LDGFIDSIIDDHIIRKKAYVNGKNDGGD-----RETDMVDELLAFYSEEAKVTESEDLQN  304

Query  1014  AIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVE  1193
             AI+LT+D+IK IIMDVMFGGTETVASAIEWAMAELM++PE+LK++QQ L + VGL+RKVE
Sbjct  305   AIRLTKDSIKAIIMDVMFGGTETVASAIEWAMAELMRSPEDLKKVQQGLANVVGLNRKVE  364

Query  1194  ESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKN  1373
             ESD EKLT+L+CCLKETLRLHPPIPLLLHETAE + V+GY+IPA+S  IIN++AI RDKN
Sbjct  365   ESDFEKLTYLRCCLKETLRLHPPIPLLLHETAEESTVSGYHIPAKSHVIINSFAIGRDKN  424

Query  1374  SWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFT  1553
             SWEDP+++KP RFLKEG+PDFKG NFEFIPFGSGRRSCPGMQLGLYA E+AVAHL HCFT
Sbjct  425   SWEDPETYKPSRFLKEGVPDFKGGNFEFIPFGSGRRSCPGMQLGLYALEMAVAHLLHCFT  484

Query  1554  WELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQLH  1676
             WELPDGMKPS+L MDD+FGLTAP+A RLV +PTPRL C L+
Sbjct  485   WELPDGMKPSELKMDDIFGLTAPRANRLVAVPTPRLLCPLY  525



>ref|XP_011025901.1| PREDICTED: cytochrome P450 84A1-like [Populus euphratica]
Length=514

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/489 (74%), Positives = 417/489 (85%), Gaps = 12/489 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG PL+G+M++MD  +HRGLAKLA+QYGGL H++MG LHMV VS P+ ARQVLQ
Sbjct  37    PYPPGPKGLPLVGSMHMMDQITHRGLAKLAKQYGGLFHMRMGYLHMVTVSSPEIARQVLQ  96

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPAN+AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDE
Sbjct  97    VQDNIFSNRPANIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDE  156

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD+ ++TV  N G  VN+GELIF LT NITYRAAFG+     +GQ EFIKILQEFSKLFG
Sbjct  157   VDSMLKTVEANIGKPVNLGELIFTLTMNITYRAAFGAK---NEGQGEFIKILQEFSKLFG  213

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN+SDF P+L   D QGL+ RL KAR ALD FID IIDDHI    ++R +N+  E    
Sbjct  214   AFNMSDFIPWLGWIDPQGLSARLVKARKALDKFIDSIIDDHI----QKRKQNNFSE----  265

Query  930   GAETDMVDELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
              AETDMVD++LAFYS+E + V++SDDLQ AI LT+DNIK IIMDVMFGGTETVASAIEWA
Sbjct  266   DAETDMVDDMLAFYSEEARQVDESDDLQKAISLTKDNIKAIIMDVMFGGTETVASAIEWA  325

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             MAELMK+PE+ KR+QQEL D VGL+R+VEESD +KLTFLKC LKETLR+HPPIPLLLHET
Sbjct  326   MAELMKSPEDQKRVQQELADVVGLERRVEESDFDKLTFLKCALKETLRMHPPIPLLLHET  385

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             +E  EV GY+IP ++R +INA+AI RDKNSWEDPD FKP RFLK G+PDFKG++FEFIPF
Sbjct  386   SEDAEVAGYFIPKQTRVMINAYAIGRDKNSWEDPDVFKPSRFLKPGVPDFKGNHFEFIPF  445

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLY  +LAVAHL HCFTWELPDGMKPS+LDM D+FGLTAP+ATRLV +
Sbjct  446   GSGRRSCPGMQLGLYTLDLAVAHLLHCFTWELPDGMKPSELDMTDMFGLTAPRATRLVAV  505

Query  1647  PTPRLNCQL  1673
             P+ R+ C L
Sbjct  506   PSKRVLCPL  514



>gb|AFZ78544.1| coniferaldehyde 5-hydroxylase [Populus tomentosa]
Length=512

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/488 (74%), Positives = 417/488 (85%), Gaps = 12/488 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG+PLIG+M+LMD  +HRGLAKLA+QYGGL H++MG LHMV VS P+ ARQVLQ
Sbjct  37    PYPPGPKGFPLIGSMHLMDQLTHRGLAKLAKQYGGLFHMRMGYLHMVAVSSPEVARQVLQ  96

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPAN+AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDE
Sbjct  97    VQDNIFSNRPANIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDE  156

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD+ VRTV  N G  VN+GELIF LT NITYRAAFG   +  +GQDEFIKILQEFSKLFG
Sbjct  157   VDSMVRTVESNIGKPVNVGELIFTLTMNITYRAAFG---AINEGQDEFIKILQEFSKLFG  213

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFNVSDF P+L   D QGL  RL KAR ALD FID IIDDHI   ++++  N+  E    
Sbjct  214   AFNVSDFIPWLGWIDPQGLTARLVKAREALDKFIDHIIDDHI---QKKKQNNYSVE----  266

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
              AETDMVD++L FYS+E KVN+SDDLQNAIKLTRDNIK IIMDVMFGGTETVASAIEWAM
Sbjct  267   -AETDMVDDMLTFYSEETKVNESDDLQNAIKLTRDNIKAIIMDVMFGGTETVASAIEWAM  325

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AEL+K+PE++KR+QQEL D VGL+R+VEESD +KLTF KC LKETLRLHPPIPLLLHET+
Sbjct  326   AELLKSPEDIKRVQQELADVVGLERRVEESDFDKLTFFKCTLKETLRLHPPIPLLLHETS  385

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             +  +++G+   +++R +INA+AI RDK+SWEDPDSFKP RFL  G+PDFKG++FEFIPFG
Sbjct  386   K-KKIHGHQSSSKTRVMINAYAIGRDKSSWEDPDSFKPSRFLGPGVPDFKGNHFEFIPFG  444

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLYA +LAVAHL HCFTWELPDGMKP +LDM D+FGLTAP+ATRLV +P
Sbjct  445   SGRRSCPGMQLGLYALDLAVAHLLHCFTWELPDGMKPGELDMTDMFGLTAPRATRLVAVP  504

Query  1650  TPRLNCQL  1673
               R+ C L
Sbjct  505   RKRVVCPL  512



>gb|AAD48912.1|AF139532_1 aldehyde 5-hydroxylase [Liquidambar styraciflua]
Length=511

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/489 (74%), Positives = 411/489 (84%), Gaps = 14/489 (3%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG P+IGNM +MD  +HRGLAKLA+QYGGL HLKMG LHMV VS PD ARQVLQ
Sbjct  37    PYPPGPKGLPVIGNMLMMDQLTHRGLAKLAKQYGGLFHLKMGFLHMVAVSTPDMARQVLQ  96

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPA +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDE
Sbjct  97    VQDNIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDE  156

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD+ VR VA N GS VNIGEL+F LT+NITYRAAFG+   S + QDEF+ ILQEFS+LFG
Sbjct  157   VDSAVRVVASNIGSTVNIGELVFALTKNITYRAAFGTI--SHEDQDEFVAILQEFSQLFG  214

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P+L     QG+N RL KAR ALDGFIDKIIDDHI            G  + +
Sbjct  215   AFNIADFIPWLKWVP-QGINVRLNKARGALDGFIDKIIDDHI----------QKGSKNSE  263

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
               +TDMVD+LLAFY +E KV++SDDLQN+IKLT+DNIK I MDVMFGGTETVASAIEWAM
Sbjct  264   EVDTDMVDDLLAFYGEEAKVSESDDLQNSIKLTKDNIKAI-MDVMFGGTETVASAIEWAM  322

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
              ELMK+PE+LK++QQEL   VGLDR+VEE D EKLT+LKC LKE LRLHPPIPLLLHETA
Sbjct  323   TELMKSPEDLKKVQQELAVVVGLDRRVEEKDFEKLTYLKCVLKEVLRLHPPIPLLLHETA  382

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E  EV GYYIPA+SR +INA AI RDKNSW DPD+F+P RFLK+G+PDFKG+NFEFIPFG
Sbjct  383   EDAEVGGYYIPAKSRVMINACAIGRDKNSWADPDTFRPSRFLKDGVPDFKGNNFEFIPFG  442

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLYA E  VAHL HCFTWELPDGMKPS+L+M+DVFGLTAP+A RL  +P
Sbjct  443   SGRRSCPGMQLGLYALETTVAHLLHCFTWELPDGMKPSELEMNDVFGLTAPRAIRLTAVP  502

Query  1650  TPRLNCQLH  1676
             +PRL C L+
Sbjct  503   SPRLLCPLY  511



>gb|AJD25205.1| cytochrome P450 CYP84A61 [Salvia miltiorrhiza]
Length=517

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/527 (71%), Positives = 437/527 (83%), Gaps = 10/527 (2%)
 Frame = +3

Query  93    MEKHNIIYVLEALEAHKHMVIYFVIPflflfllsrlrrKPYPPGPKGWPLIGNMNLMDHY  272
             MEK  +  VL+ALEA K + I  +IP LFLF LSR  RK YPPGPKGWP+IGNM +M   
Sbjct  1     MEK-KVFSVLQALEA-KPLSILLIIPLLFLFALSRFGRKRYPPGPKGWPVIGNMGMMGQL  58

Query  273   SHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYD  452
             SHRGLA+LA+QYGG++HLKMG LHMV +S PD ARQVLQ  DNIFSNRPAN AISYL+YD
Sbjct  59    SHRGLAELAKQYGGVVHLKMGFLHMVAISSPDAARQVLQVHDNIFSNRPANHAISYLTYD  118

Query  453   RADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGEL  632
             RADMAFA+YGPFWRQMRKLCV+KLFSR+RAESWDSVRDEVD+ VR V  + G  VNIGEL
Sbjct  119   RADMAFANYGPFWRQMRKLCVMKLFSRKRAESWDSVRDEVDHMVRAVXXSAGQPVNIGEL  178

Query  633   IFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNP  812
             +FGLTRNI YRAAFGSS  S +GQDEFI ILQEFSKLFGAFN++DF P+L+  DLQGLN 
Sbjct  179   VFGLTRNIVYRAAFGSS--SHEGQDEFIXILQEFSKLFGAFNIADFVPWLNGVDLQGLNS  236

Query  813   RLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVN  992
             RLAKARA+LDGFID IID HI+      ++      +    +TDMVDELLAFYS+E K++
Sbjct  237   RLAKARASLDGFIDAIIDQHIVNNNNLNSR------NNQSLDTDMVDELLAFYSEEAKIS  290

Query  993   DSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTV  1172
             +S+DL N+IKLTR+NIK IIMDVMFGGTETVASAIEWAM+EL+++PE ++++++EL + V
Sbjct  291   ESEDLHNSIKLTRNNIKAIIMDVMFGGTETVASAIEWAMSELLRSPEEIQKVKEELKNVV  350

Query  1173  GLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAW  1352
              L RKVEE D EKLT+L+CCLKE LRLHPPIPLLLHET+    ++GY++PARSR +INAW
Sbjct  351   SLARKVEEPDFEKLTYLRCCLKEVLRLHPPIPLLLHETSHDATISGYHVPARSRVMINAW  410

Query  1353  AIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVA  1532
             AI RD  +WED D FKP RFLK G PDFKGSNFEFIPFGSGRRSCPGMQLGL+A E+AVA
Sbjct  411   AIGRDSGAWEDADEFKPSRFLKAGAPDFKGSNFEFIPFGSGRRSCPGMQLGLHALEMAVA  470

Query  1533  HLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             HL HC+TWELPDGMKP +LDM DVFGLTAP+ATRLV +PTPRL C L
Sbjct  471   HLLHCYTWELPDGMKPDELDMSDVFGLTAPRATRLVAVPTPRLLCPL  517



>ref|XP_010113394.1| Cytochrome P450 84A1 [Morus notabilis]
 gb|AGT57171.1| ferulate 5-hydroxylase, partial [Morus notabilis]
 gb|EXC35401.1| Cytochrome P450 84A1 [Morus notabilis]
Length=504

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/479 (75%), Positives = 413/479 (86%), Gaps = 9/479 (2%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             ++GNM +M   +HRGLA LA+QYGG+ HLKMG LHMV +S PD ARQVLQ QDNIFSNRP
Sbjct  34    IVGNMAIMHQLTHRGLAALAKQYGGIFHLKMGYLHMVAISSPDTARQVLQIQDNIFSNRP  93

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDEVD TVR VA 
Sbjct  94    ATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDEVDKTVRVVAN  153

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
             N G+AVN+GEL+F LT +ITYRAAFG++  + +GQDEFI+ILQEFSKLFGAFN++DF P+
Sbjct  154   NTGTAVNVGELVFKLTMDITYRAAFGAA--AKEGQDEFIRILQEFSKLFGAFNIADFIPW  211

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             L+  D QGLN RL KAR ALDGFIDKIID+H+    +++ K +G  V  D  ETDMVD+L
Sbjct  212   LTWVDPQGLNTRLEKARKALDGFIDKIIDEHM----QKKEKMNG--VGNDEIETDMVDDL  265

Query  960   LAFY-SDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPEN  1136
             LAFY S+E KVN+++DLQNAI+LTRDNIK IIMDVMFGGTETVASAIEWA+ ELMK PE+
Sbjct  266   LAFYASEEAKVNETEDLQNAIRLTRDNIKAIIMDVMFGGTETVASAIEWALTELMKNPED  325

Query  1137  LKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYY  1316
             LK++QQEL D VGLDR++EESD EKLT+LKC LKETLRLHPPIPLLLHETAE   V GY+
Sbjct  326   LKKVQQELADVVGLDRRLEESDFEKLTYLKCALKETLRLHPPIPLLLHETAEDAAVAGYH  385

Query  1317  IPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGM  1496
             IP  SR +IN+WAI RDKNSW DPDSFKP RFLK+G+PDFKGSNFEFIPFGSGRRSCPGM
Sbjct  386   IPKGSRVMINSWAIGRDKNSWADPDSFKPARFLKDGVPDFKGSNFEFIPFGSGRRSCPGM  445

Query  1497  QLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             QLGLYA ELAV+HL HCFTWELPDGMKPS+LDM+DVFGLTAP+ATRL  IPT R+ C +
Sbjct  446   QLGLYALELAVSHLLHCFTWELPDGMKPSELDMNDVFGLTAPRATRLFAIPTKRVVCNI  504



>gb|ABS53040.1| Cald5H [Leucaena leucocephala]
Length=511

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/489 (73%), Positives = 413/489 (84%), Gaps = 15/489 (3%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG P+IGNM +MD  +HRGLAKLA  YGG+LHL+MG LHMV +S  D ARQVLQ
Sbjct  36    PYPPGPKGLPIIGNMAMMDQLTHRGLAKLANLYGGILHLRMGFLHMVAISDADSARQVLQ  95

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
               DNIFSNRPA +AISYL+Y RADMAFAHYGPFWRQMRK+CV+KLFSR+RAESW SV+DE
Sbjct  96    VHDNIFSNRPATIAISYLTYVRADMAFAHYGPFWRQMRKICVMKLFSRKRAESWQSVQDE  155

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             V+  VRTV  N G  VNIGEL+F LT+NITYRAAFGSS  S +GQDEFI ILQEFSKLFG
Sbjct  156   VETVVRTVGANTGKEVNIGELVFSLTKNITYRAAFGSS--SREGQDEFIGILQEFSKLFG  213

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P LS  D QGLN RLAKAR +LD FIDKIID+H +Q +++ ++         
Sbjct  214   AFNIADFIPSLSWVDPQGLNARLAKARGSLDSFIDKIIDEH-MQNKKKEDE---------  263

Query  930   GAETDMVDELLAFYS-DEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
               E DMVDELLAFYS D  KV++SDDL N+IKLT+DNIK IIMDVMFGGTETVASAIEWA
Sbjct  264   --EGDMVDELLAFYSEDHSKVSESDDLHNSIKLTKDNIKAIIMDVMFGGTETVASAIEWA  321

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             MAELM++PE+LKR+Q+EL + VGLDR+V+ESD+EKLT+LKC LKETLRLHPPIPLLLHET
Sbjct  322   MAELMRSPEDLKRVQRELAEVVGLDRRVQESDMEKLTYLKCALKETLRLHPPIPLLLHET  381

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AE   V+GY++P +SR +INAWAI RD+N+WEDPDSFKP RFL EG+PDFKGSNFEFIPF
Sbjct  382   AEDAVVSGYFVPKKSRVMINAWAIGRDRNAWEDPDSFKPARFLGEGVPDFKGSNFEFIPF  441

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLYA E+AVAHL HCF+WELPDGMKPS++DM DVFGLTAP+A+RLV +
Sbjct  442   GSGRRSCPGMQLGLYALEMAVAHLLHCFSWELPDGMKPSEMDMSDVFGLTAPRASRLVAV  501

Query  1647  PTPRLNCQL  1673
                RL C L
Sbjct  502   SRKRLVCPL  510



>ref|XP_006466893.1| PREDICTED: cytochrome P450 84A1-like [Citrus sinensis]
Length=514

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/509 (72%), Positives = 431/509 (85%), Gaps = 11/509 (2%)
 Frame = +3

Query  153   IYFVIPflflfllsrlrrK--PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHL  326
             ++F+IP LFL  +    R+  PYPPGP+G P+IGNM++MD  +HRGLAKL ++YGGL HL
Sbjct  15    VFFIIPLLFLLGVIARLRRRLPYPPGPRGLPIIGNMHMMDQLTHRGLAKLGKKYGGLCHL  74

Query  327   KMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRK  506
             +MG +HMV VS P+ ARQVLQ QDNIFSNRPA +AISYL+YDRADMAFA+YGPFWRQMRK
Sbjct  75    RMGFVHMVAVSNPEMARQVLQVQDNIFSNRPATIAISYLTYDRADMAFANYGPFWRQMRK  134

Query  507   LCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSP  686
             LCV+KLFSR+RAESW+SVRDEV+  V++ A N G AVN+GELIF LT NITYRAAFG S 
Sbjct  135   LCVMKLFSRKRAESWESVRDEVETLVKSAAANTGKAVNVGELIFTLTSNITYRAAFGLS-  193

Query  687   SSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIID  866
              S +GQDEFI+ILQEFSKLFGAFN++DF P+L+  D QGL  RL KAR ALD FID IID
Sbjct  194   -SNEGQDEFIRILQEFSKLFGAFNIADFIPWLNWIDPQGLYNRLPKARQALDRFIDNIID  252

Query  867   DHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKG  1046
             DHI    R+R+K+ GG      A++DMVD+LLAFYSDE KVN+S+DL N+IKLTRDNIK 
Sbjct  253   DHI----RKRDKSTGGSDD---ADSDMVDDLLAFYSDEAKVNESEDLNNSIKLTRDNIKA  305

Query  1047  IIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLK  1226
             IIMDVMFGGTETVASAIEWA+ ELM++PE+LKR+QQEL D VGLDR+VEESD +KLT+LK
Sbjct  306   IIMDVMFGGTETVASAIEWALTELMRSPEDLKRVQQELADVVGLDRRVEESDFDKLTYLK  365

Query  1227  CCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPD  1406
             C LKETLRLHPPIPLLLHETAE  EV GYY+PA+SR +INAWAI RD  +WEDPD+F+P 
Sbjct  366   CTLKETLRLHPPIPLLLHETAEEAEVGGYYMPAKSRVMINAWAIGRDPTAWEDPDTFRPS  425

Query  1407  RFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSD  1586
             RFLKEG+PDFKG+NFEFIPFGSGRRSCPGMQLGLYA ELAV HL HCF W+LPDGMKPS+
Sbjct  426   RFLKEGVPDFKGNNFEFIPFGSGRRSCPGMQLGLYALELAVVHLLHCFKWDLPDGMKPSE  485

Query  1587  LDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             LDM DVFGLTAP+A+RL+ +P+ RL C L
Sbjct  486   LDMSDVFGLTAPRASRLIAVPSKRLICPL  514



>ref|XP_006425557.1| hypothetical protein CICLE_v10025382mg [Citrus clementina]
 gb|ESR38797.1| hypothetical protein CICLE_v10025382mg [Citrus clementina]
Length=514

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/509 (72%), Positives = 431/509 (85%), Gaps = 11/509 (2%)
 Frame = +3

Query  153   IYFVIPflflfllsrlrrK--PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHL  326
             ++F+IP LFL  +    R+  PYPPGP+G P+IGNM++MD  +HRGLAKL ++YGGL HL
Sbjct  15    VFFIIPLLFLLGVIARLRRRLPYPPGPRGLPIIGNMHMMDQLTHRGLAKLGKKYGGLCHL  74

Query  327   KMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRK  506
             +MG +HMV VS P+ ARQVLQ QDNIFSNRPA +AISYL+YDRADMAFA+YGPFWRQMRK
Sbjct  75    RMGFVHMVAVSNPEMARQVLQVQDNIFSNRPATIAISYLTYDRADMAFANYGPFWRQMRK  134

Query  507   LCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSP  686
             LCV+KLFSR+RAESW+SVRDEV+  V++ A N G AVN+GELIF LT NITYRAAFG S 
Sbjct  135   LCVMKLFSRKRAESWESVRDEVETLVKSAAANTGKAVNVGELIFTLTSNITYRAAFGLS-  193

Query  687   SSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIID  866
              S +GQDEFI+ILQEFSKLFGAFN++DF P+L+  D QGL  RL KAR ALD FID IID
Sbjct  194   -SNEGQDEFIRILQEFSKLFGAFNIADFIPWLNWIDPQGLYNRLPKARQALDRFIDNIID  252

Query  867   DHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKG  1046
             DH+    R+R+K+ GG      A++DMVD+LLAFYSDE KVN+S+DL N+IKLTRDNIK 
Sbjct  253   DHM----RKRDKSTGGSDD---ADSDMVDDLLAFYSDEAKVNESEDLNNSIKLTRDNIKA  305

Query  1047  IIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLK  1226
             IIMDVMFGGTETVASAIEWA+ ELM++PE+LKR+QQEL D VGLDR+VEESD +KLT+LK
Sbjct  306   IIMDVMFGGTETVASAIEWALTELMRSPEDLKRVQQELADVVGLDRRVEESDFDKLTYLK  365

Query  1227  CCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPD  1406
             C LKETLRLHPPIPLLLHETAE  EV GYYIPA+SR +INAWAI RD  +WEDPD+F+P 
Sbjct  366   CTLKETLRLHPPIPLLLHETAEEAEVGGYYIPAKSRVMINAWAIGRDPTAWEDPDTFRPS  425

Query  1407  RFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSD  1586
             RFLKEG+PDFKG+NFEFIPFGSGRRSCPGMQLGLYA ELAV HL HCF W+LPDGMKPS+
Sbjct  426   RFLKEGVPDFKGNNFEFIPFGSGRRSCPGMQLGLYALELAVVHLLHCFKWDLPDGMKPSE  485

Query  1587  LDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             LDM DVFGLTAP+A+RL+ +P+ RL C L
Sbjct  486   LDMSDVFGLTAPRASRLIAVPSKRLICPL  514



>ref|XP_009338655.1| PREDICTED: cytochrome P450 84A1-like [Pyrus x bretschneideri]
Length=516

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/479 (76%), Positives = 412/479 (86%), Gaps = 11/479 (2%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             LIGNM LMD  +HRGLAKLA++YGG+ HL+MG LHMV +S PD ARQVLQ QDNIFSNRP
Sbjct  48    LIGNMLLMDQLTHRGLAKLAKKYGGIFHLRMGFLHMVAISSPDVARQVLQVQDNIFSNRP  107

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDEVD+ VRTV +
Sbjct  108   ATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDEVDSAVRTVTV  167

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
             + GSAVNIGEL+F LT+NI YRAAFG+S  S +GQDEFI ILQEFSKLFGAFN++DF P 
Sbjct  168   HVGSAVNIGELVFSLTKNIIYRAAFGTS--SQEGQDEFIGILQEFSKLFGAFNIADFIPS  225

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             L   D QGLN RLAKAR +LD FID IIDDH+        KN  G+   D +ETDMVDEL
Sbjct  226   LGWVDPQGLNNRLAKARESLDRFIDTIIDDHM-------EKNRNGKGVSD-SETDMVDEL  277

Query  960   LAFYSDEMKVNDSDD-LQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPEN  1136
             LAFYS+E KVN+S+D LQ+AIKLTRDNIK IIMDVMFGGTETVASAIEWAM+ELMK+PE+
Sbjct  278   LAFYSEEAKVNESEDNLQSAIKLTRDNIKAIIMDVMFGGTETVASAIEWAMSELMKSPED  337

Query  1137  LKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYY  1316
             LKR+QQEL D VGLDR+ EE+D EKLT+LKC LKETLRLHPPIPLLLHET+E   V GY 
Sbjct  338   LKRVQQELADVVGLDRRPEETDFEKLTYLKCALKETLRLHPPIPLLLHETSEDAVVAGYR  397

Query  1317  IPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGM  1496
             IP RSR +INAWAI RDK+SWED +SFKP RFLKEG+PDFKGSNFEFIPFGSGRRSCPGM
Sbjct  398   IPKRSRVMINAWAIGRDKDSWEDAESFKPSRFLKEGVPDFKGSNFEFIPFGSGRRSCPGM  457

Query  1497  QLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             QLGLYA E+AVAHL HCFTWELPDGMKPS+LDM+DVFGLTAP+A+RL+ +P+ R+ C L
Sbjct  458   QLGLYALEMAVAHLLHCFTWELPDGMKPSELDMNDVFGLTAPRASRLIAVPSKRVVCPL  516



>gb|KDO71086.1| hypothetical protein CISIN_1g010226mg [Citrus sinensis]
Length=514

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/509 (72%), Positives = 431/509 (85%), Gaps = 11/509 (2%)
 Frame = +3

Query  153   IYFVIPflflfllsrlrrK--PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHL  326
             ++F+IP LFL  +    R+  PYPPGP+G P+IGNM++MD  +HRGLAKL ++YGGL HL
Sbjct  15    VFFIIPLLFLLGVIARLRRRLPYPPGPRGLPIIGNMHMMDQLTHRGLAKLGKKYGGLCHL  74

Query  327   KMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRK  506
             +MG +HMV VS P+ ARQVLQ QDNIFSNRPA +AISYL+YDRADMAFA+YGPFWRQMRK
Sbjct  75    RMGFVHMVAVSNPEMARQVLQVQDNIFSNRPATIAISYLTYDRADMAFANYGPFWRQMRK  134

Query  507   LCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSP  686
             LCV+KLFSR+RAESW+SVRDEV+  V++ A N G AVN+GELIF LT NITYRAAFG S 
Sbjct  135   LCVMKLFSRKRAESWESVRDEVETLVKSAAANTGKAVNVGELIFTLTSNITYRAAFGLS-  193

Query  687   SSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIID  866
              S +GQDEFI+ILQEFSKLFGAFN++DF P+L+  D QGL  RL KAR ALD FID IID
Sbjct  194   -SNEGQDEFIRILQEFSKLFGAFNIADFIPWLNWIDPQGLYNRLPKARQALDRFIDNIID  252

Query  867   DHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKG  1046
             DH+    R+R+K+ GG      A++DMVD+LLAFYSDE KVN+S+DL N+IKLTRDNIK 
Sbjct  253   DHM----RKRDKSTGGSDD---ADSDMVDDLLAFYSDEAKVNESEDLNNSIKLTRDNIKA  305

Query  1047  IIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLK  1226
             IIMDVMFGGTETVASAIEWA+ ELM++PE+LKR+QQEL D VGLDR+VEESD +KLT+LK
Sbjct  306   IIMDVMFGGTETVASAIEWALTELMRSPEDLKRVQQELADVVGLDRRVEESDFDKLTYLK  365

Query  1227  CCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPD  1406
             C LKETLRLHPPIPLLLHETAE  EV GYY+PA+SR +INAWAI RD  +WEDPD+F+P 
Sbjct  366   CTLKETLRLHPPIPLLLHETAEEAEVGGYYMPAKSRVMINAWAIGRDPTAWEDPDTFRPS  425

Query  1407  RFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSD  1586
             RFLKEG+PDFKG+NFEFIPFGSGRRSCPGMQLGLYA ELAV HL HCF W+LPDGMKPS+
Sbjct  426   RFLKEGVPDFKGNNFEFIPFGSGRRSCPGMQLGLYALELAVVHLLHCFKWDLPDGMKPSE  485

Query  1587  LDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             LDM DVFGLTAP+A+RL+ +P+ RL C L
Sbjct  486   LDMSDVFGLTAPRASRLIAVPSKRLICPL  514



>ref|XP_009378215.1| PREDICTED: cytochrome P450 84A1-like [Pyrus x bretschneideri]
Length=516

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/479 (76%), Positives = 412/479 (86%), Gaps = 11/479 (2%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             LIGNM LMD  +HRGLAKLA++YGG+ HL+MG LHMV +S PD ARQVLQ QDNIFSNRP
Sbjct  48    LIGNMLLMDQLTHRGLAKLAKKYGGIFHLRMGFLHMVAISNPDVARQVLQVQDNIFSNRP  107

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDEVD+ VRTV +
Sbjct  108   ATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDEVDSAVRTVTV  167

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
             + GSAVNIGEL+F LT+NI YRAAFG+S  S +GQDEFI ILQEFSKLFGAFN++DF P 
Sbjct  168   HVGSAVNIGELVFSLTKNIIYRAAFGTS--SQEGQDEFIGILQEFSKLFGAFNIADFIPS  225

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             L   D QGLN RLAKAR +LD FID IIDDH+        K +G  VS   +ETDMVDEL
Sbjct  226   LGWVDPQGLNNRLAKARESLDRFIDTIIDDHM------EKKRNGKGVSD--SETDMVDEL  277

Query  960   LAFYSDEMKVNDSDD-LQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPEN  1136
             LAFYS+E KVN+S+D LQ+AIKLTRDNIK IIMDVMFGGTETVASAIEWAM+ELMK+PE+
Sbjct  278   LAFYSEEAKVNESEDNLQSAIKLTRDNIKAIIMDVMFGGTETVASAIEWAMSELMKSPED  337

Query  1137  LKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYY  1316
             LKR+QQEL D VGLDR+ EE+D EKLT+LKC LKETLRLHPPIPLLLHET+E   V GY 
Sbjct  338   LKRVQQELADVVGLDRRPEETDFEKLTYLKCALKETLRLHPPIPLLLHETSEDAVVAGYR  397

Query  1317  IPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGM  1496
             IP RSR +INAWAI RDK+SWED +SFKP RFLKEG+PDFKGSNFEFIPFGSGRRSCPGM
Sbjct  398   IPKRSRVMINAWAIGRDKDSWEDAESFKPSRFLKEGVPDFKGSNFEFIPFGSGRRSCPGM  457

Query  1497  QLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             QLGLYA E+AVAHL HCFTWELPDGMKPS+LDM+DVFGLTAP+A+RL+ +P+ R+ C L
Sbjct  458   QLGLYALEMAVAHLLHCFTWELPDGMKPSELDMNDVFGLTAPRASRLIAVPSKRVVCPL  516



>ref|XP_010679832.1| PREDICTED: cytochrome P450 84A1 [Beta vulgaris subsp. vulgaris]
Length=524

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/509 (71%), Positives = 421/509 (83%), Gaps = 5/509 (1%)
 Frame = +3

Query  150   VIYFVIPflflfllsrlrrKPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLK  329
              + F+ P L L+++S LRRKPYPPGPKG P IGNM +MD  +HRGLAKLA++YGGL HLK
Sbjct  21    TLLFIAPMLLLYIISTLRRKPYPPGPKGLPFIGNMMIMDQLTHRGLAKLAQRYGGLFHLK  80

Query  330   MGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKL  509
             MG +HM+VVS PDEARQVLQ QDNIFSNRPA VAISYL+YDRADMAFAHYGPFWRQMRKL
Sbjct  81    MGFVHMMVVSSPDEARQVLQVQDNIFSNRPATVAISYLTYDRADMAFAHYGPFWRQMRKL  140

Query  510   CVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPS  689
             CV++LFSR+RAESW SVRDEVD  VR ++    S VN+GE +F LT+N+ YRAAFGSS  
Sbjct  141   CVMRLFSRKRAESWQSVRDEVDYIVRILSEKARSPVNVGEHVFNLTKNVIYRAAFGSS--  198

Query  690   SGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDD  869
             S +GQDEFI ILQEFSKLFGAFN++DF PFL+  D  GLN RLAKAR++LDGFID+IIDD
Sbjct  199   SSEGQDEFIAILQEFSKLFGAFNIADFIPFLTWADPNGLNNRLAKARSSLDGFIDRIIDD  258

Query  870   HILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGI  1049
             HI    +R+  N       D  E DMVD+LL FYS+E KVN+S+DLQNAIKLTR+NIK I
Sbjct  259   HI---NKRKAVNGHDVKQEDKVENDMVDDLLNFYSEETKVNESEDLQNAIKLTRNNIKAI  315

Query  1050  IMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKC  1229
             IMDVMFGGTETVASAIEWAM ELM+ PE +KR+QQEL D +GLD++V+ESDL+KL F +C
Sbjct  316   IMDVMFGGTETVASAIEWAMTELMRNPEEMKRVQQELADVIGLDQRVKESDLDKLPFFRC  375

Query  1230  CLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDR  1409
             C+KETLRLHPPIPLLLHETAE   + GY IP +SR +INAWAI RD NSW+D   FKP R
Sbjct  376   CIKETLRLHPPIPLLLHETAEDAVIGGYSIPKQSRIMINAWAIGRDPNSWDDAQVFKPGR  435

Query  1410  FLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDL  1589
             FLKEG+PDFKG NFEFIPFGSGRRSCPGM LGLYA E+ VA+L H FTWELPDGMKPS+L
Sbjct  436   FLKEGVPDFKGGNFEFIPFGSGRRSCPGMVLGLYALEMCVANLLHSFTWELPDGMKPSEL  495

Query  1590  DMDDVFGLTAPKATRLVVIPTPRLNCQLH  1676
               DD+FGLTAP+ATRLV +P+PRL C L+
Sbjct  496   STDDIFGLTAPRATRLVAVPSPRLLCPLN  524



>gb|AAW50817.1| ferulate-5-hydroxylase [Broussonetia papyrifera]
 gb|AAW50818.1| ferulate-5-hydroxylase [Broussonetia papyrifera]
Length=514

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/530 (69%), Positives = 432/530 (82%), Gaps = 19/530 (4%)
 Frame = +3

Query  93    MEKHNIIYVLEALEAHKHMVIYFVIPflflfllsrlrrK--PYPPGPKGWPLIGNMNLMD  266
             M+  +I  + EAL+    M I+ VIP LFL       R   PYPPGPKG P+IG+M++MD
Sbjct  1     MDTKSITLLQEALKPLP-MAIFLVIPLLFLLGHILRSRGRLPYPPGPKGLPIIGSMSMMD  59

Query  267   HYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLS  446
               +HRGLA LA+QYGG+ HLKMG LHMV +S P+ ARQVLQ QDNIFSNRPAN+AI YL+
Sbjct  60    QLTHRGLAALAKQYGGIFHLKMGYLHMVAISSPETARQVLQLQDNIFSNRPANIAIRYLT  119

Query  447   YDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIG  626
             YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RA SW+SVR EV+ TV +VA + G+AVN+G
Sbjct  120   YDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAASWESVRGEVEKTVLSVAGSTGTAVNVG  179

Query  627   ELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGL  806
             EL+F  T +I YRAAFG+S  + +GQDEFI ILQEFSKLFGAFN++DF P+L+  D QGL
Sbjct  180   ELVFKTTMDIIYRAAFGAS--NKEGQDEFISILQEFSKLFGAFNMADFIPWLTWVDPQGL  237

Query  807   NPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYS-DEM  983
             N RL +AR ALD FIDKIID+H+++      KN       + AETDMVD+LLAFYS +E 
Sbjct  238   NGRLKRARKALDAFIDKIIDEHVVK------KN-------EAAETDMVDDLLAFYSNEEA  284

Query  984   KVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELT  1163
             KVND++DL NAI+LTRDNIK IIMDVMFGGTETVASAIEWAM E+M+ PE+LK++QQEL 
Sbjct  285   KVNDAEDLHNAIRLTRDNIKAIIMDVMFGGTETVASAIEWAMTEMMRCPEDLKKVQQELA  344

Query  1164  DTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAII  1343
             D VGLDR++EESD EKLT+L+C +KETLRLHPPIPLLLHETAE   V GY+IP  SR +I
Sbjct  345   DVVGLDRRLEESDFEKLTYLRCAIKETLRLHPPIPLLLHETAEDAAVAGYHIPKGSRVMI  404

Query  1344  NAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFEL  1523
             NAWAI RDKNSW DPDSFKP RFL++G+PDFKGSNFEFIPFGSGRRSCPGMQLGLYA EL
Sbjct  405   NAWAIGRDKNSWADPDSFKPARFLRDGVPDFKGSNFEFIPFGSGRRSCPGMQLGLYALEL  464

Query  1524  AVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
              V HL HCFTW LPDGMKPS+LDM+DVFGLTAP+ATRLV IPT R+ C +
Sbjct  465   TVGHLLHCFTWNLPDGMKPSELDMNDVFGLTAPRATRLVAIPTKRVVCTI  514



>ref|XP_003612110.1| Cytochrome P450 [Medicago truncatula]
 gb|AES95068.1| cytochrome P450 family ferulate hydroxylase [Medicago truncatula]
Length=519

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/512 (71%), Positives = 415/512 (81%), Gaps = 16/512 (3%)
 Frame = +3

Query  147   MVIYFVIPflflfllsrlrrKP--YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLL  320
             M I F++P + L  L     K   YPPGP G P+IGNM +MD  +HRGLA LA++YGG+ 
Sbjct  20    MAIMFIVPLILLLGLVSRILKRPRYPPGPIGLPIIGNMLMMDQLTHRGLANLAKKYGGIF  79

Query  321   HLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQM  500
             HL+MG LHMV +S  D ARQVLQ QDNIFSNRPA VAI YL+YDRADMAFAHYGPFWRQM
Sbjct  80    HLRMGFLHMVAISDADAARQVLQVQDNIFSNRPATVAIKYLTYDRADMAFAHYGPFWRQM  139

Query  501   RKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGS  680
             RKLCV+KLFSR+ AESW SVRDEVD  VRTV+ N G+ VNIGEL+F LT+NI YRAAFGS
Sbjct  140   RKLCVMKLFSRKHAESWQSVRDEVDYAVRTVSDNIGNPVNIGELVFNLTKNIIYRAAFGS  199

Query  681   SPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKI  860
             S  S +GQDEFI ILQEFSKLFGAFN+SDF P     D QGLN RL KAR  LD FIDKI
Sbjct  200   S--SREGQDEFIGILQEFSKLFGAFNISDFVPCFGAIDPQGLNARLVKARKELDSFIDKI  257

Query  861   IDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVN-DSDDLQNAIKLTRDN  1037
             ID+H+ + +   ++           ETDMVDELLAFYS+E K+N +SDDL N+IKLT+DN
Sbjct  258   IDEHVQKKKSVVDE-----------ETDMVDELLAFYSEEAKLNNESDDLNNSIKLTKDN  306

Query  1038  IKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLT  1217
             IK IIMDVMFGGTETVASAIEWAMAELMK+PE+LK++QQEL + VGL R+VEESD EKLT
Sbjct  307   IKAIIMDVMFGGTETVASAIEWAMAELMKSPEDLKKVQQELAEVVGLSRQVEESDFEKLT  366

Query  1218  FLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSF  1397
             +LKC LKETLRLHPPIPLLLHETAE   VNGY+IP ++R +INAWAI RD N WE+P SF
Sbjct  367   YLKCALKETLRLHPPIPLLLHETAEEATVNGYFIPKQARVMINAWAIGRDANCWEEPQSF  426

Query  1398  KPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMK  1577
             KP RFLK G+PDFKGSNFEFIPFGSGRRSCPGMQLGLYA +LAVAHL HCFTWELPDGMK
Sbjct  427   KPSRFLKPGVPDFKGSNFEFIPFGSGRRSCPGMQLGLYALDLAVAHLLHCFTWELPDGMK  486

Query  1578  PSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             PS++DM DVFGLTAP+A+RLV IPT R+ C L
Sbjct  487   PSEMDMSDVFGLTAPRASRLVAIPTKRVLCPL  518



>ref|XP_008372753.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 84A1-like [Malus 
domestica]
Length=516

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/479 (76%), Positives = 410/479 (86%), Gaps = 11/479 (2%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             LIGNM LMD  +HRGLAKLA++YGG+ HL+MG LHMV +S PD ARQVLQ QDNIFSNRP
Sbjct  48    LIGNMLLMDQLTHRGLAKLAKKYGGIFHLRMGFLHMVAISNPDVARQVLQVQDNIFSNRP  107

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDEVD++VRTV +
Sbjct  108   ATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDEVDSSVRTVTV  167

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
             + GSAVNIGEL+F LT+NI YRAAFG+S  S +GQDEFI ILQEFSKLFGAFN++DF P 
Sbjct  168   HVGSAVNIGELVFSLTKNIIYRAAFGTS--SQEGQDEFIGILQEFSKLFGAFNIADFIPS  225

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             L   D QGLN RLAKAR +LD FID IIDDH+        K   G+   DG ETDMVDEL
Sbjct  226   LGWVDPQGLNNRLAKARESLDRFIDTIIDDHM-------EKKRNGKGVSDG-ETDMVDEL  277

Query  960   LAFYSDEMKVNDSDD-LQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPEN  1136
             LAFYS+E KV +S+D LQNAIKLTRDNIK IIMDVMFGGT TVASAIEWAM+ELMK+PE+
Sbjct  278   LAFYSEEAKVYESEDNLQNAIKLTRDNIKAIIMDVMFGGTXTVASAIEWAMSELMKSPED  337

Query  1137  LKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYY  1316
             LKR+QQEL D VGLDR+ EE+D EKLT+LKC LKETLRLHPPIPLLLHET+E   V GY 
Sbjct  338   LKRVQQELADVVGLDRRPEETDFEKLTYLKCALKETLRLHPPIPLLLHETSEDAVVAGYR  397

Query  1317  IPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGM  1496
             IP RSR +INAWAI RDK+SWED +SFKP RFLKEG+PDFKGSNFEFIPFGSGRRSCPGM
Sbjct  398   IPKRSRVMINAWAIGRDKDSWEDAESFKPSRFLKEGVPDFKGSNFEFIPFGSGRRSCPGM  457

Query  1497  QLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             QLGLYA E+AVAHL HCFTWELPDGMKPS+LDM+DVFGLTAP+A+RL+ +P+ R+ C L
Sbjct  458   QLGLYALEMAVAHLLHCFTWELPDGMKPSELDMNDVFGLTAPRASRLIAVPSKRVVCPL  516



>ref|XP_008337913.1| PREDICTED: cytochrome P450 84A1-like [Malus domestica]
Length=517

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/483 (75%), Positives = 413/483 (86%), Gaps = 10/483 (2%)
 Frame = +3

Query  228   KGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIF  407
             KG PL GNM +MD  +HRGLAKLA+QYGG+ HL+MG LHMV +S PD ARQVLQ QDNIF
Sbjct  44    KGLPLFGNMLMMDQLTHRGLAKLAKQYGGIFHLRMGFLHMVAISNPDVARQVLQVQDNIF  103

Query  408   SNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVR  587
             SNRPA +AISYL+YDRADMAFAHYGPFWRQMRKLCV+K+FSR+RAESW+SVRDEVD  VR
Sbjct  104   SNRPATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKIFSRKRAESWESVRDEVDTAVR  163

Query  588   TVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSD  767
             TV ++ GSAVNIGEL+F LT+NI YRAAFG+S  S +GQDEFI ILQEFSKLFGAFN++D
Sbjct  164   TVTVHVGSAVNIGELVFSLTKNIIYRAAFGTS--SQEGQDEFIGILQEFSKLFGAFNIAD  221

Query  768   FFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDM  947
             F P L   D QGLN RLAKAR +LD FID IIDDH+ + ++     + GE       TDM
Sbjct  222   FIPSLGWVDPQGLNNRLAKARESLDRFIDTIIDDHMEKKKKNNKGLNDGE-------TDM  274

Query  948   VDELLAFYSDEMKVNDSDD-LQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMK  1124
             VD+LLAFYS+E KVN+S+D LQNAIKLTRDNIK IIMDVMFGGTETVASAIEWAM+ELMK
Sbjct  275   VDDLLAFYSEEAKVNESEDNLQNAIKLTRDNIKAIIMDVMFGGTETVASAIEWAMSELMK  334

Query  1125  TPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEV  1304
              PE+LKR+QQEL + VGLDR+ EE+D EKLT+LKC LKETLRLHPPIPLLLHET+E   V
Sbjct  335   NPEDLKRVQQELLNVVGLDRRPEEADFEKLTYLKCALKETLRLHPPIPLLLHETSEDAVV  394

Query  1305  NGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRS  1484
              GY+IP +SR +INAWAI RDK+SWEDP+SFKP RFLKEG+PDFKGSNFEFIPFGSGRRS
Sbjct  395   AGYHIPKKSRVMINAWAIGRDKDSWEDPESFKPSRFLKEGVPDFKGSNFEFIPFGSGRRS  454

Query  1485  CPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLN  1664
             CPGMQLGLYA E+AVAH+ HCFTWELPDGMKPS+LDM+DVFGLTAP+A+RLV +P+ R+ 
Sbjct  455   CPGMQLGLYALEMAVAHMLHCFTWELPDGMKPSELDMNDVFGLTAPRASRLVAVPSKRVV  514

Query  1665  CQL  1673
             C L
Sbjct  515   CPL  517



>gb|ABB02162.1| ferulate 5-hydroxylase [Medicago sativa]
Length=519

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/488 (73%), Positives = 407/488 (83%), Gaps = 14/488 (3%)
 Frame = +3

Query  213   YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQT  392
             YPPGPKG P+IGNM +MD  +HRGLA LA++YGG+ HL+MG LHMV +S  D ARQVLQ 
Sbjct  44    YPPGPKGLPVIGNMLMMDQLTHRGLANLAKKYGGIFHLRMGFLHMVAISDADAARQVLQV  103

Query  393   QDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEV  572
             QDNIFSNRPA VAI YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+ AESW SVRDEV
Sbjct  104   QDNIFSNRPATVAIKYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKHAESWQSVRDEV  163

Query  573   DNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGA  752
             D+ +RTV+ N G+ VNIGEL+F LT+NI YRAAFGSS  S +GQDEFI ILQEFSKLFGA
Sbjct  164   DHAIRTVSDNIGNPVNIGELVFNLTKNIIYRAAFGSS--SREGQDEFIGILQEFSKLFGA  221

Query  753   FNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDG  932
             FN+SDF P     D QGLN RL KAR  LD FIDKIID+H+ + +   ++          
Sbjct  222   FNISDFVPCFGAIDPQGLNARLVKARKDLDSFIDKIIDEHVQKKKSVVDE----------  271

Query  933   AETDMVDELLAFYSDEMKVN-DSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
              ETDMVDELLAFYS+E K+N +SDDL N+IKLT+DNIK IIMDVMFGGTETVASAIEWAM
Sbjct  272   -ETDMVDELLAFYSEEAKLNNESDDLHNSIKLTKDNIKAIIMDVMFGGTETVASAIEWAM  330

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AELMK+PE+LK++QQEL + VGL R+VEE D EKLT+LKC LKETLRLHPPIPLLLHETA
Sbjct  331   AELMKSPEDLKKVQQELAEVVGLSRQVEEPDFEKLTYLKCALKETLRLHPPIPLLLHETA  390

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E   VNGY+IP ++R +INAWAI RD N WE+P+SFKP RFLK G+PDFKGSNFEFIPFG
Sbjct  391   EEATVNGYFIPKQARVMINAWAIGRDANCWEEPESFKPSRFLKPGVPDFKGSNFEFIPFG  450

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLYA +LAVAHL HCFTWELPDGMKPS++DM DVFGLTAP+A+RL+ IP
Sbjct  451   SGRRSCPGMQLGLYALDLAVAHLLHCFTWELPDGMKPSEMDMSDVFGLTAPRASRLIAIP  510

Query  1650  TPRLNCQL  1673
             T R+ C L
Sbjct  511   TKRVLCPL  518



>gb|KHG17821.1| Cytochrome P450 protein [Gossypium arboreum]
Length=521

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/510 (73%), Positives = 428/510 (84%), Gaps = 10/510 (2%)
 Frame = +3

Query  147   MVIYFVIP-flflfllsrlrrKPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLH  323
             M + FVIP  L L L+SRLRRKP+PPGPKG P+IGNM +MD  +HRGLAKLA QYGG+ H
Sbjct  20    MALLFVIPFLLLLGLISRLRRKPFPPGPKGLPIIGNMMMMDQLTHRGLAKLAHQYGGIFH  79

Query  324   LKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMR  503
             LKMG LHMV +S P+ ARQVLQ QDNIFSNRPA +AISYL+YDRADMAFAHYGPFWRQMR
Sbjct  80    LKMGFLHMVAISNPEMARQVLQVQDNIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMR  139

Query  504   KLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSS  683
             KL V+KLFSR+RAESW+S+RDEVD+ V+ VA N G A+N+GELIF LT+NI YR+AFGS 
Sbjct  140   KLSVMKLFSRKRAESWESIRDEVDSLVKAVAANTGKAINMGELIFNLTKNIIYRSAFGSI  199

Query  684   PSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKII  863
               S +GQDEFI++LQEFSKLFGAFN++DF P+L   D QGLN RL  AR ALD FID II
Sbjct  200   --SQEGQDEFIRLLQEFSKLFGAFNIADFIPWLGWADPQGLNTRLENARCALDKFIDTII  257

Query  864   DDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIK  1043
             DDHI   +++RN         D  +TDMVD+LL FYS+E KVN+S+D+QN+IKLTRDNIK
Sbjct  258   DDHI--EKKKRNG-----DGPDDGDTDMVDDLLTFYSEEAKVNESEDVQNSIKLTRDNIK  310

Query  1044  GIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFL  1223
              IIMDVMFGGTETVASAIEWA++ELM+ PE +KR+QQEL + VGLDR+VEESD +KLT+L
Sbjct  311   AIIMDVMFGGTETVASAIEWALSELMRNPEEMKRVQQELAEVVGLDRRVEESDFDKLTYL  370

Query  1224  KCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKP  1403
             KC LKETLRLHPPIPLLLHETAE   V GY IPA+SR +INAWAI RD+NSWEDPDSFKP
Sbjct  371   KCTLKETLRLHPPIPLLLHETAEDAVVAGYQIPAKSRVMINAWAIGRDRNSWEDPDSFKP  430

Query  1404  DRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPS  1583
              RFLKEG+PDFKGSNFEFIPFGSGRRSCPGMQLGLYA ++AVAHL HCFTWELPDGMKPS
Sbjct  431   SRFLKEGVPDFKGSNFEFIPFGSGRRSCPGMQLGLYALDMAVAHLLHCFTWELPDGMKPS  490

Query  1584  DLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             +LDM D+FGLTAP+A RL  +P  RL C L
Sbjct  491   ELDMSDIFGLTAPRANRLYAVPKKRLVCPL  520



>gb|ABC68398.1| cytochrome P450 monooxygenase CYP84A16 [Glycine max]
Length=520

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/479 (74%), Positives = 406/479 (85%), Gaps = 9/479 (2%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM +MD  +HRGLA LA+ YGG+ HL+MG LHMV +S PD ARQVLQ QDNIFSNRP
Sbjct  49    IIGNMFMMDQLTHRGLANLAKHYGGIFHLRMGFLHMVAISDPDAARQVLQVQDNIFSNRP  108

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW SVRDEVD  VR VA 
Sbjct  109   ATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWQSVRDEVDAAVRAVAS  168

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
             + G  VNIGEL+F LT+NI YRAAFGSS  S +GQDEFIKILQEFSKLFGAFN++DF P+
Sbjct  169   SVGKPVNIGELVFNLTKNIIYRAAFGSS--SQEGQDEFIKILQEFSKLFGAFNIADFIPY  226

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             L C D QGLN RLA+AR ALD FIDKIID+H+      + KN       DG ETDMVDEL
Sbjct  227   LGCVDPQGLNSRLARARGALDSFIDKIIDEHV-----HKMKNDKSSEIVDG-ETDMVDEL  280

Query  960   LAFYSDEMKVN-DSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPEN  1136
             LAFYS+E K+N +SDDLQN+I+LT+DNIK IIMDVMFGGTETVASAIEWAMAELM++PE+
Sbjct  281   LAFYSEEAKLNNESDDLQNSIRLTKDNIKAIIMDVMFGGTETVASAIEWAMAELMRSPED  340

Query  1137  LKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYY  1316
              KR+QQEL D VGLDR+ EESD EKLT+LKC LKETLRLHPPIPLLLHETAE   V GY+
Sbjct  341   QKRVQQELADVVGLDRRAEESDFEKLTYLKCALKETLRLHPPIPLLLHETAEDATVGGYF  400

Query  1317  IPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGM  1496
             +P ++R +INAWAI RDKNSWE+P++FKP RFLK G+PDFKGSNFEFIPFGSGRRSCPGM
Sbjct  401   VPRKARVMINAWAIGRDKNSWEEPETFKPARFLKPGVPDFKGSNFEFIPFGSGRRSCPGM  460

Query  1497  QLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
              LGLYA ELAVAHL HCFTWELPDGMKPS++DM DVFGLTAP++TRL+ +PT R+ C L
Sbjct  461   VLGLYALELAVAHLLHCFTWELPDGMKPSEMDMGDVFGLTAPRSTRLIAVPTKRVVCPL  519



>ref|XP_004512097.1| PREDICTED: cytochrome P450 84A1-like [Cicer arietinum]
Length=527

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/488 (73%), Positives = 409/488 (84%), Gaps = 11/488 (2%)
 Frame = +3

Query  213   YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQT  392
             YPPGPKG P+IGNM +MD  +HRGLA LA+QYGG+ HL+MG LHMV +S  D ARQVLQ 
Sbjct  50    YPPGPKGLPIIGNMLMMDQLTHRGLANLAKQYGGIFHLRMGFLHMVAISDADTARQVLQV  109

Query  393   QDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEV  572
              DNIFSNRPA VAI YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDEV
Sbjct  110   HDNIFSNRPATVAIKYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDEV  169

Query  573   DNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGA  752
             D  VRTVA N G  VNIGEL+F LT+NI YRAAFGSS  S +GQD+FI ILQEFSKLFGA
Sbjct  170   DYAVRTVADNIGQPVNIGELVFNLTKNIIYRAAFGSS--SKEGQDKFIGILQEFSKLFGA  227

Query  753   FNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDG  932
             FN+SDF P L   D QG N RL K R ALD FIDKIID+H+    ++R+ N+  +     
Sbjct  228   FNISDFVPCLGAIDPQGFNTRLVKTRKALDSFIDKIIDEHV---EKKRDVNNVVD-----  279

Query  933   AETDMVDELLAFYSDEMKVN-DSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
              ETDMVDELLAF+S+E K+N +SDDL N+IKLT+DNIK IIMDVMFGGTETVASAIEWAM
Sbjct  280   EETDMVDELLAFHSEEAKLNNESDDLHNSIKLTKDNIKAIIMDVMFGGTETVASAIEWAM  339

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AELM++P++LKR+QQEL + VGL R+VEE D EKLT+LKC LKETLRLHPPIPLLLHETA
Sbjct  340   AELMRSPKDLKRVQQELDEVVGLGRRVEEPDYEKLTYLKCALKETLRLHPPIPLLLHETA  399

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E   VNGY+IP ++R ++NAWAI RD+N WE+P+SFKP RFLK G+PDFKGSNFEFIPFG
Sbjct  400   EDATVNGYFIPKKARVMVNAWAIGRDRNCWEEPESFKPSRFLKPGVPDFKGSNFEFIPFG  459

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLYA +LAVAHL HCFTWELP GMKPS+LDM DVFGLTAP+A+RLV IP
Sbjct  460   SGRRSCPGMQLGLYALDLAVAHLLHCFTWELPSGMKPSELDMSDVFGLTAPRASRLVAIP  519

Query  1650  TPRLNCQL  1673
             T R+ C L
Sbjct  520   TKRVVCPL  527



>gb|KDP46687.1| hypothetical protein JCGZ_06475 [Jatropha curcas]
Length=512

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/487 (72%), Positives = 410/487 (84%), Gaps = 12/487 (2%)
 Frame = +3

Query  213   YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQT  392
             YPPGPKG P+IGNM +MD  +HRGLAKLA+QYGGL HL+MG++HM+ VS P+ ARQVLQ 
Sbjct  38    YPPGPKGLPIIGNMLMMDQLTHRGLAKLAKQYGGLFHLRMGNIHMMAVSSPEIARQVLQV  97

Query  393   QDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEV  572
             QDNIFSNRPA +AISYL+Y+RADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SV+DEV
Sbjct  98    QDNIFSNRPATIAISYLTYNRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVKDEV  157

Query  573   DNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGA  752
             D  ++ V  N G  +N+GELIF LT NI YRAAFGS     +G+DEFI ILQEFSKLFGA
Sbjct  158   DCMIKKVVENKGRVLNVGELIFTLTMNIIYRAAFGSKI---EGKDEFIMILQEFSKLFGA  214

Query  753   FNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDG  932
             FN++DF P+L   D QGL  RL KAR ALD FID IID H+++      ++ G     DG
Sbjct  215   FNIADFIPWLGWIDPQGLTSRLGKARKALDRFIDLIIDQHMVK------RSQGIVPDEDG  268

Query  933   AETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMA  1112
                DMVD+LLAFYSDE +VN+SDDLQN+IKL RDNIK IIMDVMFGGTETVASAIEWA+ 
Sbjct  269   ---DMVDDLLAFYSDEAQVNESDDLQNSIKLARDNIKAIIMDVMFGGTETVASAIEWALT  325

Query  1113  ELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAE  1292
             ELMK+PE++K++QQEL + VGL+R+VEESD EKLTFLKC LKETLR+HPPIPLLLHET+ 
Sbjct  326   ELMKSPEDMKKVQQELAEVVGLERRVEESDFEKLTFLKCTLKETLRIHPPIPLLLHETSA  385

Query  1293  ATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGS  1472
               EV GYYIPA+SR +INAWAI RDKNSWEDPD+F+P RF+K G+PDFKGSNFEFIPFGS
Sbjct  386   DAEVAGYYIPAKSRVMINAWAIGRDKNSWEDPDTFRPSRFMKPGVPDFKGSNFEFIPFGS  445

Query  1473  GRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPT  1652
             GRRSCPGMQLGLYA +LAVAHL HCFTWELPDGMKPS++D +DVFGLTAP+ATRL+ +P 
Sbjct  446   GRRSCPGMQLGLYALDLAVAHLLHCFTWELPDGMKPSEIDTNDVFGLTAPRATRLIAVPN  505

Query  1653  PRLNCQL  1673
             PRL C +
Sbjct  506   PRLLCSI  512



>gb|EYU24083.1| hypothetical protein MIMGU_mgv1a025005mg, partial [Erythranthe 
guttata]
Length=499

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/496 (72%), Positives = 417/496 (84%), Gaps = 10/496 (2%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             KPYPPGPKGWPLIGN+++M+  +HRGLAKLA+QYGG+LHL+MG LH+V +S PD ARQVL
Sbjct  7     KPYPPGPKGWPLIGNIDMMNQLTHRGLAKLAKQYGGVLHLRMGFLHVVAISTPDGARQVL  66

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             Q  D IFSNRPAN+AISYLSYDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESWDSVRD
Sbjct  67    QVHDIIFSNRPANIAISYLSYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWDSVRD  126

Query  567   EVDNTVRTVA--MNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSK  740
             EVD+ V  VA   +  SAVNIGEL+FGLTRNI YRAAFG+  + G GQ +FI+ILQEFSK
Sbjct  127   EVDSMVHAVAETADGSSAVNIGELVFGLTRNIIYRAAFGTRSNEG-GQGDFIEILQEFSK  185

Query  741   LFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEV  920
             LFGAFN++DF P+L   D+QG+N R+ KAR +LDGFID IID+H++  ++++ KN+G   
Sbjct  186   LFGAFNIADFVPWLGGLDVQGINKRMIKARDSLDGFIDSIIDEHMI--KKKKAKNNGLIE  243

Query  921   SGDGAETDMVDELLAFYSDE-----MKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETV  1085
                  +TDMVDELL FYS E      ++ + D   + IKLTR+NIK IIMDVMFGGTETV
Sbjct  244   QTSNLDTDMVDELLDFYSSEDDAEVSELCEQDSHNSNIKLTRNNIKAIIMDVMFGGTETV  303

Query  1086  ASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppi  1265
             ASAIEWAMAELMK+PE++K++QQELT+ VGL RKVEE DLEKLT+L+CCLKE LRLHPPI
Sbjct  304   ASAIEWAMAELMKSPEDMKKVQQELTNEVGLARKVEEPDLEKLTYLRCCLKEVLRLHPPI  363

Query  1266  plllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGS  1445
             PLLLHETAE   V+GY+IPA+SR +INAWAI RD+++WED D FKP RFL++G+PDFKG 
Sbjct  364   PLLLHETAEDATVSGYHIPAKSRVMINAWAIGRDESAWEDADEFKPSRFLRDGVPDFKGG  423

Query  1446  NFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPK  1625
             NFEFIPFGSGRRSCPGMQLGLYA E AVAHL HCFTWELPDGMKP DLDM D+FGLTAP+
Sbjct  424   NFEFIPFGSGRRSCPGMQLGLYALETAVAHLLHCFTWELPDGMKPIDLDMSDLFGLTAPR  483

Query  1626  ATRLVVIPTPRLNCQL  1673
             A RLV +PTPRL C L
Sbjct  484   AERLVAVPTPRLLCPL  499



>gb|ABB02161.1| ferulate 5-hydroxylase [Medicago sativa]
Length=519

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/488 (73%), Positives = 405/488 (83%), Gaps = 14/488 (3%)
 Frame = +3

Query  213   YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQT  392
             YPPGPKG P+IGNM +MD  +HRGLA LA++YGG+ HL+MG LHMV +S  D ARQVLQ 
Sbjct  44    YPPGPKGLPIIGNMLMMDQLTHRGLANLAKKYGGIFHLRMGFLHMVAISDADAARQVLQV  103

Query  393   QDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEV  572
             QDNIFSNRPA VAI YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+ AESW SVRDEV
Sbjct  104   QDNIFSNRPATVAIKYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKHAESWQSVRDEV  163

Query  573   DNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGA  752
             D  VRTV+ N G+ VNIGEL+F LT+NI YRAAFGSS  S +GQDEFI ILQEFSKLFGA
Sbjct  164   DYAVRTVSDNIGNPVNIGELVFNLTKNIIYRAAFGSS--SREGQDEFIGILQEFSKLFGA  221

Query  753   FNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDG  932
             FN+SDF P     D QGLN RL KAR  LD FIDKIID+H+ + +   ++          
Sbjct  222   FNISDFVPCFGAIDPQGLNARLVKARKDLDSFIDKIIDEHVEKKKSVVDE----------  271

Query  933   AETDMVDELLAFYSDEMKVN-DSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
              ETDMVDELLAFYS+E K+N +SDDL N+IKLT+DNIK IIMDVMFGGTETVASAIEW M
Sbjct  272   -ETDMVDELLAFYSEEAKLNNESDDLHNSIKLTKDNIKAIIMDVMFGGTETVASAIEWVM  330

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AELMK+PE+LK++QQEL + VGL R+VEE D EKLT+LKC LKETLRLHPPIPLLLHETA
Sbjct  331   AELMKSPEDLKKVQQELAEVVGLSRQVEEPDFEKLTYLKCALKETLRLHPPIPLLLHETA  390

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E   VNGY+IP ++R +INAWAI RD N W++P+SFKP RFLK G+PDFKGSNFEFIPFG
Sbjct  391   EEATVNGYFIPKQARVMINAWAIGRDANCWDEPESFKPSRFLKPGVPDFKGSNFEFIPFG  450

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLYA +LAVAHL HCFTWELPDGMKPS++DM DVFGLTAP+A+RL+ IP
Sbjct  451   SGRRSCPGMQLGLYALDLAVAHLLHCFTWELPDGMKPSEMDMSDVFGLTAPRASRLIAIP  510

Query  1650  TPRLNCQL  1673
             T R+ C L
Sbjct  511   TKRVLCPL  518



>ref|XP_010029715.1| PREDICTED: cytochrome P450 84A1-like [Eucalyptus grandis]
 gb|KCW56671.1| hypothetical protein EUGRSUZ_I02371 [Eucalyptus grandis]
Length=524

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/490 (71%), Positives = 411/490 (84%), Gaps = 9/490 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGP+G P+IGNM ++D  +HRGLA LA +YGGLLHL+MG LHMV VS P+ ARQ+LQ
Sbjct  43    PYPPGPRGLPIIGNMLMLDQMTHRGLASLARKYGGLLHLRMGFLHMVAVSSPEHARQILQ  102

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD+ FSNRPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+++FSR+RAESW SVRDE
Sbjct  103   LQDHTFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKICVMRVFSRKRAESWRSVRDE  162

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD TVR VA + G+ VNIGEL+F LTR+ITYRAAFG+S +  +GQDEFI ILQEFSKLFG
Sbjct  163   VDKTVRAVAGSIGTVVNIGELVFALTRDITYRAAFGASAT--EGQDEFIGILQEFSKLFG  220

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P+L   D QG+N RL KAR +LD FIDKI+DDH+        KN    +  +
Sbjct  221   AFNLADFIPYLGRIDPQGINERLVKARGSLDRFIDKIMDDHM------EKKNKDKTLLSE  274

Query  930   GAETDMVDELLAFY-SDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
              AETDMVD+LLAFY  +E KVN+S+DLQN+IKLTR+NIK IIMDVMFGGTETVASAIEWA
Sbjct  275   EAETDMVDDLLAFYGEEEAKVNESEDLQNSIKLTRENIKAIIMDVMFGGTETVASAIEWA  334

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             M ELM++PE+LK++Q+EL D VGL R+VEESD EKLT+LKC +KETLRLHPPIPLLLHET
Sbjct  335   MTELMRSPEDLKKVQKELADVVGLHRRVEESDFEKLTYLKCVIKETLRLHPPIPLLLHET  394

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AE  EV+GY+IPA++R +INAWAI RD  SWEDPD+FKP RFL EG PDFKGSNFEFIPF
Sbjct  395   AEDAEVSGYFIPAKTRVMINAWAIGRDPTSWEDPDTFKPSRFLNEGAPDFKGSNFEFIPF  454

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLY  E +VA+L H FTWELPDG KP ++DM DVFGLTAP+A RL+ I
Sbjct  455   GSGRRSCPGMQLGLYGLEFSVANLIHSFTWELPDGQKPGEMDMSDVFGLTAPRAERLMAI  514

Query  1647  PTPRLNCQLH  1676
             P+PRL C L+
Sbjct  515   PSPRLLCPLY  524



>gb|ACJ85732.1| unknown [Medicago truncatula]
 gb|AFK36956.1| unknown [Medicago truncatula]
 gb|AFK39589.1| unknown [Medicago truncatula]
Length=519

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/512 (71%), Positives = 417/512 (81%), Gaps = 16/512 (3%)
 Frame = +3

Query  147   MVIYFVIPflflf-llsrlrrKP-YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLL  320
             M I F++P + L  L+SR+  +P YPPGP G P IGNM +MD  +HRGLA LA++YGG+ 
Sbjct  20    MAIMFIVPLILLLGLVSRILERPRYPPGPIGLPTIGNMLMMDQLTHRGLANLAKKYGGIF  79

Query  321   HLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQM  500
             HL+MG LHMV +S  D ARQVLQ QDNIFSNRP  VAI YL+YDRADMAFAHYGPFWRQM
Sbjct  80    HLRMGFLHMVAISDADAARQVLQVQDNIFSNRPTTVAIKYLTYDRADMAFAHYGPFWRQM  139

Query  501   RKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGS  680
             RKLCV+KLFSR+ AESW SVRDEVD  VRTV+ N G+ VNIGEL+F LT+NI YRAAFGS
Sbjct  140   RKLCVMKLFSRKHAESWQSVRDEVDYAVRTVSDNIGNPVNIGELVFNLTKNIIYRAAFGS  199

Query  681   SPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKI  860
             S  S +GQDEFI ILQEFSKLFGAFN+SDF P     D QGLN RL KAR  LD FIDKI
Sbjct  200   S--SREGQDEFIGILQEFSKLFGAFNISDFVPCFGAIDPQGLNARLVKARKELDSFIDKI  257

Query  861   IDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVN-DSDDLQNAIKLTRDN  1037
             ID+H+ + +   ++           ETDMVDELLAFYS+E K+N +SDDL N+IKLT+DN
Sbjct  258   IDEHVQKKKSVVDE-----------ETDMVDELLAFYSEEAKLNNESDDLNNSIKLTKDN  306

Query  1038  IKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLT  1217
             IK IIMDVMFGGTETVASAIEWAMAELMK+PE+LK++QQEL + VGL R+VEESD EKLT
Sbjct  307   IKAIIMDVMFGGTETVASAIEWAMAELMKSPEDLKKVQQELAEVVGLSRQVEESDFEKLT  366

Query  1218  FLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSF  1397
             + KC LKETLRLHPPIPLLLHETAE   VNGY+IP ++R +INAWAI RD N WE+P SF
Sbjct  367   YPKCALKETLRLHPPIPLLLHETAEEATVNGYFIPKQARVMINAWAIGRDANCWEEPQSF  426

Query  1398  KPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMK  1577
             KP RFLK G+PDFKGSNFEFIPFGSGRRSCPGMQLGLYA +LAVAHL HCFTWELPDGMK
Sbjct  427   KPSRFLKPGVPDFKGSNFEFIPFGSGRRSCPGMQLGLYALDLAVAHLLHCFTWELPDGMK  486

Query  1578  PSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             PS++DM DVFGLTAP+A+RLV IPT R+ C L
Sbjct  487   PSEMDMSDVFGLTAPRASRLVAIPTKRVLCPL  518



>ref|XP_010263873.1| PREDICTED: cytochrome P450 84A1-like [Nelumbo nucifera]
Length=512

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/489 (71%), Positives = 409/489 (84%), Gaps = 9/489 (2%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             KPYPPGPKG P++GNMN+MD  SHRGLAKLA++YGGL+HL++G LHMVVVS P+ ARQVL
Sbjct  32    KPYPPGPKGLPVVGNMNMMDQLSHRGLAKLAKEYGGLVHLRLGFLHMVVVSNPEMARQVL  91

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             Q QDNIFSNRPAN+AI YL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRD
Sbjct  92    QVQDNIFSNRPANMAIRYLTYDRADMAFAHYGPFWRQMRKICVMKVFSRKRAESWSSVRD  151

Query  567   EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLF  746
             EVD+ VR VA   GS VN+G L+F LT N+TYRAAFGS     +GQ++F+ ILQEFSKLF
Sbjct  152   EVDSIVRAVAAKAGSPVNLGGLVFQLTMNVTYRAAFGSDIC--EGQEKFVAILQEFSKLF  209

Query  747   GAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSG  926
             GAFN+ DF P+L+ FD QG N RLA+AR +LD FIDKIID H+ + + +++ N       
Sbjct  210   GAFNLVDFIPWLNWFDPQGFNKRLARARRSLDVFIDKIIDAHLAKRKNKKSDN-------  262

Query  927   DGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
                + DMVD+LLAFY +E K  +SDDLQ +IK+TRDNIK IIMDVMFGGTETVASAIEWA
Sbjct  263   TEEDNDMVDDLLAFYDEEAKKGESDDLQGSIKMTRDNIKAIIMDVMFGGTETVASAIEWA  322

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             MAE+MK+ E+LKR+QQEL D VGLDR V+ESD +KLTFLKC +KETLRLHPPIPLLLHET
Sbjct  323   MAEMMKSTEDLKRVQQELADVVGLDRIVQESDFDKLTFLKCVIKETLRLHPPIPLLLHET  382

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AE  EV GY IP +SR +INAWA+ RD  SW+ P++FKP RFL++G PDFKGSNFEFIPF
Sbjct  383   AEDAEVAGYAIPKKSRVVINAWAVNRDPGSWDQPETFKPSRFLEQGAPDFKGSNFEFIPF  442

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLYA EL +AHL HCFTWEL DGMKPS+LDM+DVFGLTAP+A RLV +
Sbjct  443   GSGRRSCPGMQLGLYALELTMAHLLHCFTWELSDGMKPSELDMNDVFGLTAPRAERLVAV  502

Query  1647  PTPRLNCQL  1673
             PTPRL C L
Sbjct  503   PTPRLQCPL  511



>ref|XP_003547953.1| PREDICTED: cytochrome P450 84A1-like [Glycine max]
Length=518

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/489 (72%), Positives = 411/489 (84%), Gaps = 12/489 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG PLIGNMN+M+  +H+GLA LA+QYGG+LHL++G LHMV +S  + AR+VLQ
Sbjct  41    PYPPGPKGLPLIGNMNIMNQLTHKGLANLAKQYGGVLHLRIGFLHMVAISNAEAAREVLQ  100

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+KLFSR+RAESW++VRDE
Sbjct  101   VQDNIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKICVMKLFSRKRAESWNTVRDE  160

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD  +R+V  N GS VN+GEL+F LT+NI YRAAFGSS  S +GQDEFI ILQEFSKLFG
Sbjct  161   VDFIIRSVTNNLGSPVNVGELVFNLTKNIIYRAAFGSS--SQEGQDEFISILQEFSKLFG  218

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFNV+DF PFL   D QGLN RL KARA+LD FIDKIID+H+   ++RR+ + G E    
Sbjct  219   AFNVADFVPFLGWVDPQGLNKRLVKARASLDSFIDKIIDEHV---QKRRSGHDGDE----  271

Query  930   GAETDMVDELLAFYSDEMKVND-SDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
               E+DMVDELL FYS E K+ND SD+L N+I LTRDNIK IIMDVMFGGTETVAS IEWA
Sbjct  272   --ESDMVDELLNFYSHEAKLNDESDELLNSISLTRDNIKAIIMDVMFGGTETVASGIEWA  329

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             MAELM++P++L+R+QQEL D VGLDR+VEESDLEKL +LKC +KETLRLHPPIPLLLHET
Sbjct  330   MAELMRSPDDLRRVQQELADVVGLDRRVEESDLEKLVYLKCAVKETLRLHPPIPLLLHET  389

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AE   V GY++P  SR +INAWAI RDK++WED ++FKP RFL   +PDFKGSNFEFIPF
Sbjct  390   AEDAAVCGYHVPKGSRVMINAWAIGRDKSAWEDAEAFKPSRFLNPHVPDFKGSNFEFIPF  449

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLY  ELA+AHL HCFTWELPDGMKPS+LD  DVFGLTAP+A+RLV +
Sbjct  450   GSGRRSCPGMQLGLYTLELAMAHLLHCFTWELPDGMKPSELDTSDVFGLTAPRASRLVAV  509

Query  1647  PTPRLNCQL  1673
             P  R+ C L
Sbjct  510   PFKRVLCPL  518



>ref|XP_003537622.1| PREDICTED: cytochrome P450 84A1-like [Glycine max]
Length=521

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/480 (73%), Positives = 408/480 (85%), Gaps = 10/480 (2%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM +MD  +HRGLA LA+ YGG+ HL+MG LHMV +S PD ARQVLQ QDNIFSNRP
Sbjct  49    IIGNMFMMDQLTHRGLANLAKHYGGIFHLRMGFLHMVAISDPDAARQVLQVQDNIFSNRP  108

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +AISYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW SVRDEVD+ VR VA 
Sbjct  109   ATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWQSVRDEVDSAVRAVAN  168

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
             + G  VNIGEL+F LT+NI YRAAFGSS  S +GQD+FIKILQEFSKLFGAFN++DF P+
Sbjct  169   SVGKPVNIGELVFNLTKNIIYRAAFGSS--SQEGQDDFIKILQEFSKLFGAFNIADFIPY  226

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             L   D QGLN RLA+AR ALD FIDKIID+H+    +++N     E+ GDG ETDMVDEL
Sbjct  227   LGRVDPQGLNSRLARARGALDSFIDKIIDEHV----QKKNNYQSSEI-GDG-ETDMVDEL  280

Query  960   LAFYSDEMKVNDS--DDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPE  1133
             LAFY +E K+N+   D+LQN+I+LT+DNIK IIMDVMFGGTETVASAIEW M+ELM++PE
Sbjct  281   LAFYGEEAKLNNESDDNLQNSIRLTKDNIKAIIMDVMFGGTETVASAIEWVMSELMRSPE  340

Query  1134  NLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGY  1313
             + KR+QQEL D VGLDR+VEESD EKLT+LKC LKETLRLHPPIPLLLHETAE   V GY
Sbjct  341   DQKRVQQELADVVGLDRRVEESDFEKLTYLKCALKETLRLHPPIPLLLHETAEDATVGGY  400

Query  1314  YIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPG  1493
             ++P ++R +INAWAI RDKNSWE+P++FKP RFLK G+PDFKGSNFEFIPFGSGRRSCPG
Sbjct  401   FVPRKARVMINAWAIGRDKNSWEEPETFKPARFLKPGVPDFKGSNFEFIPFGSGRRSCPG  460

Query  1494  MQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             M LGLYA ELAVAHL HCFTWELPDGMKPS++DM DVFGLTAP++TRL+ +PT R+ C L
Sbjct  461   MVLGLYALELAVAHLLHCFTWELPDGMKPSEMDMGDVFGLTAPRSTRLIAVPTKRVVCPL  520



>ref|XP_010526785.1| PREDICTED: cytochrome P450 84A1 [Tarenaya hassleriana]
Length=519

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/475 (73%), Positives = 402/475 (85%), Gaps = 7/475 (1%)
 Frame = +3

Query  237   PLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNR  416
             P+IGNM++MD  +HRGLAKL+++YGGL HL++G LHM  VS PD ARQVLQ QDNIFSNR
Sbjct  47    PIIGNMSMMDQLTHRGLAKLSQKYGGLFHLRIGFLHMFAVSSPDVARQVLQVQDNIFSNR  106

Query  417   PANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVA  596
             PA VAISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V 
Sbjct  107   PATVAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSVM  166

Query  597   MNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFP  776
              N G  VN+GELIF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFN++DF P
Sbjct  167   ANVGKPVNVGELIFALTRNITYRAAFGSA--CEEGQDEFIRILQEFSKLFGAFNIADFIP  224

Query  777   FLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDE  956
             +L   D QGLN RL  AR ALDGFID IID+H+   +R R K +  +  GD   TDMVD+
Sbjct  225   YLGWIDPQGLNRRLVNARKALDGFIDDIIDEHM--KKREREKQNIADQDGD---TDMVDD  279

Query  957   LLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPEN  1136
             LLAFYS+E + N+SDD QN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++PE+
Sbjct  280   LLAFYSEEAQPNESDDTQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELIRSPED  339

Query  1137  LKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYY  1316
             LKR QQEL + VG DR+VEE+ +EKLTFLKCCLKETLRLHPPIPLLLHETAE  E++G++
Sbjct  340   LKRAQQELAEVVGFDRRVEETHMEKLTFLKCCLKETLRLHPPIPLLLHETAEDAEIDGFF  399

Query  1317  IPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGM  1496
             IP RSR +INA+AI RD NSW DP+ F P RFLK G+PDFKGSNFEFIPFGSGRRSCPGM
Sbjct  400   IPKRSRVMINAFAIGRDPNSWSDPERFDPSRFLKPGVPDFKGSNFEFIPFGSGRRSCPGM  459

Query  1497  QLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRL  1661
             QLGLYA +LAVAHL HCFTWELPDGMKPS+LDM DVFGLTAP+ATRLV +P  RL
Sbjct  460   QLGLYALDLAVAHLLHCFTWELPDGMKPSELDMSDVFGLTAPRATRLVAVPATRL  514



>ref|XP_006412017.1| hypothetical protein EUTSA_v10024928mg [Eutrema salsugineum]
 gb|ESQ53470.1| hypothetical protein EUTSA_v10024928mg [Eutrema salsugineum]
Length=520

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/489 (71%), Positives = 414/489 (85%), Gaps = 8/489 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGP+GWP+IGNM +MD  +HRGLA LA++YGGL HL+MG LHM  VS PD ARQVLQ
Sbjct  39    PYPPGPRGWPIIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPDVARQVLQ  98

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD++FSNRPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDE
Sbjct  99    VQDSVFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDE  158

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD  +R+V+ N G  +N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFG
Sbjct  159   VDKMIRSVSNNVGKPINVGEQIFALTRNITYRAAFGSA--REKGQDEFIRILQEFSKLFG  216

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFNV+DF P+    D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD
Sbjct  217   AFNVADFIPYFGWIDPQGINKRLVKARDDLDGFIDDIIDEHM-----KKKENQSTVDDGD  271

Query  930   GAETDMVDELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
               +TDMVD+LLAFYS+E K V+D+ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA
Sbjct  272   VVDTDMVDDLLAFYSEEAKLVSDATDLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWA  331

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             + EL+++PE+LKR+QQEL + VGLDR+VEESD+EKLTFLKC LKETLRLHPPIPLLLHET
Sbjct  332   LTELLRSPEDLKRVQQELAEVVGLDRRVEESDIEKLTFLKCTLKETLRLHPPIPLLLHET  391

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AE  E++G+++P +SR +INA+AI RD NSW DP++F+P RFL+ G+PDFKGSNFEFIPF
Sbjct  392   AEDAEIDGFFVPKKSRVMINAFAIGRDPNSWVDPETFRPSRFLEPGVPDFKGSNFEFIPF  451

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLYA ELAVAH+ HCFTW+LPDGMKPS+LDM DVFGLTAPKATRL  +
Sbjct  452   GSGRRSCPGMQLGLYALELAVAHILHCFTWKLPDGMKPSELDMSDVFGLTAPKATRLFAV  511

Query  1647  PTPRLNCQL  1673
             P+ RL C +
Sbjct  512   PSTRLICAV  520



>dbj|BAM66576.1| ferulate-5-hydroxylase [Chrysanthemum x morifolium]
Length=506

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/510 (68%), Positives = 417/510 (82%), Gaps = 11/510 (2%)
 Frame = +3

Query  147   MVIYFVIPflflfllsrlrrKPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHL  326
             + IY +I  +    +S +RRKP PPGP GWP+IGNM +MD  +HRGLA LA++YGG+LHL
Sbjct  8     IAIYALIALITFLFISWIRRKPLPPGPMGWPIIGNMLMMDQLTHRGLAGLAKKYGGILHL  67

Query  327   KMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRK  506
             KMG  H + +S P+ A++VLQ +DNIF+NRPA +AI YL+YD ADMAF  YGPFWRQMRK
Sbjct  68    KMGFGHTIAISSPEMAKEVLQVKDNIFANRPATIAIRYLTYDCADMAFTDYGPFWRQMRK  127

Query  507   LCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSP  686
             LCV+KLFSRRRAESWDSVRDEVD  V+  A+N G  VN+GEL+FGLT +I YRAAFGS  
Sbjct  128   LCVMKLFSRRRAESWDSVRDEVDTMVKATAINTGLPVNLGELVFGLTHDIIYRAAFGSI-  186

Query  687   SSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIID  866
              S +G++EFI+ILQE++KLFGAFN++DF P+L   D  GLN RL  ARAALD FIDKIID
Sbjct  187   -SHEGKEEFIRILQEYTKLFGAFNLADFIPWLGFIDPAGLNTRLPAARAALDRFIDKIID  245

Query  867   DHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKG  1046
             +H+ +         G ++  + AE DMVDE+LAFYS+E K+N+ DDLQNAIKLTRDNIK 
Sbjct  246   EHLTK---------GKKIGDEDAENDMVDEMLAFYSEEGKINEVDDLQNAIKLTRDNIKA  296

Query  1047  IIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLK  1226
             IIMDVMFGGTETVASAIEWAMAELM TPE LKR+QQELTD VGL+R+VEESD E+LT+ K
Sbjct  297   IIMDVMFGGTETVASAIEWAMAELMHTPEALKRVQQELTDVVGLERRVEESDFERLTYFK  356

Query  1227  CCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPD  1406
             C +KETLR+HPPIP+ LH+++EAT V+GYYIP  SR ++N +AI RDK+ WEDPD+F P 
Sbjct  357   CVIKETLRMHPPIPVTLHKSSEATTVDGYYIPKGSRVMVNQYAINRDKDYWEDPDTFNPS  416

Query  1407  RFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSD  1586
             RFLK+G PDFKG+NFEF+PFGSGRRSCPGMQLGLYA E+AVAHL H FTWELPDGMKPS+
Sbjct  417   RFLKDGSPDFKGNNFEFLPFGSGRRSCPGMQLGLYATEMAVAHLLHSFTWELPDGMKPSE  476

Query  1587  LDMDDVFGLTAPKATRLVVIPTPRLNCQLH  1676
             LDM DVFGLTAPKA RLV +PTPRL C L+
Sbjct  477   LDMGDVFGLTAPKAVRLVAVPTPRLLCPLY  506



>ref|XP_009138414.1| PREDICTED: cytochrome P450 84A1-like [Brassica rapa]
Length=519

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/490 (70%), Positives = 413/490 (84%), Gaps = 8/490 (2%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             + YPPGP+GWP+IGNM +MD  +HRGLA LA++YGGL HL+MG LHM  VS PD ARQVL
Sbjct  37    RSYPPGPRGWPIIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPDVARQVL  96

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             Q QD+IFSNRPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRD
Sbjct  97    QVQDSIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRD  156

Query  567   EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLF  746
             EVD  +R+V+ N G ++N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLF
Sbjct  157   EVDKMIRSVSSNVGKSINVGEQIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLF  214

Query  747   GAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSG  926
             GAFNV+DF P+    D QG++ RL KAR  LDGFID IID+H+     ++ +N      G
Sbjct  215   GAFNVADFIPYFGWIDPQGISKRLVKARNDLDGFIDDIIDEHM-----KKKENQNTVDDG  269

Query  927   DGAETDMVDELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEW  1103
             D  +TDMVD+LLAFYS+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEW
Sbjct  270   DVGDTDMVDDLLAFYSEEAKLVSETMDLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEW  329

Query  1104  AMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhE  1283
             A+ EL+++PE+LKR+QQEL + VGLDR+VEESD+EKLTFLKC LKETLRLHPPIPLLLHE
Sbjct  330   ALTELLRSPEDLKRVQQELAEVVGLDRRVEESDIEKLTFLKCTLKETLRLHPPIPLLLHE  389

Query  1284  TAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIP  1463
             TAE TE++GY++P +SR +INA+AI RD  SW D ++F+P RFL+ G+ DFKGSNFEFIP
Sbjct  390   TAEDTEIDGYFVPKKSRVMINAFAIGRDPKSWPDAETFRPSRFLEPGVADFKGSNFEFIP  449

Query  1464  FGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVV  1643
             FGSGRRSCPGMQLGLYA ELAVAH+ HCFTW+LPDGMK S+LDM+DVFGLTAPKATRL  
Sbjct  450   FGSGRRSCPGMQLGLYALELAVAHILHCFTWKLPDGMKASELDMNDVFGLTAPKATRLFA  509

Query  1644  IPTPRLNCQL  1673
             +P+ RL C +
Sbjct  510   VPSTRLICAV  519



>ref|XP_006283399.1| hypothetical protein CARUB_v10004440mg [Capsella rubella]
 gb|EOA16297.1| hypothetical protein CARUB_v10004440mg [Capsella rubella]
Length=585

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/489 (71%), Positives = 413/489 (84%), Gaps = 8/489 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGP+GWP+IGNM +MD  +HRGLA LA++YGGL HL+MG LHM  VS PD ARQVLQ
Sbjct  104   PYPPGPRGWPIIGNMFMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPDVARQVLQ  163

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD++FSNRPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDE
Sbjct  164   VQDSVFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDE  223

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD  VR+V+ N G ++N+GE IF LTRNITYRAAFGS+     GQDEFI+ILQEFSKLFG
Sbjct  224   VDKMVRSVSCNVGKSINVGEQIFALTRNITYRAAFGSA--CENGQDEFIRILQEFSKLFG  281

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFNV+DF P+    D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD
Sbjct  282   AFNVADFIPYFGWIDPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNTVDDGD  336

Query  930   GAETDMVDELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
               +TDMVD+LLAFYS+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA
Sbjct  337   VVDTDMVDDLLAFYSEEAKLVSEATDLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWA  396

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             + EL+++PE+LKR+QQEL + VGLDR+VEE D+EKLT+LKC LKETLR+HPPIPLLLHET
Sbjct  397   LTELLRSPEDLKRVQQELAEVVGLDRRVEEKDIEKLTYLKCTLKETLRMHPPIPLLLHET  456

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AE T ++G+++P +SR +INA+AI RD  SW DP++F+P RFL+ G+PDFKGSNFEFIPF
Sbjct  457   AEDTSIDGFFVPKKSRVMINAFAIGRDPTSWADPETFRPSRFLEPGVPDFKGSNFEFIPF  516

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLYA ELAVAH+ HCFTW+LPDGMKPS+LDM+DVFGLTAPKATRL  +
Sbjct  517   GSGRRSCPGMQLGLYALELAVAHILHCFTWKLPDGMKPSELDMNDVFGLTAPKATRLFAV  576

Query  1647  PTPRLNCQL  1673
             PT RL C L
Sbjct  577   PTTRLICPL  585



>gb|AAG14963.1|AF214009_1 cytochrome p450-dependent monooxygenase [Brassica napus]
Length=513

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/490 (70%), Positives = 412/490 (84%), Gaps = 8/490 (2%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             + YPPGP+GWP+IGNM +MD  +HRGLA LA++YGGL HL+MG LHM  VS P  ARQVL
Sbjct  31    RSYPPGPRGWPIIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPHVARQVL  90

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             Q QD+IFSNRPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRD
Sbjct  91    QVQDSIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRD  150

Query  567   EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLF  746
             EVD  +R+V+ N G ++N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLF
Sbjct  151   EVDKMIRSVSSNVGKSINVGEQIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLF  208

Query  747   GAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSG  926
             GAFNV+DF P+    D QG++ RL KAR  LDGFID IID+H+     ++ +N      G
Sbjct  209   GAFNVADFIPYFGWIDPQGISKRLVKARNDLDGFIDDIIDEHM-----KKKENQNTVDDG  263

Query  927   DGAETDMVDELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEW  1103
             D  +TDMVD+LLAFYS+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEW
Sbjct  264   DVGDTDMVDDLLAFYSEEAKLVSETTDLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEW  323

Query  1104  AMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhE  1283
             A+ EL+++PE+LKR+QQEL + VGLDR+VEESD+EKLTFLKC LKETLRLHPPIPLLLHE
Sbjct  324   ALTELLRSPEDLKRVQQELAEVVGLDRRVEESDIEKLTFLKCTLKETLRLHPPIPLLLHE  383

Query  1284  TAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIP  1463
             TAE TE++GY++P +SR +INA+AI RD  SW D ++F+P RFL+ G+ DFKGSNFEFIP
Sbjct  384   TAEDTEIDGYFVPKKSRVMINAFAIGRDPKSWPDAETFRPSRFLEPGVADFKGSNFEFIP  443

Query  1464  FGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVV  1643
             FGSGR+SCPGMQLGLYA ELAVAH+ HCFTW+LPDGMK S+LDM+DVFGLTAPKATRL  
Sbjct  444   FGSGRKSCPGMQLGLYALELAVAHILHCFTWKLPDGMKASELDMNDVFGLTAPKATRLFA  503

Query  1644  IPTPRLNCQL  1673
             +P+ RL C +
Sbjct  504   VPSTRLICAV  513



>ref|XP_007156106.1| hypothetical protein PHAVU_003G259200g [Phaseolus vulgaris]
 gb|ESW28100.1| hypothetical protein PHAVU_003G259200g [Phaseolus vulgaris]
Length=506

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/489 (70%), Positives = 403/489 (82%), Gaps = 12/489 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG P+IGN+N+MD  +HRGLAKLA++YGG+LHL++G LH V +S  + AR+VLQ
Sbjct  29    PYPPGPKGLPIIGNINIMDQLTHRGLAKLAKKYGGVLHLRIGFLHTVAISNAEAAREVLQ  88

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPA  AI +L+YDRADMAFAHYGPFWRQMRK+CV+KLFSR+RAESW+SVRDE
Sbjct  89    AQDNIFSNRPATAAIRHLTYDRADMAFAHYGPFWRQMRKICVIKLFSRKRAESWNSVRDE  148

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD  VR VA N G+ VN+GEL+F LT+NITYRAAFGSS  S QGQ++FI I+QEFS LFG
Sbjct  149   VDTVVRAVAANVGNPVNVGELVFNLTKNITYRAAFGSS--SQQGQEKFISIIQEFSVLFG  206

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P +   D QGLN RL +ARAALD FIDKII++H+        K   G+   D
Sbjct  207   AFNIADFVPCIGWIDPQGLNLRLVQARAALDSFIDKIIEEHV-------EKKRSGKSCED  259

Query  930   GAETDMVDELLAFYSDEMKVND-SDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
               E+DMVDELL FYS+  K+N+ S+DL  +I LT+DNIK IIMDVMFGGTETVASAIEW 
Sbjct  260   --ESDMVDELLNFYSENPKLNEESNDLHTSITLTKDNIKAIIMDVMFGGTETVASAIEWT  317

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             M ELM++PE+L+R+QQEL D  GLDR+VEESD+EKL FLKC LKETLRLHPPIPLLLHE 
Sbjct  318   MTELMRSPEDLRRVQQELADVAGLDRRVEESDIEKLVFLKCVLKETLRLHPPIPLLLHEA  377

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AE   V GY++P  SR +INAWAI RD +SWE+P++FKP RFLK  +PDFKGSNFEFIPF
Sbjct  378   AEDAVVCGYHVPKGSRLMINAWAIGRDGDSWEEPEAFKPSRFLKSSVPDFKGSNFEFIPF  437

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLYA E+AVAHL HCFTWELPDG+KPS+LD  DVFGLTAP+A+RLV I
Sbjct  438   GSGRRSCPGMQLGLYALEVAVAHLLHCFTWELPDGLKPSELDTSDVFGLTAPRASRLVAI  497

Query  1647  PTPRLNCQL  1673
             P+ R+ C L
Sbjct  498   PSKRVLCPL  506



>gb|ABG73616.1| ferulate-5-hydroxylase [Brassica napus]
Length=520

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/481 (72%), Positives = 409/481 (85%), Gaps = 8/481 (2%)
 Frame = +3

Query  234   WPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSN  413
             WP+IGNM++MD  +HRGLA LA++YGGL HL+MG LHM  VS PD A+QVLQ QD++FSN
Sbjct  47    WPIIGNMSMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPDVAKQVLQVQDSVFSN  106

Query  414   RPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTV  593
             RPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  +R+V
Sbjct  107   RPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMIRSV  166

Query  594   AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFF  773
             + N G ++N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF 
Sbjct  167   SSNVGKSINVGEQIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNVADFI  224

Query  774   PFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVD  953
             P+    D QG+N RL KAR  LDGFID IID+HI     ++ +N     +GD  +TDMVD
Sbjct  225   PYFGWVDPQGINKRLVKARNDLDGFIDDIIDEHI-----KKKENQNSVDAGDVVDTDMVD  279

Query  954   ELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTP  1130
             +LLAFYS+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++P
Sbjct  280   DLLAFYSEEAKLVSETADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSP  339

Query  1131  ENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNG  1310
             E+LKR+QQEL + VGLDR+VEESD+EKLTFLKC L ETLRLHPPIPLLLHETAE TE++G
Sbjct  340   EDLKRVQQELAEVVGLDRRVEESDIEKLTFLKCTLNETLRLHPPIPLLLHETAEDTEIDG  399

Query  1311  YYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCP  1490
             Y++P +SR +INA+AI RDKNSW DP++F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCP
Sbjct  400   YFVPKKSRVMINAFAIGRDKNSWVDPETFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCP  459

Query  1491  GMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQ  1670
             GMQLGLYA ELAVAH+ HCFTW+LPDGMKPS+LDM DVFGLTAPKATRL  +P  RL C 
Sbjct  460   GMQLGLYALELAVAHILHCFTWKLPDGMKPSELDMSDVFGLTAPKATRLYAVPCTRLICA  519

Query  1671  L  1673
             L
Sbjct  520   L  520



>gb|AAG14961.1|AF214007_1 cytochrome p450-dependent monooxygenase [Brassica napus]
Length=520

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/481 (71%), Positives = 410/481 (85%), Gaps = 8/481 (2%)
 Frame = +3

Query  234   WPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSN  413
             WP+IGNM++MD  +HRGLA LA++YGGL HL+MG LHM  VS PD A+QVLQ QD++FSN
Sbjct  47    WPIIGNMSMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPDVAKQVLQVQDSVFSN  106

Query  414   RPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTV  593
             RPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  +R+V
Sbjct  107   RPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMIRSV  166

Query  594   AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFF  773
             + N G ++N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF 
Sbjct  167   SSNVGKSINVGEQIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNVADFI  224

Query  774   PFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVD  953
             P+    D QG+N RL KAR  LDGFID IID+H+     ++ +N     +GD  +TDMVD
Sbjct  225   PYFGWIDPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNSVDAGDVVDTDMVD  279

Query  954   ELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTP  1130
             +LLAFYS+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++P
Sbjct  280   DLLAFYSEEAKLVSETADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSP  339

Query  1131  ENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNG  1310
             E+L R+QQEL + VGLDR+VEESD+EKLTFLKC LKETLRLHPPIPLLLHETAE TE++G
Sbjct  340   EDLNRVQQELAEVVGLDRRVEESDIEKLTFLKCTLKETLRLHPPIPLLLHETAEDTEIDG  399

Query  1311  YYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCP  1490
             Y++P +SR +INA+AI RDKNSW DP++F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCP
Sbjct  400   YFVPKKSRVMINAFAIGRDKNSWVDPETFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCP  459

Query  1491  GMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQ  1670
             GMQLGLYA ELAVAH+ HCFTW+LPDGMKPS+LDM DVFGLTAPKATRL  +P+ RL C 
Sbjct  460   GMQLGLYALELAVAHILHCFTWKLPDGMKPSELDMSDVFGLTAPKATRLYAVPSTRLICS  519

Query  1671  L  1673
             +
Sbjct  520   V  520



>ref|XP_002274902.1| PREDICTED: cytochrome P450 84A1-like [Vitis vinifera]
Length=517

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/488 (69%), Positives = 410/488 (84%), Gaps = 8/488 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG P+IGNM +M+  +HRGLA L++ YGGLLH+KMG LH+VVVS P+ AR+VLQ
Sbjct  36    PYPPGPKGLPIIGNMLMMNQLTHRGLANLSKVYGGLLHMKMGVLHLVVVSTPEMAREVLQ  95

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD++F+NRPA VAI YL+YDRADMAFA YGP WRQMRK+CV+KLFSR+RAESW SVR+E
Sbjct  96    VQDSVFANRPARVAIKYLTYDRADMAFAQYGPSWRQMRKICVMKLFSRKRAESWASVREE  155

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD+T++++A   GSAVNIGEL   LT+NITYRAAFGSS  S + Q+EF+KILQEFS+LFG
Sbjct  156   VDSTLQSIAKRGGSAVNIGELALDLTKNITYRAAFGSS--SREKQEEFVKILQEFSRLFG  213

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN +DF P+L     +  N RL KAR +LD FIDKIIDDHI    +R+ +N+ G+ S  
Sbjct  214   AFNFADFIPWLGWIQGKEFNKRLVKARGSLDEFIDKIIDDHI---EKRKKQNNSGDESES  270

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
              AE DMVDEL+ FYS+++    ++DL ++IK TRDNIK IIMDVMFGGTETVASAIEWAM
Sbjct  271   EAELDMVDELMEFYSEDVA---AEDLNSSIKFTRDNIKAIIMDVMFGGTETVASAIEWAM  327

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AELMK+P++LK+LQQELTD VGL+R++ ESDLEKLT+LKCC+KETLRLHPPIP+LLHET+
Sbjct  328   AELMKSPDDLKKLQQELTDVVGLNRRLHESDLEKLTYLKCCIKETLRLHPPIPVLLHETS  387

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             EA+ V GY +PARS  +INAWAI RDK +WEDP++FKP+RFLK+  PDFKGS+FEFIPFG
Sbjct  388   EASVVAGYSVPARSDVMINAWAINRDKTAWEDPETFKPERFLKKDAPDFKGSHFEFIPFG  447

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLY  +LAVAHL HCF+WELPDGMK SDLDM D+FGLTAP+A +LV +P
Sbjct  448   SGRRSCPGMQLGLYGLDLAVAHLVHCFSWELPDGMKASDLDMSDLFGLTAPRAIQLVAVP  507

Query  1650  TPRLNCQL  1673
             T RL C L
Sbjct  508   TYRLQCPL  515



>gb|AAG14962.1|AF214008_1 cytochrome p450-dependent monooxygenase [Brassica napus]
Length=520

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/481 (71%), Positives = 409/481 (85%), Gaps = 8/481 (2%)
 Frame = +3

Query  234   WPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSN  413
             WP+IGNM++MD  +HRGLA LA++YGGL HL+MG LHM  VS PD A+QVLQ QD++FSN
Sbjct  47    WPIIGNMSMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPDVAKQVLQVQDSVFSN  106

Query  414   RPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTV  593
             RPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  +R+V
Sbjct  107   RPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMIRSV  166

Query  594   AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFF  773
             + N G ++N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF 
Sbjct  167   SSNVGKSINVGEQIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNVADFI  224

Query  774   PFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVD  953
             P+    D QG+N RL KAR  LDGFID IID+HI     ++ +N     +GD  +TDMVD
Sbjct  225   PYFGWIDPQGINKRLVKARNDLDGFIDDIIDEHI-----KKKENQNSVDAGDVVDTDMVD  279

Query  954   ELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTP  1130
             +LLAFYS+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++P
Sbjct  280   DLLAFYSEEAKLVSETADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSP  339

Query  1131  ENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNG  1310
             E+LKR+QQEL + VGLDR+VEESD+EKLTFLKC L ETLRLHPPIPLLLHETAE TE++G
Sbjct  340   EDLKRVQQELAEVVGLDRRVEESDIEKLTFLKCTLNETLRLHPPIPLLLHETAEDTEIDG  399

Query  1311  YYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCP  1490
             Y++P +SR +INA+AI RDKNSW DP++F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCP
Sbjct  400   YFVPKKSRVMINAFAIGRDKNSWVDPETFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCP  459

Query  1491  GMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQ  1670
             GMQLGLYA ELAVAH+ HCFTW+LPDGMKPS+LDM DVFGLTAPKATRL  +P  RL C 
Sbjct  460   GMQLGLYALELAVAHILHCFTWKLPDGMKPSELDMSDVFGLTAPKATRLYAVPCTRLICS  519

Query  1671  L  1673
             +
Sbjct  520   V  520



>ref|XP_010531068.1| PREDICTED: cytochrome P450 84A1-like [Tarenaya hassleriana]
Length=517

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/477 (71%), Positives = 400/477 (84%), Gaps = 10/477 (2%)
 Frame = +3

Query  231   GWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFS  410
             G P+IGNM +MD  +HRGLAKL+++YGGL HL+MG LHM  VS P+ ARQVLQ QDNIFS
Sbjct  46    GLPIIGNMLMMDQLTHRGLAKLSQKYGGLFHLRMGFLHMFAVSSPEVARQVLQVQDNIFS  105

Query  411   NRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRT  590
             NRPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VRT
Sbjct  106   NRPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRT  165

Query  591   VAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDF  770
             V  N G  VN+GELIF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFN++DF
Sbjct  166   VVSNVGKPVNVGELIFALTRNITYRAAFGSA--CEEGQDEFIRILQEFSKLFGAFNIADF  223

Query  771   FPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMV  950
              P+L   D QG+N RL  AR ALDGFID IID+H+    ++R+K +  +           
Sbjct  224   IPYLGWIDPQGINRRLVNARKALDGFIDDIIDEHM----KKRDKQNVDDDVDTDMVD---  276

Query  951   DELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTP  1130
              +LLAFYS+E K+N+SDDLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++P
Sbjct  277   -DLLAFYSEEAKLNESDDLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSP  335

Query  1131  ENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNG  1310
             E+LKR+QQEL + VGLD++VEE+ +E+LTFLKCCLKETLRLHPPIPLLLHETAE  E++G
Sbjct  336   EDLKRVQQELAEVVGLDQRVEETHMERLTFLKCCLKETLRLHPPIPLLLHETAEDAEIDG  395

Query  1311  YYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCP  1490
             +++P RSR +INA+AI RD NSW DPD F P RFLK G+PDF+GSNFEFIPFGSGRRSCP
Sbjct  396   FFVPKRSRVMINAFAIGRDPNSWSDPDRFDPSRFLKPGVPDFRGSNFEFIPFGSGRRSCP  455

Query  1491  GMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRL  1661
             GMQLGLYA +LAVAHL HCFTW+LPDGMKP DLD DDVFGLTAP+ATRL+ +P+ RL
Sbjct  456   GMQLGLYALDLAVAHLLHCFTWDLPDGMKPGDLDTDDVFGLTAPRATRLIAVPSTRL  512



>ref|XP_004134878.1| PREDICTED: cytochrome P450 84A1-like [Cucumis sativus]
 gb|KGN48892.1| hypothetical protein Csa_6G504720 [Cucumis sativus]
Length=521

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/489 (69%), Positives = 407/489 (83%), Gaps = 6/489 (1%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             P+PPGPKG P IGNM ++D  +HRGLAKLA +YGG+ +++MG L+M  V+ PD ARQVLQ
Sbjct  37    PFPPGPKGLPFIGNMLMLDQLTHRGLAKLAARYGGIFYMRMGFLNMFTVADPDIARQVLQ  96

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
               D+I SNRPA +AISYL+Y RADMAFA+YGPFWRQMRK+CV+KLFSR+RAESW SVRD 
Sbjct  97    VHDSICSNRPATIAISYLTYSRADMAFANYGPFWRQMRKICVMKLFSRKRAESWQSVRDV  156

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VDNTV+ VA+  G+AVN+GEL+F LTR+I YRAAFG+S  + QGQDEFI ILQEFSKLFG
Sbjct  157   VDNTVKKVAVQTGTAVNVGELVFELTRDIIYRAAFGTS--TLQGQDEFISILQEFSKLFG  214

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P L   D QGLN RL +AR +LD FID IID+HI++ R   +K    ++   
Sbjct  215   AFNIADFIPGLRWIDPQGLNKRLIEARQSLDKFIDSIIDEHIMKKRNASSKLSNYKLE--  272

Query  930   GAETDMVDELLAFYSDEMKV-NDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
               E+DMVDELLAFYSD+  + N+S+D+QN IKL RDNIKGIIMDVMFGGTETVASAIEWA
Sbjct  273   -TESDMVDELLAFYSDDSSIINESNDIQNNIKLNRDNIKGIIMDVMFGGTETVASAIEWA  331

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             M+ELM++PE+LK+ QQEL+  VGL R+VEE+DL+ LTFLKCCLKET+RLHPPIPLLLHE 
Sbjct  332   MSELMRSPEDLKKAQQELSQVVGLQRRVEETDLDNLTFLKCCLKETIRLHPPIPLLLHEA  391

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AE   + GY+IPA+SR ++NAWAI RD  SW+D ++F+P RFL+EG+PDFKG+NFEFIPF
Sbjct  392   AEDAVIAGYFIPAKSRIMVNAWAIGRDPASWDDAETFRPARFLEEGVPDFKGNNFEFIPF  451

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLY  E+AVAHL HCF WELPDGMKPS++DM DVFGLTAP+ATRLV +
Sbjct  452   GSGRRSCPGMQLGLYGLEIAVAHLLHCFDWELPDGMKPSEMDMSDVFGLTAPRATRLVAV  511

Query  1647  PTPRLNCQL  1673
             PT R+ C L
Sbjct  512   PTKRVLCPL  520



>gb|KFK30256.1| hypothetical protein AALP_AA7G237600 [Arabis alpina]
Length=520

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/476 (71%), Positives = 402/476 (84%), Gaps = 8/476 (2%)
 Frame = +3

Query  249   NMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANV  428
             NM +MD  +HRGLA LA++YGGL HL+MG LHM  VS P+ A+QVLQ QD+IFSNRPA +
Sbjct  52    NMLMMDQLTHRGLASLAKKYGGLCHLRMGFLHMFAVSSPEVAKQVLQVQDSIFSNRPATI  111

Query  429   AISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCG  608
             AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V+ N G
Sbjct  112   AISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSVSSNVG  171

Query  609   SAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSC  788
               +N+GE IF LTRNITYRAAFGS+  +GQ  DEFI+ILQEFSKLFGAFNV+DF P+   
Sbjct  172   KPINVGEQIFALTRNITYRAAFGSACITGQ--DEFIRILQEFSKLFGAFNVADFIPYFGW  229

Query  789   FDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAF  968
              D QG+N RL KAR  LDGFID+IID+H+   +++ ++N   +  GD  +TDMVD+LL F
Sbjct  230   IDPQGINKRLVKARNDLDGFIDEIIDEHM---KKKEDQNTVDD--GDIVDTDMVDDLLTF  284

Query  969   YSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKR  1145
             YS+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++PE+LKR
Sbjct  285   YSEEAKLVSEATDLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSPEDLKR  344

Query  1146  LQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPA  1325
             +QQEL D VGLDR+VEESD+EKLTFLKC LKETLRLHPPIPLLLHET+E  E++GYY+P 
Sbjct  345   VQQELADVVGLDRRVEESDIEKLTFLKCTLKETLRLHPPIPLLLHETSEDAEIDGYYVPK  404

Query  1326  RSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLG  1505
             RSR +INA+AI RD  SW DPD+F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCPGMQLG
Sbjct  405   RSRIMINAFAIGRDPKSWVDPDTFRPARFLEPGVPDFKGSNFEFIPFGSGRRSCPGMQLG  464

Query  1506  LYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             LYA +LAVAH+ HCFTWELPDGMKP+DLDM DVFGLTAPKATRL  +P  RL C +
Sbjct  465   LYALDLAVAHILHCFTWELPDGMKPNDLDMSDVFGLTAPKATRLFAVPITRLTCDV  520



>ref|XP_009145966.1| PREDICTED: cytochrome P450 84A1 [Brassica rapa]
Length=520

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/481 (71%), Positives = 408/481 (85%), Gaps = 8/481 (2%)
 Frame = +3

Query  234   WPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSN  413
             WP+IGNM++MD  +HRGLA LA++YGGL HL+MG LHM  VS PD A+QVLQ QD++FSN
Sbjct  47    WPIIGNMSMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPDVAKQVLQVQDSVFSN  106

Query  414   RPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTV  593
             RPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  +R+V
Sbjct  107   RPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMIRSV  166

Query  594   AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFF  773
             + N G ++N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF 
Sbjct  167   SSNVGKSINVGEQIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNVADFI  224

Query  774   PFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVD  953
             P+    D QG+N RL KAR  LDGFID IID+H+     ++ +N     +GD  +TDMVD
Sbjct  225   PYFGWIDPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNSVDAGDVVDTDMVD  279

Query  954   ELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTP  1130
             +LLAFYS+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++P
Sbjct  280   DLLAFYSEEAKLVSETADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSP  339

Query  1131  ENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNG  1310
             E+LKR+QQEL + VGLDR+VEESD+EKLTFLKC LKETLRLHPPIPLLLHETAE TE++G
Sbjct  340   EDLKRVQQELAEVVGLDRRVEESDIEKLTFLKCTLKETLRLHPPIPLLLHETAEDTEIDG  399

Query  1311  YYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCP  1490
             Y++P +SR +INA+AI RD  SW D ++F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCP
Sbjct  400   YFVPKKSRVMINAFAIGRDPKSWPDAETFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCP  459

Query  1491  GMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQ  1670
             GMQLGLYA ELAVAH+ HCFTW+LPDGMKPS+LDM DVFGLTAPKATRL  +P+ RL C 
Sbjct  460   GMQLGLYALELAVAHILHCFTWKLPDGMKPSELDMSDVFGLTAPKATRLYAVPSTRLICS  519

Query  1671  L  1673
             +
Sbjct  520   V  520



>ref|XP_010446813.1| PREDICTED: cytochrome P450 84A1 [Camelina sativa]
Length=520

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/481 (71%), Positives = 408/481 (85%), Gaps = 8/481 (2%)
 Frame = +3

Query  234   WPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSN  413
             WP+IGNM +MD  +HRGLA LA++YGGL HL+MG LHM  VS PD ARQVLQ QD++FSN
Sbjct  47    WPIIGNMFMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPDVARQVLQVQDSVFSN  106

Query  414   RPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTV  593
             RPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V
Sbjct  107   RPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSV  166

Query  594   AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFF  773
             + N G+++N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF 
Sbjct  167   SCNVGNSINVGEQIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNVADFI  224

Query  774   PFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVD  953
             P+    D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  +TDMVD
Sbjct  225   PYFGWIDPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNTVDDGDVVDTDMVD  279

Query  954   ELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTP  1130
             +LLAFYS+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++P
Sbjct  280   DLLAFYSEEAKLVSEATDLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSP  339

Query  1131  ENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNG  1310
             E+LKR+QQEL + VGLDR+VEE+D+EKLTFLKC LKETLR+HPPIPLLLHETAE T ++G
Sbjct  340   EDLKRVQQELAEVVGLDRRVEETDIEKLTFLKCTLKETLRMHPPIPLLLHETAEDTSIDG  399

Query  1311  YYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCP  1490
             +++P +SR +INA+AI RD  SW DP++F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCP
Sbjct  400   FFVPKKSRVMINAFAIGRDPKSWVDPETFRPSRFLEAGVPDFKGSNFEFIPFGSGRRSCP  459

Query  1491  GMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQ  1670
             GMQLGLYA ELAVAH+ HCFTW+LPDGMKPS+LDM+DVFGLTAPKATRL  +PT RL C 
Sbjct  460   GMQLGLYALELAVAHILHCFTWKLPDGMKPSELDMNDVFGLTAPKATRLFAVPTTRLICA  519

Query  1671  L  1673
             L
Sbjct  520   L  520



>gb|ABL07485.1| cytochrome P450 [Isatis tinctoria]
Length=520

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/485 (70%), Positives = 410/485 (85%), Gaps = 8/485 (2%)
 Frame = +3

Query  222   GPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDN  401
             G +GWP+IGNM +MD  +HRGLA LA++YGGL HL+MG LHM  VS PD A+QVLQ QD+
Sbjct  43    GQRGWPIIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPDVAKQVLQVQDS  102

Query  402   IFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNT  581
             +FSNRPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  
Sbjct  103   VFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKM  162

Query  582   VRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNV  761
             +R+V+ N G  +N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV
Sbjct  163   IRSVSSNIGKPINVGEQIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNV  220

Query  762   SDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAET  941
             +DF P+    D QG+N RL KAR  LDGFID IID+H+     ++ ++      GD  +T
Sbjct  221   ADFIPYFGWIDPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKESQNTVDDGDVVDT  275

Query  942   DMVDELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAEL  1118
             DMVD+LLAFYS+E K V+D+ DLQ++IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL
Sbjct  276   DMVDDLLAFYSEEAKLVSDATDLQSSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTEL  335

Query  1119  MKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEAT  1298
             +++PE+LKR+QQEL + VGLDR+VEESD+EKLTFLKC LKETLRLHPPIPLLLHETAE T
Sbjct  336   LRSPEDLKRVQQELAEVVGLDRRVEESDIEKLTFLKCTLKETLRLHPPIPLLLHETAEDT  395

Query  1299  EVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGR  1478
             E++GY++P +SR ++NA+AI RD +SW DP++F+P RFL+ G+PDFKGSNFEFIPFGSGR
Sbjct  396   EIDGYFVPKKSRVMVNAFAIGRDPDSWVDPETFRPSRFLEPGVPDFKGSNFEFIPFGSGR  455

Query  1479  RSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPR  1658
             RSCPGMQLGLYA ELAVAH+ HCFTW+LPDGMKPS+LDM DVFGLTAPKATRL  +P+ R
Sbjct  456   RSCPGMQLGLYALELAVAHILHCFTWKLPDGMKPSELDMSDVFGLTAPKATRLFAVPSTR  515

Query  1659  LNCQL  1673
             L C +
Sbjct  516   LICAV  520



>emb|CAC26936.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAC26937.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAC26938.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAC26939.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAC26940.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAC26941.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
Length=520

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/481 (71%), Positives = 406/481 (84%), Gaps = 8/481 (2%)
 Frame = +3

Query  234   WPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSN  413
             WP+IGNM +MD  +HRGLA LA++YGGL HL+MG LHM  VS P+ ARQVLQ QD++FSN
Sbjct  47    WPIIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPEVARQVLQVQDSVFSN  106

Query  414   RPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTV  593
             RPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V
Sbjct  107   RPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSV  166

Query  594   AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFF  773
             + N G  +N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF 
Sbjct  167   SCNVGKTINVGEQIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNVADFI  224

Query  774   PFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVD  953
             P+    D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  +TDMVD
Sbjct  225   PYFGWIDPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNAVDDGDVVDTDMVD  279

Query  954   ELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTP  1130
             +LLAFYS+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++P
Sbjct  280   DLLAFYSEEAKLVSETADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSP  339

Query  1131  ENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNG  1310
             E+LKR+QQEL + VGLDR+VEESD+EKLT+LKC LKETLR+HPPIPLLLHETAE T ++G
Sbjct  340   EDLKRVQQELAEVVGLDRRVEESDIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTSIDG  399

Query  1311  YYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCP  1490
             ++IP +SR +INA+AI RD  SW DPD+F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCP
Sbjct  400   FFIPKKSRVMINAFAIGRDPTSWTDPDTFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCP  459

Query  1491  GMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQ  1670
             GMQLGLYA +LAVAH+ HCFTW+LPDGMKPS+LDM+DVFGLTAPKATRL  +PT RL C 
Sbjct  460   GMQLGLYALDLAVAHILHCFTWKLPDGMKPSELDMNDVFGLTAPKATRLFAVPTTRLICA  519

Query  1671  L  1673
             L
Sbjct  520   L  520



>ref|NP_195345.1| ferulic acid 5-hydroxylase 1 [Arabidopsis thaliana]
 sp|Q42600.1|C84A1_ARATH RecName: Full=Cytochrome P450 84A1; AltName: Full=Ferulate-5-hydroxylase; 
Short=F5H [Arabidopsis thaliana]
 gb|AAC49389.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAA18128.1| ferulate-5-hydroxylase (FAH1) [Arabidopsis thaliana]
 gb|AAD11580.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAB80293.1| ferulate-5-hydroxylase (FAH1) [Arabidopsis thaliana]
 emb|CAC26922.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAC26923.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAC26924.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAC26925.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAC26926.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAC26927.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAC26928.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAC26929.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAC26930.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAC26931.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAC26934.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAC26935.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 gb|AEE86636.1| ferulic acid 5-hydroxylase 1 [Arabidopsis thaliana]
Length=520

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/481 (71%), Positives = 406/481 (84%), Gaps = 8/481 (2%)
 Frame = +3

Query  234   WPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSN  413
             WP+IGNM +MD  +HRGLA LA++YGGL HL+MG LHM  VS P+ ARQVLQ QD++FSN
Sbjct  47    WPIIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPEVARQVLQVQDSVFSN  106

Query  414   RPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTV  593
             RPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V
Sbjct  107   RPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSV  166

Query  594   AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFF  773
             + N G  +N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF 
Sbjct  167   SCNVGKPINVGEQIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNVADFI  224

Query  774   PFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVD  953
             P+    D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  +TDMVD
Sbjct  225   PYFGWIDPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNAVDDGDVVDTDMVD  279

Query  954   ELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTP  1130
             +LLAFYS+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++P
Sbjct  280   DLLAFYSEEAKLVSETADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSP  339

Query  1131  ENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNG  1310
             E+LKR+QQEL + VGLDR+VEESD+EKLT+LKC LKETLR+HPPIPLLLHETAE T ++G
Sbjct  340   EDLKRVQQELAEVVGLDRRVEESDIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTSIDG  399

Query  1311  YYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCP  1490
             ++IP +SR +INA+AI RD  SW DPD+F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCP
Sbjct  400   FFIPKKSRVMINAFAIGRDPTSWTDPDTFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCP  459

Query  1491  GMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQ  1670
             GMQLGLYA +LAVAH+ HCFTW+LPDGMKPS+LDM+DVFGLTAPKATRL  +PT RL C 
Sbjct  460   GMQLGLYALDLAVAHILHCFTWKLPDGMKPSELDMNDVFGLTAPKATRLFAVPTTRLICA  519

Query  1671  L  1673
             L
Sbjct  520   L  520



>emb|CAC26932.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAC26933.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
Length=520

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/481 (71%), Positives = 406/481 (84%), Gaps = 8/481 (2%)
 Frame = +3

Query  234   WPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSN  413
             WP+IGNM +MD  +HRGLA LA++YGGL HL+MG LHM  VS P+ ARQVLQ QD++FSN
Sbjct  47    WPIIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPEVARQVLQVQDSVFSN  106

Query  414   RPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTV  593
             RPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V
Sbjct  107   RPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSV  166

Query  594   AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFF  773
             + N G  +N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF 
Sbjct  167   SCNVGKPINVGEQIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNVADFI  224

Query  774   PFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVD  953
             P+    D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  +TDMVD
Sbjct  225   PYFGWIDPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNAVDDGDVVDTDMVD  279

Query  954   ELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTP  1130
             +LLAFYS+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++P
Sbjct  280   DLLAFYSEEAKLVSETADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSP  339

Query  1131  ENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNG  1310
             E+LKR+QQEL + VGLDR+VEESD+EKLT+LKC LKETLR+HPPIPLLLHETAE T ++G
Sbjct  340   EDLKRVQQELAEVVGLDRRVEESDIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTSIDG  399

Query  1311  YYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCP  1490
             ++IP +SR +INA+AI RD  SW DPD+F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCP
Sbjct  400   FFIPKKSRVMINAFAIGRDPTSWTDPDTFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCP  459

Query  1491  GMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQ  1670
             GMQLGLYA +LAVAH+ HCFTW+LPDGMKPS+LDM+DVFGLTAPKATRL  +PT RL C 
Sbjct  460   GMQLGLYALDLAVAHILHCFTWKLPDGMKPSELDMNDVFGLTAPKATRLFAVPTTRLICA  519

Query  1671  L  1673
             L
Sbjct  520   L  520



>ref|XP_002867029.1| ferulate-5-hydroxylase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43288.1| ferulate-5-hydroxylase [Arabidopsis lyrata subsp. lyrata]
Length=520

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/481 (71%), Positives = 406/481 (84%), Gaps = 8/481 (2%)
 Frame = +3

Query  234   WPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSN  413
             WP+IGNM +MD  +HRGLA LA++YGGL HL+MG LHM  VS PD ARQVLQ QD++FSN
Sbjct  47    WPIIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPDVARQVLQVQDSVFSN  106

Query  414   RPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTV  593
             RPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V
Sbjct  107   RPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSV  166

Query  594   AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFF  773
             + N G  +N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF 
Sbjct  167   SCNVGKPINVGEHIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNVADFI  224

Query  774   PFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVD  953
             P+    D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  +TDMVD
Sbjct  225   PYFGWIDPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNAVDDGDVVDTDMVD  279

Query  954   ELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTP  1130
             +LLAFYS+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++P
Sbjct  280   DLLAFYSEEAKLVSEAADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSP  339

Query  1131  ENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNG  1310
             E+LKR+QQEL + VGLDR+VEE+D+EKLT+LKC LKETLR+HPPIPLLLHETAE T ++G
Sbjct  340   EDLKRVQQELAEVVGLDRRVEEADIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTSIDG  399

Query  1311  YYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCP  1490
             ++IP +SR +INA+AI RD  SW DPD+F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCP
Sbjct  400   FFIPKKSRVMINAFAIGRDPTSWADPDTFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCP  459

Query  1491  GMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQ  1670
             GMQLGLYA +LAVAH+ HCFTW+LPDGMKPS+LDM+DVFGLTAPKATRL  +PT RL C 
Sbjct  460   GMQLGLYALDLAVAHILHCFTWKLPDGMKPSELDMNDVFGLTAPKATRLFAVPTTRLICA  519

Query  1671  L  1673
             L
Sbjct  520   L  520



>ref|XP_010271496.1| PREDICTED: cytochrome P450 84A1-like [Nelumbo nucifera]
Length=510

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/513 (68%), Positives = 416/513 (81%), Gaps = 16/513 (3%)
 Frame = +3

Query  144   HMVIYFVIPflflf--llsrlrrKPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGL  317
             +M++++ +P L     +  R RRKPYPPGPKG P+IGNMN+MD  +HRGLAKLA++YGGL
Sbjct  10    YMILFYAVPPLLFLLGVFVRFRRKPYPPGPKGLPVIGNMNIMDQLTHRGLAKLAKEYGGL  69

Query  318   LHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQ  497
             +HL++G LHMVVVS P+ ARQVLQ QDNIFSNRPAN+AI YL+YDR+DMAFAHYGPFWRQ
Sbjct  70    IHLRLGFLHMVVVSTPEMARQVLQVQDNIFSNRPANIAIRYLTYDRSDMAFAHYGPFWRQ  129

Query  498   MRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFG  677
             MRK+C +K+FSR+RAESW SVR+EVD+ +R+VA   GS VN+G L+F LT NITYRAAFG
Sbjct  130   MRKICAMKVFSRKRAESWTSVREEVDSIIRSVAGKAGSPVNLGVLVFSLTMNITYRAAFG  189

Query  678   SSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDK  857
             S      GQ++F+ ILQEFSKLFGAFN+ DF P+L   DLQG N RL  AR +LD FIDK
Sbjct  190   SDIR--HGQEKFVAILQEFSKLFGAFNLGDFIPWLGGLDLQGFNKRLYGARRSLDAFIDK  247

Query  858   IIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVND-SDDLQNAIKLTRD  1034
             IID H L  R+ +  N   E      + DMVD+LLAFY +E    D S +LQ    ++RD
Sbjct  248   IIDAH-LAKRKNKRTNEAEE------DNDMVDDLLAFYDEEDDEKDESGNLQ----VSRD  296

Query  1035  NIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKL  1214
             NIK IIMDVMFGGTETVASAIEWAMAE+M++P++LKR+QQEL D VGLDR+V++SDLEKL
Sbjct  297   NIKAIIMDVMFGGTETVASAIEWAMAEMMRSPDDLKRVQQELVDVVGLDRRVQDSDLEKL  356

Query  1215  TFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDS  1394
             TFL+C +KETLRLHPPIPLLLHETAE  EV GY+IP ++R +IN+WAI RD  +W++P++
Sbjct  357   TFLRCVVKETLRLHPPIPLLLHETAEDAEVGGYFIPKQARVVINSWAINRDPAAWDEPET  416

Query  1395  FKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGM  1574
             FKP RFLKEG PDF+GSNFEFIPFGSGRRSCPGMQLGLY  ELA+AHL HCFTWELPDGM
Sbjct  417   FKPSRFLKEGAPDFRGSNFEFIPFGSGRRSCPGMQLGLYTLELAMAHLLHCFTWELPDGM  476

Query  1575  KPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             KPS+LDM+DVFGLT P+A RLV IPTP L C L
Sbjct  477   KPSELDMNDVFGLTVPRAERLVAIPTPCLQCPL  509



>ref|XP_009378429.1| PREDICTED: cytochrome P450 84A1-like [Pyrus x bretschneideri]
Length=519

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/488 (68%), Positives = 398/488 (82%), Gaps = 7/488 (1%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKGWP+IGNM + D  +HRGLA LA+QYGGLLHL+MG++H++ VS PD AR++LQ
Sbjct  39    PYPPGPKGWPIIGNMLMTDQLTHRGLAHLAKQYGGLLHLQMGAIHVIAVSTPDTAREILQ  98

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD+ F+NRPAN+A+SYL+YDRADMAFA+YGPFWR+MRK+CV+ LFSR+RAESW SVR+E
Sbjct  99    VQDSSFANRPANIALSYLTYDRADMAFANYGPFWRRMRKICVINLFSRKRAESWASVREE  158

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             V+  V+TVA   GS VNIG+L+F LTRNITYRAAFGS    GQG  EF+KILQEFSKLFG
Sbjct  159   VNEMVQTVAGKTGSPVNIGQLVFALTRNITYRAAFGSRSHEGQG--EFVKILQEFSKLFG  216

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN+ DF P+L     QG   R+A+AR +LD FIDKIIDDH+     +R  N   +   +
Sbjct  217   AFNMQDFLPWLGWVHAQGFQDRMARARKSLDVFIDKIIDDHMA----KRKANTENKDDSE  272

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
              A+TDMVDEL+A++SD+    + DD  +  KLTRDNIK +IMDVMFGGTETVAS IEW M
Sbjct  273   AADTDMVDELIAYFSDDAG-KEGDDPNSGFKLTRDNIKALIMDVMFGGTETVASVIEWTM  331

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AELMK+PE+LKR+QQELTD VGL+R+++E+DLE LT+LKC +KE+LRLHPPIPLLLHET 
Sbjct  332   AELMKSPEDLKRVQQELTDVVGLNRRLQETDLENLTYLKCAVKESLRLHPPIPLLLHETV  391

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E T V GY  PA SR  INAWAIARD  +W++P++FKP RFL +G PDFKGSNFEFIPFG
Sbjct  392   EDTSVAGYSFPAGSRVWINAWAIARDPTAWDEPETFKPSRFLDDGSPDFKGSNFEFIPFG  451

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGM LGLY  E+AVAHL HCF WELP GMKPS+LDM+DVFGLTAPKA +LV +P
Sbjct  452   SGRRSCPGMALGLYGLEMAVAHLLHCFAWELPGGMKPSELDMNDVFGLTAPKAVQLVAVP  511

Query  1650  TPRLNCQL  1673
             T RLNC L
Sbjct  512   TYRLNCPL  519



>ref|XP_004509332.1| PREDICTED: cytochrome P450 84A1-like [Cicer arietinum]
Length=524

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/491 (69%), Positives = 394/491 (80%), Gaps = 10/491 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG PLIGNMN+MD  +HRGLA LA+QYGG+L+L+MG +HMV VS  + AR+VLQ
Sbjct  41    PYPPGPKGLPLIGNMNMMDKLTHRGLANLAKQYGGVLYLRMGFIHMVAVSNAEAAREVLQ  100

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
               DNIFSNRPA + ISYL+Y+RADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW SVRDE
Sbjct  101   LHDNIFSNRPATITISYLTYNRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWKSVRDE  160

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             +   +  V  N G  VN+GELIF LT+NI YRAAFGS   S +GQDEFI ILQEFSKLFG
Sbjct  161   IGVVITNVNDNIGKPVNVGELIFNLTKNIIYRAAFGSC--SKEGQDEFISILQEFSKLFG  218

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P L   D QG N RL KAR ALDGFIDKIID+H+      +  N  G+  GD
Sbjct  219   AFNIADFVPCLRWIDPQGFNARLVKARGALDGFIDKIIDEHV-----EKKNNIMGDCGGD  273

Query  930   GAE--TDMVDELLAFYSDEMKVN-DSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIE  1100
                  +DMVDELLAFYSDE KVN +SDDLQN+IKLTRDNIK IIMDVMFGGTETVASA+E
Sbjct  274   EIYEGSDMVDELLAFYSDEAKVNNESDDLQNSIKLTRDNIKAIIMDVMFGGTETVASAME  333

Query  1101  WAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllh  1280
             W M+ELM+   +LK +Q+ELT  VGLDR VEE D+EKL +LKC +KETLRLHPPIPLLLH
Sbjct  334   WVMSELMRNGRDLKLVQEELTKVVGLDRHVEEEDIEKLAYLKCVIKETLRLHPPIPLLLH  393

Query  1281  ETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFI  1460
             ETAE  ++  Y+IP  SR +IN WAI RD++SWEDP+ F P RFL    PDFKG+NF+FI
Sbjct  394   ETAEEAKILNYFIPKGSRVMINVWAIGRDEDSWEDPEDFNPSRFLNLSAPDFKGNNFDFI  453

Query  1461  PFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLV  1640
             PFGSGRRSCPGMQLGLYA EL +AHL HCFTW+LPDGM P++LDM+DVFGLTAP+A RL+
Sbjct  454   PFGSGRRSCPGMQLGLYALELGLAHLLHCFTWDLPDGMNPNELDMNDVFGLTAPRAIRLI  513

Query  1641  VIPTPRLNCQL  1673
              +PT R+ C L
Sbjct  514   AVPTKRVLCAL  524



>ref|XP_010437364.1| PREDICTED: cytochrome P450 84A1-like [Camelina sativa]
Length=520

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/479 (71%), Positives = 406/479 (85%), Gaps = 8/479 (2%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM +MD  +HRGLA LA++YGGL HL+MG LHM  VS PD ARQVLQ QD++FSNRP
Sbjct  49    IIGNMFMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPDVARQVLQVQDSVFSNRP  108

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V+ 
Sbjct  109   ATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSVSC  168

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
             N G+++N+GE IF LTRNITYRAAFGS+  +GQ  DEFI+ILQEFSKLFGAFNV+DF P+
Sbjct  169   NVGNSINVGEQIFALTRNITYRAAFGSACENGQ--DEFIRILQEFSKLFGAFNVADFIPY  226

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
                 D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  ++DMVD+L
Sbjct  227   FGWIDPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNTVDDGDVVDSDMVDDL  281

Query  960   LAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPEN  1136
             LAFYS+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++PE+
Sbjct  282   LAFYSEEAKLVSEATDLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSPED  341

Query  1137  LKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYY  1316
             LKR+QQEL + VGLDR+VEE+D+EKLTFLKC LKETLR+HPPIPLLLHETAE T ++G++
Sbjct  342   LKRVQQELAEVVGLDRRVEETDIEKLTFLKCTLKETLRMHPPIPLLLHETAEDTSIDGFF  401

Query  1317  IPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGM  1496
             +P +SR +INA+AI RD  SW DP++F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCPGM
Sbjct  402   VPKKSRVMINAFAIGRDPKSWVDPETFRPSRFLEAGVPDFKGSNFEFIPFGSGRRSCPGM  461

Query  1497  QLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             QLGLYA ELAVAH+ HCFTW+LPDGMKPS+LDM+DVFGLTAPKATRL  +PT RL C L
Sbjct  462   QLGLYALELAVAHILHCFTWKLPDGMKPSELDMNDVFGLTAPKATRLFAVPTTRLICAL  520



>ref|XP_010432189.1| PREDICTED: cytochrome P450 84A1-like [Camelina sativa]
Length=520

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/479 (71%), Positives = 406/479 (85%), Gaps = 8/479 (2%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM +MD  +HRGLA LA++YGGL HL+MG LHM  VS PD ARQVLQ QD++FSNRP
Sbjct  49    IIGNMFMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPDVARQVLQVQDSVFSNRP  108

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V+ 
Sbjct  109   ATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSVSC  168

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
             N G+++N+GE IF LTRNITYRAAFGS+  +GQ  DEFI+ILQEFSKLFGAFNV+DF P+
Sbjct  169   NVGNSINVGEQIFALTRNITYRAAFGSACENGQ--DEFIRILQEFSKLFGAFNVADFIPY  226

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
                 D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  +TDMVD+L
Sbjct  227   FGWIDPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNTVDDGDVVDTDMVDDL  281

Query  960   LAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPEN  1136
             LAFYS+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++PE+
Sbjct  282   LAFYSEEAKLVSEATDLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSPED  341

Query  1137  LKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYY  1316
             LKR+QQEL + VGLDR+VEE+D+EKLTFLKC LKETLR+HPPIPLLLHETAE T ++G++
Sbjct  342   LKRVQQELAEVVGLDRRVEETDIEKLTFLKCTLKETLRMHPPIPLLLHETAEDTSIDGFF  401

Query  1317  IPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGM  1496
             +P +SR +INA+AI RD  SW DP++F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCPGM
Sbjct  402   VPKKSRVMINAFAIGRDPKSWVDPETFRPSRFLEAGVPDFKGSNFEFIPFGSGRRSCPGM  461

Query  1497  QLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             QLGLYA ELAVAH+ HCFTW+LPDGMKPS+LDM+DVFGLTAPKATRL  +PT RL C L
Sbjct  462   QLGLYALELAVAHILHCFTWKLPDGMKPSELDMNDVFGLTAPKATRLFAVPTTRLICAL  520



>gb|AEV93477.1| ferulate 5-hydroxylase [Caragana korshinskii]
Length=520

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/486 (72%), Positives = 406/486 (84%), Gaps = 8/486 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG P+IGNMN+MD  +HRGLA LA+QYGG+LHL+MG +HMV +S  + ARQVLQ
Sbjct  41    PYPPGPKGLPIIGNMNMMDKLTHRGLANLAKQYGGVLHLRMGFIHMVAISNAETARQVLQ  100

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPA +AISYL+Y+RADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW SVRDE
Sbjct  101   LQDNIFSNRPATIAISYLTYNRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWQSVRDE  160

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD  V  V  N G  VN+GEL+F LT+++ YRAAFGS   S +GQDEFI ILQEFSKLFG
Sbjct  161   VDTVVSAVNDNVGKPVNVGELVFNLTKDVIYRAAFGSC--SKEGQDEFISILQEFSKLFG  218

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P+L   D QGLN RL KAR ALDGFIDKIID+H+ + RR R    GG    D
Sbjct  219   AFNIADFVPYLGWIDPQGLNARLVKARGALDGFIDKIIDEHV-EKRRNRGGGGGGGGGED  277

Query  930   GAETDMVDELLAFYSD-EMKVN-DSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEW  1103
                +DMVDELLAFYSD E K+N +SDDLQN+IKLTRDNIK IIMDVMFGGTETVASA+EW
Sbjct  278   ---SDMVDELLAFYSDDEAKLNSESDDLQNSIKLTRDNIKAIIMDVMFGGTETVASAMEW  334

Query  1104  AMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhE  1283
             AM+ELM++PE+LKR+Q+EL   VGLDR+VEE D+EKLT LKC +KETLRLHPPIPLLLHE
Sbjct  335   AMSELMRSPEDLKRVQEELATVVGLDRRVEEPDIEKLTHLKCAIKETLRLHPPIPLLLHE  394

Query  1284  TAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIP  1463
             TAE   V+GY++P  SR +INAWAI RDK+SWEDP+ FKP RFL    P FKGSNFEFIP
Sbjct  395   TAEDATVSGYFVPKGSRVMINAWAIGRDKDSWEDPEEFKPSRFLNSSAPVFKGSNFEFIP  454

Query  1464  FGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVV  1643
             FGSGRRSCPGMQLGLYA +LA+AHL HCFTWELPDGMKPS++D  DVFGLTAP+A+RLV 
Sbjct  455   FGSGRRSCPGMQLGLYALDLALAHLLHCFTWELPDGMKPSEMDTSDVFGLTAPRASRLVA  514

Query  1644  IPTPRL  1661
             +PT R+
Sbjct  515   VPTKRV  520



>gb|AID69231.1| ferulate-5-hydroxylase [Garcinia mangostana]
Length=522

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/482 (71%), Positives = 394/482 (82%), Gaps = 14/482 (3%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM +MD  +HRGLAKL+++YGG+ HLKMG LHMV +S P+ ARQVLQ QDNIFSNR 
Sbjct  51    IIGNMLMMDQLTHRGLAKLSQKYGGIFHLKMGYLHMVCISSPETARQVLQVQDNIFSNRS  110

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +AI +L+YDRADMA AHYGPFWRQMRK+CV++LFSR+RAESW+SVR EVD+ V++VA 
Sbjct  111   ATIAIRHLTYDRADMASAHYGPFWRQMRKICVMRLFSRKRAESWESVRHEVDSMVKSVAG  170

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
             N G  VN+GELIF LT NITYRAAFGS     QGQDEFI ILQEFSKLFGAFN++DF P+
Sbjct  171   NVGHQVNVGELIFRLTMNITYRAAFGSKT---QGQDEFIGILQEFSKLFGAFNIADFIPW  227

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAE--TDMVD  953
             LS  D QGLN RL KAR ALD FID IIDDH+        K   G V+G   E  TDMVD
Sbjct  228   LSWVDPQGLNARLEKARNALDKFIDLIIDDHM-------KKREIGNVNGCDQEVNTDMVD  280

Query  954   ELLAFYSD--EMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKT  1127
              LL FY++  E KV++SDDLQN+IKLT+ NIK IIMDVM GGTETVASAIEWA+ ELM++
Sbjct  281   NLLDFYTEVEEAKVSESDDLQNSIKLTKTNIKAIIMDVMLGGTETVASAIEWALVELMRS  340

Query  1128  PENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVN  1307
             P++LKR+QQEL D VGLDR+VEESD+EKLTFLKC LKETLRLHPPIPLLLHETAE   V 
Sbjct  341   PQDLKRVQQELADVVGLDRRVEESDIEKLTFLKCALKETLRLHPPIPLLLHETAEDAVVL  400

Query  1308  GYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSC  1487
             G+Y+P RSR +IN WAI RD NSWEDP+SFKP RFLKEGMPD KGSNFEFIPFGSGRRSC
Sbjct  401   GFYVPKRSRVMINVWAIGRDPNSWEDPESFKPSRFLKEGMPDVKGSNFEFIPFGSGRRSC  460

Query  1488  PGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNC  1667
             PGMQLGLY  ELAVAHL H F WELPDGMKPS++DM D+FGLTAP+A+RL+ IP  R  C
Sbjct  461   PGMQLGLYGLELAVAHLLHYFNWELPDGMKPSEMDMSDIFGLTAPRASRLIAIPRTRSIC  520

Query  1668  QL  1673
              +
Sbjct  521   PI  522



>ref|XP_007199246.1| hypothetical protein PRUPE_ppa022388mg [Prunus persica]
 gb|EMJ00445.1| hypothetical protein PRUPE_ppa022388mg [Prunus persica]
Length=520

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/488 (68%), Positives = 398/488 (82%), Gaps = 8/488 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGP+GWP+IGNM +MD  +HRGLA+LA+QYGGLLHL+MG LH++VVS P  AR++LQ
Sbjct  41    PYPPGPRGWPIIGNMLMMDQLTHRGLAQLAKQYGGLLHLQMGVLHIMVVSSPKVAREILQ  100

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD+ F+NRPAN AISYL+YDRADMAFA+YGPFWR+MRK+CV+ LFSR+RAESW SVR+E
Sbjct  101   VQDSSFANRPANAAISYLTYDRADMAFANYGPFWRRMRKICVINLFSRKRAESWASVREE  160

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             V+  VR VA    S VNIG+L+F LT+NITYRAAFGSS   GQG  EF+KILQEFSKLFG
Sbjct  161   VEEMVRHVATKTSSPVNIGQLVFTLTKNITYRAAFGSSSHEGQG--EFVKILQEFSKLFG  218

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN+ DF P+L     Q    R+AKAR +LD FIDKIIDDH+ +    + K    E    
Sbjct  219   AFNMQDFLPWLGWVHAQAFKDRMAKARRSLDVFIDKIIDDHMAKRNTNKAKKDDNE----  274

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
              AETDMVDEL+AF+SD+    +SDD  +  +LTRDNIK IIMDVMFGGTETVAS IEW M
Sbjct  275   -AETDMVDELIAFFSDD-AAKESDDPNSTFRLTRDNIKAIIMDVMFGGTETVASVIEWTM  332

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AELMK+PE+L+++QQEL + VGL+R+V+E+DLE LT+LKC +KE+LRLHPPIPLLLHETA
Sbjct  333   AELMKSPEDLQKVQQELINVVGLNRRVQETDLENLTYLKCAVKESLRLHPPIPLLLHETA  392

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E T V GY  P  SR  INAWAIARD  +W++P++FKP RFLK+G PDFKGS+FEF+PFG
Sbjct  393   EETSVAGYSFPVGSRVYINAWAIARDPTAWDEPETFKPSRFLKDGSPDFKGSDFEFLPFG  452

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLY  E+AVAHL HCF WELP+GMKP++LDM+DVFGLTAPKA +LV +P
Sbjct  453   SGRRSCPGMQLGLYGLEMAVAHLLHCFAWELPEGMKPNELDMNDVFGLTAPKAVQLVAVP  512

Query  1650  TPRLNCQL  1673
             + RLNC L
Sbjct  513   SYRLNCPL  520



>ref|XP_008236853.1| PREDICTED: cytochrome P450 84A1-like [Prunus mume]
Length=520

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/488 (68%), Positives = 399/488 (82%), Gaps = 8/488 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGP+GWP+IGNM +MD  +HRGLA+LA+QYGGLLHL+MG LH++VVS P+ AR++LQ
Sbjct  41    PYPPGPRGWPIIGNMLMMDQLTHRGLAQLAKQYGGLLHLQMGVLHIMVVSSPEVAREILQ  100

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD+ F+NRPAN AISYL+YDRADMAFA+YGPFWR+MRK+CV+ LFSR+RAESW+SVR+E
Sbjct  101   VQDSSFANRPANAAISYLTYDRADMAFANYGPFWRRMRKICVINLFSRKRAESWNSVREE  160

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD  VR VA    S VNIG+L+F LT+NITYRAAFGSS   GQG  EF+KILQEFSKLFG
Sbjct  161   VDEMVRHVATKTSSPVNIGQLVFTLTKNITYRAAFGSSSHEGQG--EFVKILQEFSKLFG  218

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN+ DF P+L     Q    R+AKAR +LD FIDKIIDDH+ +    ++K    E    
Sbjct  219   AFNMQDFLPWLGWVHAQAFKDRMAKARRSLDVFIDKIIDDHMAKRNTNKDKKDDNE----  274

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
              A+TDMVDEL+AF+SD+    +SDD  +  +LTRDNIK IIMDVMFGGTETVAS IEW M
Sbjct  275   -ADTDMVDELIAFFSDD-AAKESDDPNSTFRLTRDNIKAIIMDVMFGGTETVASVIEWTM  332

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AELMK+PE+L+++QQEL + VGL+R+V+E+DLE LT+LKC +KE+LRLHPPIPLLLHETA
Sbjct  333   AELMKSPEDLQKVQQELINVVGLNRRVQETDLENLTYLKCAVKESLRLHPPIPLLLHETA  392

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E T V GY  P  SR  INAWAIARD  +W++P++FKP RFL +G PDFKGS+FEF+PFG
Sbjct  393   EETSVAGYSFPIGSRVYINAWAIARDPTAWDEPEAFKPSRFLNDGSPDFKGSDFEFLPFG  452

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLY  E+AVAHL HCF WELPDGM P++LDM+DVFGLTAPKA +LV +P
Sbjct  453   SGRRSCPGMQLGLYGLEMAVAHLLHCFAWELPDGMNPNELDMNDVFGLTAPKAVQLVAVP  512

Query  1650  TPRLNCQL  1673
             + RLNC L
Sbjct  513   SYRLNCPL  520



>emb|CAN74838.1| hypothetical protein VITISV_002617 [Vitis vinifera]
Length=516

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/488 (68%), Positives = 404/488 (83%), Gaps = 9/488 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG P+IGNM +M+  +HRGLA L++ YGGLLH+KMG LH+VVVS P+ AR+VLQ
Sbjct  36    PYPPGPKGLPIIGNMLMMNQLTHRGLANLSKVYGGLLHMKMGVLHLVVVSTPEMAREVLQ  95

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD++F+NRPA VAI YL+YDRADMAFA YGP WRQMRK+CV+KLFSR+RAESW SVR+E
Sbjct  96    VQDSVFANRPARVAIKYLTYDRADMAFAQYGPSWRQMRKICVMKLFSRKRAESWASVREE  155

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD+T++++A   GSAVNIGEL   LT+NITYRAAFGS  SS + Q EF+KILQEFS+LFG
Sbjct  156   VDSTLQSIAKRGGSAVNIGELALDLTKNITYRAAFGS--SSREKQKEFVKILQEFSRLFG  213

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN +DF P+L     +    RL KAR +LD FIDKIIDDHI    +R+ +N+ G+ S  
Sbjct  214   AFNFADFIPWLGWIQGKEFTKRLVKARGSLDEFIDKIIDDHI---EKRKKQNNSGDESES  270

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
              AE D+VDEL+ FYS ++    ++DL ++IK TRD+IK IIMDVMFGGTETVASAIEWAM
Sbjct  271   EAELDIVDELMEFYSKDVA---AEDLNSSIKFTRDDIKAIIMDVMFGGTETVASAIEWAM  327

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AELMK+P++LK+LQQEL D VGL+R++ ESDLEKLT+LKCC+KETLRLHPPIP+LLHETA
Sbjct  328   AELMKSPDDLKKLQQELIDVVGLNRRLHESDLEKLTYLKCCIKETLRLHPPIPVLLHETA  387

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E + V GY +PARS  +INAWAI RDK +WEDP++FKP+RFLK+  PDFKGS+FEFIPFG
Sbjct  388   EDSVVAGYSVPARSDVMINAWAINRDKTAWEDPETFKPERFLKDA-PDFKGSHFEFIPFG  446

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLY  +LAV HL HCF+WELPDGMK SDLDM DVFGLTAP+A +L+ +P
Sbjct  447   SGRRSCPGMQLGLYGLDLAVGHLVHCFSWELPDGMKASDLDMSDVFGLTAPRAIQLIAVP  506

Query  1650  TPRLNCQL  1673
             T RL C L
Sbjct  507   TYRLQCLL  514



>ref|XP_007042040.1| Ferulic acid 5-hydroxylase 1 [Theobroma cacao]
 gb|EOX97871.1| Ferulic acid 5-hydroxylase 1 [Theobroma cacao]
Length=521

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/488 (69%), Positives = 405/488 (83%), Gaps = 13/488 (3%)
 Frame = +3

Query  213   YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYG--GLLHLKMGSLHMVVVSGPDEARQVL  386
             YPPGPKG+P+IGNMN+MD  +HRGLA+LA+QYG  GLLHL+MG LH+V VS P+ AR+VL
Sbjct  37    YPPGPKGYPIIGNMNMMDQLTHRGLARLAKQYGQGGLLHLRMGKLHIVAVSTPEMAREVL  96

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             QTQD+I+SNRPAN AI YL+YDRADMAFA+YGPFWRQMRK+CV+K+FSR+RAESW SVR+
Sbjct  97    QTQDSIYSNRPANDAIIYLTYDRADMAFANYGPFWRQMRKICVMKVFSRKRAESWASVRE  156

Query  567   EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLF  746
             EV +TV TV    GS VN+GEL+F LTRNITYRAAFGS   S  GQDEF+KILQEFSKLF
Sbjct  157   EVGSTVETVMKKLGSPVNLGELVFALTRNITYRAAFGSL--SRDGQDEFVKILQEFSKLF  214

Query  747   GAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSG  926
             GAFN +DFFP+L     +    RL KARA+LDGFID IID+H L  R++  K+H      
Sbjct  215   GAFNFADFFPWLGWIHGKEFRKRLVKARASLDGFIDHIIDEH-LAKRKKYGKDHD-----  268

Query  927   DGAETDMVDELLAFYSDEMKVNDSDDL-QNAIKLTRDNIKGIIMDVMFGGTETVASAIEW  1103
                E DMVDEL+AFYS+++   D D+  Q  I+LT+DNIK IIMDVMFGGTETVASAIEW
Sbjct  269   --IEEDMVDELMAFYSEDVSKGDYDESSQPTIRLTKDNIKAIIMDVMFGGTETVASAIEW  326

Query  1104  AMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhE  1283
             AMAELMK+PE+LK++QQEL D VGL+R V ESDLEKLT+LKC +KETLRLHPPIPLLLHE
Sbjct  327   AMAELMKSPEDLKKVQQELADVVGLNRVVHESDLEKLTYLKCAIKETLRLHPPIPLLLHE  386

Query  1284  TAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIP  1463
             TA  + + G+ +PA+SR +I+AWAI RD +SW+DPD+FKP RFL +  PDFKGS+FEFIP
Sbjct  387   TAVDSVLAGFRVPAKSRIMISAWAIGRDPSSWKDPDAFKPSRFLNDAAPDFKGSSFEFIP  446

Query  1464  FGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVV  1643
             FGSGRRSCPGMQLGLY  EL+VAHL HCF WELPDGMKPS+LDM+D+FGLTAP+A+RLV 
Sbjct  447   FGSGRRSCPGMQLGLYGLELSVAHLLHCFNWELPDGMKPSELDMNDLFGLTAPRASRLVA  506

Query  1644  IPTPRLNC  1667
             +P+ RL+C
Sbjct  507   VPSYRLSC  514



>ref|XP_002275191.1| PREDICTED: cytochrome P450 84A1-like [Vitis vinifera]
Length=516

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/488 (68%), Positives = 403/488 (83%), Gaps = 9/488 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG P+IGNM +M+  +HRGLA L++ YGGLLH+KMG LH+VVVS P+ AR+VLQ
Sbjct  36    PYPPGPKGLPIIGNMLMMNQLTHRGLANLSKVYGGLLHMKMGVLHLVVVSTPEMAREVLQ  95

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD++F+NRPA VAI YL+YDRADMAFA YGP WRQMRK+CV+KLFSR+RAESW SVR+E
Sbjct  96    VQDSVFANRPARVAIKYLTYDRADMAFAQYGPSWRQMRKICVMKLFSRKRAESWASVREE  155

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD+T++++A   GSAVNIGEL   LT+NITYRAAFGS  SS + Q EF+KILQEFS+LFG
Sbjct  156   VDSTLQSIAKRGGSAVNIGELALDLTKNITYRAAFGS--SSREKQKEFVKILQEFSRLFG  213

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN +DF P+L     +    RL KAR +LD FIDKIID HI    +R+ +N+ G+ S  
Sbjct  214   AFNFADFIPWLGWIQGKEFTKRLVKARGSLDEFIDKIIDGHI---EKRKKQNNSGDESES  270

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
              AE D+VDEL+ FYS ++    ++DL ++IK TRDNIK IIMDVMFGGTETVASAIEWAM
Sbjct  271   EAELDIVDELMEFYSKDVA---AEDLNSSIKFTRDNIKAIIMDVMFGGTETVASAIEWAM  327

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AELMK+P++LK+LQQEL D VGL+R++ ESDLEKLT+LKCC+KETLRLHPPIP+LLHETA
Sbjct  328   AELMKSPDDLKKLQQELIDVVGLNRRLHESDLEKLTYLKCCIKETLRLHPPIPVLLHETA  387

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E + V GY +PARS  +INAWAI RDK +WEDP++FKP+RFLK+  PDFKGS+FEFIPFG
Sbjct  388   EDSVVAGYSVPARSDVMINAWAINRDKTAWEDPETFKPERFLKDA-PDFKGSHFEFIPFG  446

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLY  +LAV HL HCF+WELPDGMK SDLDM DVFGLTAP+A +L+ +P
Sbjct  447   SGRRSCPGMQLGLYGLDLAVGHLVHCFSWELPDGMKASDLDMSDVFGLTAPRAIQLIAVP  506

Query  1650  TPRLNCQL  1673
             T RL C L
Sbjct  507   TYRLQCLL  514



>emb|CAN60361.1| hypothetical protein VITISV_036388 [Vitis vinifera]
Length=516

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/488 (68%), Positives = 403/488 (83%), Gaps = 9/488 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG P+IGNM +M+  +HRGLA L++ YGGLLH+KMG LH+VVVS P+ AR+VLQ
Sbjct  36    PYPPGPKGLPIIGNMLMMNQLTHRGLANLSKVYGGLLHMKMGVLHLVVVSTPEMAREVLQ  95

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD++F+NRPA VAI YL+YDRADMAFA YGP WRQMRK+CV+KLFSR+RAESW SVR+E
Sbjct  96    VQDSVFANRPARVAIKYLTYDRADMAFAQYGPSWRQMRKICVMKLFSRKRAESWASVREE  155

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD+T++++A   GSAVNIGEL   LT+NITYRAAFGS  SS + Q EF+KILQEFS+LFG
Sbjct  156   VDSTLQSIAKRGGSAVNIGELALDLTKNITYRAAFGS--SSREKQKEFVKILQEFSRLFG  213

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN +DF P+L     +    RL KAR +LD FIDKIID HI    +R+ +N+ G+ S  
Sbjct  214   AFNFADFIPWLGWIQGKEFTKRLVKARGSLDEFIDKIIDXHI---EKRKKQNNSGDESES  270

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
              AE D+VDEL+ FYS ++    ++DL ++IK TRD+IK IIMDVMFGGTETVASAIEWAM
Sbjct  271   EAELDIVDELMEFYSKDVA---AEDLNSSIKFTRDBIKAIIMDVMFGGTETVASAIEWAM  327

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AELMK+P++LK+LQQEL D VGL+R++ ESDLEKLT+LKCC+KETLRLHPPIP+LLHETA
Sbjct  328   AELMKSPDDLKKLQQELIDVVGLNRRLHESDLEKLTYLKCCIKETLRLHPPIPVLLHETA  387

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E + V GY +PARS  +INAWAI RDK +WEDP++FKP+RFLK+  PDFKGS+FEFIPFG
Sbjct  388   EDSVVAGYSVPARSDVMINAWAINRDKTAWEDPETFKPERFLKDA-PDFKGSHFEFIPFG  446

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLY  +LAV HL HCF+WELPDGMK SDLDM DVFGLTAP+A +L+ +P
Sbjct  447   SGRRSCPGMQLGLYGLDLAVGHLVHCFSWELPDGMKASDLDMSDVFGLTAPRAIQLIAVP  506

Query  1650  TPRLNCQL  1673
             T RL C L
Sbjct  507   TYRLQCLL  514



>emb|CBI37999.3| unnamed protein product [Vitis vinifera]
Length=536

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/488 (68%), Positives = 403/488 (83%), Gaps = 9/488 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG P+IGNM +M+  +HRGLA L++ YGGLLH+KMG LH+VVVS P+ AR+VLQ
Sbjct  56    PYPPGPKGLPIIGNMLMMNQLTHRGLANLSKVYGGLLHMKMGVLHLVVVSTPEMAREVLQ  115

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD++F+NRPA VAI YL+YDRADMAFA YGP WRQMRK+CV+KLFSR+RAESW SVR+E
Sbjct  116   VQDSVFANRPARVAIKYLTYDRADMAFAQYGPSWRQMRKICVMKLFSRKRAESWASVREE  175

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD+T++++A   GSAVNIGEL   LT+NITYRAAFGS  SS + Q EF+KILQEFS+LFG
Sbjct  176   VDSTLQSIAKRGGSAVNIGELALDLTKNITYRAAFGS--SSREKQKEFVKILQEFSRLFG  233

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN +DF P+L     +    RL KAR +LD FIDKIID HI    +R+ +N+ G+ S  
Sbjct  234   AFNFADFIPWLGWIQGKEFTKRLVKARGSLDEFIDKIIDGHI---EKRKKQNNSGDESES  290

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
              AE D+VDEL+ FYS ++    ++DL ++IK TRDNIK IIMDVMFGGTETVASAIEWAM
Sbjct  291   EAELDIVDELMEFYSKDVA---AEDLNSSIKFTRDNIKAIIMDVMFGGTETVASAIEWAM  347

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AELMK+P++LK+LQQEL D VGL+R++ ESDLEKLT+LKCC+KETLRLHPPIP+LLHETA
Sbjct  348   AELMKSPDDLKKLQQELIDVVGLNRRLHESDLEKLTYLKCCIKETLRLHPPIPVLLHETA  407

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E + V GY +PARS  +INAWAI RDK +WEDP++FKP+RFLK+  PDFKGS+FEFIPFG
Sbjct  408   EDSVVAGYSVPARSDVMINAWAINRDKTAWEDPETFKPERFLKDA-PDFKGSHFEFIPFG  466

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLY  +LAV HL HCF+WELPDGMK SDLDM DVFGLTAP+A +L+ +P
Sbjct  467   SGRRSCPGMQLGLYGLDLAVGHLVHCFSWELPDGMKASDLDMSDVFGLTAPRAIQLIAVP  526

Query  1650  TPRLNCQL  1673
             T RL C L
Sbjct  527   TYRLQCLL  534



>ref|XP_003607058.1| Ferulate 5-hydroxylase [Medicago truncatula]
 gb|AES89255.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=518

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/489 (66%), Positives = 401/489 (82%), Gaps = 7/489 (1%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG P+IGNM +MD  SH GLA+LAE+YGG  HL+MG++H+V VS P+ AR+VLQ
Sbjct  36    PYPPGPKGLPIIGNMLMMDQLSHHGLARLAEKYGGFCHLQMGAIHIVAVSTPEMAREVLQ  95

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDN+F+NRPAN+AI+YL+YDRADMAFA+YGPFWRQMRK+CV+KLFSR+RAESW SVR+E
Sbjct  96    AQDNVFANRPANIAITYLTYDRADMAFANYGPFWRQMRKICVMKLFSRKRAESWASVREE  155

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             V  T + +A   GS +N+GEL+F LTR+IT++AAFGS+    +GQ+EF+ ILQEFSKLFG
Sbjct  156   VKATTKIIASKSGSPINLGELVFSLTRSITFKAAFGSNLK--KGQEEFMGILQEFSKLFG  213

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN+++F P+L  F+ Q  N RLA AR ALD FID+IIDDH+     +R KN   +   +
Sbjct  214   AFNIAEFIPWLGWFNGQDFNKRLASARKALDVFIDEIIDDHV----TKRKKNMENKDIEN  269

Query  930   GAETDMVDELLAFYSDEMKVNDSDDL-QNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
              A+ DMVDEL+AF  +      + ++ Q+A+KLTRDNIK +IMDVMFGGTETVAS IEW 
Sbjct  270   EADVDMVDELMAFLDESNGDGAATEISQSALKLTRDNIKALIMDVMFGGTETVASVIEWT  329

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             MAELMK+P++L+++QQELTD +GL RK  E+DLEKLT+LKC +KETLRLHPPIPLLLHET
Sbjct  330   MAELMKSPKDLQKIQQELTDVIGLGRKFNETDLEKLTYLKCIIKETLRLHPPIPLLLHET  389

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AE T V+GY+IP  +R  IN WAI RDK++W++P+ F P RFL EGMPDFKGSNFEFIPF
Sbjct  390   AEDTTVSGYFIPKSTRVWINVWAIGRDKSAWDEPEKFNPSRFLNEGMPDFKGSNFEFIPF  449

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLYA E+ VA+L HCF WELP+GMKPS+LDM+DVFGLTAP+A +LV +
Sbjct  450   GSGRRSCPGMQLGLYAVEMTVANLLHCFKWELPNGMKPSELDMNDVFGLTAPRAVQLVAV  509

Query  1647  PTPRLNCQL  1673
             P+ RLNC L
Sbjct  510   PSYRLNCPL  518



>ref|XP_003629360.1| Ferulate 5-hydroxylase [Medicago truncatula]
 gb|AET03836.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=510

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/489 (70%), Positives = 402/489 (82%), Gaps = 13/489 (3%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG PLIGNMN++D  +HRGLA LA+QYGG+ HL+MG +HMV +S  + AR+VLQ
Sbjct  34    PYPPGPKGLPLIGNMNMLDKLTHRGLANLAKQYGGVYHLRMGFIHMVAISNAEAAREVLQ  93

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
               D+IFSNRPA VAISYL+Y+RADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW SV+DE
Sbjct  94    LHDSIFSNRPATVAISYLTYNRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWQSVKDE  153

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             V+  +  V  N G +VN+GEL+F LT+NI YRAAFGS   S +GQDEFI ILQEFSKLFG
Sbjct  154   VEVVITNVNNNLGKSVNVGELVFNLTKNIIYRAAFGSC--SKEGQDEFISILQEFSKLFG  211

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P L   D QG N RL KAR ALDGFIDKI D+H+    ++RN      +SGD
Sbjct  212   AFNIADFVPCLKWVDPQGFNDRLVKARGALDGFIDKIFDEHV---EKKRN------MSGD  262

Query  930   GAETDMVDELLAFYSDEMKV-NDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
               ++DMVDELLAFYSDE KV N+SDDL N+IKLTRDNIK IIMDVMFGGTETVASA+EWA
Sbjct  263   -EDSDMVDELLAFYSDEAKVENESDDLHNSIKLTRDNIKAIIMDVMFGGTETVASAMEWA  321

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             M+ELM+ PE LKR+QQEL   VGLDR+VEESD+EKLT+LKC +KETLRLHPPIPLLLHET
Sbjct  322   MSELMRNPEELKRVQQELAVVVGLDRRVEESDIEKLTYLKCAVKETLRLHPPIPLLLHET  381

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AE   V GY++P  SR +IN WAI RDK+SWEDP+ F+P RFL    PDFKGS+FEFIPF
Sbjct  382   AEDATVGGYFVPKGSRVMINVWAIGRDKDSWEDPEEFRPSRFLDSSAPDFKGSHFEFIPF  441

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLYA +LA+AHL HCFTWELP+GM+ S++D  DVFGLTAP+A+RL+ +
Sbjct  442   GSGRRSCPGMQLGLYALDLALAHLLHCFTWELPNGMRASEMDTSDVFGLTAPRASRLIAV  501

Query  1647  PTPRLNCQL  1673
             P  R+ C L
Sbjct  502   PAKRVVCPL  510



>emb|CBI38004.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/474 (69%), Positives = 397/474 (84%), Gaps = 8/474 (2%)
 Frame = +3

Query  252   MNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVA  431
             M +M+  +HRGLA L++ YGGLLH+KMG LH+VVVS P+ AR+VLQ QD++F+NRPA VA
Sbjct  1     MLMMNQLTHRGLANLSKVYGGLLHMKMGVLHLVVVSTPEMAREVLQVQDSVFANRPARVA  60

Query  432   ISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGS  611
             I YL+YDRADMAFA YGP WRQMRK+CV+KLFSR+RAESW SVR+EVD+T++++A   GS
Sbjct  61    IKYLTYDRADMAFAQYGPSWRQMRKICVMKLFSRKRAESWASVREEVDSTLQSIAKRGGS  120

Query  612   AVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCF  791
             AVNIGEL   LT+NITYRAAFGSS  S + Q+EF+KILQEFS+LFGAFN +DF P+L   
Sbjct  121   AVNIGELALDLTKNITYRAAFGSS--SREKQEEFVKILQEFSRLFGAFNFADFIPWLGWI  178

Query  792   DLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFY  971
               +  N RL KAR +LD FIDKIIDDHI    +R+ +N+ G+ S   AE DMVDEL+ FY
Sbjct  179   QGKEFNKRLVKARGSLDEFIDKIIDDHI---EKRKKQNNSGDESESEAELDMVDELMEFY  235

Query  972   SDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQ  1151
             S+++    ++DL ++IK TRDNIK IIMDVMFGGTETVASAIEWAMAELMK+P++LK+LQ
Sbjct  236   SEDVA---AEDLNSSIKFTRDNIKAIIMDVMFGGTETVASAIEWAMAELMKSPDDLKKLQ  292

Query  1152  QELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARS  1331
             QELTD VGL+R++ ESDLEKLT+LKCC+KETLRLHPPIP+LLHET+EA+ V GY +PARS
Sbjct  293   QELTDVVGLNRRLHESDLEKLTYLKCCIKETLRLHPPIPVLLHETSEASVVAGYSVPARS  352

Query  1332  RAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLY  1511
               +INAWAI RDK +WEDP++FKP+RFLK+  PDFKGS+FEFIPFGSGRRSCPGMQLGLY
Sbjct  353   DVMINAWAINRDKTAWEDPETFKPERFLKKDAPDFKGSHFEFIPFGSGRRSCPGMQLGLY  412

Query  1512  AFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
               +LAVAHL HCF+WELPDGMK SDLDM D+FGLTAP+A +LV +PT RL C L
Sbjct  413   GLDLAVAHLVHCFSWELPDGMKASDLDMSDLFGLTAPRAIQLVAVPTYRLQCPL  466



>ref|XP_008440792.1| PREDICTED: cytochrome P450 84A1-like [Cucumis melo]
Length=520

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/489 (69%), Positives = 403/489 (82%), Gaps = 6/489 (1%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             P+PPGPKG P IGNM +M+  +HRGLA LA +YGG+ +++MG ++M VVS PD ARQVLQ
Sbjct  36    PFPPGPKGLPFIGNMLMMEQLTHRGLANLAARYGGIFYMRMGFVNMFVVSNPDIARQVLQ  95

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
               D+I SNRPA +AISYL+Y+ ADMAFA+YGPFWRQMRK+CV+KLFSR+RAESW SVRD 
Sbjct  96    VHDSICSNRPATIAISYLTYNCADMAFANYGPFWRQMRKICVMKLFSRKRAESWQSVRDM  155

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VDNTV+ VA+  G+AVNIGEL+F L  +I YRAAFG+S  + QGQDEFI+ILQEFSKLFG
Sbjct  156   VDNTVKKVAVQTGTAVNIGELVFELMGDIIYRAAFGTS--TLQGQDEFIRILQEFSKLFG  213

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P L   D QGLN RL KAR +LD FID IIDDHI++ R   +K    E+   
Sbjct  214   AFNIADFIPSLRWIDPQGLNKRLVKARQSLDKFIDSIIDDHIIRKRNASSKLPNYELE--  271

Query  930   GAETDMVDELLAFYSDEMKV-NDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
               E+DMVDELLAFY ++  + N SDDL+N IKL RDNIKGIIMDVMFGGTETVASAIEWA
Sbjct  272   -TESDMVDELLAFYGEDSSIRNASDDLKNNIKLNRDNIKGIIMDVMFGGTETVASAIEWA  330

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             M+ELM++PE+LK+ QQEL+  VGL R+VEE+DL+ LTFLKCCLKET+RLHPPIPLLLHE 
Sbjct  331   MSELMRSPEDLKKAQQELSQVVGLQRRVEETDLDNLTFLKCCLKETIRLHPPIPLLLHEA  390

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AE   + GY+IPA+SR ++NAWAI RD  SW+D ++F+P RFL++G+PDFKG+NFEFIPF
Sbjct  391   AEDAVIAGYFIPAKSRIMVNAWAIGRDPASWDDAETFRPTRFLEQGVPDFKGNNFEFIPF  450

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLY  E+AVA L HCF WELPDGMKPS++DM DVFGLTAP+ATRLV +
Sbjct  451   GSGRRSCPGMQLGLYGLEIAVAQLLHCFDWELPDGMKPSEMDMSDVFGLTAPRATRLVAV  510

Query  1647  PTPRLNCQL  1673
             PT R+ C L
Sbjct  511   PTKRVLCPL  519



>gb|AGC29946.1| CYP84A52 [Sinopodophyllum hexandrum]
Length=514

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/473 (68%), Positives = 387/473 (82%), Gaps = 7/473 (1%)
 Frame = +3

Query  249   NMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANV  428
             NM + D  +HRG+A+L +QYGG++HL++G LHMV V+ P+ ARQVLQTQDNIFSNRPAN+
Sbjct  47    NMLIADQLTHRGIAQLGKQYGGMVHLRLGLLHMVSVTSPEYARQVLQTQDNIFSNRPANI  106

Query  429   AISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCG  608
             AI YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+R ESW SVRDEV++ +RTV    G
Sbjct  107   AIKYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRGESWASVRDEVNSMMRTVVAKSG  166

Query  609   SAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSC  788
             + +++G L+F LT NI Y+AAFGS      GQ EFI ILQEFSKLFGA N++D+FPFL+ 
Sbjct  167   TPLDVGHLVFNLTNNIIYKAAFGSDLI--HGQSEFISILQEFSKLFGAPNIADYFPFLTW  224

Query  789   FDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAF  968
              D  G++ RL KAR ALD FIDKIIDDH+    + RNK+ G   + D AETDMVD+LLAF
Sbjct  225   ADPSGVHKRLVKARQALDHFIDKIIDDHM---EKNRNKDIGR--NDDDAETDMVDDLLAF  279

Query  969   YSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRL  1148
             Y +  + N  DDLQ  I LTRDNIK IIMDVMFGGTETVASAIEWAMAEL+++P++LK++
Sbjct  280   YRENSENNKPDDLQTTISLTRDNIKAIIMDVMFGGTETVASAIEWAMAELIQSPDDLKKV  339

Query  1149  QQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPAR  1328
             Q+EL + VGLDRKV E+DLEKL F KC +KETLRLHPPIPLLLHET+E  +V+GY IPA+
Sbjct  340   QEELAEVVGLDRKVHETDLEKLPFFKCAIKETLRLHPPIPLLLHETSEDAKVDGYLIPAQ  399

Query  1329  SRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGL  1508
             +R +IN WAI RDK  WE+PD+F P RFLK G PDFKGSNFEF+PFGSGRRSCPGMQLGL
Sbjct  400   ARVVINTWAIGRDKTVWEEPDTFNPSRFLKAGAPDFKGSNFEFLPFGSGRRSCPGMQLGL  459

Query  1509  YAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNC  1667
             YA EL V +L H FTWELPDGMKPS++DM DVFGLTAP+ATRLV +P+PRL C
Sbjct  460   YALELGVVNLLHSFTWELPDGMKPSEMDMSDVFGLTAPRATRLVAVPSPRLVC  512



>ref|XP_006487364.1| PREDICTED: cytochrome P450 84A1-like [Citrus sinensis]
Length=533

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/487 (68%), Positives = 404/487 (83%), Gaps = 12/487 (2%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM +MD  +HRGLA LA++YGGLLHL+MG++H+V VS PD A++VLQ QD +F+NRP
Sbjct  47    IIGNMAMMDQLTHRGLADLAKKYGGLLHLQMGAIHVVAVSTPDMAKEVLQAQDLVFANRP  106

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             ANVAI+YL+YDRADMAFA+YGPFWRQMRK+CV+KLFSRRR ESW SVR+EVD+T++TV  
Sbjct  107   ANVAITYLTYDRADMAFANYGPFWRQMRKICVIKLFSRRREESWASVREEVDSTLQTVMN  166

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
               GS VNIGEL+F LTRNITYRAAFGS   S  GQDEF+KILQEFSKLFGAFN++DFFP+
Sbjct  167   TTGSKVNIGELVFALTRNITYRAAFGSF--SHDGQDEFVKILQEFSKLFGAFNIADFFPW  224

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSG-DG-----AET  941
             +   + +G   R+A+AR +LDGFID IID+H+ + +++  ++  G+++  DG     A+T
Sbjct  225   MGWINARGFYKRMARARESLDGFIDSIIDEHMKKKKKKNVRDEEGKINNNDGEADAEADT  284

Query  942   DMVDELLAFYSDEMKVN---DSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMA  1112
             DMVDEL+AFYS+E  V    D DDLQ+A KLTRD+IK IIMDVMFGGTETVASAIEWAMA
Sbjct  285   DMVDELMAFYSEEEGVTAKGDGDDLQSA-KLTRDHIKAIIMDVMFGGTETVASAIEWAMA  343

Query  1113  ELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAE  1292
             ELMK+P +LK++Q+EL + VGL R + +SDL++LT+LKCC+KETLRLHPPIPLLLHETA 
Sbjct  344   ELMKSPYDLKKVQEELAEKVGLTRILHDSDLKQLTYLKCCIKETLRLHPPIPLLLHETAS  403

Query  1293  ATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGS  1472
              T V+GY IPA+SR +INAWAI RD ++WEDPD F P RFL E  PDF G++FE+IPFGS
Sbjct  404   NTVVSGYNIPAKSRVMINAWAIGRDPSAWEDPDKFNPARFLHENAPDFTGNHFEYIPFGS  463

Query  1473  GRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPT  1652
             GRRSCPGMQLGLYA EL+VAHL HCF WELPDGM P +LDM+D+FGLTAPKA RLV +P+
Sbjct  464   GRRSCPGMQLGLYALELSVAHLLHCFNWELPDGMSPGELDMNDMFGLTAPKACRLVAVPS  523

Query  1653  PRLNCQL  1673
              RL C L
Sbjct  524   YRLTCPL  530



>ref|XP_006423464.1| hypothetical protein CICLE_v10028122mg [Citrus clementina]
 gb|ESR36704.1| hypothetical protein CICLE_v10028122mg [Citrus clementina]
Length=556

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/487 (68%), Positives = 403/487 (83%), Gaps = 12/487 (2%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM +MD  +HRGLA LA++YGGLLHL+MG++H+V VS PD A++VLQ QD +F+NRP
Sbjct  70    IIGNMAMMDQLTHRGLADLAKKYGGLLHLQMGAIHVVAVSTPDMAKEVLQAQDLVFANRP  129

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             ANVAI+YL+YDRADMAFA+YGPFWRQMRK+CV+KLFSRRR ESW SVR+EVD+T++TV  
Sbjct  130   ANVAITYLTYDRADMAFANYGPFWRQMRKICVIKLFSRRREESWASVREEVDSTLQTVMN  189

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
               GS VNIGEL+F LTRNITYRAAFGS   S  GQDEF+KILQEFSKLFGAFN++DFFP+
Sbjct  190   TTGSKVNIGELVFALTRNITYRAAFGSF--SHDGQDEFVKILQEFSKLFGAFNIADFFPW  247

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVS-GDG-----AET  941
             +   + +G   R+A+AR +LDGFID IID+H+ + +++  ++  G+++  DG     A+T
Sbjct  248   MGWINARGFYKRMARARESLDGFIDSIIDEHMKKKKKKNVRDEEGKINYNDGEAEAEADT  307

Query  942   DMVDELLAFYSDEMKV---NDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMA  1112
             DMVDEL+AFYS+E  V    D DDLQ+A KLTRD+IK IIMDVMFGGTETVASAIEWAMA
Sbjct  308   DMVDELMAFYSEEEGVAAKGDGDDLQSA-KLTRDHIKAIIMDVMFGGTETVASAIEWAMA  366

Query  1113  ELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAE  1292
             ELMK+P +LK++Q+EL D VGL R + +SDL++LT+LKCC+KETLRLHPPIPLLLHETA 
Sbjct  367   ELMKSPHDLKKVQEELADKVGLTRILHDSDLKQLTYLKCCIKETLRLHPPIPLLLHETAS  426

Query  1293  ATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGS  1472
              T V+GY IPA+SR +INAWAI RD  +WEDPD F P RFL E  PDF G++FE+IPFGS
Sbjct  427   NTVVSGYNIPAKSRVMINAWAIGRDPFAWEDPDKFNPARFLHENAPDFTGNHFEYIPFGS  486

Query  1473  GRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPT  1652
             GRRSCPGMQLGLYA EL+VAHL HCF WELPDGM P +LDM+D+FGLTAPKA RLV +P+
Sbjct  487   GRRSCPGMQLGLYALELSVAHLLHCFNWELPDGMSPGELDMNDMFGLTAPKACRLVAVPS  546

Query  1653  PRLNCQL  1673
              RL C L
Sbjct  547   YRLTCPL  553



>gb|KDO49907.1| hypothetical protein CISIN_1g009497mg [Citrus sinensis]
Length=533

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/487 (68%), Positives = 404/487 (83%), Gaps = 12/487 (2%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM +MD  +HRGLA LA++YGGLLHL+MG++H+V VS PD A++VLQ QD +F+NRP
Sbjct  47    IIGNMAMMDQLTHRGLADLAKKYGGLLHLQMGAIHVVAVSTPDMAKEVLQAQDLVFANRP  106

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             ANVAI+YL+YDRADMAFA+YGPFWRQMRK+CV+KLFSRRR ESW SVR+EVD+T++TV  
Sbjct  107   ANVAITYLTYDRADMAFANYGPFWRQMRKICVIKLFSRRREESWASVREEVDSTLQTVMN  166

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
               GS VNIGEL+F LTRNITYRAAFGS   S  GQDEF+KILQEFSKLFGAFN++DFFP+
Sbjct  167   TTGSKVNIGELVFALTRNITYRAAFGSF--SHDGQDEFVKILQEFSKLFGAFNIADFFPW  224

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVS-GDG-----AET  941
             +   + +G   R+A+AR +LDGFID IID+H+ + +++  ++  G+++  DG     A+T
Sbjct  225   MGWINARGFYKRMARARESLDGFIDSIIDEHMKKKKKKNVRDEEGKINYNDGEAEAEADT  284

Query  942   DMVDELLAFYSDEMKV---NDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMA  1112
             DMVDEL+AFYS+E  V    D DDLQ+A KLTRD+IK IIMDVMFGGTETVASAIEWAMA
Sbjct  285   DMVDELMAFYSEEEGVAAKGDGDDLQSA-KLTRDHIKAIIMDVMFGGTETVASAIEWAMA  343

Query  1113  ELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAE  1292
             ELMK+P +LK++Q+EL + VGL R + +SDL++LT+LKCC+KETLRLHPPIPLLLHETA 
Sbjct  344   ELMKSPYDLKKVQEELAEKVGLTRILHDSDLKQLTYLKCCIKETLRLHPPIPLLLHETAS  403

Query  1293  ATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGS  1472
              T V+GY IPA+SR +INAWAI RD ++WEDPD F P RFL E  PDF G++FE+IPFGS
Sbjct  404   NTVVSGYNIPAKSRVMINAWAIGRDPSAWEDPDKFNPARFLHENAPDFTGNHFEYIPFGS  463

Query  1473  GRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPT  1652
             GRRSCPGMQLGLYA EL+VAHL HCF WELPDGM P +LDM+D+FGLTAPKA RLV +P+
Sbjct  464   GRRSCPGMQLGLYALELSVAHLLHCFNWELPDGMSPGELDMNDMFGLTAPKACRLVAVPS  523

Query  1653  PRLNCQL  1673
              RL C L
Sbjct  524   YRLTCPL  530



>ref|XP_002313762.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE87717.1| cytochrome P450 family protein [Populus trichocarpa]
Length=519

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/478 (68%), Positives = 392/478 (82%), Gaps = 4/478 (1%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGN+ ++D  +HRGLA L+++YGGL HL+MG LH+V VS P+ AR+VLQ QD +F+NRP
Sbjct  46    IIGNLGMVDQLTHRGLASLSKRYGGLCHLQMGGLHVVAVSTPEIAREVLQAQDVVFANRP  105

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             ANVAI YL+YDRADMAFA+YGPFWRQ RK+CV+KLFSR+RAESW SVRDEV+ TVR V+ 
Sbjct  106   ANVAIVYLTYDRADMAFANYGPFWRQTRKICVMKLFSRKRAESWASVRDEVEFTVRRVSE  165

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
               G  VNIGEL+F LTR+ITY+AAFGSS  S +GQ+EF++ILQEFSKLFGAFNV+DFFP+
Sbjct  166   KTGEPVNIGELVFALTRSITYKAAFGSS--SNEGQEEFMEILQEFSKLFGAFNVADFFPW  223

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             L   + Q  N RLAKAR +LDGFID IID+HI +    ++ N   E   +  ++DMVDEL
Sbjct  224   LGWVNAQDFNKRLAKARNSLDGFIDTIIDEHIAKKNNTKSLNAKDE--NEEVDSDMVDEL  281

Query  960   LAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENL  1139
             LAFYS++   ND D+ ++ +K  +D+IK +IMDVMFGGTETVASAIEWA+AELMK+PE+L
Sbjct  282   LAFYSEDASKNDFDESRSTVKFNKDHIKALIMDVMFGGTETVASAIEWAIAELMKSPEDL  341

Query  1140  KRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYI  1319
             K++ QEL D VGL+R V ESDLEKL +LKC +KETLRLHPPIPLLLHETA+ T +NGY I
Sbjct  342   KKVHQELMDVVGLNRTVHESDLEKLIYLKCAMKETLRLHPPIPLLLHETAKDTVLNGYRI  401

Query  1320  PARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQ  1499
             PARSR +INAWAI RD N+WEDPD F P RFL    PDF+G +FEF+PFGSGRRSCPGMQ
Sbjct  402   PARSRVMINAWAIGRDPNAWEDPDKFNPSRFLDGKAPDFRGMDFEFLPFGSGRRSCPGMQ  461

Query  1500  LGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             LGLYA ELAVAHL HCF WELP GMKP++LDM+DVFGLTAP+A RLV +PT RLNC L
Sbjct  462   LGLYALELAVAHLLHCFNWELPHGMKPAELDMNDVFGLTAPRAVRLVAVPTYRLNCPL  519



>ref|XP_004292435.1| PREDICTED: cytochrome P450 84A1-like [Fragaria vesca subsp. vesca]
Length=500

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/488 (66%), Positives = 391/488 (80%), Gaps = 11/488 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG P++GNM ++D  +HRGLA+L + YGGL+HL++G LH++ VS P+ AR++LQ
Sbjct  24    PYPPGPKGLPIVGNMLMLDQLTHRGLAQLGKLYGGLVHLQIGVLHIMAVSTPEMAREILQ  83

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD++F+NRPANV I+YL+YDRADMAFA+YGPFWR+MRK+CV+ +FSR+RAESW SVR+E
Sbjct  84    AQDSVFANRPANVTIAYLTYDRADMAFANYGPFWRRMRKICVMNIFSRKRAESWASVREE  143

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             +D TVRTVA   GS VNIGEL+F LTRNITYRAAFGS   S +GQDEF+KILQEFSKLFG
Sbjct  144   IDETVRTVAEKVGSPVNIGELVFALTRNITYRAAFGSK--SHEGQDEFMKILQEFSKLFG  201

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN+ DF P+L     Q    R+AKAR +LD FIDKIIDDH+ +   + N        G 
Sbjct  202   AFNMQDFLPWLGWMHGQAFQNRMAKARKSLDVFIDKIIDDHMTKKTTKEN--------GI  253

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
              AETDMVDELLAF  ++  + D DD  +   LTRDNIK ++MDVMFGGTETVAS IEW +
Sbjct  254   EAETDMVDELLAFIRNDASM-DIDDSNSGFALTRDNIKALVMDVMFGGTETVASVIEWTL  312

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AELMK+P++L ++QQEL D VGL+R+V+E+DLE LT+LKC +KE LRLHPPIPLLLHE A
Sbjct  313   AELMKSPQDLIKVQQELVDVVGLNRRVQETDLENLTYLKCAVKEALRLHPPIPLLLHEAA  372

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
             E   V GY  PA SR  INAWAI RD ++W++PD FKP RFLK+G PDFKG++FEFIPFG
Sbjct  373   EDGVVAGYSFPAGSRVYINAWAIGRDPSAWDEPDKFKPSRFLKDGSPDFKGNDFEFIPFG  432

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGM LGLY  E+AVAHL HCFTWELPDGMK S+LDM+DVFGLTAP+A +LV +P
Sbjct  433   SGRRSCPGMALGLYGLEMAVAHLLHCFTWELPDGMKASELDMNDVFGLTAPRAVQLVAVP  492

Query  1650  TPRLNCQL  1673
               RLNC L
Sbjct  493   HYRLNCPL  500



>ref|XP_008391587.1| PREDICTED: cytochrome P450 84A1-like [Malus domestica]
Length=519

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/478 (68%), Positives = 390/478 (82%), Gaps = 8/478 (2%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM + D  +HRGLA LA+QYGGLLHL+MG +H++ VS PD AR++LQ+QD++F+NRP
Sbjct  50    IIGNMLMTDQLTHRGLAHLAKQYGGLLHLQMGVIHVMAVSTPDMAREILQSQDSLFANRP  109

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             ANVAISYL+YDRADMAFA+YGPFWR+MRK+CV+ LFSR+RAESW SVR+EVD  V+TVA 
Sbjct  110   ANVAISYLTYDRADMAFANYGPFWRRMRKICVINLFSRKRAESWASVREEVDEMVQTVAG  169

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
               GS VNIG+L+F LTRNITYRAAFGSS   GQG  EF++ILQEFSKLFGAFN+ DF P+
Sbjct  170   KTGSPVNIGQLVFALTRNITYRAAFGSSSHEGQG--EFVQILQEFSKLFGAFNMQDFLPW  227

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             L     QG   R+A+AR +LD FIDKIIDDH+ + +    K+       + A+TDMVDEL
Sbjct  228   LGWVHAQGFQDRMARARKSLDVFIDKIIDDHMAKRKANMEKD-----DSEAADTDMVDEL  282

Query  960   LAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENL  1139
             +A++SD+    + DD  +  KLTRDNIK +IMDVMFGGTETVAS IEW MAELMK+PE+L
Sbjct  283   IAYFSDDAG-KEGDDPNSGFKLTRDNIKALIMDVMFGGTETVASVIEWTMAELMKSPEDL  341

Query  1140  KRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYI  1319
             KR+QQELTD VGL+R+++E+DLE LT+LKC +KE+LRLHPPIPLLLHET E T V GY  
Sbjct  342   KRVQQELTDVVGLNRRLQETDLENLTYLKCAVKESLRLHPPIPLLLHETVEDTSVAGYSF  401

Query  1320  PARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQ  1499
             PA SR  INAWAIARD  +W++P++FKP RFL++  PDFKGSNFEFIPFGSGRRSCPGM 
Sbjct  402   PAGSRVWINAWAIARDPTAWDEPETFKPSRFLEDSSPDFKGSNFEFIPFGSGRRSCPGMA  461

Query  1500  LGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             LGLY  E+AVAHL HCF WELP GMKPS+LDM+DVFGLTAPKA +LV +PT RLNC L
Sbjct  462   LGLYGLEMAVAHLLHCFAWELPGGMKPSELDMNDVFGLTAPKAVQLVAVPTYRLNCPL  519



>ref|XP_011092843.1| PREDICTED: cytochrome P450 84A1-like [Sesamum indicum]
Length=520

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/488 (66%), Positives = 392/488 (80%), Gaps = 6/488 (1%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             P+PPGPKG P+IGNM ++   +HRGLA+LA+ YGGL HLKMG +HMV VS  + ARQVLQ
Sbjct  38    PFPPGPKGLPVIGNMRMISLLTHRGLAELAKTYGGLFHLKMGHVHMVAVSTAEMARQVLQ  97

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDN+FSNRPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV K+FSR+RAESW S R+E
Sbjct  98    AQDNVFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVTKVFSRKRAESWASAREE  157

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             +D+ ++ +    GS VNIGE++ GLT+NITYRAAFGS   S +GQ+EF+KI+QEFSKLFG
Sbjct  158   IDSLIKAIDARVGSPVNIGEIVLGLTKNITYRAAFGSM--SQEGQEEFVKIMQEFSKLFG  215

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFNV+DF P++   + Q  + RL KAR +LD FIDKIIDDH+   ++R NKN   E  G 
Sbjct  216   AFNVADFLPWMRWINGQDFHKRLEKARGSLDQFIDKIIDDHL---KKRHNKNSHEEDDGA  272

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
               E DMVDEL+ FY +E   + +D +   I +TRDNIK +IMDVMFGGTETVASAIEWAM
Sbjct  273   KVEDDMVDELMEFY-NENDNSKNDPVSTNISITRDNIKALIMDVMFGGTETVASAIEWAM  331

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AELM + E+LK++QQEL + VG DRKV+ESDLEKLT+L+C +KETLRLHPPIPLLLHETA
Sbjct  332   AELMHSWEDLKKVQQELAEVVGFDRKVQESDLEKLTYLRCVVKETLRLHPPIPLLLHETA  391

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
                 V+GY IPA++R +INAWAIAR+  +W++P++F P RFL+ G PDF+GSNFE+IPFG
Sbjct  392   ADAVVDGYKIPAKARVMINAWAIAREHGAWDEPNTFMPSRFLESGAPDFRGSNFEYIPFG  451

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLYA EL VAHL H F WELPDGMK  DLDM+DVFGLTAP+A +LV IP
Sbjct  452   SGRRSCPGMQLGLYALELTVAHLCHSFNWELPDGMKGDDLDMNDVFGLTAPRAVQLVAIP  511

Query  1650  TPRLNCQL  1673
               RLN  L
Sbjct  512   QNRLNFPL  519



>emb|CDX72582.1| BnaC07g46040D [Brassica napus]
Length=480

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/490 (64%), Positives = 379/490 (77%), Gaps = 47/490 (10%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             + YPPGP+GWP+IGNM +MD  +HRGLA LA++YGGL HL+MG LHM  VS PD ARQVL
Sbjct  37    RSYPPGPRGWPIIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPDVARQVL  96

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             Q QD+IFSNRPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRD
Sbjct  97    QVQDSIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRD  156

Query  567   EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLF  746
             EVD  +R V+ N G ++N+GE IF LTRNITYRAAFGS  +  +GQDEFI+ILQEFSKLF
Sbjct  157   EVDKMIRLVSSNVGKSINVGEQIFALTRNITYRAAFGS--ACEKGQDEFIRILQEFSKLF  214

Query  747   GAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSG  926
             GAFNV+DF P+    D QG+N RL KAR  LDGFID IID+H+   +++ N+N   +  G
Sbjct  215   GAFNVADFIPYFGWIDPQGINKRLVKARNDLDGFIDDIIDEHM---KKKENQNTVDD--G  269

Query  927   DGAETDMVDELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEW  1103
                +TDMVD+LLAFYS+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEW
Sbjct  270   YVGDTDMVDDLLAFYSEEAKLVSETTDLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEW  329

Query  1104  AMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhE  1283
             A+ EL+++PE+LKR+QQEL + VGLDR++EESD+EK                        
Sbjct  330   ALTELLRSPEDLKRVQQELAEVVGLDRRLEESDIEK------------------------  365

Query  1284  TAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIP  1463
                            SR +INA+AI RD  SW D ++F+P RFL+ G+ DFKGSNFEFIP
Sbjct  366   ---------------SRVMINAFAIGRDPKSWPDAETFRPSRFLEPGVADFKGSNFEFIP  410

Query  1464  FGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVV  1643
             FGSGRRSCPGMQLGLYA ELAVAH+ HCFTW+LPDGMKPS+LDM+DVFGLTAPKATRL  
Sbjct  411   FGSGRRSCPGMQLGLYALELAVAHILHCFTWKLPDGMKPSELDMNDVFGLTAPKATRLFA  470

Query  1644  IPTPRLNCQL  1673
             +P+ RL C +
Sbjct  471   VPSTRLICAV  480



>ref|XP_010550444.1| PREDICTED: cytochrome P450 84A1-like [Tarenaya hassleriana]
Length=514

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/485 (67%), Positives = 388/485 (80%), Gaps = 5/485 (1%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGP G P++GN N++D  +HRGLA+L+E++GGL H+++G LHM  VS P+ ARQVLQ
Sbjct  30    PYPPGPAGLPIVGNFNILDKMTHRGLAELSERFGGLFHVRVGFLHMFAVSSPEIARQVLQ  89

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
               D +FSNRPA  AI YL+YDRADMAFAHYGPFWRQMRKLCVVKLFSR+RAESW SVRDE
Sbjct  90    VHDGVFSNRPATAAIRYLTYDRADMAFAHYGPFWRQMRKLCVVKLFSRKRAESWASVRDE  149

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD  VR V  +    VN+GELIF LTRNI YRAAFGS+  S +GQDEF+KILQEFSKLFG
Sbjct  150   VDKMVRLVETHSDQPVNVGELIFSLTRNIIYRAAFGSA--SDEGQDEFVKILQEFSKLFG  207

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF PFL   D  G+  R  +ARA+LD FID IID H+ + ++ R+   GG+ + D
Sbjct  208   AFNIADFLPFLGWIDPHGIKGRTKRARASLDQFIDTIIDKHVEKKKKNRSTGDGGDPNED  267

Query  930   GAETDMVDELLAFYSDEMKVNDSD-DLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
                TDMVDELLAF  D    N+S  D  N I+LTRDNIK IIMDVMFGGTETVASAIEW 
Sbjct  268   --TTDMVDELLAFCGDGNAENESAADPNNTIELTRDNIKAIIMDVMFGGTETVASAIEWT  325

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             M+EL+++P+  K++Q EL D VGL+R+VE++DL  L +LKC +KETLRLHPPIPLLLHET
Sbjct  326   MSELLRSPDEFKQVQSELADAVGLERRVEDTDLPMLPYLKCVVKETLRLHPPIPLLLHET  385

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AE  EV GY+IP  SR +INAWAI RD  SWEDPDSF+P RFL++G  DF+GS+FEFIPF
Sbjct  386   AEDAEVAGYFIPKGSRVMINAWAIGRDPASWEDPDSFRPSRFLEQGAADFRGSSFEFIPF  445

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLYA ELAVA+L HCFTW+LPD  KPS+LDM D+FGLTAP+A+RL+ +
Sbjct  446   GSGRRSCPGMQLGLYALELAVANLLHCFTWDLPDETKPSELDMADMFGLTAPRASRLLAV  505

Query  1647  PTPRL  1661
             P+ R+
Sbjct  506   PSKRV  510



>ref|XP_011047458.1| PREDICTED: cytochrome P450 84A1-like [Populus euphratica]
Length=519

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/478 (67%), Positives = 392/478 (82%), Gaps = 4/478 (1%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGN+ ++D  +HRGLA L+++YGGL HL+MG LH+V VS P+ AR+VLQ QD +F+NRP
Sbjct  46    IIGNLGMVDQLTHRGLANLSKRYGGLCHLQMGGLHVVAVSTPEIAREVLQAQDVVFANRP  105

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             ANVAI YL+YDRADMAFA+YGPFWRQ RK+CV+KLFSR+RAESW SVRDEV+ TVR V+ 
Sbjct  106   ANVAIVYLTYDRADMAFANYGPFWRQTRKICVIKLFSRKRAESWASVRDEVEFTVRQVSE  165

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
               G  VN+GEL+F LTR+ITY+AAFGSS  S +GQ+EF++ILQEFSKLFGAFNV+DFFP+
Sbjct  166   RTGEPVNLGELVFALTRSITYKAAFGSS--SNEGQEEFMEILQEFSKLFGAFNVADFFPW  223

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             L   + Q  N RLAKAR +LDGFID IID+HI +   R++ N   E   +  ++DMVDEL
Sbjct  224   LGWVNAQDFNKRLAKARNSLDGFIDTIIDEHIAKKNNRKSLNAKDE--NEEVDSDMVDEL  281

Query  960   LAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENL  1139
             L FYS++   N+ D+ ++ +K  +D+IK +IMDVMFGGTETVASAIEWA+AELMK+PE+L
Sbjct  282   LDFYSEDASKNNFDESKSTVKFNKDHIKALIMDVMFGGTETVASAIEWAIAELMKSPEDL  341

Query  1140  KRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYI  1319
             KR+ +EL D VGL+R V ESDLEKL +LKC +KETLRLHPPIPLLLHETA+ T +NGY I
Sbjct  342   KRVHKELMDVVGLNRTVHESDLEKLIYLKCAMKETLRLHPPIPLLLHETAKDTVLNGYRI  401

Query  1320  PARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQ  1499
             PARSR +INAWAI RD N+WE+PD F P RFL    PDF+G +FEF+PFGSGRRSCPGMQ
Sbjct  402   PARSRVMINAWAIGRDPNAWENPDKFNPSRFLDGKAPDFRGMDFEFLPFGSGRRSCPGMQ  461

Query  1500  LGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             LGLYA ELAVAHL HCF WELP GMKP++LDM+DVFGLTAP+A RLV +PT RLNC L
Sbjct  462   LGLYALELAVAHLLHCFNWELPHGMKPAELDMNDVFGLTAPRAVRLVAVPTYRLNCPL  519



>ref|XP_006409197.1| hypothetical protein EUTSA_v10022643mg [Eutrema salsugineum]
 gb|ESQ50650.1| hypothetical protein EUTSA_v10022643mg [Eutrema salsugineum]
Length=521

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/492 (65%), Positives = 396/492 (80%), Gaps = 17/492 (3%)
 Frame = +3

Query  207   KP-YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQV  383
             KP YPPGPKG P+IGNM +MD  +H GLAKLA QYGGL HL+MG  H+  ++ PD ARQV
Sbjct  38    KPLYPPGPKGLPIIGNMLMMDQLTHHGLAKLANQYGGLFHLRMGFRHVFAITSPDVARQV  97

Query  384   LQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR  563
             LQ QD  FSNRP  +AI+YL+YD ADMAFA YGPFWRQMRK+CV+K+FSR+RAESW SVR
Sbjct  98    LQVQDISFSNRPVTIAINYLTYDLADMAFAPYGPFWRQMRKVCVMKVFSRKRAESWASVR  157

Query  564   DEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKL  743
             DEV+N VR+++ N G  VN+GELIF LTRNITYRAAFG++  + Q  DEFI+ILQEFSKL
Sbjct  158   DEVNNMVRSLSSNLGKPVNVGELIFTLTRNITYRAAFGAACETEQ--DEFIRILQEFSKL  215

Query  744   FGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVS  923
             FGAFN++DF PFL  FDLQG+N RL KAR  LDGFID++ID+H+    ++R      E+ 
Sbjct  216   FGAFNIADFIPFLGWFDLQGINKRLVKARNDLDGFIDEVIDEHM----KKR------EIV  265

Query  924   GDGAETDMVDELLAFYSDEMKV----NDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVAS  1091
                 +TDMVD+LLAFYS+E K+    + +D  +NA+KLTRDNIK ++MDVMFGGTET+AS
Sbjct  266   NVDEDTDMVDDLLAFYSEEEKLVSEDSSTDRNKNAMKLTRDNIKALVMDVMFGGTETMAS  325

Query  1092  AIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppipl  1271
              IEWA+ EL++ P  LKRLQQEL + VGLDR+V+E+ LEKLTFLKC LKET+RLHPPIPL
Sbjct  326   GIEWALTELLRNPNELKRLQQELAEVVGLDRRVDETHLEKLTFLKCTLKETMRLHPPIPL  385

Query  1272  llhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNF  1451
             +LHE  E T++ G+ +P  SR +INA+AIARD   W DP++F+P RF++ GMPDF G+NF
Sbjct  386   ILHEAVEDTKLQGFSVPKGSRLMINAFAIARDPKLWVDPEAFRPSRFMEPGMPDFMGTNF  445

Query  1452  EFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKAT  1631
             EFIPFG+GRRSCPGMQLGLYA E+AVA++ HC+TW+LP+GMKPS+LDM DV GLTAP+AT
Sbjct  446   EFIPFGAGRRSCPGMQLGLYAMEVAVANIIHCYTWQLPNGMKPSELDMSDVMGLTAPRAT  505

Query  1632  RLVVIPTPRLNC  1667
             RL+ +P  RL C
Sbjct  506   RLIAVPNTRLIC  517



>ref|XP_010672525.1| PREDICTED: cytochrome P450 84A1-like [Beta vulgaris subsp. vulgaris]
Length=514

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/485 (64%), Positives = 385/485 (79%), Gaps = 11/485 (2%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             +PYPPGP G P+IGNM +MD  +HRGLAKLA +YGGL HLKMG +H++VVS P EA+ VL
Sbjct  40    RPYPPGPTGLPIIGNMMMMDQLNHRGLAKLARRYGGLFHLKMGFVHIMVVSSPKEAQLVL  99

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             Q  DNIFSNRPA +AI+YL+Y+RADM FAHYGPFWR++ KLCV++LFSR+RA+SW SV  
Sbjct  100   QAHDNIFSNRPATIAINYLTYNRADMVFAHYGPFWRKICKLCVIRLFSRKRAKSWQSVHY  159

Query  567   EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLF  746
             EVD+ V+ +    GS +NIGEL+F LT+N+TYRAAFG  P   +G DE   ILQE+SKLF
Sbjct  160   EVDDMVQDLLGRAGSPINIGELMFKLTKNVTYRAAFG--PKFSKGVDELFAILQEYSKLF  217

Query  747   GAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSG  926
             GAFN++DF PFL+  D  GLN RL   R+ALD FID IIDDH+       NK +  ++ G
Sbjct  218   GAFNIADFIPFLTWVDPSGLNDRLVMVRSALDRFIDPIIDDHM-------NKKY--DIHG  268

Query  927   DGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
                E DMVD+LL FYSDE K+N+S+DLQN+IKLTRDNIK IIMDVM GG+ETV  A+EW 
Sbjct  269   HVEEEDMVDDLLKFYSDETKINESEDLQNSIKLTRDNIKAIIMDVMIGGSETVTWAVEWV  328

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             M EL++ P+++KR+QQEL D VGL R+V E DL+KL FL+CC+KETLR+HPPIPLLLHET
Sbjct  329   MTELLRNPQDMKRVQQELVDIVGLTRRVNEMDLDKLPFLRCCMKETLRMHPPIPLLLHET  388

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
              E   + GYYIP +S+ +IN WAI RD NSW D D+FKP+RFL+EG+PDFKG +FEFIPF
Sbjct  389   NEDAIIGGYYIPKQSQVMINTWAIGRDANSWPDADTFKPERFLEEGIPDFKGCHFEFIPF  448

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGM LGL+  E+ +A+L HCFTWELPD MKPS++ +D+ FGLTAP A+RL+ +
Sbjct  449   GSGRRSCPGMMLGLHMLEICMANLLHCFTWELPDEMKPSEVSIDEKFGLTAPMASRLIAV  508

Query  1647  PTPRL  1661
             P+PRL
Sbjct  509   PSPRL  513



>ref|XP_009384541.1| PREDICTED: cytochrome P450 84A1-like [Musa acuminata subsp. malaccensis]
Length=516

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/485 (67%), Positives = 383/485 (79%), Gaps = 19/485 (4%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM +MD  +HRGLAKL E YGGL HL++G LH   VS P+ ARQVLQ QDN+FSNRP
Sbjct  45    VIGNMLMMDQLTHRGLAKLGEHYGGLCHLRLGFLHAFAVSTPEIARQVLQVQDNVFSNRP  104

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +AISYL+Y+RADMAFAHYGPFWRQMRKLCV+KLFS++RAESW SVR+EVD  VR++A 
Sbjct  105   ATIAISYLTYNRADMAFAHYGPFWRQMRKLCVMKLFSKKRAESWASVREEVDVAVRSLAD  164

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
               GSAVN+GEL+F LT+NI +RAAFG+   S + Q+EFI ILQEFSKLFG+FN+ DF P+
Sbjct  165   RAGSAVNVGELLFNLTKNIIFRAAFGT--QSHENQNEFISILQEFSKLFGSFNIGDFIPW  222

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             LS  D QG+N RL  ARA+LD FIDKIID+H+   +             D ++ DMVD++
Sbjct  223   LSWMDPQGINKRLKVARASLDRFIDKIIDEHMANRK-----------EADASDADMVDDM  271

Query  960   LAFYSDE---MKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTP  1130
             LAF  +     +  + DDLQ  +KLTR+NIK IIMDVMFGGTETVASAIEWAMAELMK+P
Sbjct  272   LAFLDESGYRCQAGERDDLQGTLKLTRNNIKAIIMDVMFGGTETVASAIEWAMAELMKSP  331

Query  1131  ENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNG  1310
             E++KR+QQEL   VGLDRKV ESDL+KL+FLKC  KETLRLHPPIPLLLHETAE  EV G
Sbjct  332   EDMKRVQQELAHVVGLDRKVHESDLDKLSFLKCVTKETLRLHPPIPLLLHETAEDCEVAG  391

Query  1311  YYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMP---DFKGSNFEFIPFGSGRR  1481
             Y +PARSR +IN WAI RDK+SWED D+F+P RF   G     DFKG+ FEF+PFGSGRR
Sbjct  392   YTVPARSRVMINVWAIGRDKSSWEDADAFRPSRFTPGGCAASLDFKGNYFEFLPFGSGRR  451

Query  1482  SCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRL  1661
             SCPGMQLGL+A ELAVA L HCFTW LPDGMKPS+LDM DVFGLTAP+A RL  +P PRL
Sbjct  452   SCPGMQLGLHALELAVAQLIHCFTWTLPDGMKPSELDMGDVFGLTAPRAVRLAAVPAPRL  511

Query  1662  NCQLH  1676
             +C L+
Sbjct  512   SCPLY  516



>gb|KFK40191.1| hypothetical protein AALP_AA3G341800 [Arabis alpina]
Length=503

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/494 (64%), Positives = 390/494 (79%), Gaps = 16/494 (3%)
 Frame = +3

Query  207   KP-YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQV  383
             KP YPPGPKG P+IGNM +MD  +H GLAKLA QYGGL HL+MG  H+  ++ PD ARQV
Sbjct  21    KPLYPPGPKGLPIIGNMLMMDQLTHHGLAKLANQYGGLFHLRMGFRHVFAITSPDVARQV  80

Query  384   LQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR  563
             LQ QD  FSNRP  +AI+YL+YD +DMAFA YGPFWRQMRK+CV+K+FSR+RAESW SVR
Sbjct  81    LQVQDLSFSNRPVTIAINYLTYDLSDMAFAPYGPFWRQMRKVCVMKVFSRKRAESWASVR  140

Query  564   DEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKL  743
             DEV+N V +++ N G AVN+GELIF LTRNITYRAAFG++  + Q  DEFI+ILQEFSKL
Sbjct  141   DEVNNMVVSLSSNIGKAVNVGELIFTLTRNITYRAAFGAACETEQ--DEFIRILQEFSKL  198

Query  744   FGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVS  923
             FGAFNV+DF PFL  FDLQG+N RL KAR  LDGFID++ID+H+   ++R N  +  E  
Sbjct  199   FGAFNVADFIPFLGWFDLQGINKRLVKARNDLDGFIDEVIDEHM---KKRENNVNVDE--  253

Query  924   GDGAETDMVDELLAFYSDEMKVNDSDDL----QNAIKLTRDNIKGIIMDVMFGGTETVAS  1091
                 ETDMVD+LLAFYS+  K+   D      +N++KLTRDNIK ++MDVMFGGTET+AS
Sbjct  254   ----ETDMVDDLLAFYSEGEKLVSEDSSSTRNKNSVKLTRDNIKALVMDVMFGGTETMAS  309

Query  1092  AIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppipl  1271
              IEWA+ EL++ P+ LK LQ+EL + VGLD++V+++ LEKLTFLKC +KET+RLHPPIPL
Sbjct  310   GIEWALTELLRNPDQLKLLQKELAEVVGLDQRVDDTHLEKLTFLKCTMKETMRLHPPIPL  369

Query  1272  llhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNF  1451
             + HE  E T++ G+ +P  SR  INA+AIARD   W DP++FKP RF++ GMPDF GSNF
Sbjct  370   IFHEAVEDTKLQGFSVPKGSRLTINAFAIARDPKLWVDPEAFKPSRFMEPGMPDFMGSNF  429

Query  1452  EFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKAT  1631
             EFIPFGSGRRSCPGMQLGLYA E+AVA++ HCF W+LPDG KPS+LDM DV  LTAP+AT
Sbjct  430   EFIPFGSGRRSCPGMQLGLYAMEVAVANIIHCFDWQLPDGTKPSELDMSDVMALTAPRAT  489

Query  1632  RLVVIPTPRLNCQL  1673
             RL+ +P  RL C L
Sbjct  490   RLIAVPNKRLICPL  503



>ref|XP_009150750.1| PREDICTED: cytochrome P450 84A1-like [Brassica rapa]
Length=514

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/483 (64%), Positives = 386/483 (80%), Gaps = 15/483 (3%)
 Frame = +3

Query  213   YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQT  392
             +PPGPKG P+IGNM +MD  +H GLAKLA +YGGL HL+MG  H+  ++ PD ARQVLQ 
Sbjct  41    FPPGPKGLPVIGNMLMMDQLTHHGLAKLAHKYGGLFHLRMGFRHVFAITSPDVARQVLQV  100

Query  393   QDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEV  572
             QD  FSNRP  VAI+YL+YD ADMAFA YGPFWRQMRK+CV+K+FSR+R ESW SVR+EV
Sbjct  101   QDVSFSNRPVTVAINYLTYDLADMAFAPYGPFWRQMRKVCVMKVFSRKRTESWASVREEV  160

Query  573   DNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGA  752
             +N VR+++ N G  VN+GELIF LTRNITYRAAFG++  + Q  DEFI+ILQEFSKLFGA
Sbjct  161   NNMVRSLSSNVGKPVNVGELIFTLTRNITYRAAFGAACETEQ--DEFIRILQEFSKLFGA  218

Query  753   FNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDG  932
             FN++D+ PFL  FDLQG+N RL KAR  LDGFID++ID+H+ +T          E     
Sbjct  219   FNIADYIPFLGWFDLQGINKRLVKARNDLDGFIDEVIDEHMKKT----------ETVNVD  268

Query  933   AETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMA  1112
              +TDMVD LLAFYS++   N +   +N +KLTRDNIK ++MDVMFGGTET+AS IEWA+ 
Sbjct  269   EDTDMVDVLLAFYSEDSSTNRN---KNTVKLTRDNIKALVMDVMFGGTETMASGIEWALT  325

Query  1113  ELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAE  1292
             EL++ P  LKRLQQELT+ VGLDR+V+++ LE+LTFLKC LKET+RLHPPIPL+LHE  E
Sbjct  326   ELLRNPAELKRLQQELTEVVGLDRRVDDTHLEQLTFLKCTLKETMRLHPPIPLILHEAIE  385

Query  1293  ATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGS  1472
              T++ G+ +P  SR +INA+AIARD   W DP++F+P RF++ GMPDF G+NFEFIPFG+
Sbjct  386   DTKLQGFSVPKGSRLMINAFAIARDPKLWVDPEAFRPSRFMEPGMPDFMGTNFEFIPFGA  445

Query  1473  GRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPT  1652
             GRRSCPGMQLGLYA E+AVA++ HCFTW+LPDGMKPS+LDM DV GLTAP+ATRL+ +P 
Sbjct  446   GRRSCPGMQLGLYAMEVAVANIIHCFTWKLPDGMKPSELDMSDVMGLTAPRATRLIAVPD  505

Query  1653  PRL  1661
              RL
Sbjct  506   TRL  508



>emb|CDX75562.1| BnaA01g01400D [Brassica napus]
Length=482

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/481 (64%), Positives = 375/481 (78%), Gaps = 46/481 (10%)
 Frame = +3

Query  234   WPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSN  413
             WP+IGNM++MD  +HRGLA LA++YGGL HL+MG LHM  VS PD A+QVLQ QD++FSN
Sbjct  47    WPIIGNMSMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPDVAKQVLQVQDSVFSN  106

Query  414   RPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTV  593
             RPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  +R+V
Sbjct  107   RPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMIRSV  166

Query  594   AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFF  773
             + N G ++N+GE IF LTRNITYRAAFGS  +  +GQDEFI+ILQEFSKLFGAFNV+DF 
Sbjct  167   SSNVGKSINVGEQIFALTRNITYRAAFGS--ACEKGQDEFIRILQEFSKLFGAFNVADFI  224

Query  774   PFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVD  953
             P+    D QG+N RL KAR  LDGFID IID+H+     ++ +N     +GD  +TDMVD
Sbjct  225   PYFGWIDPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNSVDAGDVVDTDMVD  279

Query  954   ELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTP  1130
             +LLAFYS+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++P
Sbjct  280   DLLAFYSEEAKLVSETADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSP  339

Query  1131  ENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNG  1310
             E+LKR+QQEL + VGLDR+++                                      G
Sbjct  340   EDLKRVQQELAEVVGLDRRID--------------------------------------G  361

Query  1311  YYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCP  1490
             Y++P +SR +INA+AI RDKNSW DP++F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCP
Sbjct  362   YFVPKKSRVMINAFAIGRDKNSWVDPETFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCP  421

Query  1491  GMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQ  1670
             GMQLGLYA ELAVAH+ HCFTW+LPDGMKPS+LDM DVFGLTAPKATRL  +P+ RL C 
Sbjct  422   GMQLGLYALELAVAHILHCFTWKLPDGMKPSELDMGDVFGLTAPKATRLYAVPSTRLICS  481

Query  1671  L  1673
             +
Sbjct  482   V  482



>ref|XP_010933756.1| PREDICTED: cytochrome P450 84A1-like [Elaeis guineensis]
Length=523

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/483 (66%), Positives = 378/483 (78%), Gaps = 18/483 (4%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM +MD  +HRGLAKLAE+YGGL HL++G LH   VS PD ARQVLQ QDN FSNRP
Sbjct  53    IIGNMLMMDQLTHRGLAKLAEKYGGLCHLRLGYLHAFAVSTPDVARQVLQVQDNAFSNRP  112

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +AI+YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW SVRDEVD T+R  + 
Sbjct  113   ATIAITYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWASVRDEVDTTLRAASD  172

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
               GS VN+GEL+F LT+NI +RAAFG+   + + QDEFI ILQEFSKLFGAFN+ DF P+
Sbjct  173   RRGSPVNLGELVFNLTKNIIFRAAFGT--HNHEDQDEFIGILQEFSKLFGAFNIGDFIPW  230

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             LS  D+QG+N RL  AR +LD FIDKI+D+H+   +             D  + DMVD++
Sbjct  231   LSWMDMQGINKRLKAARGSLDRFIDKILDEHLANPK-----------VADAEDADMVDDM  279

Query  960   LAFYSDE--MKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPE  1133
             LAF  D    K     DLQ  +KLTRDNIK IIMDVMFGGTETVASAIEWA+AELM+ PE
Sbjct  280   LAFLGDSPAGKGGAGGDLQGYLKLTRDNIKAIIMDVMFGGTETVASAIEWALAELMRKPE  339

Query  1134  NLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGY  1313
              LKR+QQEL D VGLDRKV ESDL+KL++LKC +KETLRLHPPIPLLLHETAE  E+ GY
Sbjct  340   ELKRVQQELADVVGLDRKVHESDLDKLSYLKCAIKETLRLHPPIPLLLHETAEDCEIAGY  399

Query  1314  YIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMP---DFKGSNFEFIPFGSGRRS  1484
              +P +SR +IN WAI RDK++W+D ++F+P RF  +G     DF+G+ FE +PFGSGRRS
Sbjct  400   AVPKKSRVMINVWAIGRDKSAWKDAETFRPSRFTPDGDSAGVDFRGNYFELLPFGSGRRS  459

Query  1485  CPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLN  1664
             CPGMQLGLYA ELAVA L HCF W LPDGMKPS+LDM DVFGLTAP+A RLV +PTPRLN
Sbjct  460   CPGMQLGLYALELAVAQLMHCFNWSLPDGMKPSELDMGDVFGLTAPRAVRLVAVPTPRLN  519

Query  1665  CQL  1673
             C L
Sbjct  520   CAL  522



>ref|XP_008448126.1| PREDICTED: cytochrome P450 84A1-like [Cucumis melo]
Length=523

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/484 (67%), Positives = 382/484 (79%), Gaps = 6/484 (1%)
 Frame = +3

Query  213   YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQT  392
             YPPGP G P+IGNM +MD  +HRGLA LA  YGGL HL++G LHMVVVS PD AR+ LQ 
Sbjct  32    YPPGPTGLPIIGNMLMMDQLTHRGLAHLATIYGGLFHLRLGILHMVVVSTPDMAREFLQV  91

Query  393   QDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEV  572
             QD  F+NRPANVAISYL+YDRADMAFA+YGPFWRQMRK+CVVKLFSRRR ESW SVRDEV
Sbjct  92    QDIAFANRPANVAISYLTYDRADMAFANYGPFWRQMRKICVVKLFSRRRIESWASVRDEV  151

Query  573   DNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGA  752
             D  ++ V+      VNIG+L+F LTRNITY+AAFGSS  S +GQDEF+KILQEFSKLFGA
Sbjct  152   DALIKIVSSKIQQPVNIGDLVFSLTRNITYKAAFGSS--SHEGQDEFVKILQEFSKLFGA  209

Query  753   FNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDG  932
             FN++DF P+L     +  N RLAKAR  LD FID IID+H+    +++ K   G+   D 
Sbjct  210   FNIADFLPWLGWIHAREFNERLAKARRDLDMFIDSIIDEHL----QKKMKKLKGKTVDDE  265

Query  933   AETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMA  1112
              ++DMVDEL+AF  D+   N+ DD Q+ +KLTRDNIK +IMDVMFGGTETVAS IEWAMA
Sbjct  266   EDSDMVDELMAFLVDDSSSNEFDDSQSVLKLTRDNIKALIMDVMFGGTETVASVIEWAMA  325

Query  1113  ELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAE  1292
             ELMK PE L +LQQELT TVGLDR V ESDL+ L +LK  +KETLRLHPPIPLLLHETA 
Sbjct  326   ELMKNPEELNKLQQELTLTVGLDRNVHESDLQNLPYLKFVIKETLRLHPPIPLLLHETAV  385

Query  1293  ATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGS  1472
              + V+GY+IP  SR  INAWAI RD+ +WE+PD F+P RF  +  PDFKG++FEF+PFGS
Sbjct  386   DSSVDGYFIPTGSRVWINAWAIGRDRTAWEEPDRFRPGRFQNDAAPDFKGNDFEFVPFGS  445

Query  1473  GRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPT  1652
             GRRSCPGMQLGLYA E+AVA+L HCF+WELP GM   +LDM+D FGLTAP+A RLV +P+
Sbjct  446   GRRSCPGMQLGLYACEMAVANLVHCFSWELPGGMTADELDMNDSFGLTAPRAIRLVAVPS  505

Query  1653  PRLN  1664
              RLN
Sbjct  506   LRLN  509



>ref|XP_007156105.1| hypothetical protein PHAVU_003G259100g, partial [Phaseolus vulgaris]
 gb|ESW28099.1| hypothetical protein PHAVU_003G259100g, partial [Phaseolus vulgaris]
Length=476

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/459 (68%), Positives = 370/459 (81%), Gaps = 12/459 (3%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG P+IGN+N+MD ++HRGLAK+A+QYG +LHL++G LH VV+S  + AR+VLQ
Sbjct  29    PYPPGPKGLPIIGNINIMDQFTHRGLAKIAKQYGAVLHLRIGFLHTVVISNAEAAREVLQ  88

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD IFSNRPA  AI YL+YDRADMAFA+YGPFWRQMRK+CV+KLFSR+R ESW+SVRDE
Sbjct  89    AQDKIFSNRPATAAIRYLTYDRADMAFANYGPFWRQMRKICVIKLFSRKRPESWNSVRDE  148

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD  VRTVA N GS VN+GEL+F LT+NI YRAAFGSS  S Q Q++FI I+ EFS LFG
Sbjct  149   VDTVVRTVAANVGSPVNVGELVFNLTKNIIYRAAFGSS--SQQEQEKFISIILEFSVLFG  206

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             A N++DF P L   D QGLN RL +ARAALD FIDKII++H+        K   G+   D
Sbjct  207   ALNIADFVPCLGWIDPQGLNLRLVQARAALDSFIDKIIEEHV-------EKKRSGKSCDD  259

Query  930   GAETDMVDELLAFYSDEMKVND-SDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
               E+DMVDELL FYS+  K+N+ S+DL N+I LT+ NIK IIMDVMFGGTETVA AIEW 
Sbjct  260   --ESDMVDELLNFYSENPKLNEESNDLHNSITLTKHNIKAIIMDVMFGGTETVALAIEWT  317

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             M ELM++PE+L+R+QQEL D  GLDR+VEESDLEKL FLKC +KETLR+HPPIPLL H  
Sbjct  318   MVELMRSPEDLQRVQQELADVAGLDRRVEESDLEKLAFLKCAVKETLRMHPPIPLLPHAA  377

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             AE   V GY++P  SR +INAWAI RD +SWE+P++FKP RFL   +PDFKGSN+EFIPF
Sbjct  378   AEDAVVCGYHVPKGSRLMINAWAIGRDGDSWEEPEAFKPSRFLNPSVPDFKGSNYEFIPF  437

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPS  1583
             GSGRRSCPGMQLGLYA E+ VAHL HCFTWELPDG+KP+
Sbjct  438   GSGRRSCPGMQLGLYALEVVVAHLLHCFTWELPDGLKPA  476



>emb|CDX69213.1| BnaC01g02400D [Brassica napus]
Length=482

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/479 (64%), Positives = 373/479 (78%), Gaps = 46/479 (10%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM++MD  +HRGLA LA++YGGL HL+MG LHM  VS PD ARQVLQ QD++FSNRP
Sbjct  49    IIGNMSMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPDVARQVLQVQDSVFSNRP  108

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  +R+V+ 
Sbjct  109   ATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDRMIRSVSS  168

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
             N G ++N+GE IF LTRNITYRAAFGS  +  +GQDEFI+ILQEFSKLFGAFNV+DF P+
Sbjct  169   NVGKSINVGEQIFALTRNITYRAAFGS--ACEKGQDEFIRILQEFSKLFGAFNVADFIPY  226

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
                 D QG+N RL KAR  LDGFID IID+HI     ++ +N     +GD  +TDMVD+L
Sbjct  227   FGWIDPQGINKRLVKARNDLDGFIDDIIDEHI-----KKKENQNSIDAGDVVDTDMVDDL  281

Query  960   LAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPEN  1136
             LAFYS+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++PE+
Sbjct  282   LAFYSEEAKLVSETADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSPED  341

Query  1137  LKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYY  1316
             LKR+QQEL + VGLDR+++                                      GY+
Sbjct  342   LKRVQQELAEVVGLDRRID--------------------------------------GYF  363

Query  1317  IPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGM  1496
             +P +SR +INA+AI RDKNSW DP++F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCPGM
Sbjct  364   VPKKSRVMINAFAIGRDKNSWVDPETFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCPGM  423

Query  1497  QLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             QLGLYA ELAVAH+ HCFTW+LPDGMKPS+LDM DVFGLTAPKATRL  +P+ RL C +
Sbjct  424   QLGLYALELAVAHILHCFTWKLPDGMKPSELDMSDVFGLTAPKATRLYAVPSTRLICSV  482



>ref|XP_006411697.1| hypothetical protein EUTSA_v10027317mg, partial [Eutrema salsugineum]
 gb|ESQ53150.1| hypothetical protein EUTSA_v10027317mg, partial [Eutrema salsugineum]
Length=488

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/488 (64%), Positives = 382/488 (78%), Gaps = 10/488 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             P+PPGPKG+P+IGNM L +  +HRGLA+LA+QYGGLLHL+MG +H+V  S  D ARQ+LQ
Sbjct  9     PFPPGPKGYPVIGNMKLKNKLNHRGLAELAKQYGGLLHLQMGKIHIVAASTSDMARQILQ  68

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD +F+NRPANVAISYL+Y+RADMAFA+YGP WRQMRK+CV+KLFSR+RAESW SVR+E
Sbjct  69    VQDVVFANRPANVAISYLTYNRADMAFANYGPLWRQMRKICVMKLFSRKRAESWASVREE  128

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             +D+ V+T+    G  VN+GEL+F LTRNITYRAAFGS   +  GQDEFIKILQEFSKLFG
Sbjct  129   IDSMVQTLTKQSGLPVNVGELVFALTRNITYRAAFGSF--ARDGQDEFIKILQEFSKLFG  186

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AF++++F P++  F  +G N RL  AR +LDGFIDKIID HI +   R+          D
Sbjct  187   AFDITEFLPWMRWFSNRGFNERLENARKSLDGFIDKIIDAHIEKKNSRKQDY-------D  239

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
             G+E DMVDEL+AFYSDE     S+D Q+ ++LTRDNIK ++MDVMFGGTETVASAIEWAM
Sbjct  240   GSEDDMVDELMAFYSDE-NGGQSNDSQSLLRLTRDNIKALVMDVMFGGTETVASAIEWAM  298

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
              ELMK P  L++ QQEL D +GLDR+  ESDLE L + +C +KETLRLHPPIPLLLHE A
Sbjct  299   TELMKNPHELRKSQQELADVIGLDRQFHESDLENLPYFRCAMKETLRLHPPIPLLLHEAA  358

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFG  1469
               + V+GY  P  SR +IN +AI RD + W +PD F+P RF+    PDFKGS+FEF+PFG
Sbjct  359   ADSVVSGYSTPRDSRVMINVYAIGRDASVWTEPDEFRPGRFMDSKAPDFKGSDFEFLPFG  418

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGMQLGLYA ELAVAH+ H F W+LP+G+   DLDM D+FGLTAP+ATRL+ +P
Sbjct  419   SGRRSCPGMQLGLYAMELAVAHMLHSFHWKLPEGVSSGDLDMSDMFGLTAPRATRLIAVP  478

Query  1650  TPRLNCQL  1673
             + RL C +
Sbjct  479   SYRLKCPM  486



>ref|XP_010919382.1| PREDICTED: cytochrome P450 84A1 [Elaeis guineensis]
Length=515

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/483 (67%), Positives = 378/483 (78%), Gaps = 18/483 (4%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM +MD  +HRGLAKLA+++GGL HL++G LH   VS PD ARQVLQ +DN+FSNRP
Sbjct  45    IIGNMLMMDQLTHRGLAKLADKFGGLCHLRLGFLHAFAVSTPDMARQVLQVRDNVFSNRP  104

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +AI+YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW SVRDEVD T+R  + 
Sbjct  105   ATIAITYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWASVRDEVDFTLRAASD  164

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
               G  VNIGEL+F LT+NI +RAAFGS   S + QDEFI ILQEFSKLFGAFN+ DF P+
Sbjct  165   KSGEPVNIGELVFNLTKNIIFRAAFGS--QSHEDQDEFIGILQEFSKLFGAFNIGDFIPW  222

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             LS  D+QG+N RL  AR ALD FIDKIID+H+L+ +             D  + DMVD++
Sbjct  223   LSWMDMQGINQRLKAARGALDQFIDKIIDEHLLKPK-----------VADAEDADMVDDM  271

Query  960   LAFYSDE--MKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPE  1133
             LAF  D    K  +  DLQ  +KLTRDNIK IIMDVMFGGTETVASAIEWAMAELM+ PE
Sbjct  272   LAFLDDSPAGKGGEGGDLQGNLKLTRDNIKAIIMDVMFGGTETVASAIEWAMAELMRNPE  331

Query  1134  NLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGY  1313
              LKR Q+EL D VGLDRKV ESDL+KL++ KC +KETLRLHPPIPLLLHETAE  EV GY
Sbjct  332   ELKRAQKELADVVGLDRKVHESDLDKLSYFKCAIKETLRLHPPIPLLLHETAEDCEVAGY  391

Query  1314  YIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEG---MPDFKGSNFEFIPFGSGRRS  1484
              IP +SR +IN WAI RDK+SW+D ++F+P RF  +G     DF+G+ FE +PFGSGRRS
Sbjct  392   SIPKKSRVMINVWAIGRDKSSWKDAETFRPSRFTPDGDDAGVDFRGNYFELLPFGSGRRS  451

Query  1485  CPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLN  1664
             CPGMQLGL+A ELAVA L HCF W LPDGMKPS+LDM DVFGLTAP+A RLV + TPRLN
Sbjct  452   CPGMQLGLHALELAVAQLLHCFNWSLPDGMKPSELDMGDVFGLTAPRAVRLVAVLTPRLN  511

Query  1665  CQL  1673
             C L
Sbjct  512   CPL  514



>gb|KHG17003.1| Cytochrome P450 protein [Gossypium arboreum]
Length=540

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/479 (67%), Positives = 387/479 (81%), Gaps = 9/479 (2%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYG--GLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSN  413
             +IGNM +MD  +HRGLA L+ QYG  GLLHL MG LH+V VS P+ AR+VL TQD+I+SN
Sbjct  47    IIGNMMMMDQLTHRGLAHLSRQYGHAGLLHLTMGKLHIVAVSTPEMAREVLLTQDSIYSN  106

Query  414   RPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTV  593
             RPAN AI YL+YDRADMAFA+YGPFWRQMRK+CV+K+FSR+RAESW SVR+EV +TVRTV
Sbjct  107   RPANDAIVYLTYDRADMAFANYGPFWRQMRKICVMKVFSRKRAESWASVREEVGSTVRTV  166

Query  594   AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFF  773
               + GS +N+GEL+F LTRNITYR AFGS   S  GQ+E +KILQEFSKLFGAFN++DFF
Sbjct  167   MKSLGSPLNVGELVFALTRNITYRTAFGSF--SRDGQEELVKILQEFSKLFGAFNIADFF  224

Query  774   PFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVD  953
             P++          RL KARA+LDGFID IID+H++   RR+     G+ +    + DMVD
Sbjct  225   PWMGWIHGGEFQKRLVKARASLDGFIDHIIDEHLVTRERRKT----GDDAAAKYDDDMVD  280

Query  954   ELLAFYSDEMKVNDSDDLQNA-IKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTP  1130
             EL+AFYS+ +   D ++  N+ I+LT+DNIK IIMDVMFGGTETVASAIEWAMAELM +P
Sbjct  281   ELMAFYSENVFKGDYNESSNSSIQLTKDNIKAIIMDVMFGGTETVASAIEWAMAELMNSP  340

Query  1131  ENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNG  1310
             E LK++QQEL+D VGL+R V ESDLEKLT+LKC +KETLRLHPPIPLLLHETA  + +  
Sbjct  341   EELKKVQQELSDVVGLERVVHESDLEKLTYLKCAIKETLRLHPPIPLLLHETAVDSVLGR  400

Query  1311  YYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCP  1490
             Y++P +SR +INAWAI RD +SW+DP+ FKP RFL EG PDFKG+NFEFIPFGSGRRSCP
Sbjct  401   YWVPRKSRIMINAWAIGRDPSSWKDPNVFKPSRFLDEGGPDFKGNNFEFIPFGSGRRSCP  460

Query  1491  GMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNC  1667
             GMQLGLY  EL+VAHL HCF WELP+GMK ++LDM D FGLTAP+ATRLV +P+ RL+C
Sbjct  461   GMQLGLYGLELSVAHLLHCFNWELPNGMKATELDMSDSFGLTAPRATRLVAVPSYRLSC  519



>ref|XP_010467614.1| PREDICTED: cytochrome P450 84A1-like [Camelina sativa]
Length=503

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/492 (65%), Positives = 389/492 (79%), Gaps = 17/492 (3%)
 Frame = +3

Query  207   KP-YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQV  383
             KP YPPGPKG P+IGNM +MD  SH GLAKLAE YGGL HL+MG  H+  ++ PD ARQV
Sbjct  21    KPLYPPGPKGLPIIGNMLMMDQLSHHGLAKLAETYGGLFHLRMGFRHVFAITSPDLARQV  80

Query  384   LQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR  563
             LQ QD  FSNRP  +AI+YL+YD ADMAFA YGPFWRQMRK+CV+K+FSRRRAESW SVR
Sbjct  81    LQVQDISFSNRPVTIAINYLTYDLADMAFAPYGPFWRQMRKVCVMKVFSRRRAESWASVR  140

Query  564   DEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKL  743
             DEV+N VR+++ N G  VN+GELIF LTRNITYRAAFG++  + Q  DEFI+ILQEFSKL
Sbjct  141   DEVNNMVRSLSSNVGKPVNVGELIFTLTRNITYRAAFGAACETEQ--DEFIRILQEFSKL  198

Query  744   FGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVS  923
             FGAFNV+DF PFL  FDL G+N RL KAR  LDGFID++ID+H+    ++R      E  
Sbjct  199   FGAFNVADFIPFLGWFDLHGINKRLVKARNDLDGFIDEVIDEHM----KKR------ETV  248

Query  924   GDGAETDMVDELLAFYSDEMKVNDSDDLQN----AIKLTRDNIKGIIMDVMFGGTETVAS  1091
              D  +TDMVD+LLAFYS+E  +   D   N    ++KLTRDNIK ++MDVMFGGTET+AS
Sbjct  249   KDDEDTDMVDDLLAFYSEEENLVSKDSSTNRNKSSVKLTRDNIKALVMDVMFGGTETMAS  308

Query  1092  AIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppipl  1271
              IEWA+ EL++ P+ LKRLQQEL + VGLD++V+E  LEKLTFLKC LKET+RLHPPIPL
Sbjct  309   GIEWALTELLRNPDELKRLQQELAEVVGLDQRVDEMHLEKLTFLKCTLKETMRLHPPIPL  368

Query  1272  llhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNF  1451
             +LHE  E T++ G+ +P  SR IINA+AIARD   W +P++FKP RF++ GMPDF G+NF
Sbjct  369   ILHEAIEDTKLQGFSVPKGSRLIINAFAIARDPKLWVEPEAFKPSRFMEPGMPDFMGTNF  428

Query  1452  EFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKAT  1631
             EFIPFGSGRRSCPGMQLGLYA E+AVA++ H FTW+LPDGM PS+LDM DV GLTAP+AT
Sbjct  429   EFIPFGSGRRSCPGMQLGLYAMEVAVANIIHSFTWQLPDGMTPSELDMSDVMGLTAPRAT  488

Query  1632  RLVVIPTPRLNC  1667
             RL+ +P  RL C
Sbjct  489   RLIAVPNMRLTC  500



>ref|XP_004148555.1| PREDICTED: cytochrome P450 84A1-like [Cucumis sativus]
 gb|KGN43170.1| hypothetical protein Csa_7G004720 [Cucumis sativus]
Length=520

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/484 (67%), Positives = 378/484 (78%), Gaps = 6/484 (1%)
 Frame = +3

Query  213   YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQT  392
             YPPGP G P+IGNM +MD  +HRGLA+LA  YGGL HL++G LHMVVVS PD AR+ LQ 
Sbjct  32    YPPGPTGLPIIGNMLMMDQLTHRGLARLATIYGGLFHLRLGVLHMVVVSTPDMAREFLQV  91

Query  393   QDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEV  572
             QD  F+NRPANVAISYL+YDRADMAFA+YGPFWRQMRK+CV+KLFSRRRAESW SVRDEV
Sbjct  92    QDVAFANRPANVAISYLTYDRADMAFANYGPFWRQMRKICVIKLFSRRRAESWASVRDEV  151

Query  573   DNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGA  752
             D  V  V+      VNIG+L+F LTRNITY+AAFGSS  S +GQDEF+KILQEFSKLFGA
Sbjct  152   DTLVEIVSRKIQQPVNIGDLVFSLTRNITYKAAFGSS--SHEGQDEFVKILQEFSKLFGA  209

Query  753   FNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDG  932
             FN++DF P+L     +  N RLAKAR  LD FID IID+H+ +  ++           D 
Sbjct  210   FNIADFLPWLGWIHAREFNERLAKARRDLDVFIDSIIDEHLEKKMKKLKGE----KVDDE  265

Query  933   AETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMA  1112
              +TDMVDEL+AF  D+   N+ DD Q+ +KLTRD+IK +IMDVMFGGTETVAS IEWAMA
Sbjct  266   EDTDMVDELMAFLVDDSSSNEFDDSQSVLKLTRDHIKALIMDVMFGGTETVASVIEWAMA  325

Query  1113  ELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAE  1292
             ELMK PE L ++QQELT  VGLDR V ESDLE L +LK  +KETLRLHPPIPLLLHETA 
Sbjct  326   ELMKNPEELNKVQQELTLVVGLDRNVHESDLENLPYLKFVVKETLRLHPPIPLLLHETAV  385

Query  1293  ATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGS  1472
              + V+GY+IP  SR  INAWAI RD+ +W++PD F P RF  +  PDFKGS+FEFIPFGS
Sbjct  386   DSSVSGYFIPTGSRVWINAWAIGRDRTAWKEPDRFWPGRFQNDAAPDFKGSDFEFIPFGS  445

Query  1473  GRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPT  1652
             GRRSCPGMQLGLYA E+AVA+L HCF+WELP GM   +LDM+D FGLTAP+A RLV +P+
Sbjct  446   GRRSCPGMQLGLYACEMAVANLVHCFSWELPGGMTADELDMNDSFGLTAPRAIRLVAVPS  505

Query  1653  PRLN  1664
              RLN
Sbjct  506   LRLN  509



>ref|XP_010919383.1| PREDICTED: cytochrome P450 84A1-like [Elaeis guineensis]
Length=517

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/518 (63%), Positives = 400/518 (77%), Gaps = 22/518 (4%)
 Frame = +3

Query  150   VIYFVIPflflfllsrlrrKP--YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLH  323
             +++F+IP   LF+LS  RR+   +PPGP+  P+IGNM +MD  +HRGLAKLA++YGGL H
Sbjct  13    ILFFLIPLALLFVLSTRRRRELLFPPGPRQLPIIGNMLMMDQLTHRGLAKLADKYGGLCH  72

Query  324   LKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMR  503
             L++G LH   VS P+ AR+VLQ QDN+FSNRPA +AI+YL+YDR+DMAFAHYGPFWRQMR
Sbjct  73    LRLGYLHAFAVSTPEMAREVLQVQDNVFSNRPATMAITYLTYDRSDMAFAHYGPFWRQMR  132

Query  504   KLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSS  683
             KLCV+KLFSR+ A SW +VR+E++  +  VA   G+ VN+GELIF LT NIT+RAAFG+ 
Sbjct  133   KLCVMKLFSRKCAMSWAAVREEIEVMIHAVAGRKGTTVNLGELIFNLTMNITFRAAFGT-  191

Query  684   PSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKII  863
               + + QDEF+ ILQEFSKLFGAFN+ DF P+LS  D QG+N RL  ARAALD FIDKII
Sbjct  192   -PNHENQDEFVSILQEFSKLFGAFNIGDFIPWLSWMDPQGINKRLNVARAALDRFIDKII  250

Query  864   DDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVN----DSDDLQNAIKLTR  1031
             D+H+   +           + D  + DMVD++LAF  D  +V+    + D+LQ  +KLTR
Sbjct  251   DEHMANPK-----------ATDAEDADMVDDMLAFLDDHSRVSKQGGEKDELQGNLKLTR  299

Query  1032  DNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEK  1211
             DNIK IIMDVMFGGTETVASAIEW MAELM++P++LKR+Q+EL D +GLDRKV E+DL++
Sbjct  300   DNIKAIIMDVMFGGTETVASAIEWTMAELMRSPDDLKRVQRELADIIGLDRKVHENDLDR  359

Query  1212  LTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPD  1391
             L FLKC  KETLRLHPPIPLLLHETA   +V+GY+IP +SR +INAWAI RDK++W D D
Sbjct  360   LLFLKCATKETLRLHPPIPLLLHETAVDCKVDGYFIPKKSRVMINAWAIGRDKSAWRDAD  419

Query  1392  SFKPDRFLKEGMP---DFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWEL  1562
              F+P RF   G     DFKG+ FE IPFGSGRRSCPGMQLGLYA ELAVA L HCF W L
Sbjct  420   KFRPSRFASGGDSTGIDFKGNFFELIPFGSGRRSCPGMQLGLYALELAVAQLLHCFNWAL  479

Query  1563  PDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQLH  1676
             PD MKPS+LDM DVFGLTAP+A RL  +PTPRL+C L+
Sbjct  480   PDDMKPSELDMGDVFGLTAPRAVRLTAVPTPRLSCALY  517



>ref|XP_004164845.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 84A1-like [Cucumis 
sativus]
Length=520

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/484 (67%), Positives = 377/484 (78%), Gaps = 6/484 (1%)
 Frame = +3

Query  213   YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQT  392
             YPPGP G P+IGNM +MD  +HRGLA+LA  YGGL HL++G LHMVVVS PD AR+ LQ 
Sbjct  32    YPPGPTGLPIIGNMLMMDQLTHRGLARLATIYGGLFHLRLGVLHMVVVSTPDMAREFLQV  91

Query  393   QDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEV  572
             QD  F+NRPANVAISYL+YDRADMAFA+YGPFWRQMRK+CV+KLFSRRRAESW SVRDEV
Sbjct  92    QDVAFANRPANVAISYLTYDRADMAFANYGPFWRQMRKICVIKLFSRRRAESWASVRDEV  151

Query  573   DNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGA  752
             D  V  V+      VNIG+L+F LTRNITY+AAFGSS  S +GQDEF+KILQEFSKLFGA
Sbjct  152   DTLVEIVSRKIQQPVNIGDLVFSLTRNITYKAAFGSS--SHEGQDEFVKILQEFSKLFGA  209

Query  753   FNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDG  932
             FN++DF P+L     +  N RLAKAR  LD FID IID+H+ +  ++           D 
Sbjct  210   FNIADFLPWLGWIHAREFNERLAKARRDLDVFIDSIIDEHLEKKMKKLKGE----KVDDE  265

Query  933   AETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMA  1112
              +TDMVDEL+AF  D+   N+ DD Q+ +KLTRD+IK +IMDVMFGGTETVAS IEWAMA
Sbjct  266   EDTDMVDELMAFLVDDSSSNEFDDSQSVLKLTRDHIKALIMDVMFGGTETVASVIEWAMA  325

Query  1113  ELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAE  1292
             ELMK PE L ++QQELT  VGLDR V ESDLE L +LK  +KETLRLHPPIPLLLHETA 
Sbjct  326   ELMKNPEELNKVQQELTLVVGLDRNVHESDLENLPYLKFVVKETLRLHPPIPLLLHETAV  385

Query  1293  ATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGS  1472
              + V+GY+IP  SR  INAWAI RD+ +W++PD F P RF  +  PDFKGS+FEFIPFGS
Sbjct  386   DSSVSGYFIPTGSRVRINAWAIGRDRTAWKEPDRFWPGRFQNDAAPDFKGSDFEFIPFGS  445

Query  1473  GRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPT  1652
             GRRSCPGMQLGLYA E AVA+L HCF+WELP GM   +LDM+D FGLTAP+A RLV +P+
Sbjct  446   GRRSCPGMQLGLYACETAVANLVHCFSWELPGGMTAXELDMNDSFGLTAPRAIRLVAVPS  505

Query  1653  PRLN  1664
              RLN
Sbjct  506   LRLN  509



>ref|XP_008791650.1| PREDICTED: cytochrome P450 84A1-like [Phoenix dactylifera]
Length=517

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/518 (63%), Positives = 392/518 (76%), Gaps = 22/518 (4%)
 Frame = +3

Query  150   VIYFVIPflflfllsrlrrK--PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLH  323
             + +F+IP   LF++S  RR+  P+P GP+  P+IGNM +MD  +HRGLAKLA++YGGL +
Sbjct  13    ISFFLIPLALLFVISMRRRRKFPFPAGPRQLPIIGNMLMMDQLTHRGLAKLADKYGGLCY  72

Query  324   LKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMR  503
             L++G LH   VS P+ AR+VLQ QDN+FSNRPA + I+YL+YDRADMAFAHYGPFWRQMR
Sbjct  73    LRLGYLHAFAVSTPEMAREVLQVQDNVFSNRPATMTITYLTYDRADMAFAHYGPFWRQMR  132

Query  504   KLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSS  683
             KLCV+KLFSR+RAESW +VR+E++  +  VA   G+ VN+GELIF LT+NIT+RAAFG+ 
Sbjct  133   KLCVMKLFSRKRAESWAAVREEIEAMIHAVADRKGTTVNLGELIFNLTKNITFRAAFGT-  191

Query  684   PSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKII  863
               S + QDEFI I+QEFSKLFGAFN+ DF P+LS  D  G+N RL  ARAALD FID II
Sbjct  192   -QSQENQDEFISIIQEFSKLFGAFNIGDFIPWLSWIDPHGINQRLKVARAALDCFIDNII  250

Query  864   DDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVND----SDDLQNAIKLTR  1031
             D H+   +           + D  + DMVD++LAF  D     +     D+L   +KL+R
Sbjct  251   DMHMANPK-----------ATDAEDADMVDDMLAFLEDSRVSKEGGDQKDELHGNLKLSR  299

Query  1032  DNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEK  1211
             DNIK IIMDVMFGGTETVASAIEWAMAELM+ P+ LKR+QQEL D VGLDRKV ESDL++
Sbjct  300   DNIKAIIMDVMFGGTETVASAIEWAMAELMRCPDELKRVQQELADLVGLDRKVRESDLDR  359

Query  1212  LTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPD  1391
             L FLKC +KETLRLHPPIPLLLHETAE  +V GY IP +SR +INAWAI RDK +W D D
Sbjct  360   LPFLKCVIKETLRLHPPIPLLLHETAEDCKVAGYLIPKKSRVMINAWAIGRDKLAWRDAD  419

Query  1392  SFKPDRFLKEGMP---DFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWEL  1562
              F+P RF   G     DFKGS FE IPFGSGRRSCPGMQLGL+A ELAVA L HCF W L
Sbjct  420   KFRPSRFAPGGDSTGIDFKGSFFELIPFGSGRRSCPGMQLGLHALELAVAQLLHCFNWAL  479

Query  1563  PDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQLH  1676
             PDGMKPS+LDM DVFGLTAP+A RL  +PTPRL C L+
Sbjct  480   PDGMKPSELDMGDVFGLTAPRAVRLTAVPTPRLTCALY  517



>ref|XP_002886147.1| hypothetical protein ARALYDRAFT_319761 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62406.1| hypothetical protein ARALYDRAFT_319761 [Arabidopsis lyrata subsp. 
lyrata]
Length=503

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/489 (65%), Positives = 389/489 (80%), Gaps = 15/489 (3%)
 Frame = +3

Query  213   YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQT  392
             YPPGPKG P+IGNM +MD  +H GLAKLAE YGGL HL+MG  H+  ++ PD +RQVLQ 
Sbjct  24    YPPGPKGLPIIGNMLMMDQLTHHGLAKLAETYGGLFHLRMGFRHVFAITSPDVSRQVLQV  83

Query  393   QDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEV  572
             QD  FSNRP  +AI+YL+YD ADMAFA YGPFWRQMRK+CV+K+FSRRRAESW SVRDEV
Sbjct  84    QDISFSNRPVTIAINYLTYDLADMAFAPYGPFWRQMRKVCVMKVFSRRRAESWASVRDEV  143

Query  573   DNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGA  752
             +  VR+++ N G+ VN+GELIF LTRNITYRAAFG++  + Q  DEFI+ILQEFSKLFGA
Sbjct  144   NKMVRSLSSNVGNPVNVGELIFTLTRNITYRAAFGAACETEQ--DEFIRILQEFSKLFGA  201

Query  753   FNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDG  932
             FNV+DF PFL  FDL G+N RL KAR  LDGFID++ID+H+   ++R   NH      D 
Sbjct  202   FNVADFVPFLGWFDLHGINKRLVKARNDLDGFIDEVIDEHM---KKREIVNH------DD  252

Query  933   AETDMVDELLAFYSDEMKVNDSDDL----QNAIKLTRDNIKGIIMDVMFGGTETVASAIE  1100
              +TDMVD+LLAFYS+E K+   D      +N++KLTRDNIK ++MDVMFGGTET+AS IE
Sbjct  253   EDTDMVDDLLAFYSEEEKLVSEDSSTNRNKNSVKLTRDNIKALVMDVMFGGTETMASGIE  312

Query  1101  WAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllh  1280
             WA+ EL++ P+ LKRLQQEL + VGLD++V+E+ LEKLT LKC LKET+RLHPPIPL+LH
Sbjct  313   WALTELLRNPDELKRLQQELAEVVGLDQRVDETHLEKLTLLKCTLKETMRLHPPIPLILH  372

Query  1281  ETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFI  1460
             E  E T++ G+ +P  SR +INA+AIARD   W +P++FKP RF++ GMPDF G+NFEFI
Sbjct  373   EAIEDTKLQGFSVPKGSRLMINAFAIARDPKLWVEPEAFKPSRFMEPGMPDFMGTNFEFI  432

Query  1461  PFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLV  1640
             PFGSGRRSCPGMQLGLYA E+AVA++ H F W+LP GMKPS+LDM DV GLTAP+ATRL+
Sbjct  433   PFGSGRRSCPGMQLGLYAMEVAVANIIHTFKWQLPKGMKPSELDMSDVMGLTAPRATRLI  492

Query  1641  VIPTPRLNC  1667
              +P  RL C
Sbjct  493   AVPNRRLTC  501



>ref|XP_010490429.1| PREDICTED: cytochrome P450 84A1-like [Camelina sativa]
Length=503

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/489 (65%), Positives = 384/489 (79%), Gaps = 16/489 (3%)
 Frame = +3

Query  213   YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQT  392
             YPPGPKG P+IGNM +MD  SH GLAKLAE YGGL HL+MG  H+  ++ PD ARQVLQ 
Sbjct  24    YPPGPKGLPIIGNMLMMDQLSHHGLAKLAETYGGLFHLRMGFRHVFAITSPDLARQVLQV  83

Query  393   QDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEV  572
             QD  FSNRP  +AI+YL+YD ADMAFA YGPFWRQMRK+CV+K+FSRRRAESW SVRDEV
Sbjct  84    QDISFSNRPVTIAINYLTYDLADMAFAPYGPFWRQMRKVCVMKVFSRRRAESWASVRDEV  143

Query  573   DNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGA  752
             +N VR+++ N G  VN+GELIF LTRNITYRAAFG++  + Q  DEFI+ILQEFSKLFGA
Sbjct  144   NNMVRSLSSNVGKPVNVGELIFTLTRNITYRAAFGAACETEQ--DEFIRILQEFSKLFGA  201

Query  753   FNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDG  932
             FNV+DF PFL  FDL G+N RL KAR  LDGFID++ID+H+   ++R   N         
Sbjct  202   FNVADFIPFLGWFDLHGINKRLVKARNDLDGFIDEVIDEHM---KKRETVNDD-------  251

Query  933   AETDMVDELLAFYSDEMKVNDSDDLQN----AIKLTRDNIKGIIMDVMFGGTETVASAIE  1100
              +TDMVD+LLAFYS+E  +   D   N    ++KLTRDNIK ++MDVMFGGTET+AS IE
Sbjct  252   EDTDMVDDLLAFYSEEENLVSKDSSTNRNKSSVKLTRDNIKALVMDVMFGGTETMASGIE  311

Query  1101  WAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllh  1280
             WA+ EL++ P+ L RLQQEL + VGLD++V+E  LEKLTFLKC LKET+RLHPPIPL+LH
Sbjct  312   WALTELLRNPDELNRLQQELAEVVGLDQRVDEMHLEKLTFLKCTLKETMRLHPPIPLILH  371

Query  1281  ETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFI  1460
             E  E T++ G+ +P  SR IINA+AIARD   W +P++FKP RF++ GMPDF G+NFEFI
Sbjct  372   EAIEDTKLQGFSVPKGSRLIINAFAIARDPKLWVEPEAFKPSRFMEPGMPDFMGTNFEFI  431

Query  1461  PFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLV  1640
             PF SGRRSCPGMQLGLYA E+AVA++ H FTW+LPDGM PS+LDM DV GLTAP+ATRL+
Sbjct  432   PFESGRRSCPGMQLGLYAMEVAVANIIHSFTWQLPDGMTPSELDMSDVMGLTAPRATRLI  491

Query  1641  VIPTPRLNC  1667
              +P  RL C
Sbjct  492   AVPNMRLTC  500



>ref|XP_008796879.1| PREDICTED: cytochrome P450 84A1-like [Phoenix dactylifera]
Length=515

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/483 (67%), Positives = 378/483 (78%), Gaps = 18/483 (4%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM +MD  +HRGLAKLA +YGGL +L++G LH   VS PD ARQVLQ QDN+FSNRP
Sbjct  45    IIGNMLMMDQLTHRGLAKLAGKYGGLCYLRLGYLHAFAVSTPDVARQVLQVQDNVFSNRP  104

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +AI+YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW SVRDEVD T+R  A 
Sbjct  105   ATIAITYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWASVRDEVDTTLRAAAD  164

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
               G  VN+GEL+F LT+NI +RAAFG+   S + QDEFI ILQEFSKLFGAFN+ DF P+
Sbjct  165   RSGFPVNLGELVFNLTKNIIFRAAFGT--HSHEDQDEFIGILQEFSKLFGAFNIGDFIPW  222

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             LS  D+QG+N RL  AR ALDGFIDKI+D+H+   +                + DMVD++
Sbjct  223   LSWLDMQGINKRLKAARGALDGFIDKILDEHLANPKVADA-----------DDADMVDDM  271

Query  960   LAFYSDE--MKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPE  1133
             LAF  D    K  D  DLQ  +KLTRDNIK IIMDVMFGGTETVASAIEWAMAELM+ PE
Sbjct  272   LAFLGDSPGSKGGDGGDLQGHLKLTRDNIKAIIMDVMFGGTETVASAIEWAMAELMRNPE  331

Query  1134  NLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGY  1313
              LK +QQELTD VGLDRKV+ESDL+KL++LKC +KETLRLHPPIPLLLHETAE  EV+GY
Sbjct  332   ELKLVQQELTDVVGLDRKVQESDLDKLSYLKCAIKETLRLHPPIPLLLHETAEDCEVDGY  391

Query  1314  YIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMP---DFKGSNFEFIPFGSGRRS  1484
              +P +SR +IN WAI RDK++W+D ++F+P RF+  G     DF+G+ FE +PFGSGRRS
Sbjct  392   CVPKKSRVMINVWAIGRDKSAWKDAETFRPSRFISNGDSSGVDFRGNYFELLPFGSGRRS  451

Query  1485  CPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLN  1664
             CPGMQLGLY  ELAVA L HCF W LPDGMKPS+LDM DVFGLT P+A RLV +PTPRLN
Sbjct  452   CPGMQLGLYGLELAVAQLMHCFYWSLPDGMKPSELDMGDVFGLTTPRAVRLVAVPTPRLN  511

Query  1665  CQL  1673
             C L
Sbjct  512   CAL  514



>emb|CDX72721.1| BnaC07g47430D [Brassica napus]
Length=512

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/490 (63%), Positives = 382/490 (78%), Gaps = 11/490 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             P+PPGPKG+P+IGNM L +  +HRGLA+LA+QYGGLLHL+MG +H+V  S  + AR++LQ
Sbjct  30    PFPPGPKGYPIIGNMKLKNQLNHRGLAELAKQYGGLLHLQMGRIHIVAASTAEMAREILQ  89

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD +F+NRPANVAISYL+Y+RADMAFA+YGP WRQMRK+CV+KLFSR+RAESW SVRDE
Sbjct  90    VQDVVFANRPANVAISYLTYNRADMAFANYGPLWRQMRKVCVMKLFSRKRAESWASVRDE  149

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             ++  V+T+    GS VN+GEL+F LTRNITYRAAFGS   +  GQDEF+KILQEFSKLFG
Sbjct  150   INTMVQTLTKQTGSPVNVGELVFALTRNITYRAAFGSF--ARDGQDEFVKILQEFSKLFG  207

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AF++++F P++  F  +  + RL  AR +LDGFID+IID HI +   R+  +       D
Sbjct  208   AFDITEFLPWMKWFSNRDFSKRLENARKSLDGFIDRIIDAHIEKKNSRKQDD-------D  260

Query  930   GAETDMVDELLAFYSDEMKVN--DSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEW  1103
             G E DMVDEL+AFYS E   N   S+D  ++ KLTRDNIK ++MDVMFGGTETVASAIEW
Sbjct  261   GLEDDMVDELMAFYSGESGENGGKSNDSLSSFKLTRDNIKALVMDVMFGGTETVASAIEW  320

Query  1104  AMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhE  1283
             AM ELMK P  L +LQQEL D +GL+R+  ESDLE L + +C +KETLRLHPPIPLLLHE
Sbjct  321   AMTELMKNPHELVKLQQELADVIGLNRQFHESDLENLPYFRCAMKETLRLHPPIPLLLHE  380

Query  1284  TAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIP  1463
              A  + V+GY IP  SR +IN +AI RD + W +PD+F+P RF+    PDFKGS+FEF+P
Sbjct  381   AAADSVVSGYSIPRDSRVMINVYAIGRDGSVWTEPDAFRPGRFMDSKAPDFKGSDFEFLP  440

Query  1464  FGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVV  1643
             FGSGRRSCPGMQLGLYA ELAVAH+ H F WELP+G+   DLDM D+FGLTAP+ATRL+ 
Sbjct  441   FGSGRRSCPGMQLGLYAMELAVAHMLHSFDWELPEGVSSDDLDMTDMFGLTAPRATRLIA  500

Query  1644  IPTPRLNCQL  1673
             +P+ RL C +
Sbjct  501   VPSYRLKCPM  510



>ref|XP_009384087.1| PREDICTED: cytochrome P450 84A1-like [Musa acuminata subsp. malaccensis]
Length=516

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/485 (64%), Positives = 378/485 (78%), Gaps = 19/485 (4%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             ++GNM +M   +HRGLAKL+E++GGL HL++G +H+  VS  + ARQVLQ QD +FSNR 
Sbjct  45    IVGNMLMMGQLTHRGLAKLSERFGGLCHLRLGFVHVFAVSTSEIARQVLQVQDAVFSNRF  104

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +AI+YL+YDRADMAFAHYGPFWRQMRKLCV+KLFS++RA SW SVR+EVD  VR V  
Sbjct  105   ATIAITYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSKKRAVSWASVREEVDAAVRAVTD  164

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
               G+AVN+GEL+F LT+NIT+RAAFG+   S + Q+EFI ILQEFS LFGAFN+ DF P+
Sbjct  165   GAGAAVNLGELMFNLTKNITFRAAFGT--QSHENQEEFIAILQEFSLLFGAFNIGDFIPW  222

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             +S  DLQG+N R   AR ALDGFIDKII++H+   +             D  ++DMVDE+
Sbjct  223   VSWMDLQGINKRFKVAREALDGFIDKIIEEHMANPK-----------EADAEDSDMVDEM  271

Query  960   LAFYS---DEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTP  1130
             LAF+    D  K N++D+LQ  ++LTR+NIK IIMDVMFGGTETVASAIEWAMAELMK P
Sbjct  272   LAFFEESRDRTKENEADELQRTLRLTRNNIKAIIMDVMFGGTETVASAIEWAMAELMKNP  331

Query  1131  ENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNG  1310
             E+++R+Q+EL   VGL RKV ESDL+KL  LKC +KETLRLHPPIP+LLHETAE  ++ G
Sbjct  332   EDMRRVQEELASVVGLHRKVRESDLDKLPHLKCAVKETLRLHPPIPILLHETAEDCQLTG  391

Query  1311  YYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMP---DFKGSNFEFIPFGSGRR  1481
             Y +PARSR +IN WAI RDK++WED + F+P RF   G     DFKG  FEF+PFGSGRR
Sbjct  392   YAVPARSRIMINVWAIGRDKSAWEDAEVFRPSRFAPGGEAAALDFKGGCFEFLPFGSGRR  451

Query  1482  SCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRL  1661
             SCPGMQLGL+A ELAVA L HCF+WELPDGMKP +LDM D+FGLTAP+A RLV +PTPRL
Sbjct  452   SCPGMQLGLHALELAVAQLTHCFSWELPDGMKPGELDMGDMFGLTAPRAVRLVAVPTPRL  511

Query  1662  NCQLH  1676
              C L+
Sbjct  512   TCPLY  516



>ref|XP_009101907.1| PREDICTED: cytochrome P450 84A1-like [Brassica rapa]
Length=513

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/490 (62%), Positives = 380/490 (78%), Gaps = 11/490 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             P+PPGPKG+P+IGNM L +  +HRGLA+LA+QYGGLLHL+MG +H+V  S  + AR++LQ
Sbjct  30    PFPPGPKGYPIIGNMKLKNQLNHRGLAELAKQYGGLLHLQMGRIHIVAASTAEMAREILQ  89

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD +F+NRPANVAISYL+Y+RADMAFA+YGP WRQMRK+CV+KLFSR+RAESW SVRDE
Sbjct  90    VQDVVFANRPANVAISYLTYNRADMAFANYGPLWRQMRKVCVMKLFSRKRAESWASVRDE  149

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             ++  V+T+     S VN+GEL+F LTRNITYRAAFGS   +  GQDEF+KILQEFSKLFG
Sbjct  150   INTMVQTLTKQTCSPVNVGELVFALTRNITYRAAFGSF--ARDGQDEFVKILQEFSKLFG  207

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AF++++F P++  F  +  + RL  AR +LDGFID+IID HI +   R+  +       D
Sbjct  208   AFDITEFLPWMKWFSNRDFSERLENARKSLDGFIDRIIDAHIEKKNSRKQDD-------D  260

Query  930   GAETDMVDELLAFYSDEMKVN--DSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEW  1103
             G E DMVDEL+AFYS E   N   S+D  ++ KLTRDNIK ++MDVMFGGTETVASAIEW
Sbjct  261   GLEDDMVDELMAFYSVESGENGGKSNDSLSSFKLTRDNIKALVMDVMFGGTETVASAIEW  320

Query  1104  AMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhE  1283
             AM ELMK P  L +LQQEL D +GL+R+  ESDLE L + +C +KETLRLHPPIPLLLHE
Sbjct  321   AMTELMKNPHELVKLQQELADVIGLNREFHESDLENLPYFRCAMKETLRLHPPIPLLLHE  380

Query  1284  TAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIP  1463
              A  + V+GY IP  SR +IN +AI RD + W +PD+F+P RF+    PDFKGS+FEF+P
Sbjct  381   AAADSVVSGYSIPRDSRVMINVYAIGRDGSVWTEPDAFRPGRFMDSKAPDFKGSDFEFLP  440

Query  1464  FGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVV  1643
             FGSGRRSCPGMQLGLYA ELAVAH+ H F WELP+G+   DLDM D+ GLTAP+ATRL+ 
Sbjct  441   FGSGRRSCPGMQLGLYAMELAVAHMLHSFDWELPEGVSADDLDMTDMCGLTAPRATRLIA  500

Query  1644  IPTPRLNCQL  1673
             +P+ RL C +
Sbjct  501   VPSYRLKCPM  510



>ref|XP_010527150.1| PREDICTED: cytochrome P450 84A1-like [Tarenaya hassleriana]
Length=513

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/488 (63%), Positives = 379/488 (78%), Gaps = 11/488 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             P PPGP+G+P+ GNM LM+  SHRGLA L+++YGGLLHL+MG +H+V VS  D AR++LQ
Sbjct  30    PSPPGPRGYPIFGNMALMNQLSHRGLADLSKKYGGLLHLQMGRIHIVAVSTADMAREILQ  89

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD +F+NRPANVAI+YL+YDRADMAFA+YGP WRQMRK+CV+KLFSR+RAESW SVR+E
Sbjct  90    VQDVVFANRPANVAITYLTYDRADMAFANYGPLWRQMRKICVMKLFSRKRAESWASVREE  149

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             + + ++++    GS VN+GEL+F LTRNITYRAAFGS   +  GQDEF+KILQEFSKLFG
Sbjct  150   IGSMIQSITEQAGSPVNVGELVFALTRNITYRAAFGSF--ARDGQDEFMKILQEFSKLFG  207

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AF++++F P+L     +    RL KAR +LD FID IID+H+ + R R   +        
Sbjct  208   AFDMAEFLPWLGWLYPRDFVKRLEKARGSLDSFIDNIIDEHMEKKRTRDINDDD------  261

Query  930   GAETDMVDELLAFYSDE--MKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEW  1103
                 DMVDEL+AFYS+E   K    DD Q+ ++LTRDNIK ++MDVMFGGTETVASAIEW
Sbjct  262   -GNDDMVDELMAFYSEEHEQKGVKHDDSQSLLRLTRDNIKALVMDVMFGGTETVASAIEW  320

Query  1104  AMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhE  1283
             AMAELMK+P+ LKR+QQELTD +GL+R   ESDLE L + +C +KETLR+HPPIPLLLHE
Sbjct  321   AMAELMKSPKELKRVQQELTDVIGLNRPFNESDLENLPYFRCAMKETLRMHPPIPLLLHE  380

Query  1284  TAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIP  1463
             T+  T V+GY IP  SR +IN WAI RD + W DPD F+P RFL    PDFKGS+F+F+P
Sbjct  381   TSADTVVSGYGIPKDSRVMINVWAIGRDGSVWPDPDEFRPGRFLDSNSPDFKGSDFQFLP  440

Query  1464  FGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVV  1643
             FGSGRRSCPGMQLGLYA ELAVAH+ H F WELPDG+   DLDM D+FGLTAPKA RLV 
Sbjct  441   FGSGRRSCPGMQLGLYALELAVAHMLHSFDWELPDGVSSGDLDMTDMFGLTAPKAVRLVA  500

Query  1644  IPTPRLNC  1667
             +P+ RL C
Sbjct  501   VPSYRLTC  508



>ref|XP_002868879.1| hypothetical protein ARALYDRAFT_912358 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45138.1| hypothetical protein ARALYDRAFT_912358 [Arabidopsis lyrata subsp. 
lyrata]
Length=509

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/487 (62%), Positives = 382/487 (78%), Gaps = 9/487 (2%)
 Frame = +3

Query  213   YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQT  392
             +PPGPKG+P+IGN  L +  +HRGLA+LA+Q+GGLLHL+MG +H+V VS  D AR++LQ 
Sbjct  31    FPPGPKGFPVIGNFKLKNQLNHRGLAELAKQFGGLLHLQMGKIHIVAVSTADMAREILQV  90

Query  393   QDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEV  572
             QD +F+NRPANVAISYL+Y+RADMAFA+YGP WRQMRK+CV+KLFSR+RAESW SVR+E+
Sbjct  91    QDVVFANRPANVAISYLTYNRADMAFANYGPLWRQMRKICVMKLFSRKRAESWASVREEI  150

Query  573   DNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGA  752
             D+ V+T+    GS VN+GEL+F LTRNITYRAAFGS   +  GQDEF+KILQEFSKLFGA
Sbjct  151   DSMVQTLTNQTGSLVNVGELVFALTRNITYRAAFGSF--ARDGQDEFVKILQEFSKLFGA  208

Query  753   FNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDG  932
             F++++F P++  F   G N RL  AR +LDGFID+I+D HI + + R+  + G       
Sbjct  209   FDITEFLPWMKWFGNHGFNKRLENARKSLDGFIDRILDAHIEKKKSRKPDDDG-------  261

Query  933   AETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMA  1112
              + DMVDEL+AFY+ E     ++D Q+++ LTRDNIK ++MDVMFGGTETVASAIEWAM 
Sbjct  262   LDDDMVDELMAFYNGENGSKSNNDSQSSLSLTRDNIKALVMDVMFGGTETVASAIEWAMT  321

Query  1113  ELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAE  1292
             ELMK P  L++LQQEL + + L+R+  ESDLE L + +C +KETLRLHPPIPLLLHE A 
Sbjct  322   ELMKNPHELRKLQQELAEVISLNRQFHESDLENLPYFRCAMKETLRLHPPIPLLLHEAAA  381

Query  1293  ATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGS  1472
              + V+GY IP  SR +IN +AI RD++ W +PD+FKP RF+    PDFKGS+FEF+PFGS
Sbjct  382   DSVVSGYSIPRGSRVMINVYAIGRDRSVWTEPDAFKPGRFMDNKAPDFKGSDFEFLPFGS  441

Query  1473  GRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPT  1652
             GRRSCPGMQLGLYA ELAVAH+ H F W+LP G+   DLDM D+FGLTAP+ATRL+ +PT
Sbjct  442   GRRSCPGMQLGLYAMELAVAHMLHSFDWDLPGGVSSGDLDMTDMFGLTAPRATRLIAVPT  501

Query  1653  PRLNCQL  1673
              RL C +
Sbjct  502   YRLKCPM  508



>dbj|BAO37287.1| ferulate-5-hydroxylase [Panicum virgatum]
Length=523

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/490 (65%), Positives = 375/490 (77%), Gaps = 25/490 (5%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM +MD  +HRGLA LAEQYGGLLHL++G LH+  VS P+ AR+VLQ QD  FSNRP
Sbjct  48    IIGNMTMMDQLTHRGLAALAEQYGGLLHLRLGQLHVFAVSTPEFAREVLQAQDAAFSNRP  107

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +A+SYL+YDRADMAFAHYGPFWRQMRKLCV+KLFSRRRAE+W +VRDE    VR VA 
Sbjct  108   ATIAVSYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRRRAETWVAVRDESAALVRAVAS  167

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
             + G AVN+GELIF LT N+T+RAAFG+    G+ Q+EFI ILQEFSKLFGAFNV DF P+
Sbjct  168   SAGEAVNLGELIFNLTMNVTFRAAFGT--RDGEDQEEFIAILQEFSKLFGAFNVGDFIPW  225

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             LS  D QG+N R   ARAALD FID+IID+HI   RR R  +         A+ DMVD++
Sbjct  226   LSWMDPQGINRRTRDARAALDRFIDRIIDEHI---RRGRPDD---------ADADMVDDM  273

Query  960   LAFYSD--------EMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAE  1115
             LA+ ++        +    D DDLQN ++L RDNIK IIMDVMFGGTETVASAIEWAMAE
Sbjct  274   LAYLAEAKPNKDGGKSAAGDVDDLQNTLRLARDNIKAIIMDVMFGGTETVASAIEWAMAE  333

Query  1116  LMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEA  1295
             +M  P+ L+RLQQEL D VG DR V ESDL+KL FL+C +KETLRLHPPIP+LLHETAE 
Sbjct  334   MMHRPDELRRLQQELADVVGYDRNVNESDLDKLPFLRCVVKETLRLHPPIPVLLHETAED  393

Query  1296  TEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMP---DFKGSNFEFIPF  1466
               V GY +P  SR ++N WAI RD+ SW+D D+F+P RF  +G     DFKG  FEF+PF
Sbjct  394   CVVGGYSVPRGSRVMVNVWAIGRDRGSWKDADAFRPSRFAPDGDAVGLDFKGGCFEFLPF  453

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGM LGLYA ELAVA L H F+W LPDGMKPS+LDM D+FGLTAP+ATRL  +
Sbjct  454   GSGRRSCPGMALGLYALELAVAQLAHGFSWSLPDGMKPSELDMGDIFGLTAPRATRLYAV  513

Query  1647  PTPRLNCQLH  1676
             PTPRLNC LH
Sbjct  514   PTPRLNCPLH  523



>ref|XP_010436199.1| PREDICTED: cytochrome P450 84A1-like [Camelina sativa]
Length=511

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/489 (62%), Positives = 385/489 (79%), Gaps = 10/489 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             P+PPGP+G+P++GN+ L +  SHRGLA+LA+QYGGLLHL+MG +H+V VS  + AR++LQ
Sbjct  30    PFPPGPRGYPIVGNLKLKNQLSHRGLAELAKQYGGLLHLQMGRIHIVAVSTAEMAREILQ  89

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD +F+NRPANVAISYL+Y+RADMAFA+YGP WRQMRK+CV+KLFSRRRAESW SVR+E
Sbjct  90    VQDVVFANRPANVAISYLTYNRADMAFANYGPLWRQMRKICVMKLFSRRRAESWASVREE  149

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             +D+ V+T+    G  VN+GEL+F LTRNITYRAAFGS   +  GQDEF+KILQEFSKLFG
Sbjct  150   IDSMVQTLTEQTGLPVNVGELVFALTRNITYRAAFGSF--ARDGQDEFVKILQEFSKLFG  207

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AF++++F P++  F  +G   RL  AR +LDGFID+IID HI +   R+N + G      
Sbjct  208   AFDITEFLPWMRWFGNRGFTMRLENARKSLDGFIDRIIDAHIEKKESRQNDDDG------  261

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNA-IKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
               + DMVDEL+AFYS E   + S+D Q++ ++LTRDNIK ++MDVMFGGTETVASAIEWA
Sbjct  262   -LDDDMVDELMAFYSGENGGDLSNDSQSSSLRLTRDNIKALVMDVMFGGTETVASAIEWA  320

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             M EL+K P  L++LQQEL D +GL R+  ESDLE L + +C +KETLRLHPPIPLLLHE 
Sbjct  321   MTELLKNPHELRKLQQELADVIGLSRQFHESDLENLPYFRCAMKETLRLHPPIPLLLHEA  380

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             A  + V+GY IP  SR +IN +AI RD++ W +P++FKP RF+    PDFKGS+FE++PF
Sbjct  381   AADSVVSGYSIPRDSRVMINVYAIGRDESVWTEPNAFKPGRFMDSKAPDFKGSDFEYLPF  440

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLYA ELAVAH+ H F WELP+G    DLD+ D+FGLTAP+ATRL+ +
Sbjct  441   GSGRRSCPGMQLGLYAMELAVAHMLHSFNWELPEGANSGDLDITDMFGLTAPRATRLIAV  500

Query  1647  PTPRLNCQL  1673
             P+ RL C +
Sbjct  501   PSYRLKCPM  509



>ref|XP_006829159.1| hypothetical protein AMTR_s00001p00269980 [Amborella trichopoda]
 gb|ERM96575.1| hypothetical protein AMTR_s00001p00269980 [Amborella trichopoda]
Length=517

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/482 (65%), Positives = 363/482 (75%), Gaps = 18/482 (4%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             ++GNM LMD  +HRGLAKLA  YGGL++L++G +  VVVS P+ A+QVLQ QDN FSNRP
Sbjct  47    IVGNMALMDQLTHRGLAKLARPYGGLMYLRLGFMPNVVVSTPEMAKQVLQVQDNTFSNRP  106

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +AI YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSRRR ESW  VR+EVD  V+ VA 
Sbjct  107   ATIAIQYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRRRPESWRPVREEVDAMVKAVAT  166

Query  600   NC----GSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSD  767
                   G  VN+GEL+FGLTRNIT++AAFGS+   G+GQD F  +LQEFS+LFGAFN+ D
Sbjct  167   KAKTEPGMPVNVGELVFGLTRNITFKAAFGSA--LGEGQDMFNSLLQEFSRLFGAFNIGD  224

Query  768   FFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDM  947
             F P LS  DLQG+N RL  AR +LD FIDKIIDDH+    ++           D    DM
Sbjct  225   FLPVLSWMDLQGINKRLRNARQSLDHFIDKIIDDHMASAGQK-----------DERTLDM  273

Query  948   VDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKT  1127
             VD++L    D    ND  D   A+KLTRDNIK IIMDVMFGGTETVASAIEWAMAELM  
Sbjct  274   VDDMLVHLGDGPASNDDTD-TAALKLTRDNIKAIIMDVMFGGTETVASAIEWAMAELMHN  332

Query  1128  PENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVN  1307
             P+ ++++Q EL   VGL+R+V+E DLE LT+LKC +KE LRLHPPIPLLLHETAE TEV+
Sbjct  333   PQEMQKVQDELKKVVGLNRQVQEGDLENLTYLKCVVKEVLRLHPPIPLLLHETAEETEVS  392

Query  1308  GYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSC  1487
             GY IP + R +IN WAI RD  SW DPD+FKP+RF KE   DFKGS FEF+PFGSGRRSC
Sbjct  393   GYRIPKQCRVMINVWAIGRDPKSWPDPDAFKPERFTKENAYDFKGSCFEFLPFGSGRRSC  452

Query  1488  PGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNC  1667
             PGMQLGLY  E+AVAHL H F W LPDGMK  D+DM D FGLTAPKA RLV + T RL+C
Sbjct  453   PGMQLGLYGLEMAVAHLVHSFDWSLPDGMKSKDMDMSDSFGLTAPKAQRLVALATVRLSC  512

Query  1668  QL  1673
              L
Sbjct  513   DL  514



>ref|XP_008453715.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 84A1-like [Cucumis 
melo]
Length=513

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/476 (64%), Positives = 368/476 (77%), Gaps = 17/476 (4%)
 Frame = +3

Query  249   NMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANV  428
             NM L    +HRGLA LA++YGG+ HL++G +HMVV+S PD AR VLQ QD +FSNRPA  
Sbjct  49    NMLLRHQLTHRGLAALAKRYGGIFHLRIGFVHMVVISDPDAARNVLQVQDLVFSNRPATN  108

Query  429   AISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCG  608
             AI YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW SVR EVDN + T+A N  
Sbjct  109   AIKYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWTSVRHEVDNLITTIANNTQ  168

Query  609   SAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSC  788
             +  N+G L+F +T NI YRAAFG+S    Q Q  FIKIL+EFSKLFGAFNV+DFFP L  
Sbjct  169   TPFNLGHLVFSMTMNIIYRAAFGTSQPRDQAQ--FIKILEEFSKLFGAFNVADFFPCLGW  226

Query  789   FDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAF  968
              D QG+  RL +AR +LD FID+IID H+++ + R  +           + DMVDELLAF
Sbjct  227   IDPQGITSRLVEARRSLDRFIDRIIDQHLVERKERDQE----------IDKDMVDELLAF  276

Query  969   YSDEMKVNDSDDL-----QNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPE  1133
             YS++   N+  DL     Q  IKLTRDNIK IIMDVMFGGTETVASAIEW MAELM+ P+
Sbjct  277   YSEDEGGNNETDLEDLHLQTTIKLTRDNIKAIIMDVMFGGTETVASAIEWTMAELMRNPD  336

Query  1134  NLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGY  1313
             +LK+LQQ+L  TVGL  + +ESDL  LT+L+C LKETLRLHPPIPLLLHETA  T++ GY
Sbjct  337   DLKKLQQQLDATVGLHHRPQESDLHNLTYLRCILKETLRLHPPIPLLLHETAADTKLAGY  396

Query  1314  YIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPG  1493
              IPA+SR  INAWAI RD+ SW DPD F+P RF  EG  DFKG +FEFIPFGSGRRSCPG
Sbjct  397   RIPAKSRVFINAWAIGRDEKSWVDPDIFRPARFEMEGAADFKGGDFEFIPFGSGRRSCPG  456

Query  1494  MQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRL  1661
             MQLG+YA E+AVA+L HCF W+LP+GMKP++LDM+DVFGLTAP+A+RLV +P  R+
Sbjct  457   MQLGIYAVEMAVANLVHCFEWKLPEGMKPAELDMNDVFGLTAPRASRLVAVPYQRV  512



>ref|XP_010444886.1| PREDICTED: cytochrome P450 84A1-like [Camelina sativa]
Length=511

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/489 (62%), Positives = 384/489 (79%), Gaps = 10/489 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             P+PPGP+G+P++GN+ L +  SHRGLA+LA+QYGGLLHL+MG +H+V VS  + AR++LQ
Sbjct  30    PFPPGPRGYPIVGNLKLKNQLSHRGLAELAKQYGGLLHLQMGRIHIVAVSTAEMAREILQ  89

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD +F+NRPANVAISYL+Y+RADMAFA+YGP WRQMRK+CV+KLFSR+RAESW SVR+E
Sbjct  90    VQDVVFANRPANVAISYLTYNRADMAFANYGPLWRQMRKICVMKLFSRKRAESWASVREE  149

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             +D+ V+ +    GS VN+GEL+F LTRNITYRAAFGS   +  GQDEF+KILQEFSKLFG
Sbjct  150   IDSMVQMLTEQTGSPVNVGELVFALTRNITYRAAFGSF--ARDGQDEFVKILQEFSKLFG  207

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AF++++F P++  F  +G N RL  AR +LDGFIDKIID HI +   R+N + G      
Sbjct  208   AFDITEFLPWMRWFGNRGFNKRLENARKSLDGFIDKIIDAHIEKKESRQNDDDG------  261

Query  930   GAETDMVDELLAFYSDEMKVNDSDDLQNAI-KLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
               + DMVDEL+AFYS E   +  +D Q+++ +LTRDNIK ++MDVMFGGTETVASAIEWA
Sbjct  262   -LDDDMVDELMAFYSGENGGDLCNDSQSSLLRLTRDNIKALVMDVMFGGTETVASAIEWA  320

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             M EL+K P  L++LQQEL D +GL R+  ESDLE L + +C +KETLRLHPPIPLLLHE 
Sbjct  321   MTELLKNPHELRKLQQELADVIGLSRQFHESDLENLPYFRCAMKETLRLHPPIPLLLHEA  380

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             A  + V+GY IP  SR ++N +AI RDK+ W +P++FKP RF+     DFKGS+FE++PF
Sbjct  381   AADSVVSGYSIPRDSRVMVNVYAIGRDKSVWTEPNAFKPGRFMDSKALDFKGSDFEYLPF  440

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLYA ELAVAH+ H F WELP+G    DLD+ D+FGLTAP+ATRL+ +
Sbjct  441   GSGRRSCPGMQLGLYAMELAVAHMLHSFNWELPEGANSGDLDISDMFGLTAPRATRLIAV  500

Query  1647  PTPRLNCQL  1673
             P+ RL C +
Sbjct  501   PSYRLKCPM  509



>ref|XP_006661950.1| PREDICTED: cytochrome P450 84A1-like [Oryza brachyantha]
Length=531

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/540 (60%), Positives = 393/540 (73%), Gaps = 30/540 (6%)
 Frame = +3

Query  108   IIYVLEALEAHKHMVIYFVIPflflfllsrlrrKPYPPGPKGWPLIGNMNLMDHYSHRGL  287
             + + +E L+    +VI   +  L + +  R R  P PPGPK  P++GNM++MD  +HRGL
Sbjct  5     VKFTMEWLQDPLSLVIVVTVAVLAMQIPRRRRAAPLPPGPKAMPIVGNMSMMDQLTHRGL  64

Query  288   AKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMA  467
             A LA++YGGL+HL++G LH   VS P+ AR+VLQ QD  FSNRPA +AI+YL+YDRADMA
Sbjct  65    AALAKEYGGLMHLRLGRLHAFAVSTPEYAREVLQAQDGAFSNRPATIAIAYLTYDRADMA  124

Query  468   FAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGS-AVNIGELIFGL  644
             FAHYGPFWRQMRKLCVVKLFSRRRAE+W +VRDE    VR VA + G  AVN+GELIF L
Sbjct  125   FAHYGPFWRQMRKLCVVKLFSRRRAETWLAVRDESAALVRAVAESRGERAVNLGELIFNL  184

Query  645   TRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAK  824
             T+N+ +RAAFG+    G G DEFI ILQEFSKLFGAFN+ DF P+LS  D  G+N RL  
Sbjct  185   TKNVIFRAAFGT--RDGDGHDEFIAILQEFSKLFGAFNIGDFIPWLSWVDPNGINRRLVA  242

Query  825   ARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDE--------  980
             AR+ALD FIDKIID+H+     +R KN       D A+ DMVD++LAF ++         
Sbjct  243   ARSALDRFIDKIIDEHM-----KRGKNP------DDADADMVDDMLAFLAEAKPHAGKAA  291

Query  981   -----MKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKR  1145
                         DL N ++LTRDNIK IIMDVMFGGTETVASAIEWAMAE+M +P++L+R
Sbjct  292   AAAAAAAAAADADLHNTLRLTRDNIKAIIMDVMFGGTETVASAIEWAMAEMMHSPDDLRR  351

Query  1146  LQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPA  1325
             +QQEL D VGLDR V ESDL++L FLKC +KETLRLHPPIP+LLHETAE   V GY +P 
Sbjct  352   VQQELADVVGLDRNVAESDLDRLPFLKCVVKETLRLHPPIPILLHETAEDCVVGGYSVPR  411

Query  1326  RSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMP---DFKGSNFEFIPFGSGRRSCPGM  1496
              SR +IN WAI RD+ +W+D D F+P RF   G     DFKG  FEF+PFGSGRRSCPGM
Sbjct  412   GSRVMINVWAIGRDRGAWKDADVFRPSRFAPGGDAAGLDFKGGCFEFLPFGSGRRSCPGM  471

Query  1497  QLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQLH  1676
              LGLYA ELAVA L H FTW LPDGMKPS+LDM D+FGLTAP+ATRL  + TPRL C L+
Sbjct  472   ALGLYALELAVAQLAHAFTWSLPDGMKPSELDMSDIFGLTAPRATRLSAVATPRLTCPLY  531



>ref|XP_010450987.1| PREDICTED: cytochrome P450 84A1-like [Camelina sativa]
Length=515

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/489 (62%), Positives = 383/489 (78%), Gaps = 9/489 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             P+PPGP+G+P++GN+ L +  SHRGLA+LA+QYGGLLHL+MG +H+V VS  + AR++LQ
Sbjct  33    PFPPGPRGYPIVGNLKLKNQLSHRGLAELAKQYGGLLHLQMGRIHIVAVSTAEMAREILQ  92

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD +F+NRPANVAISYL+Y+RADMAFA+YGP WRQMRK+CV+KLFSR+RAESW SVR+E
Sbjct  93    VQDVVFANRPANVAISYLTYNRADMAFANYGPLWRQMRKICVMKLFSRKRAESWASVREE  152

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             +D+ V+T+    GS VN+GEL+F LTRNITYRAAFGS   +  GQDEF+KILQEFSKLFG
Sbjct  153   IDSMVQTLTEQTGSPVNVGELVFALTRNITYRAAFGSF--ARDGQDEFVKILQEFSKLFG  210

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AF++++F P++  F  +G N RL  AR +LDGFIDKIID HI +   R+N         D
Sbjct  211   AFDITEFLPWMRWFGNRGFNKRLENARKSLDGFIDKIIDAHIEKKESRQN------YDDD  264

Query  930   GAETDMVDELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
               + DMVDEL+AFYS E      +D   ++++LTRDNIK ++MDVMFGGTETVASAIEWA
Sbjct  265   SLDDDMVDELMAFYSGENGGDQSNDSQSSSLRLTRDNIKALVMDVMFGGTETVASAIEWA  324

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhET  1286
             M EL+K P  L++LQQEL D +GL R+  ESDLE L + +C +KETLRLHPPIPLLLHE 
Sbjct  325   MTELLKNPHELRKLQQELADVIGLSRQFHESDLENLPYFRCAMKETLRLHPPIPLLLHEA  384

Query  1287  AEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPF  1466
             A  + V+GY IP  SR ++N +AI RD++ W +P++FKP RF+    PDFKGS+FE++PF
Sbjct  385   AADSVVSGYSIPRDSRVMVNVYAIGRDESVWTEPNAFKPGRFMDIKAPDFKGSDFEYLPF  444

Query  1467  GSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVI  1646
             GSGRRSCPGMQLGLYA ELAVAH+ H F WELP+G    DLD+ D+FGLTAP+ATRL+ +
Sbjct  445   GSGRRSCPGMQLGLYAMELAVAHMLHSFNWELPEGANSGDLDITDMFGLTAPRATRLIAV  504

Query  1647  PTPRLNCQL  1673
             P+ RL C +
Sbjct  505   PSYRLKCPM  513



>ref|XP_010490942.1| PREDICTED: cytochrome P450 84A4-like [Camelina sativa]
Length=512

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/493 (62%), Positives = 378/493 (77%), Gaps = 17/493 (3%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             KPYPPGPKG P+IGN+ +M+H++HRGLAKL+  YGGLLHL++G  H+ VVS P  ARQVL
Sbjct  31    KPYPPGPKGLPIIGNILMMNHFNHRGLAKLSRIYGGLLHLRLGFSHVFVVSSPGIARQVL  90

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             Q QD++FSNRP  +AI YL+Y  +D+AF +YGPFWR+MRKL V+ LFSR+RAESW SV +
Sbjct  91    QVQDHVFSNRPTTIAIRYLTYGGSDLAFCNYGPFWRRMRKLFVMMLFSRKRAESWVSVDE  150

Query  567   EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQ--DEFIKILQEFSK  740
             EV  +VR VA+N G  +N+ +L F LTR+IT+RAAFGSS S+   +  DEF++I+QEFSK
Sbjct  151   EVHKSVRFVAVNVGKPLNVCKLAFSLTRDITFRAAFGSSSSTSDEERLDEFLEIIQEFSK  210

Query  741   LFGAFNVSDFFP-FLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGE  917
             LFG FNV+D+ P +LS  D QG+N R+ KAR +LD FI+ IIDDH+L+  R RN      
Sbjct  211   LFGEFNVADYVPSWLSWIDPQGINKRVEKARKSLDCFIESIIDDHLLKKTRERNV-----  265

Query  918   VSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAI  1097
                D  E DMVD+LLAFY +E+KVN+S   Q  IKL  +NIKGIIMDVMFGGTETVA AI
Sbjct  266   ---DDEENDMVDQLLAFYKEEIKVNNS---QTNIKL--NNIKGIIMDVMFGGTETVALAI  317

Query  1098  EWAMAELMKTPENLKRLQQELTDTVGLDR-KVEESDLEKLTFLKCCLKETlrlhppipll  1274
             EW + EL+++PEN+KR+Q EL   VGLD+ +VE++ LEKLTFLKC LKETLRLHPP PLL
Sbjct  318   EWVLTELLRSPENMKRVQDELASVVGLDQWRVEDTHLEKLTFLKCTLKETLRLHPPFPLL  377

Query  1275  lhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFE  1454
             LHET +  EV GY+IP  SR ++N +A+ RD  SW DP+ F P RFL    PD KG+NFE
Sbjct  378   LHETVKDAEVTGYFIPKGSRVMVNTYALGRDPGSWSDPEIFNPGRFLDPDAPDLKGNNFE  437

Query  1455  FIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATR  1634
             FIPFGSGRRSCPGMQLGLYAFELAVAHL HCFTW LPDGMK  D+D  +  GLT PK+T 
Sbjct  438   FIPFGSGRRSCPGMQLGLYAFELAVAHLLHCFTWSLPDGMKSGDVDTVEGPGLTVPKSTP  497

Query  1635  LVVIPTPRLNCQL  1673
             LV +PT RL C +
Sbjct  498   LVTVPTTRLFCPI  510



>emb|CDY29219.1| BnaA06g25380D [Brassica napus]
Length=476

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/488 (59%), Positives = 358/488 (73%), Gaps = 54/488 (11%)
 Frame = +3

Query  207   KP-YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQV  383
             KP YPPGPKG P+IGNM +MD  +H GLAKLA +YGGL HL+MG  H+  ++ PD ARQV
Sbjct  38    KPLYPPGPKGLPVIGNMLMMDQLTHHGLAKLAHKYGGLFHLRMGFHHVFAITSPDVARQV  97

Query  384   LQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR  563
             LQ QD  FSNRP  VAI+YL+YD ADMAFA YGPFWRQMRK+CV+K+FSR+R ESW SVR
Sbjct  98    LQVQDISFSNRPVTVAINYLTYDLADMAFAPYGPFWRQMRKVCVMKVFSRKRTESWASVR  157

Query  564   DEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKL  743
             +EV+N VR+++ N G  VN+GELIF LTRNITYRAAFG++  +   QDEFI+ILQEFSKL
Sbjct  158   EEVNNMVRSLSSNVGKPVNVGELIFTLTRNITYRAAFGAACET--EQDEFIRILQEFSKL  215

Query  744   FGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVS  923
             FGAFN++DF PFL  FD QG+N RL KAR  LDGFID++ID+H+   R+R   N      
Sbjct  216   FGAFNIADFIPFLGWFDFQGINKRLVKARNDLDGFIDEVIDEHM---RKRETVNV-----  267

Query  924   GDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEW  1103
                 +TDMVD+LLAFYS++   N +   +N +KLTRDNIK ++MDVMFGGTET+AS IEW
Sbjct  268   --DEDTDMVDDLLAFYSEDSSTNRN---KNTVKLTRDNIKALVMDVMFGGTETMASGIEW  322

Query  1104  AMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhE  1283
             A+ EL++ P  LKRLQQELT+ VGLDR+++                              
Sbjct  323   ALTELLRNPAELKRLQQELTEVVGLDRRLQ------------------------------  352

Query  1284  TAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIP  1463
                     G+ +P  SR +INA+AIARD   W DP++F+P RF++ GMPDF G+NFEFIP
Sbjct  353   --------GFSVPKGSRLMINAFAIARDPKLWVDPEAFRPSRFMEPGMPDFMGTNFEFIP  404

Query  1464  FGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVV  1643
             FG+GRRSCPGMQLGLYA E+AVA++ HCFTW+LPDGMKPS+LDM DV GLTAP+ATRL+ 
Sbjct  405   FGAGRRSCPGMQLGLYAMEVAVANIIHCFTWKLPDGMKPSELDMSDVMGLTAPRATRLIA  464

Query  1644  IPTPRLNC  1667
             +P  RL C
Sbjct  465   VPDTRLIC  472



>emb|CDY20907.1| BnaC06g01270D [Brassica napus]
Length=476

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/491 (59%), Positives = 361/491 (74%), Gaps = 54/491 (11%)
 Frame = +3

Query  207   KP-YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQV  383
             KP YPPGPKG P+IGNM +MD  +H GLAKLA +YGGL +L+MG  H+  ++ PD ARQV
Sbjct  38    KPLYPPGPKGLPVIGNMLMMDQLTHHGLAKLAHKYGGLFYLRMGFRHVFAITSPDVARQV  97

Query  384   LQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR  563
             LQ QD  FSNRP NVAI+YL+YD ADMAFA YGPFWR+MRK+CV+K+FSR+R ESW SVR
Sbjct  98    LQVQDISFSNRPVNVAINYLTYDLADMAFAPYGPFWREMRKVCVMKVFSRKRTESWASVR  157

Query  564   DEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKL  743
             +EV+N VR+ + N G  VN+GELIF LTRNITYRAAFG++  +   QDEFI+ILQEFSKL
Sbjct  158   EEVNNMVRSFSSNVGKPVNVGELIFTLTRNITYRAAFGAACET--EQDEFIRILQEFSKL  215

Query  744   FGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVS  923
             FGAFN++DF PFL  FD QG+N RL KAR  LDGFID++ID+H+   ++R   N      
Sbjct  216   FGAFNIADFIPFLGWFDFQGINKRLVKARNDLDGFIDEVIDEHM---KKRETVNV-----  267

Query  924   GDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEW  1103
                 +TDMVD+LLAFYS++   N +   +N +KLTRDNIK ++MDVMFGGTET+AS IEW
Sbjct  268   --DEDTDMVDDLLAFYSEDSSTNRN---KNTVKLTRDNIKALVMDVMFGGTETMASGIEW  322

Query  1104  AMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhE  1283
             A+ EL++ P  LKRLQQELT+ VGLDR+++                              
Sbjct  323   ALTELLRNPAELKRLQQELTEVVGLDRRLQ------------------------------  352

Query  1284  TAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIP  1463
                     G+++P  SR +INA+AIARD   W DP++F+P RF++ GMPDF G+NFEFIP
Sbjct  353   --------GFFVPKGSRLMINAFAIARDPKLWVDPEAFRPSRFMEPGMPDFMGTNFEFIP  404

Query  1464  FGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVV  1643
             FG+GRRSCPGMQLGLYA E+AVA++ HCFTW+LPDGMKPS+LDM DV GLTAP+ATRL+ 
Sbjct  405   FGAGRRSCPGMQLGLYAMEVAVANIIHCFTWKLPDGMKPSELDMSDVMGLTAPRATRLIA  464

Query  1644  IPTPRLNCQLH  1676
             +P  RL C ++
Sbjct  465   VPDTRLICPVY  475



>ref|XP_010423591.1| PREDICTED: cytochrome P450 84A4 [Camelina sativa]
Length=511

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/493 (61%), Positives = 380/493 (77%), Gaps = 18/493 (4%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             KPYPPGPKG P+IGN+ +M+H++HRGLAKL+  YGGLLHL++G  H+ VVS PD ARQVL
Sbjct  30    KPYPPGPKGLPIIGNILMMNHFNHRGLAKLSRIYGGLLHLRLGFSHVFVVSSPDIARQVL  89

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             Q QD++FSNRP  +AI YL+Y  +D+AF +YGPFWR+MRKL V+ LFSR+RAESW SV +
Sbjct  90    QVQDHVFSNRPTTIAIRYLTYGGSDLAFCNYGPFWRRMRKLYVMMLFSRKRAESWVSVDE  149

Query  567   EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQ--DEFIKILQEFSK  740
             EV  +VR VA+N G  +N+ +L F LTR+IT+RAAFGSS S+   +  DEF++I+QEFSK
Sbjct  150   EVHKSVRFVAVNVGKPLNVCKLAFSLTRDITFRAAFGSSASTSDEERLDEFLEIIQEFSK  209

Query  741   LFGAFNVSDFFP-FLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGE  917
             LFG FNV+D+ P +LS  D QG+N R+ KAR +LD FI+ +IDDH+L+  R RN +    
Sbjct  210   LFGEFNVADYVPSWLSWIDPQGINKRVEKARKSLDCFIESVIDDHLLKKTRERNVDE---  266

Query  918   VSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAI  1097
                   E DMVD+LLAFY +E+KVN+S   +  IKL  +NIKGIIMDVMFGGTETVA AI
Sbjct  267   ------ENDMVDQLLAFYKEEIKVNNS---ETNIKL--NNIKGIIMDVMFGGTETVALAI  315

Query  1098  EWAMAELMKTPENLKRLQQELTDTVGLDR-KVEESDLEKLTFLKCCLKETlrlhppipll  1274
             EW + EL+++PEN+KR+Q EL   VGLD+ +VE++ LEKLTFLKC LKETLRLHPP PLL
Sbjct  316   EWVLTELLRSPENMKRVQDELASVVGLDQWRVEDTHLEKLTFLKCTLKETLRLHPPFPLL  375

Query  1275  lhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFE  1454
             LHET E  +V GY+IP  SR ++N +A+ RD +SW DP+ F P RFL    PD KG+NFE
Sbjct  376   LHETVEDADVTGYFIPKGSRVMVNTYALGRDPDSWSDPEIFNPGRFLDPDAPDLKGNNFE  435

Query  1455  FIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATR  1634
             FIPFGSGRRSCPGMQLGLYAFELA+AHL HCFTW LPDG+K  D+D  +  GLT PK+T 
Sbjct  436   FIPFGSGRRSCPGMQLGLYAFELALAHLLHCFTWSLPDGLKSGDVDTVEGAGLTVPKSTP  495

Query  1635  LVVIPTPRLNCQL  1673
             L+ +PT RL C +
Sbjct  496   LMAVPTTRLLCPI  508



>ref|NP_196053.2| cytochrome P450 84A4 [Arabidopsis thaliana]
 sp|F4JW83.1|C84A4_ARATH RecName: Full=Cytochrome P450 84A4 [Arabidopsis thaliana]
 gb|AED90728.1| cytochrome P450 84A4 [Arabidopsis thaliana]
Length=512

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/493 (62%), Positives = 379/493 (77%), Gaps = 17/493 (3%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             KPYPPGPKG P+IGN+ +M+ ++HRGLAKL+  YGGLLHL++G  H+ VVS PD ARQVL
Sbjct  30    KPYPPGPKGLPVIGNILMMNQFNHRGLAKLSRIYGGLLHLRLGFSHIFVVSSPDIARQVL  89

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             Q QD++FSNRP  +AI YL+Y  +D+AF +YGPFWR+MRKL V+ LFSR+RAESW SV +
Sbjct  90    QVQDHVFSNRPTTIAIRYLTYGGSDLAFCNYGPFWRRMRKLYVMMLFSRKRAESWVSVDE  149

Query  567   EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQ--DEFIKILQEFSK  740
             EV  +VR VA N G  +NI +L F L+R+IT+RAAFGSS S+      DEF++I+QEFSK
Sbjct  150   EVHKSVRLVASNVGKPLNICKLAFSLSRDITFRAAFGSSSSTSDESRLDEFLEIIQEFSK  209

Query  741   LFGAFNVSDFFP-FLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGE  917
             LFG FNV+D+ P +LS  D QG+N R+ KAR +LDGFI+ +IDDH L  ++R + N    
Sbjct  210   LFGEFNVADYVPSWLSWIDPQGINGRVEKARKSLDGFIESVIDDH-LHKKKREHDN----  264

Query  918   VSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAI  1097
                   ETDMVD+LLAFY +E+KVN+S       K+  DNIKGIIMDVMFGGTETVA AI
Sbjct  265   ---VDEETDMVDQLLAFYEEEVKVNNS-----VTKINLDNIKGIIMDVMFGGTETVALAI  316

Query  1098  EWAMAELMKTPENLKRLQQELTDTVGLDR-KVEESDLEKLTFLKCCLKETlrlhppipll  1274
             EW + E++++PEN+KR+Q ELT  VGLDR +VE++ LEKLTFLKC LKETLRLHPP PLL
Sbjct  317   EWVLTEILRSPENMKRVQDELTSVVGLDRWRVEDTHLEKLTFLKCILKETLRLHPPFPLL  376

Query  1275  lhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFE  1454
             LHET + TE++GY+IP  SR ++N +A+ RD NSW DP+SF P RFL    PD KG+NFE
Sbjct  377   LHETVKDTEISGYFIPKGSRVMVNTYALGRDPNSWSDPESFNPGRFLNPIAPDLKGNNFE  436

Query  1455  FIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATR  1634
             F+PFGSGRRSCPGMQLGLYAFELAVAHL HCFTW LPDGM P D+D  +  GLT PKA  
Sbjct  437   FVPFGSGRRSCPGMQLGLYAFELAVAHLLHCFTWSLPDGMNPGDVDTVEGPGLTVPKAIP  496

Query  1635  LVVIPTPRLNCQL  1673
             LV +PT RL C +
Sbjct  497   LVAVPTTRLLCPI  509



>ref|XP_002873144.1| hypothetical protein ARALYDRAFT_487214 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49403.1| hypothetical protein ARALYDRAFT_487214 [Arabidopsis lyrata subsp. 
lyrata]
Length=508

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/493 (62%), Positives = 376/493 (76%), Gaps = 16/493 (3%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             KPYPPGPKG P+IGN+ +M+H++HRGLAKL+  YGGLLHL++G  H+ VVS PD ARQVL
Sbjct  26    KPYPPGPKGLPVIGNILIMNHFNHRGLAKLSRIYGGLLHLRLGFSHIFVVSSPDIARQVL  85

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             Q QD++FSNRP  +AI YL+Y  +D+AF +YGPFWR+MRKL V+ LFSR+RAESW SV +
Sbjct  86    QVQDHVFSNRPTTIAIRYLTYGGSDLAFCNYGPFWRRMRKLYVMMLFSRKRAESWVSVDE  145

Query  567   EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQ--DEFIKILQEFSK  740
             EV  +VR VA   G  +NI +L F L+R IT+RAAFGSS S+      DEF++I+QEFSK
Sbjct  146   EVHKSVRFVASKVGKPLNICKLAFSLSRGITFRAAFGSSSSTSDESRLDEFLEIIQEFSK  205

Query  741   LFGAFNVSDFFP-FLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGE  917
             LFG FNV+D+ P +LS  D QG+N R+ KAR +LDGFI+ +IDDH L  ++R + N    
Sbjct  206   LFGEFNVADYVPSWLSWIDPQGINGRVEKARKSLDGFIESVIDDHYLHKKKREHNNLV--  263

Query  918   VSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAI  1097
                   ETDMVD+LL FY +E+KVN SD      K+  DNIKGIIMDVMFGGTETVA AI
Sbjct  264   -----EETDMVDQLLTFYEEEVKVNTSD-----TKINLDNIKGIIMDVMFGGTETVALAI  313

Query  1098  EWAMAELMKTPENLKRLQQELTDTVGLDRK-VEESDLEKLTFLKCCLKETlrlhppipll  1274
             EW + EL+++PEN+KR+Q E+   VGLDR+ VE++ LEKLTFLKC LKETLRLHPP PLL
Sbjct  314   EWVLTELLRSPENMKRVQDEIASVVGLDRRRVEDTHLEKLTFLKCILKETLRLHPPFPLL  373

Query  1275  lhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFE  1454
             LHET E TEV+GY+IP  SR ++N +A+ RD +SW DP+ F P RFL    PD KG+NFE
Sbjct  374   LHETVEDTEVSGYFIPKGSRVMVNTYALGRDPDSWSDPEIFNPGRFLDPSAPDLKGNNFE  433

Query  1455  FIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATR  1634
             F+PFGSGRRSCPGMQLGLYAFELAVA L HCFTW LPDGMKP D+D  +  GLT PKAT 
Sbjct  434   FVPFGSGRRSCPGMQLGLYAFELAVAQLLHCFTWSLPDGMKPGDVDTVEGPGLTVPKATP  493

Query  1635  LVVIPTPRLNCQL  1673
             LV +PT RL C +
Sbjct  494   LVAVPTTRLLCPI  506



>ref|XP_003571958.1| PREDICTED: cytochrome P450 84A1-like [Brachypodium distachyon]
Length=540

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/497 (64%), Positives = 371/497 (75%), Gaps = 31/497 (6%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM +MD  +HRGLA LA+QYGGLLHL++G LH   VS P+ AR+VLQ QD  FSNRP
Sbjct  45    IIGNMTMMDQLTHRGLAALAKQYGGLLHLRLGKLHAFAVSTPEYAREVLQAQDGAFSNRP  104

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVA-  596
             A +AI YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSRRRAE+W +VR+E    V  VA 
Sbjct  105   ATIAIKYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRRRAETWVAVREESAALVGAVAS  164

Query  597   MNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFP  776
                G AVN+GELIF LT+N+ +RAA GS+   G+ QDEFI ILQEFSKLFGAFN+ DFFP
Sbjct  165   AKTGEAVNLGELIFSLTKNVIFRAAIGSAGDGGK-QDEFIAILQEFSKLFGAFNIGDFFP  223

Query  777   FLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDE  956
             +L   D QG++ RL  AR+ALDGFID IID+H+      R KN       D A+ DMVD+
Sbjct  224   WLGWADTQGIDARLRAARSALDGFIDNIIDEHM-----ERGKNP------DDADADMVDD  272

Query  957   LLAFYSDEMKVNDS------DDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAEL  1118
             +LAF  DE K   +      DDLQN+++LTRDNIK IIMDVMFGGTETVASAIEWAMAE+
Sbjct  273   MLAFL-DEAKPKKAGAGAGDDDLQNSLRLTRDNIKAIIMDVMFGGTETVASAIEWAMAEM  331

Query  1119  MKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEAT  1298
             M +P +L RLQQEL D VGLDR   ESDL+KL FLKC +KETLRLHPPIPLLLHETAE  
Sbjct  332   MHSPSDLHRLQQELADVVGLDRNANESDLDKLPFLKCVIKETLRLHPPIPLLLHETAEDC  391

Query  1299  EVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMP-----------DFKGS  1445
              V GY +P  SR +IN +AI RD  +W+DPD F+P RF +               DFKG 
Sbjct  392   VVGGYSVPRGSRVMINVYAIGRDAGAWKDPDVFRPSRFARGIGGEGEESGEAAGLDFKGG  451

Query  1446  NFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPK  1625
              FEF+PFGSGRRSCPGM LGLYA ELAVA L H F+WELPDGMKPS+LDM DVFGLTAP+
Sbjct  452   CFEFLPFGSGRRSCPGMALGLYALELAVAQLAHGFSWELPDGMKPSELDMGDVFGLTAPR  511

Query  1626  ATRLVVIPTPRLNCQLH  1676
             ATRL  +PTPRL C L 
Sbjct  512   ATRLFAVPTPRLTCSLQ  528



>gb|AFZ78545.1| coniferaldehyde 5-hydroxylase [Populus tomentosa]
Length=408

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/405 (73%), Positives = 343/405 (85%), Gaps = 12/405 (3%)
 Frame = +3

Query  462   MAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFG  641
             MAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDEVD+ ++TV  N G  VN+GELIF 
Sbjct  15    MAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDEVDSMLKTVEANIGKPVNLGELIFT  74

Query  642   LTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLA  821
             LT NITYRAAFG+     +GQDEFIKILQEFSKLFGAFN+SDF P+L   D QGL+ RL 
Sbjct  75    LTMNITYRAAFGAK---NEGQDEFIKILQEFSKLFGAFNMSDFIPWLGWIDPQGLSARLV  131

Query  822   KARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEM-KVNDS  998
             KAR ALD FID IIDDHI    ++R +N+  E     AETDMVD++LAFY +E  KV++S
Sbjct  132   KARKALDRFIDSIIDDHI----QKRKQNNFSE----DAETDMVDDMLAFYGEEARKVDES  183

Query  999   DDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGL  1178
             DDLQ AI LT+DNIK IIMDVMFGGTETVASAIEW MAELMK+PE+ KR+QQEL + VGL
Sbjct  184   DDLQKAISLTKDNIKAIIMDVMFGGTETVASAIEWVMAELMKSPEDQKRVQQELAEVVGL  243

Query  1179  DRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAI  1358
             +R+VEESD++KLTFLKC LKETLR+HPPIPLLLHET+E  EV GY+IP ++R +INA+AI
Sbjct  244   ERRVEESDIDKLTFLKCALKETLRMHPPIPLLLHETSEDAEVAGYFIPKQTRVMINAYAI  303

Query  1359  ARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHL  1538
              RDKNSWEDPD+FKP RFLK G+PDFKG++FEFIPFGSGRRSCPGMQLGLY  +LAVAHL
Sbjct  304   GRDKNSWEDPDAFKPSRFLKPGVPDFKGNHFEFIPFGSGRRSCPGMQLGLYTLDLAVAHL  363

Query  1539  FHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
              HCFTWELPDGMKPS+LDM D+FGLTAP+ATRLV +P+ R+ C L
Sbjct  364   LHCFTWELPDGMKPSELDMTDMFGLTAPRATRLVAVPSKRVLCPL  408



>ref|XP_010456392.1| PREDICTED: cytochrome P450 84A4-like [Camelina sativa]
Length=511

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/493 (61%), Positives = 376/493 (76%), Gaps = 17/493 (3%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             KPYPPGPKG P+IGN+ +M+H++HRGLAKL+  YGGLLHL++G  H+ VVS PD ARQVL
Sbjct  30    KPYPPGPKGLPIIGNILMMNHFNHRGLAKLSRIYGGLLHLRLGFSHVFVVSSPDIARQVL  89

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             Q Q ++FSNRP  +AI YL+Y  +D+AF +YGPFWR+MRKL V+ LFSR+RAESW SV +
Sbjct  90    QVQHHVFSNRPTTIAIRYLTYGGSDLAFCNYGPFWRRMRKLFVMMLFSRKRAESWVSVDE  149

Query  567   EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQ--DEFIKILQEFSK  740
             EV  +VR VA+N G  +N+ +L F LTR+IT+RAAFGSS S+   +  +EF++I+QEFSK
Sbjct  150   EVHKSVRFVAVNVGKPLNVCKLAFSLTRDITFRAAFGSSSSTSDEERLEEFLEIIQEFSK  209

Query  741   LFGAFNVSDFFP-FLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGE  917
             LFG FNV+D+ P +LS  D QG+N R+ KAR +LD FI+ +IDDH+L+  R RN      
Sbjct  210   LFGEFNVADYVPSWLSWIDPQGINKRVEKARKSLDCFIESVIDDHLLKKTRERNV-----  264

Query  918   VSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAI  1097
                D  E DMVD+LLAF  +E+KVN+S   +  IKL  +NIKGIIMDVMFGGTETVA AI
Sbjct  265   ---DDEENDMVDQLLAFNKEEIKVNNS---ETNIKL--NNIKGIIMDVMFGGTETVALAI  316

Query  1098  EWAMAELMKTPENLKRLQQELTDTVGLDR-KVEESDLEKLTFLKCCLKETlrlhppipll  1274
             EW + EL+++PEN+KR+Q EL   VGLD+ ++E++ LEKLTFLKC LKE LRLHPP PLL
Sbjct  317   EWVLTELLRSPENMKRVQDELASVVGLDQWRMEDTHLEKLTFLKCTLKEALRLHPPFPLL  376

Query  1275  lhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFE  1454
             LHET E  EV GY+IP  SR ++N  A+ RD +SW DP+ F P RFL    PD +G+NFE
Sbjct  377   LHETVEDAEVTGYFIPKGSRVMVNTSALGRDPDSWSDPEIFNPGRFLDPDAPDLRGNNFE  436

Query  1455  FIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATR  1634
             FIPFGSGRRSCPGMQLG+YAFELAVAHL  CFTW LPDGMK SD+D  +  GLT PKAT 
Sbjct  437   FIPFGSGRRSCPGMQLGVYAFELAVAHLLLCFTWSLPDGMKSSDVDTVEGPGLTVPKATP  496

Query  1635  LVVIPTPRLNCQL  1673
             LV +PT RL C +
Sbjct  497   LVAVPTTRLLCPI  509



>gb|AGR85825.1| ferulate-5-hydroxylase, partial [Hibiscus cannabinus]
Length=392

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/404 (74%), Positives = 338/404 (84%), Gaps = 13/404 (3%)
 Frame = +3

Query  462   MAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFG  641
             MAFAHYGPFWRQMRKL V+KLFSR+RAESW+S+RDEVD+ V+ VA N G  VN+GELIF 
Sbjct  1     MAFAHYGPFWRQMRKLSVMKLFSRKRAESWESIRDEVDSHVKAVASNAGDVVNMGELIFN  60

Query  642   LTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLA  821
             LT+NI YRAAFG    S QGQ+EFI+ILQEFSKLFGAFN++DF P+L   D QGLN RL 
Sbjct  61    LTKNIIYRAAFGCI--SQQGQEEFIRILQEFSKLFGAFNMADFIPWLGWADPQGLNTRLE  118

Query  822   KARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVNDSD  1001
             KAR ALD FID IID        ++ +N+GG   GD   TDMVD+LL F ++E +VN S+
Sbjct  119   KARGALDKFIDTIID--------KKMRNNGGSDVGD---TDMVDDLLTFCTEEAQVNQSE  167

Query  1002  DLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLD  1181
             DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+AELMK+PE++KR+QQEL + VGLD
Sbjct  168   DLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALAELMKSPEDMKRVQQELAEVVGLD  227

Query  1182  RKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIA  1361
             R+VEESD+EKLT LKC LKETLRLHPPIPLLLHETAE T V GY IPA+SR +INAWAIA
Sbjct  228   RRVEESDMEKLTSLKCTLKETLRLHPPIPLLLHETAEDTVVAGYQIPAKSRVMINAWAIA  287

Query  1362  RDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLF  1541
             RDK+SWEDPDSFKP RFLKEG+ D+KGSNFEFIPFGSGRRSCPGM LGLYA +LAVAHL 
Sbjct  288   RDKDSWEDPDSFKPSRFLKEGVADYKGSNFEFIPFGSGRRSCPGMTLGLYALDLAVAHLL  347

Query  1542  HCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             HCFTWELPDGMKPS+LDM DVFGLTAP+A RL  +P  RL C L
Sbjct  348   HCFTWELPDGMKPSELDMSDVFGLTAPRAARLYAVPKKRLICPL  391



>ref|XP_006286043.1| hypothetical protein CARUB_v10007572mg [Capsella rubella]
 gb|EOA18941.1| hypothetical protein CARUB_v10007572mg [Capsella rubella]
Length=525

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/478 (62%), Positives = 375/478 (78%), Gaps = 10/478 (2%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             ++GN+ L D  SHRGLA+LA+ YGGLLHL+MG +H+V VS  + ARQ+LQ QD +F+NRP
Sbjct  57    IVGNLKLKDQLSHRGLAELAKPYGGLLHLQMGIIHIVAVSTAEMARQILQVQDVVFANRP  116

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             ANVAISYL+Y+RADMAFA+YGP WRQMRK+CV+KLFSR+RAESW SVR+E+D+ V+T+  
Sbjct  117   ANVAISYLTYNRADMAFANYGPLWRQMRKICVMKLFSRKRAESWASVREEIDSMVQTLIE  176

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
               GS VN+GEL+F LTR ITYRAAFGS   +  GQDEF+KILQEFSKLFGAF++++F P+
Sbjct  177   QTGSPVNVGELVFALTRKITYRAAFGSF--ARDGQDEFVKILQEFSKLFGAFDITEFLPW  234

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             +  F  +G   RL  AR +LDGFID+IID HI +   R+  +       DG + DMVDEL
Sbjct  235   MRWFGNRGFTKRLENARNSLDGFIDRIIDAHIEKKISRKPNDD------DGLDDDMVDEL  288

Query  960   LAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENL  1139
             +AFYS E + ND+    ++++LTRDNIK ++MDVMFGGTETVASAIEWAM ELMK P  L
Sbjct  289   MAFYSGEDESNDAQS--SSLRLTRDNIKALVMDVMFGGTETVASAIEWAMTELMKNPHEL  346

Query  1140  KRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYI  1319
             +++QQEL D +GL+R+  ESDLE L + +C +KETLRLHPPIPLLLHE A  + V+GY I
Sbjct  347   RKVQQELADVIGLNRRFHESDLENLPYFRCAMKETLRLHPPIPLLLHEAAADSVVSGYSI  406

Query  1320  PARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQ  1499
             P  SR +IN +AI RD + W +P++FKP RF++   PDFKGS+FE++PFGSGRRSCPGMQ
Sbjct  407   PRDSRVMINVYAIGRDGSVWTEPNAFKPGRFMESKAPDFKGSDFEYLPFGSGRRSCPGMQ  466

Query  1500  LGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             LGLYA ELAVAH+ H F WELP G+   DLDM D+FGLTAP+ATRL+ +P+ RLNC +
Sbjct  467   LGLYAMELAVAHMLHSFDWELPGGVTSDDLDMTDMFGLTAPRATRLIAVPSYRLNCPM  524



>gb|EYU40391.1| hypothetical protein MIMGU_mgv1a006014mg [Erythranthe guttata]
Length=461

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/474 (63%), Positives = 361/474 (76%), Gaps = 14/474 (3%)
 Frame = +3

Query  252   MNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVA  431
             M +    +HRGLA LA+ YGGL H+KMG +HMV VS  + AR+VLQTQD++FSNRPAN +
Sbjct  1     MGMSGELNHRGLAALAKTYGGLFHMKMGRIHMVAVSTAEMAREVLQTQDHVFSNRPANNS  60

Query  432   ISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGS  611
             I YL+YDRADMAFAHYGPFWRQMRK+CV KLFSR+RA SW S R+E+D+ V+T+    GS
Sbjct  61    IRYLTYDRADMAFAHYGPFWRQMRKICVTKLFSRKRAGSWASAREEIDSFVKTLDSRVGS  120

Query  612   AVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCF  791
             +VN+GE + GLT+NITYRAAFGS    GQG         +FS   G  N++DFFP+L   
Sbjct  121   SVNVGETVLGLTKNITYRAAFGSVSRDGQG---------DFS---GLLNIADFFPWLGWM  168

Query  792   DLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFY  971
             + + LN RL  AR ALDGFIDKIIDDHI +  R+ N N+  E  G+  + DMVDEL+ FY
Sbjct  169   NGRDLNRRLTNARGALDGFIDKIIDDHINKKNRKCNNNNNSEEEGEVED-DMVDELMEFY  227

Query  972   SDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQ  1151
              +    N+ D   ++I +TRDNIK +IMDVMFGGTETVASAIEWAMAELMK+P++LK++Q
Sbjct  228   DENGNANN-DLKSSSISITRDNIKALIMDVMFGGTETVASAIEWAMAELMKSPQDLKKVQ  286

Query  1152  QELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARS  1331
             QEL + VG DRKV ESDLEKL + KC +KETLRLHPPIPLLLHETA    +NGY IPA +
Sbjct  287   QELAEVVGFDRKVNESDLEKLPYFKCVIKETLRLHPPIPLLLHETASEATINGYTIPAGA  346

Query  1332  RAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLY  1511
             R +IN WAI RD   W DPD F P RFL++G PDFKGSNFE+IPFGSGRRSCPGMQLGLY
Sbjct  347   RVMINVWAIGRDPTQWADPDKFDPSRFLEDGTPDFKGSNFEYIPFGSGRRSCPGMQLGLY  406

Query  1512  AFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
               EL VAHL H F WELPDGMKP++LDM+D+FGLTAP+A +LV +P  RLN  L
Sbjct  407   GLELTVAHLCHSFNWELPDGMKPNELDMNDLFGLTAPRAVQLVAVPKHRLNIPL  460



>emb|CDP05522.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/521 (59%), Positives = 380/521 (73%), Gaps = 34/521 (7%)
 Frame = +3

Query  117   VLEALEAHKHMVIYFVIPflflfllsrlrrKPYPPGPKGWPLIGNMNLMDHYSHRGLAKL  296
             +L  +   + M+I  ++  +FL+ LSR RRK +PPGPKG P IGNM + +  S  GLAKL
Sbjct  3     LLRQISDAETMLIIAIVTLVFLYFLSRFRRKNHPPGPKGLPFIGNMMIANQISQIGLAKL  62

Query  297   AEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMAFAH  476
             A QYGG+  +K+  L+ VVVS PD ARQVLQ QDNIFSNRPA +AISYL+Y+RADMAFA 
Sbjct  63    ANQYGGIFRVKLPFLNTVVVSSPDLARQVLQVQDNIFSNRPATIAISYLTYERADMAFAQ  122

Query  477   YGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGLTRNI  656
             YGP WRQMRKLCV+KLFS +RA SWD+VRDEVD+ +R +    G  VN+G+L F L+R I
Sbjct  123   YGPMWRQMRKLCVMKLFSSKRAASWDAVRDEVDDMIRVLDSRAGLPVNLGKLFFRLSRKI  182

Query  657   TYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAA  836
              YRAAFGS   + + QDEFI+ILQE S L  AFN++DF P+L   DLQG N RL  +RA+
Sbjct  183   IYRAAFGS--RTPERQDEFIQILQEISTLLNAFNLADFIPWLKWADLQGFNKRLISSRAS  240

Query  837   LDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYS-DEMKVNDSDDLQN  1013
             LD FID II+DH+      + KN  G  S D  E DMVDELLAF   DE KV ++ +LQ 
Sbjct  241   LDAFIDSIIEDHM-----EKKKNVNG--SFDQVEGDMVDELLAFMGDDEGKVTEAGNLQK  293

Query  1014  AIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVE  1193
             +++LT++N+K +IM+                       P +LKR+Q+EL + VGL RKV+
Sbjct  294   SLRLTKNNVKALIMN-----------------------PNDLKRVQEELANVVGLHRKVQ  330

Query  1194  ESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKN  1373
             ESD+ KLT+ K C KE LRLHPPIPLLLHET E +EV GY+IPA+SR ++N WAI R+K+
Sbjct  331   ESDMNKLTYFKSCFKEVLRLHPPIPLLLHETMEDSEVAGYHIPAKSRVMVNVWAIGRNKD  390

Query  1374  SW-EDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCF  1550
             +W ED D+FKP RFL  G PD+KGSNFEFIPFGSGRRSCPGMQLGL+A E+AVAHL HCF
Sbjct  391   TWGEDADTFKPSRFLSNGAPDYKGSNFEFIPFGSGRRSCPGMQLGLFAVEMAVAHLLHCF  450

Query  1551  TWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
              WELPDGMKPSD+D +DVFGL AP+A+RLV +PTPRL C L
Sbjct  451   QWELPDGMKPSDVDTNDVFGLAAPRASRLVAVPTPRLLCPL  491



>gb|ACG29306.1| cytochrome P450 CYP84A33v1 [Zea mays]
Length=526

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/492 (66%), Positives = 376/492 (76%), Gaps = 26/492 (5%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             ++GNM +MD  +HRGLA LAE+YGGLLHL++G LH   VS PD AR+VLQ QD  FSNRP
Sbjct  48    IVGNMAMMDQLTHRGLAALAERYGGLLHLRLGRLHAFAVSTPDYAREVLQAQDGAFSNRP  107

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVA-  596
             A +AI+YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSRRRAE+W +VRDE    VR VA 
Sbjct  108   ATIAIAYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRRRAETWVAVRDECAALVRAVAS  167

Query  597   --MNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDF  770
                  G AVN+GELIF LT+N+T+RAAFG+    G+ Q+EFI ILQEFSKLFGAFNV DF
Sbjct  168   GGGGGGEAVNLGELIFNLTKNVTFRAAFGT--RDGEDQEEFIAILQEFSKLFGAFNVVDF  225

Query  771   FPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMV  950
              P+LS  DLQG+N RL  AR+ALD FIDKIID+H+     RR KN       D A+ DMV
Sbjct  226   LPWLSWMDLQGINRRLRAARSALDRFIDKIIDEHV-----RRGKNP------DDADADMV  274

Query  951   DELLAFYSDE-------MKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
             D++LAF+++            D DDL N ++LTRDNIK IIMDVMFGGTETVASAIEWAM
Sbjct  275   DDMLAFFAEAKPPKKGPAAAADGDDLHNTLRLTRDNIKAIIMDVMFGGTETVASAIEWAM  334

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AE+M +P++L+RLQQEL D VGLDR V ESDL+KL FLKC +KETLRLHPPIPLLLHETA
Sbjct  335   AEMMHSPDDLRRLQQELADVVGLDRNVNESDLDKLPFLKCVIKETLRLHPPIPLLLHETA  394

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMP---DFKGSNFEFI  1460
                 V GY +P  SR ++N WAI R + SW+D D+F+P RF  EG     DFKG  FEF+
Sbjct  395   GDCVVGGYSVPRGSRVMVNVWAIGRHRASWKDADAFRPSRFTPEGEAAGLDFKGGCFEFL  454

Query  1461  PFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLV  1640
             PFGSGRRSCPG  LGLYA ELAVA L H F W LPDGMKPS+LDM DVFGLTAP+ATRL 
Sbjct  455   PFGSGRRSCPGTALGLYALELAVAQLAHGFNWSLPDGMKPSELDMGDVFGLTAPRATRLY  514

Query  1641  VIPTPRLNCQLH  1676
              +PTPRLNC L+
Sbjct  515   AVPTPRLNCPLY  526



>ref|XP_008664759.1| PREDICTED: cytochrome P450 84A1-like [Zea mays]
 tpg|DAA49325.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=526

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/492 (65%), Positives = 376/492 (76%), Gaps = 26/492 (5%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             ++GNM +MD  +HRGLA LAE+YGGLLHL++G LH   VS P+ AR+VLQ QD  FSNRP
Sbjct  48    IVGNMAMMDQLTHRGLAALAERYGGLLHLRLGRLHAFAVSTPEYAREVLQAQDGAFSNRP  107

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVA-  596
             A +AI+YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSRRRAE+W +VRDE    VR VA 
Sbjct  108   ATIAIAYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRRRAETWVAVRDECAALVRAVAS  167

Query  597   --MNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDF  770
                  G AVN+GELIF LT+N+T+RAAFG+    G+ Q+EFI ILQEFSKLFGAFNV DF
Sbjct  168   GGGGGGEAVNLGELIFNLTKNVTFRAAFGT--RDGEDQEEFIAILQEFSKLFGAFNVVDF  225

Query  771   FPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMV  950
              P+LS  DLQG+N RL  AR+ALD FIDKIID+H+     RR KN       D A+ DMV
Sbjct  226   LPWLSWMDLQGINRRLRAARSALDRFIDKIIDEHV-----RRGKNP------DDADADMV  274

Query  951   DELLAFYSDE-------MKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAM  1109
             D++LAF+++            D DDL N ++LTRDNIK IIMDVMFGGTETVASAIEWAM
Sbjct  275   DDMLAFFAEAKPPKKGPAAAADGDDLHNTLRLTRDNIKAIIMDVMFGGTETVASAIEWAM  334

Query  1110  AELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETA  1289
             AE+M +P++L+RLQQEL D VGLDR V ESDL+KL FLKC +KETLRLHPPIPLLLHETA
Sbjct  335   AEMMHSPDDLRRLQQELADVVGLDRNVNESDLDKLPFLKCVIKETLRLHPPIPLLLHETA  394

Query  1290  EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMP---DFKGSNFEFI  1460
                 V GY +P  SR ++N WAI R + SW+D D+F+P RF  EG     DFKG  FEF+
Sbjct  395   GDCVVGGYSVPRGSRVMVNVWAIGRHRASWKDADAFRPSRFTPEGEAAGLDFKGGCFEFL  454

Query  1461  PFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLV  1640
             PFGSGRRSCPG  LGLYA ELAVA L H F W LPDGMKPS+LDM DVFGLTAP+ATRL 
Sbjct  455   PFGSGRRSCPGTALGLYALELAVAQLAHGFNWSLPDGMKPSELDMGDVFGLTAPRATRLY  514

Query  1641  VIPTPRLNCQLH  1676
              +PTPRLNC L+
Sbjct  515   AVPTPRLNCPLY  526



>ref|XP_009403617.1| PREDICTED: cytochrome P450 84A1-like [Musa acuminata subsp. malaccensis]
Length=511

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/481 (60%), Positives = 349/481 (73%), Gaps = 16/481 (3%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM +MD  +HRGLA+LAE+YGGL HL++GSLH VVVS P+ AR VLQ QD  F NRP
Sbjct  43    IIGNMLMMDQLTHRGLARLAERYGGLFHLRLGSLHAVVVSTPEMARLVLQVQDASFCNRP  102

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
                AI+YL+YDRADMAFA+YGPFWRQ RKLCV+KLFSRRR +SW SVR EVD+ VR  A 
Sbjct  103   VTAAIAYLTYDRADMAFANYGPFWRQTRKLCVMKLFSRRRLQSWASVRQEVDSAVRFAAR  162

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
               GS+V++G+L F L +N+T+ AAFG+     QG  EF  ILQE+SKLFG FN+SDF P+
Sbjct  163   RSGSSVDVGDLAFTLAKNVTFMAAFGAQSHGNQG--EFAGILQEYSKLFGEFNISDFLPW  220

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             L   DLQG++ RL  AR A+D +ID IIDDH+   +             D  + DMVD +
Sbjct  221   LRWMDLQGIDKRLKVARQAIDRYIDVIIDDHLANPK-----------EADAQDADMVDGM  269

Query  960   LAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENL  1139
             LAF  D    N+  DL   + LTR NIK IIMDVMFGGTETVA  IEWAMAEL+K+PE L
Sbjct  270   LAFLGDSGDTNEGGDLHGDLSLTRSNIKAIIMDVMFGGTETVALGIEWAMAELLKSPEEL  329

Query  1140  KRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYI  1319
             KR QQEL   VGL RKV++SDL+KL +LKC +KE LRLHPP+PLL H+  +  E+ GY+I
Sbjct  330   KRTQQELASVVGLHRKVDDSDLDKLPYLKCAVKEMLRLHPPLPLLQHQATQDCELAGYFI  389

Query  1320  PARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMP---DFKGSNFEFIPFGSGRRSCP  1490
             P  +R  +NAW I RD+++W+ P++F+P RF   G     DF+GS FE +PFGSGRRSCP
Sbjct  390   PVGTRVFVNAWGIGRDRDAWKSPNAFRPSRFALGGDAAAFDFRGSCFELLPFGSGRRSCP  449

Query  1491  GMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQ  1670
             GMQLGLY  ELAVA L HCF W LP G KP DLDM DVFGLTAPKA RL+ +PTPRL C 
Sbjct  450   GMQLGLYVLELAVAQLLHCFDWSLPAGTKPGDLDMGDVFGLTAPKAVRLMAVPTPRLTCP  509

Query  1671  L  1673
             L
Sbjct  510   L  510



>ref|XP_004982626.1| PREDICTED: cytochrome P450 84A1-like [Setaria italica]
Length=523

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/488 (67%), Positives = 378/488 (77%), Gaps = 22/488 (5%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM +MD  +HRGLA LAEQYGGLLHL++G LH   VS P+ AR+VLQ QD  FSNRP
Sbjct  49    IIGNMTMMDQLTHRGLAALAEQYGGLLHLRLGRLHAFAVSTPEYAREVLQVQDGAFSNRP  108

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +AI+YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSRRRAE+W +VRDE    VR VA 
Sbjct  109   ATIAIAYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRRRAETWVAVRDEAAALVRAVAS  168

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
             + G AVN+GELIF LT+N+ +RAAFG+    G GQDEFI ILQEFSKLFGAFN+ DF P+
Sbjct  169   SGGEAVNLGELIFNLTKNVIFRAAFGT--RDGGGQDEFIAILQEFSKLFGAFNIGDFIPW  226

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             LS  D QG+N RL  ARAALD FIDKIID+H+     +R K      S D A+ DMVD++
Sbjct  227   LSWMDPQGINRRLRAARAALDRFIDKIIDEHM-----KRGK------SPDDADADMVDDM  275

Query  960   LAFYSDEMKVN------DSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELM  1121
             LAF ++    N      D DDLQ+ ++LTRDNIK IIMDVMFGGTETVASAIEWAMAE+M
Sbjct  276   LAFLAEAKPANKSAAGGDVDDLQSTLRLTRDNIKAIIMDVMFGGTETVASAIEWAMAEMM  335

Query  1122  KTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATE  1301
              +P++L+RLQQEL D VG DR V ESDL+KL FL+C +KETLRLHPPIPLLLHETAE   
Sbjct  336   HSPDDLRRLQQELADVVGYDRNVSESDLDKLPFLRCVIKETLRLHPPIPLLLHETAEDCV  395

Query  1302  VNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMP---DFKGSNFEFIPFGS  1472
             V GY +P  SR +IN WAI RD+ SW+D D F+P RF  EG     DFKG  FEF+PFGS
Sbjct  396   VGGYSVPKGSRVMINVWAIGRDRGSWKDADVFRPSRFAPEGEAAGLDFKGGCFEFLPFGS  455

Query  1473  GRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPT  1652
             GRRSCPGM LGLYA ELAVA L H F+W LPDGMKPS+LDM D+FGLTAP+ATRL  +PT
Sbjct  456   GRRSCPGMALGLYALELAVAQLAHGFSWSLPDGMKPSELDMGDIFGLTAPRATRLYAVPT  515

Query  1653  PRLNCQLH  1676
             PRLNC L+
Sbjct  516   PRLNCPLY  523



>emb|CBI17416.3| unnamed protein product [Vitis vinifera]
Length=409

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/482 (60%), Positives = 334/482 (69%), Gaps = 115/482 (24%)
 Frame = +3

Query  228   KGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIF  407
             KG PLIG+MN+MD  +HRGLAK+A+QY                                 
Sbjct  42    KGLPLIGSMNMMDQLTHRGLAKIAKQY---------------------------------  68

Query  408   SNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVR  587
                             ADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVR+EV++TVR
Sbjct  69    ----------------ADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVREEVESTVR  112

Query  588   TVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSD  767
             TVA + GS VNIGEL+F LT+NI YRAAFG+S  S +GQDEFI ILQEFSKLFGAFN++D
Sbjct  113   TVASSIGSPVNIGELVFTLTKNIIYRAAFGTS--SKEGQDEFISILQEFSKLFGAFNIAD  170

Query  768   FFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDM  947
             F P+LS  D QGLN RLAKAR +LD                            D  +TDM
Sbjct  171   FIPWLSWVDPQGLNARLAKARKSLD----------------------------DEVDTDM  202

Query  948   VDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKT  1127
             VD+LLAFYS+E KVN+S+DLQNAI+LTRDNIK IIMDVMFGGTETVASAIEWAMAE+MK+
Sbjct  203   VDDLLAFYSEEAKVNESEDLQNAIELTRDNIKAIIMDVMFGGTETVASAIEWAMAEMMKS  262

Query  1128  PENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVN  1307
             PE+LK++QQEL D VGL+R+VEESDLEKLT+LK                           
Sbjct  263   PEDLKKVQQELADVVGLNRRVEESDLEKLTYLKV--------------------------  296

Query  1308  GYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSC  1487
                       +INAWAI RDKNSW++P++FKP RFLK G+PDFKGSNFEFIPFGSGRRSC
Sbjct  297   ----------MINAWAIGRDKNSWDEPETFKPSRFLKAGVPDFKGSNFEFIPFGSGRRSC  346

Query  1488  PGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNC  1667
             PGMQLGLYA ELAV HL HCFTWELPDGMKPS+LDM DVFGLTAP+ATRLV +P+PRL C
Sbjct  347   PGMQLGLYALELAVVHLLHCFTWELPDGMKPSELDMGDVFGLTAPRATRLVAVPSPRLEC  406

Query  1668  QL  1673
              L
Sbjct  407   PL  408



>gb|KFK24882.1| hypothetical protein AALP_AA8G037000 [Arabis alpina]
Length=465

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/476 (62%), Positives = 363/476 (76%), Gaps = 17/476 (4%)
 Frame = +3

Query  258   LMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAIS  437
             +M+H++HRGLAKL+ +YGGLLHL+ G  H+ VVS PD ARQVLQ QD +FSNRP   AI 
Sbjct  1     MMNHFNHRGLAKLSRKYGGLLHLRFGFSHIFVVSSPDIARQVLQVQDQVFSNRPTTNAIR  60

Query  438   YLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAV  617
             YL+Y  +D+AF +YGPFWR+MRKL V+ LFSR+RAESW SV +EV  +VR VA+N G  +
Sbjct  61    YLTYGSSDLAFCNYGPFWRRMRKLYVMMLFSRKRAESWTSVDEEVHKSVRFVAVNLGKPL  120

Query  618   NIGELIFGLTRNITYRAAFGSSPS-SGQGQ-DEFIKILQEFSKLFGAFNVSDFFP-FLSC  788
             NIG+L F LTR+I +RAAFGSS S S +G+ +EF++I+QEFSKLFG FNV+D+ P +LS 
Sbjct  121   NIGKLAFSLTRDIIFRAAFGSSSSISDEGRLNEFLEIIQEFSKLFGEFNVADYVPSWLSW  180

Query  789   FDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAF  968
              D QG+N RL KAR +LD FI+ II+DH+ + +        GE + D  +TDMVD+LLAF
Sbjct  181   IDPQGINGRLEKARKSLDSFIESIINDHLHKQK--------GEHNVDDEDTDMVDQLLAF  232

Query  969   YSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRL  1148
             Y +E K+NDS+      K+  DNIKGIIMDVMFGGTETVA AIEW + EL+++PEN+KR+
Sbjct  233   YKEEDKINDSE-----TKINLDNIKGIIMDVMFGGTETVALAIEWVLTELLRSPENMKRV  287

Query  1149  QQELTDTVGLDR-KVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPA  1325
             Q EL   VGLDR +VE++ LEKLTFLKC LKETLRLHPP PLLLHET E  E+ GY+IP 
Sbjct  288   QNELASVVGLDRWRVEDTHLEKLTFLKCVLKETLRLHPPFPLLLHETVEDAEITGYFIPK  347

Query  1326  RSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLG  1505
              SR +IN  A+ RD +SW DP+ F P RFL  G PD KG+NFEF+PFGSGRRSCPGMQLG
Sbjct  348   GSRVMINTHALGRDPDSWSDPEIFNPGRFLDPGAPDLKGNNFEFLPFGSGRRSCPGMQLG  407

Query  1506  LYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             +YAFEL VAHL HCF W LPDGMK  D+D D+  GLT PKAT LV +PT RL C +
Sbjct  408   MYAFELTVAHLLHCFAWSLPDGMKSGDVDTDEGPGLTVPKATPLVAVPTTRLLCPI  463



>ref|NP_001065043.1| Os10g0512400 [Oryza sativa Japonica Group]
 gb|ABG66184.1| Cytochrome P450 84A1, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26957.1| Os10g0512400 [Oryza sativa Japonica Group]
Length=530

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/497 (62%), Positives = 372/497 (75%), Gaps = 32/497 (6%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             ++GNM +MD  +HRGLA LA++YGGL+HL++G LH   VS P+ AR+VLQ QD  FSNRP
Sbjct  48    IVGNMAMMDQLTHRGLAALAKEYGGLMHLRLGRLHAFAVSTPEYAREVLQAQDGAFSNRP  107

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A  AI+YL+YDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAE+W +VRDE    VR VA 
Sbjct  108   ATTAIAYLTYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAETWLAVRDESAALVRAVAA  167

Query  600   NCG-SAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFP  776
             + G +AVN+GELIF LT+N+ +RAAFG+    G+G DEFI ILQEFSKLFGAFN+ DF P
Sbjct  168   SRGEAAVNLGELIFNLTKNVIFRAAFGT--RDGEGHDEFIAILQEFSKLFGAFNIGDFIP  225

Query  777   FLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDE  956
             +LS  D  G+N RL  AR ALD FIDKIID+H+      R KN       D A+ DMVD+
Sbjct  226   WLSWADTNGINARLVAARTALDRFIDKIIDEHM-----ERGKNP------DDADADMVDD  274

Query  957   LLAFYSDE------------MKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIE  1100
             +LAF ++                + +DDLQN ++LTRDNIK IIMDVMFGGTETVASAIE
Sbjct  275   MLAFLAEAKPHAGKAAAAAAGAGDGADDLQNTLRLTRDNIKAIIMDVMFGGTETVASAIE  334

Query  1101  WAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllh  1280
             WAMAE+M +P++L+R+Q+EL   VGL R V ESDL+KL FL+C +KETLRLHPPIP+LLH
Sbjct  335   WAMAEMMHSPDDLRRVQEELAAVVGLGRDVAESDLDKLPFLRCVIKETLRLHPPIPILLH  394

Query  1281  ETAEATEVNGYYIPARSRAIINAWAIARDKNSW-EDPDSFKPDRF----LKEGMPDFKGS  1445
             ETA    V GY +P  SR ++N WAIARD+ +W  D D+F+P RF      EG+ DF+G 
Sbjct  395   ETAADCLVAGYSVPRGSRVMVNVWAIARDRAAWGPDADAFRPSRFAAGAAAEGL-DFRGG  453

Query  1446  NFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPK  1625
              FEF+PFGSGRRSCPGM LGLYA ELAVA L H F W LPDGMKPS+LDM D+FGLTAP+
Sbjct  454   CFEFLPFGSGRRSCPGMALGLYALELAVARLAHGFNWSLPDGMKPSELDMSDIFGLTAPR  513

Query  1626  ATRLVVIPTPRLNCQLH  1676
             ATRL  + TPRL C L+
Sbjct  514   ATRLSAVATPRLTCPLY  530



>gb|ACG29763.1| cytochrome P450 CYP84A34 [Zea mays]
Length=531

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/497 (62%), Positives = 369/497 (74%), Gaps = 13/497 (3%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             P PPGP+  P++GNM +MD  +HRGLA LAE YGGLLHL++G LH   VS P+ AR+VLQ
Sbjct  40    PLPPGPQALPIVGNMGMMDQLTHRGLAALAETYGGLLHLRLGRLHAFAVSTPEYAREVLQ  99

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QD  FSNRPA  AI+YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSRRRAE+W +VRDE
Sbjct  100   AQDGAFSNRPATAAIAYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRRRAETWAAVRDE  159

Query  570   V----DNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFS  737
                             G AVN+GELIF LT+N+T+RAAFG+    G+GQ+EFI ILQEFS
Sbjct  160   CAALVRAVAVGGGGGRGEAVNLGELIFSLTKNVTFRAAFGT--RDGEGQEEFIAILQEFS  217

Query  738   KLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGE  917
             KLFGAFNV DF P+L   DLQG+N RL  AR+ALD FIDKIID+H+   RR ++ +    
Sbjct  218   KLFGAFNVGDFLPWLGWMDLQGINRRLRAARSALDRFIDKIIDEHV---RRGKSPDDADA  274

Query  918   VSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAI  1097
                D      V+      +     +  DDL N ++LTRDNIK IIMDVMFGGTETVASAI
Sbjct  275   DMVDDMLAFFVEATPGKATGAAAADGGDDLHNTLRLTRDNIKAIIMDVMFGGTETVASAI  334

Query  1098  EWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplll  1277
             EWAMAE+M +P++L+R+QQEL D VGLDR V ESDL++L FL+C +KETLRLHPPIPLLL
Sbjct  335   EWAMAEMMHSPDDLRRVQQELADVVGLDRNVSESDLDRLPFLRCVIKETLRLHPPIPLLL  394

Query  1278  hETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFL-KEGMP---DFKGS  1445
             HETA+   V GY +P  SR ++N WAI R + SW+D D+F+P RF   EG     DFKG 
Sbjct  395   HETADDCVVAGYSVPRGSRVMVNVWAIGRHRASWKDADAFRPSRFAPPEGEAAGLDFKGG  454

Query  1446  NFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPK  1625
              FEF+PFGSGRRSCPGM LGLYA ELAVA L H F W LPDG+KPS++DM D+FGLTAP+
Sbjct  455   CFEFLPFGSGRRSCPGMALGLYALELAVAQLAHAFNWSLPDGIKPSEMDMSDIFGLTAPR  514

Query  1626  ATRLVVIPTPRLNCQLH  1676
             ATRL  +PTPRLNC L+
Sbjct  515   ATRLYAVPTPRLNCPLY  531



>emb|CAC26920.1| ferulate-5-hydroxylase [Arabidopsis lyrata subsp. petraea]
Length=453

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/414 (69%), Positives = 346/414 (84%), Gaps = 8/414 (2%)
 Frame = +3

Query  234   WPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSN  413
             WP+IGNM +MD  +HRGLA LA++YGGL HL+MG LHM  VS PD ARQVLQ QD++FSN
Sbjct  47    WPIIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPDVARQVLQVQDSVFSN  106

Query  414   RPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTV  593
             RPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V
Sbjct  107   RPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSV  166

Query  594   AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFF  773
             + N G  +N+GE IF LTRNITYRAAFGS  +  +GQDEFI+ILQEFSKLFGAFNV+DF 
Sbjct  167   SCNVGKPINVGEHIFALTRNITYRAAFGS--ACEKGQDEFIRILQEFSKLFGAFNVADFI  224

Query  774   PFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVD  953
             P+    D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  +TDMVD
Sbjct  225   PYFGWIDPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNAVDDGDVVDTDMVD  279

Query  954   ELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTP  1130
             +LLAFYS+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++P
Sbjct  280   DLLAFYSEEAKLVSEAADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSP  339

Query  1131  ENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNG  1310
             E+LKR+QQEL + VGLDR+VEE+D+EKLT+LKC LKETLR+HPPIPLLLHETAE T ++G
Sbjct  340   EDLKRVQQELAEVVGLDRRVEEADIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTSIDG  399

Query  1311  YYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGS  1472
             ++IP +SR +INA+AI RD  SW DPD+F+P RFL+ G+PDFKGSNFEFIPFGS
Sbjct  400   FFIPKKSRVMINAFAIGRDPTSWADPDTFRPSRFLEPGVPDFKGSNFEFIPFGS  453



>gb|ABC59101.1| cytochrome P450 monooxygenase CYP84A17 [Medicago truncatula]
Length=442

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/422 (69%), Positives = 333/422 (79%), Gaps = 16/422 (4%)
 Frame = +3

Query  147   MVIYFVIPflflfllsrlrrKP--YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLL  320
             M I F++P + L  L     K   YPPGP G P+IGNM +MD  +HRGLA LA++YGG+ 
Sbjct  20    MAIMFIVPLILLLGLVSRILKRPRYPPGPIGLPIIGNMLMMDQLTHRGLANLAKKYGGIF  79

Query  321   HLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQM  500
             HL+MG LHMV +S  D ARQVLQ QDNIFSNRPA VAI YL+YDRADMAFAHYGPFWRQM
Sbjct  80    HLRMGFLHMVAISDADAARQVLQVQDNIFSNRPATVAIKYLTYDRADMAFAHYGPFWRQM  139

Query  501   RKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGS  680
             RKLCV+KLFSR+ AESW SVRDEVD  VRTV+ N G+ VNIGEL+F LT+NI YRAAFGS
Sbjct  140   RKLCVMKLFSRKHAESWQSVRDEVDYAVRTVSDNIGNPVNIGELVFNLTKNIIYRAAFGS  199

Query  681   SPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKI  860
               SS +GQDEFI ILQEFSKLFGAFN+SDF P     D QGLN RL KAR  LD FIDKI
Sbjct  200   --SSREGQDEFIGILQEFSKLFGAFNISDFVPCFGAIDPQGLNARLVKARKELDSFIDKI  257

Query  861   IDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKV-NDSDDLQNAIKLTRDN  1037
             ID+H+ + +           S    ETDMVDELLAFYS+E K+ N+SDDL N+IKLT+DN
Sbjct  258   IDEHVQKKK-----------SVVDEETDMVDELLAFYSEEAKLNNESDDLNNSIKLTKDN  306

Query  1038  IKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLT  1217
             IK IIMDVMFGGTETVASAIEWAMAELMK+PE+LK++QQEL + VGL R+VEESD EKLT
Sbjct  307   IKAIIMDVMFGGTETVASAIEWAMAELMKSPEDLKKVQQELAEVVGLSRQVEESDFEKLT  366

Query  1218  FLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSF  1397
             +LKC LKETLRLHPPIPLLLHETAE   VNGY+IP ++R +INAWAI RD N WE+P SF
Sbjct  367   YLKCALKETLRLHPPIPLLLHETAEEATVNGYFIPKQARVMINAWAIGRDANCWEEPQSF  426

Query  1398  KP  1403
             KP
Sbjct  427   KP  428



>ref|XP_002464383.1| hypothetical protein SORBIDRAFT_01g017270 [Sorghum bicolor]
 gb|EER91381.1| hypothetical protein SORBIDRAFT_01g017270 [Sorghum bicolor]
Length=529

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/495 (64%), Positives = 376/495 (76%), Gaps = 29/495 (6%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             ++GNM +MD  +HRGLA LA++YGGLLHL++G LH   VS P+ AR+VLQT D +FSNRP
Sbjct  48    IVGNMAMMDQLTHRGLAALADKYGGLLHLRLGRLHAFAVSTPEYAREVLQTHDGVFSNRP  107

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +AI+YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSRRRAE+W +VRDE    VR VA 
Sbjct  108   ATIAIAYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRRRAETWVAVRDECAALVRAVAT  167

Query  600   NCG-SAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFP  776
             + G  AVN+GELIF LT+N+T+RAAFG+    G+ Q+EFI ILQEFSKLFGAFN+ DF P
Sbjct  168   SGGEKAVNLGELIFTLTKNVTFRAAFGT--RDGEDQEEFIAILQEFSKLFGAFNIGDFLP  225

Query  777   FLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDE  956
             +L   DLQG+N RL  AR+ALD FIDKIID+H+     +R K      S D A+ DMVD+
Sbjct  226   WLGWMDLQGINRRLRAARSALDRFIDKIIDEHV-----KRGK------SPDDADADMVDD  274

Query  957   LLAFYSDE-------MKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAE  1115
             +LAF+++            + DDLQN ++LTRDNIK IIMDVMFGGTETVASAIEWAMAE
Sbjct  275   MLAFFAEAKPAAVNGGAAANGDDLQNTLRLTRDNIKAIIMDVMFGGTETVASAIEWAMAE  334

Query  1116  LMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAE-  1292
             +M +P++L+R+QQEL D VGLDR V ESDL+KL FLKC +KETLRLHPPIPLLLHETA+ 
Sbjct  335   MMHSPDDLRRVQQELADVVGLDRNVNESDLDKLPFLKCVIKETLRLHPPIPLLLHETADD  394

Query  1293  ----ATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMP---DFKGSNF  1451
                       Y +P  SR +IN WAI R + SW+D D F+P RF  +G     DFKG  F
Sbjct  395   CVVGGGGGRRYSVPRGSRVMINVWAIGRHRGSWKDADVFRPSRFTPDGDAAGLDFKGGCF  454

Query  1452  EFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKAT  1631
             EF+PFGSGRRSCPG  LGLYA ELAVA L H F W LPDGMKPS+LDM DVFGLTAP+AT
Sbjct  455   EFLPFGSGRRSCPGTALGLYALELAVAQLAHGFNWSLPDGMKPSELDMSDVFGLTAPRAT  514

Query  1632  RLVVIPTPRLNCQLH  1676
             RL  +PTPRLNC L+
Sbjct  515   RLYAVPTPRLNCPLY  529



>ref|XP_009411495.1| PREDICTED: cytochrome P450 84A1 [Musa acuminata subsp. malaccensis]
Length=515

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/485 (59%), Positives = 363/485 (75%), Gaps = 23/485 (5%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM LM+  +HRGLA+LA+ YGGLLHL++G +H  VVS PD ARQVLQ QD++FS+RP
Sbjct  48    IIGNMLLMNQLTHRGLARLAKLYGGLLHLRLGFVHHFVVSTPDVARQVLQVQDSVFSDRP  107

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A  AI YL+Y+R+D+AFA  GP+WRQMRKLCV KLFSR+ AESW S+ +EVD  V TVA 
Sbjct  108   ATTAIVYLTYNRSDLAFAQCGPYWRQMRKLCVTKLFSRKHAESWLSIPEEVDAAVCTVAK  167

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
             + GSA N+ +L F LT+NI +R+AFG    S + Q+E+I ++QE + L GAF+V DF P+
Sbjct  168   HAGSAFNVRDLAFTLTKNIVFRSAFGK--RSDENQEEYIAVVQEIATLLGAFSVGDFIPW  225

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             LS  D QG+N RL  ARA LD FID+IID+H+               + D A  DMV  +
Sbjct  226   LSWMDPQGINKRLRVARATLDLFIDRIIDEHM---------------ATDAANADMVGVM  270

Query  960   LAFY---SDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTP  1130
             LAF    S   +  + DDL+  ++L+R NI+ ++MDVMFGGTETVA AIEWA+A+L+ +P
Sbjct  271   LAFLEESSHHHRQEEGDDLKGTLRLSRANIRAVMMDVMFGGTETVAIAIEWALADLLTSP  330

Query  1131  ENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNG  1310
             ++LKR+Q+EL   VGLDRKV ES L+KL+FLKC +KETLRLHPP PLLLH+TA+  EV G
Sbjct  331   DDLKRVQEELAMVVGLDRKVHESHLDKLSFLKCAIKETLRLHPPFPLLLHQTADHCEVAG  390

Query  1311  YYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEG---MPDFKGSNFEFIPFGSGRR  1481
             Y IPARS  +IN WAI RD+++W+D D+++P RF   G     DFKG+ FEF+PFGSGRR
Sbjct  391   YSIPARSPVMINVWAIGRDESAWKDADAYRPSRFAPGGDAAALDFKGNCFEFLPFGSGRR  450

Query  1482  SCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRL  1661
             SCPGMQLG++  ELAVA L HCFTW LPDGMKP++LDM DVFGL+APKA  LV +PTPRL
Sbjct  451   SCPGMQLGMHELELAVAQLLHCFTWALPDGMKPTELDMGDVFGLSAPKAVPLVAVPTPRL  510

Query  1662  NCQLH  1676
             +C L+
Sbjct  511   SCPLN  515



>emb|CDY22397.1| BnaA06g37190D [Brassica napus]
Length=484

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/484 (60%), Positives = 356/484 (74%), Gaps = 40/484 (8%)
 Frame = +3

Query  228   KGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIF  407
             KG+P+IGNM L +  +HRGLA+LA+QYGGLLHL+MG +H+V  S  + AR++LQ QD +F
Sbjct  36    KGYPIIGNMKLKNQLNHRGLAELAKQYGGLLHLQMGRIHIVAASTAEMAREILQVQDVVF  95

Query  408   SNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVR  587
             +NRPANVAISYL+Y+RADMAFA+YGP WRQMRK+CV+KLFSR+RAESW SVRDE++  V+
Sbjct  96    ANRPANVAISYLTYNRADMAFANYGPLWRQMRKVCVMKLFSRKRAESWASVRDEINTMVQ  155

Query  588   TVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSD  767
             T+    GS VN+GEL+F LTRNITYRAAFGS   +  GQDEF+KILQEFSKLFGAF++++
Sbjct  156   TLTKQTGSPVNVGELVFALTRNITYRAAFGS--FARDGQDEFVKILQEFSKLFGAFDITE  213

Query  768   FFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDM  947
             F P++  F  +  + RL  AR +LDGFID+IID HI +   R+  +       DG E DM
Sbjct  214   FLPWMKWFSNRDFSERLENARKSLDGFIDRIIDAHIEKKNSRKQDD-------DGLEDDM  266

Query  948   VDELLAFYSDEMKVN--DSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELM  1121
             VDEL+AFYS E   N   S D  ++ KLTRDNIK ++MDVMFGGTETVASAIEWAM ELM
Sbjct  267   VDELMAFYSVESGENGGKSTDSLSSFKLTRDNIKALVMDVMFGGTETVASAIEWAMTELM  326

Query  1122  KTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATE  1301
             K P  L +LQQEL D +GL+R+  ESDLE L + +C +KETLRLHPPIPLLLHE A    
Sbjct  327   KNPHELVKLQQELADVIGLNREFHESDLENLPYFRCAMKETLRLHPPIPLLLHEAAA---  383

Query  1302  VNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRR  1481
                                       + PD+F+P RF+    PDFKGS+FEF+PFGSGRR
Sbjct  384   --------------------------DSPDAFRPGRFMDSKAPDFKGSDFEFLPFGSGRR  417

Query  1482  SCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRL  1661
             SCPGMQLGLYA ELAVAH+ H F WELP+G+   DLDM D+FGLTAP+ATRL+ +P+ RL
Sbjct  418   SCPGMQLGLYAMELAVAHMLHSFDWELPEGVSADDLDMTDMFGLTAPRATRLIAVPSYRL  477

Query  1662  NCQL  1673
              C +
Sbjct  478   KCPM  481



>ref|NP_001141478.1| putative cytochrome P450 superfamily protein [Zea mays]
 gb|ACF86452.1| unknown [Zea mays]
 gb|AFW68401.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=532

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/495 (64%), Positives = 374/495 (76%), Gaps = 29/495 (6%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             ++GNM +MD  +HRGLA LAE YGGLLHL++G LH   VS P+ AR+VLQ QD  FSNRP
Sbjct  51    IVGNMGMMDQLTHRGLAALAETYGGLLHLRLGRLHAFAVSTPEYAREVLQAQDGAFSNRP  110

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVR---T  590
             A  AI+YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSRRRAE+W +VRDE    VR    
Sbjct  111   ATAAIAYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRRRAETWAAVRDECAALVRAVAV  170

Query  591   VAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDF  770
                + G AVN+GELIF LT+N+T+RAAFG+    G+GQ+EFI ILQEFSKLFGAFNV DF
Sbjct  171   GGGSGGEAVNLGELIFSLTKNVTFRAAFGT--RDGEGQEEFIAILQEFSKLFGAFNVGDF  228

Query  771   FPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMV  950
              P+L   DLQG+N RL  AR+ALD FIDKIID+H+     RR K      S D A+ DMV
Sbjct  229   LPWLGWMDLQGINRRLRAARSALDRFIDKIIDEHV-----RRGK------SPDDADADMV  277

Query  951   DELLAFYSDEMKVNDS---------DDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEW  1103
             D++LAF+ +      +         DDL N ++LTRDNIK IIMDVMFGGTETVASAIEW
Sbjct  278   DDMLAFFVEATPGKATGAAAAADGGDDLHNTLRLTRDNIKAIIMDVMFGGTETVASAIEW  337

Query  1104  AMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhE  1283
             AMAE+M +P++L+R+QQEL D VGLDR V ESDL++L FL+C +KETLRLHPPIPLLLHE
Sbjct  338   AMAEMMHSPDDLRRVQQELADVVGLDRNVSESDLDRLPFLRCVIKETLRLHPPIPLLLHE  397

Query  1284  TAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLK-EGMP---DFKGSNF  1451
             TA+   V GY +P  SR ++N WAI R + SW+D D+F+P RF   EG     DFKG  F
Sbjct  398   TADDCVVAGYSVPRGSRVMVNVWAIGRHRASWKDADAFRPSRFAAPEGEAAGLDFKGGCF  457

Query  1452  EFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKAT  1631
             EF+PFGSGRRSCPGM LGLYA ELAVA L H F W LPDGMKPS++DM D+FGLTAP+AT
Sbjct  458   EFLPFGSGRRSCPGMALGLYALELAVAQLAHAFNWSLPDGMKPSEMDMGDIFGLTAPRAT  517

Query  1632  RLVVIPTPRLNCQLH  1676
             RL  +PTPRLNC L+
Sbjct  518   RLYAVPTPRLNCPLY  532



>gb|ACG29136.1| cytochrome P450 CYP84A33v2 [Zea mays]
Length=532

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/487 (62%), Positives = 362/487 (74%), Gaps = 13/487 (3%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             ++GNM +MD  +HRGLA LAE YGGLLHL++G LH   VS P+ AR+VLQ QD  FSNRP
Sbjct  51    IVGNMGMMDQLTHRGLAALAETYGGLLHLRLGRLHAFAVSTPEYAREVLQAQDGAFSNRP  110

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEV----DNTVR  587
             A  AI+YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSRRRAE+W +VRDE          
Sbjct  111   ATAAIAYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRRRAETWAAVRDECAALVRAVAV  170

Query  588   TVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSD  767
                   G AVN+GELIF LT+N+T+RAAFG+    G+GQ+EFI ILQEFSKLFGAFNV D
Sbjct  171   GGGGGRGEAVNLGELIFSLTKNVTFRAAFGT--RDGEGQEEFIAILQEFSKLFGAFNVGD  228

Query  768   FFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDM  947
             F P+L   DLQG+N RL  AR+ALD FIDKIID+H+   RR ++ +       D      
Sbjct  229   FLPWLGWMDLQGINRRLRAARSALDRFIDKIIDEHV---RRGKSPDDADADMVDDMLAFF  285

Query  948   VDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKT  1127
             V+      +     +  DDL N ++LTRDNIK IIMDVMFGGTETVASAIEWAMAE+M +
Sbjct  286   VEATPGKATGAAAADGGDDLHNTLRLTRDNIKAIIMDVMFGGTETVASAIEWAMAEMMHS  345

Query  1128  PENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVN  1307
             P++L+R+QQEL D VGLDR V ESDL++L FL+C +KETLRLHPPIPLLLHETA+   V 
Sbjct  346   PDDLRRVQQELADVVGLDRNVSESDLDRLPFLRCVIKETLRLHPPIPLLLHETADDCVVA  405

Query  1308  GYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFL-KEGMP---DFKGSNFEFIPFGSG  1475
             GY +P  SR ++N WAI R + SW+D D+F+P RF   EG     DFKG  FEF+PFGSG
Sbjct  406   GYSVPRGSRVMVNVWAIGRHRASWKDADAFRPSRFAPPEGEAAGLDFKGGCFEFLPFGSG  465

Query  1476  RRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTP  1655
             RRSCPGM LGLYA ELAVA L H F W LPDGMKPS++DM D+FGLTAP+ATRL  +PTP
Sbjct  466   RRSCPGMALGLYALELAVAQLAHGFNWSLPDGMKPSEMDMADIFGLTAPRATRLYAVPTP  525

Query  1656  RLNCQLH  1676
             RLNC L+
Sbjct  526   RLNCPLY  532



>emb|CDM81337.1| unnamed protein product [Triticum aestivum]
Length=535

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/487 (61%), Positives = 366/487 (75%), Gaps = 20/487 (4%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             ++GNM++MD  +HRGL  LA++YGG LHL++G +H   VS P+ A++VLQ QD  FSNRP
Sbjct  50    IVGNMSMMDQLTHRGLTALAKKYGGFLHLRLGKVHAFAVSTPEYAQEVLQVQDAAFSNRP  109

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A++A +YL+YDRADMAFAH+GPFWRQMRKLCV+KLFSRRR E+W +VR+E    VR VA 
Sbjct  110   ASLAATYLTYDRADMAFAHHGPFWRQMRKLCVMKLFSRRRPETWLAVRNESAALVRAVAR  169

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQG-QDEFIKILQEFSKLFGAFNVSDFFP  776
               G  VN+GELIF L +N+T+RAAFG+  +   G Q+EFI ILQEFSKLF  F + DF P
Sbjct  170   RSGETVNLGELIFNLAKNVTFRAAFGAGAAGDAGKQEEFIAILQEFSKLFVEFCIGDFIP  229

Query  777   FLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDE  956
             +LS  D QG+N RL  ARAALD FIDKIID+H+   +R RN +          + DMVD+
Sbjct  230   WLSWADPQGINVRLRAARAALDQFIDKIIDEHM---KRGRNPDD--------VDADMVDD  278

Query  957   LLAFY----SDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMK  1124
             +LAF     + +   +  DDLQN ++LTRDNIK +IMDVMFGGTETVASAIEWAM+E+M 
Sbjct  279   MLAFLPEARTKKAAGDRGDDLQNTLRLTRDNIKAMIMDVMFGGTETVASAIEWAMSEMMH  338

Query  1125  TPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEV  1304
              P++L+RLQQEL DTVGLD+ V+ESDL+KL FLKC +KETLRLHPPIPLL HE AE   V
Sbjct  339   CPDDLRRLQQELADTVGLDQNVDESDLDKLPFLKCVIKETLRLHPPIPLLNHENAEDCVV  398

Query  1305  NGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLK-EGMP---DFKGSNFEFIPFGS  1472
              GY +P  SR +IN +AI RD ++W+D D+F+P RF++ EG     DFKG  FEF+PFGS
Sbjct  399   GGYSVPRGSRVMINVFAIGRDASTWKDADAFRPSRFMEGEGEAAGVDFKGGCFEFLPFGS  458

Query  1473  GRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPT  1652
             GRRSCPGM LGLY+ EL VA L H F   LPDGM PS+LDM DVFGLT P+ATRL V+PT
Sbjct  459   GRRSCPGMALGLYSLELIVAQLAHGFNLALPDGMAPSELDMRDVFGLTVPRATRLCVVPT  518

Query  1653  PRLNCQL  1673
             PRL C L
Sbjct  519   PRLTCSL  525



>ref|XP_008791649.1| PREDICTED: cytochrome P450 84A1-like [Phoenix dactylifera]
Length=397

 Score =   523 bits (1348),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 271/409 (66%), Positives = 316/409 (77%), Gaps = 18/409 (4%)
 Frame = +3

Query  462   MAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFG  641
             MAFAHYGPFWRQMRKLCV+KLFSR+RAESW SVRDEVD T+R  +   G  +N+GEL+F 
Sbjct  1     MAFAHYGPFWRQMRKLCVMKLFSRKRAESWASVRDEVDTTLRAASEKRGEPINLGELVFN  60

Query  642   LTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLA  821
             LT+NI +RAAFGS   S   QDEFI ILQEFSKLFGAFN+ DF P+LS  D+QG+N RL 
Sbjct  61    LTKNIIFRAAFGSQ--SHDDQDEFIGILQEFSKLFGAFNIGDFIPWLSWMDMQGINKRLK  118

Query  822   KARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDE--MKVND  995
              AR ALD FIDKIID+H+   +             D  + DMVD++LAF  D    K  +
Sbjct  119   AARGALDRFIDKIIDEHLANPK-----------VADAEDADMVDDMLAFLEDSPAGKGGE  167

Query  996   SDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVG  1175
             + DL   +KLTRDNIK IIMDVMFGGTETVASAIEWAMAELM+  + LKR+QQEL D VG
Sbjct  168   AGDLHGNLKLTRDNIKAIIMDVMFGGTETVASAIEWAMAELMRNTKELKRVQQELADVVG  227

Query  1176  LDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWA  1355
             LDRKV+ESDL+KL++ KC +KETLRLHPPIPLLLHETAE +EV GY IP +SR +IN WA
Sbjct  228   LDRKVQESDLDKLSYFKCVIKETLRLHPPIPLLLHETAEDSEVAGYSIPKKSRVMINVWA  287

Query  1356  IARDKNSWEDPDSFKPDRFLKEG---MPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELA  1526
             I RDK+SW+D ++F+P RF  +G     DF+G+ FE +PFGSGRRSCPGMQLGL+A ELA
Sbjct  288   IGRDKSSWKDAETFRPSRFTPDGDGAGVDFRGNYFELLPFGSGRRSCPGMQLGLHALELA  347

Query  1527  VAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             VA L HCF W LPDGMKPS+LDM DVFGLTAPKA RLV +PTPRLNC L
Sbjct  348   VAQLMHCFNWSLPDGMKPSELDMGDVFGLTAPKAVRLVAVPTPRLNCPL  396



>gb|KFK40190.1| hypothetical protein AALP_AA3G341800 [Arabis alpina]
Length=397

 Score =   520 bits (1338),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 262/408 (64%), Positives = 324/408 (79%), Gaps = 15/408 (4%)
 Frame = +3

Query  462   MAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFG  641
             MAFA YGPFWRQMRK+CV+K+FSR+RAESW SVRDEV+N V +++ N G AVN+GELIF 
Sbjct  1     MAFAPYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVNNMVVSLSSNIGKAVNVGELIFT  60

Query  642   LTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLA  821
             LTRNITYRAAFG++  + Q  DEFI+ILQEFSKLFGAFNV+DF PFL  FDLQG+N RL 
Sbjct  61    LTRNITYRAAFGAACETEQ--DEFIRILQEFSKLFGAFNVADFIPFLGWFDLQGINKRLV  118

Query  822   KARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVNDSD  1001
             KAR  LDGFID++ID+H+   ++R N  +  E      ETDMVD+LLAFYS+  K+   D
Sbjct  119   KARNDLDGFIDEVIDEHM---KKRENNVNVDE------ETDMVDDLLAFYSEGEKLVSED  169

Query  1002  DL----QNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDT  1169
                   +N++KLTRDNIK ++MDVMFGGTET+AS IEWA+ EL++ P+ LK LQ+EL + 
Sbjct  170   SSSTRNKNSVKLTRDNIKALVMDVMFGGTETMASGIEWALTELLRNPDQLKLLQKELAEV  229

Query  1170  VGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINA  1349
             VGLD++V+++ LEKLTFLKC +KET+RLHPPIPL+ HE  E T++ G+ +P  SR  INA
Sbjct  230   VGLDQRVDDTHLEKLTFLKCTMKETMRLHPPIPLIFHEAVEDTKLQGFSVPKGSRLTINA  289

Query  1350  WAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAV  1529
             +AIARD   W DP++FKP RF++ GMPDF GSNFEFIPFGSGRRSCPGMQLGLYA E+AV
Sbjct  290   FAIARDPKLWVDPEAFKPSRFMEPGMPDFMGSNFEFIPFGSGRRSCPGMQLGLYAMEVAV  349

Query  1530  AHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             A++ HCF W+LPDG KPS+LDM DV  LTAP+ATRL+ +P  RL C L
Sbjct  350   ANIIHCFDWQLPDGTKPSELDMSDVMALTAPRATRLIAVPNKRLICPL  397



>dbj|BAJ95312.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   521 bits (1342),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 291/483 (60%), Positives = 359/483 (74%), Gaps = 20/483 (4%)
 Frame = +3

Query  240   LIGNMNLMDH--YSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSN  413
             ++GNM  MD    +HRGLA LA+QYG + H+++G +H +V+S P+ A++VLQ QD  FSN
Sbjct  51    IVGNMFTMDQDQLTHRGLAALAKQYGSIFHIRLGKVHAIVLSTPEYAQEVLQAQDVAFSN  110

Query  414   RPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTV  593
             RPA +A  YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSRRRA +W +VRDE    VR V
Sbjct  111   RPATIAAIYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRRRAGTWLAVRDESAALVRAV  170

Query  594   AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQ-DEFIKILQEFSKLFGAFNVSDF  770
             A   G +VN+GELIF LT+N+T+RAAFG+  +   G+ DEFI I+QEFS LF AF++ DF
Sbjct  171   ARQTGESVNLGELIFNLTKNVTFRAAFGADAAGDAGKRDEFIAIMQEFSHLFAAFSLGDF  230

Query  771   FPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMV  950
              P+LS  D QG N R   ARAALD FIDKIID+H+      R KN       D  + DMV
Sbjct  231   IPWLSWAD-QGTNVRARAARAALDEFIDKIIDEHV-----ERGKN------PDDVDADMV  278

Query  951   DELLAFYSD-EMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKT  1127
             D++LAF S+ + K  D DDLQN ++LTRDNIK +IMDVMFGGTETVAS IEWAMAE+M++
Sbjct  279   DDMLAFLSEAKPKEADGDDLQNTLRLTRDNIKAMIMDVMFGGTETVASGIEWAMAEMMQS  338

Query  1128  PENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVN  1307
             P  L+RLQ+EL D VGLDR V+ESDL+KL FLKC +KETLRLHPPIP+L HE A+   V 
Sbjct  339   PNELRRLQEELADVVGLDRNVDESDLDKLPFLKCVIKETLRLHPPIPILHHENAKDCVVG  398

Query  1308  GYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFL----KEGMPDFKGSNFEFIPFGSG  1475
             GY +P  S  +IN + I R+   W+D D F+P RF+    +    DFKG+ FEF+PFGSG
Sbjct  399   GYSVPQGSSIMINVFDIGRNAKVWKDADMFRPSRFMAVEGEAAKVDFKGNCFEFLPFGSG  458

Query  1476  RRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTP  1655
             RRSCPGM LG+Y+ E AVA L H F W LPDGMKPS+LDM D+FGLTAP+ATRL  +PTP
Sbjct  459   RRSCPGMTLGIYSLEFAVAQLAHGFNWALPDGMKPSELDMTDIFGLTAPRATRLCAVPTP  518

Query  1656  RLN  1664
             RL+
Sbjct  519   RLS  521



>emb|CDM80985.1| unnamed protein product [Triticum aestivum]
Length=510

 Score =   517 bits (1331),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 268/480 (56%), Positives = 344/480 (72%), Gaps = 23/480 (5%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM L+D  +HRGLA LA+Q+GGLLHL+ G LH++ VS P+ AR+VL  QD +FSNRP
Sbjct  48    VIGNMTLVDQLTHRGLAALAKQFGGLLHLRFGWLHVLAVSTPEYAREVLHAQDGVFSNRP  107

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A +A+ YL+Y R+DMAFAH G +WRQMRKLCV K+FSRRRAE+W +VR+      R V  
Sbjct  108   ATIAVVYLTYGRSDMAFAHNGAYWRQMRKLCVTKIFSRRRAETWLAVREGYGALAREVGR  167

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
               G AVN+GELIF LT ++ +RAAF  S     G  EFI ILQEFS+L G F++ DFFP+
Sbjct  168   RSGEAVNLGELIFNLTVSVIFRAAF--STCDEDGLIEFIAILQEFSRLLGLFHIGDFFPW  225

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             L+    +G N RL+ AR ALD FIDKI+D+H+     RR K+          + D+VD L
Sbjct  226   LAWVGRRGFNRRLSTARGALDRFIDKIVDEHM-----RRGKDPADP------DADLVDGL  274

Query  960   LAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENL  1139
             L F +      D++  ++A++ TRDN+K +IMD++FGG ETV S  EWAMAE+M++P+ L
Sbjct  275   LGFLA------DANPREDALRFTRDNVKAMIMDMLFGGPETVGSTTEWAMAEMMRSPDEL  328

Query  1140  KRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYI  1319
             +RLQQEL D VGLDR VEESDL+KL FL+C +KE LR+HPPIP+LLHE A+   V GY I
Sbjct  329   ERLQQELADVVGLDRAVEESDLDKLPFLRCVVKEALRMHPPIPVLLHEAAKDCVVGGYSI  388

Query  1320  PARSRAIINAWAIARDKNSWEDPDSFKPDRFLK-EGMP---DFKGSNFEFIPFGSGRRSC  1487
             P  SR ++ AWAI RD  +W+D D+F+P RF+  EG     D KGS +EF+PFGSGRRSC
Sbjct  389   PRGSRVLVIAWAINRDCGAWKDGDTFRPARFIPGEGEAAGLDLKGSCYEFLPFGSGRRSC  448

Query  1488  PGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNC  1667
             P   LG +A E AVA L H F W+LPDGMKP++LDM D+FGLTA ++TRL  +PTPRL C
Sbjct  449   PAQGLGQHAVEFAVAQLAHGFNWKLPDGMKPAELDMGDIFGLTASRSTRLYAVPTPRLTC  508



>ref|NP_001048732.1| Os03g0112900 [Oryza sativa Japonica Group]
 gb|AAO17011.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF93616.1| Cytochrome P450 84A1, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10646.1| Os03g0112900 [Oryza sativa Japonica Group]
 dbj|BAF43423.1| ferulate-5-hydroxylase [Oryza sativa Japonica Group]
 gb|EAZ25333.1| hypothetical protein OsJ_09145 [Oryza sativa Japonica Group]
Length=519

 Score =   512 bits (1319),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 271/484 (56%), Positives = 342/484 (71%), Gaps = 21/484 (4%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM +MD  +HRGLA +A +YGGLLHL++G +HMVVVS P+ AR+VLQ QD  FSNRP
Sbjct  51    IIGNMLMMDQLTHRGLAAMAARYGGLLHLRLGRVHMVVVSSPEHAREVLQVQDGDFSNRP  110

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A++AI+YL+Y RADMAF+HYG FWRQ+RKL  V+LFSRRRA+SW +VRDE    V  +A 
Sbjct  111   ASIAIAYLTYGRADMAFSHYGHFWRQVRKLSAVRLFSRRRAQSWRAVRDESAKLVGAIAR  170

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
               G AV++GELIFGLT+++ +RAAFG+    G G+ E   +LQEFSKLFGAFNV DF P+
Sbjct  171   RAGEAVDLGELIFGLTKDVIFRAAFGTRDGGGHGELEV--LLQEFSKLFGAFNVGDFIPW  228

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             L+  D  G+N RL  ARAALD  ID+IID+H+         N  G+      + DMVD++
Sbjct  229   LAWLDPHGINRRLRAARAALDSVIDRIIDEHV--------SNPAGD-----EDADMVDDM  275

Query  960   LAFYSDEMK--VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPE  1133
             LAF  +  +       +LQ  ++LTRDNIK IIMD +FGGTETVASAIEWAMAEL+ +P 
Sbjct  276   LAFLDEAGRDQTGGGGELQGTLRLTRDNIKAIIMDFVFGGTETVASAIEWAMAELLHSPG  335

Query  1134  NLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGY  1313
             +L+RLQ EL D VGL R VEE DLEKL FL+C   ETLRLHPPIPLLLHE A    V GY
Sbjct  336   DLRRLQAELADVVGLGRGVEEGDLEKLPFLRCVAMETLRLHPPIPLLLHEAAADCVVGGY  395

Query  1314  YIPARSRAIINAWAIARDKNSWE-DPDSFKPDRFLKEGMP---DFKGSNFEFIPFGSGRR  1481
              +P  +R ++N W++ RD  +W+ D  +F+P RF+  G     D +G  FE +PFGSGRR
Sbjct  396   SVPRGARVVVNVWSVGRDAGAWKGDAGAFRPARFMAGGEAAGMDLRGGCFELLPFGSGRR  455

Query  1482  SCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRL  1661
             +CP + LG+Y  EL VA L H F W  P G+ P +LDM D FGLTAP+A RL  +PTPRL
Sbjct  456   ACPAIVLGMYELELVVARLVHAFGWAPPGGVAPEELDMADGFGLTAPRAARLRAVPTPRL  515

Query  1662  NCQL  1673
              C +
Sbjct  516   TCPM  519



>gb|ABU53977.1| coniferyl aldehyde 5 hydroxylase [Leucaena leucocephala]
Length=352

 Score =   503 bits (1296),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 258/358 (72%), Positives = 300/358 (84%), Gaps = 15/358 (4%)
 Frame = +3

Query  453   RADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGEL  632
             RADM +AHYGPFWRQMRK+CV+KLFSR+RAESW SV+DEV+  VRTV  N G  VNIGEL
Sbjct  2     RADMEYAHYGPFWRQMRKICVMKLFSRKRAESWQSVQDEVETVVRTVGANTGKEVNIGEL  61

Query  633   IFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNP  812
             +F LT+NITYRAAFGSS  S +GQDEFI ILQEFSKLFGAFN++DF P LS  D QG N 
Sbjct  62    VFSLTKNITYRAAFGSS--SREGQDEFIGILQEFSKLFGAFNIADFIPGLSWVDPQGSNA  119

Query  813   RLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYS-DEMKV  989
             RLAKAR +LD FIDKIID+H +Q ++++++           E DMVDELLAFYS D  KV
Sbjct  120   RLAKARGSLDSFIDKIIDEH-MQNKKKKDE-----------EGDMVDELLAFYSEDHSKV  167

Query  990   NDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDT  1169
             ++SDDL N+IKLT+DNIK IIMDVMFGGTETVASAIEWAMAELM++PE LKR+Q+EL + 
Sbjct  168   SESDDLHNSIKLTKDNIKAIIMDVMFGGTETVASAIEWAMAELMRSPEGLKRVQRELAEV  227

Query  1170  VGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINA  1349
             VGLDR+V ESD+EKLT+LKC LKETLRL PPIPLLLHETAE   V+GY++P + R +INA
Sbjct  228   VGLDRRVLESDMEKLTYLKCALKETLRLRPPIPLLLHETAEDAVVSGYFVPKKPRVMINA  287

Query  1350  WAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFEL  1523
             WAI RD+N+W+DPDSFKP RFL EG+PDFKGSNFEFIPFGSGRRSCPGMQLGLYA E+
Sbjct  288   WAIGRDRNAWKDPDSFKPARFLGEGVPDFKGSNFEFIPFGSGRRSCPGMQLGLYALEM  345



>ref|XP_002450575.1| hypothetical protein SORBIDRAFT_05g007210 [Sorghum bicolor]
 gb|EES09563.1| hypothetical protein SORBIDRAFT_05g007210 [Sorghum bicolor]
Length=512

 Score =   504 bits (1298),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 269/489 (55%), Positives = 335/489 (69%), Gaps = 26/489 (5%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGN+ +M   +HRGLA LAE+YGGLLHL++G  H+ VVS  + AR+VLQ QD  F+NRP
Sbjct  40    IIGNLMMMGQLTHRGLAALAERYGGLLHLRLGRRHVFVVSTAEYAREVLQAQDVAFANRP  99

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A  AI+YLSY  ADMAFAHYGPFWRQ RKL V KLFSRRRAE+W ++RDE    VR VA 
Sbjct  100   ATAAIAYLSYGHADMAFAHYGPFWRQARKLSVTKLFSRRRAETWLALRDESAALVRAVAR  159

Query  600   NCGSA--VNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFF  773
               G    VN+GEL+F L+ N+ +RAAFG+       Q E+I +LQEFSK    F++ DF 
Sbjct  160   RSGDGEVVNLGELVFTLSTNVIFRAAFGTGGCEAL-QGEYIGVLQEFSKNISTFSIGDFM  218

Query  774   P-FLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMV  950
             P +L+  DL     RL + R  LD FIDKIIDDHI + R           S   A+ D+V
Sbjct  219   PAWLAWIDLN--RRRLRQTRDGLDRFIDKIIDDHIQRGR-----------SSSDAQADIV  265

Query  951   DELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTP  1130
             DE+LA    +  V+D      +++LTR NIK  I+D+MFGGTETVAS+IEW M EL++  
Sbjct  266   DEMLACIPRDDAVDDRHG--GSLRLTRRNIKAFILDIMFGGTETVASSIEWTMKELLRNA  323

Query  1131  ENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNG  1310
             + L+RLQQEL D VG+D+ V ESDL  L FL+C +KETLR+HPPIP+L H TA+   V G
Sbjct  324   DELRRLQQELADVVGMDQNVSESDLGSLPFLRCVVKETLRMHPPIPMLYHATAKDCVVGG  383

Query  1311  YYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMP-------DFKGSNFEFIPFG  1469
             Y +P  S+  +N WAI RD+ +W+DPD F+P RF  E +        D  GS FEF+PFG
Sbjct  384   YSVPGGSQVTVNVWAIGRDRRTWKDPDVFRPSRFAAEDVDGDAAAGLDLNGSCFEFLPFG  443

Query  1470  SGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIP  1649
             SGRRSCPGM LGL+A ELAVA L H F W LP GMKPSD+D+ DVFGL+AP ATRL  +P
Sbjct  444   SGRRSCPGMALGLHALELAVAQLAHGFRWALPGGMKPSDIDVADVFGLSAPCATRLYAVP  503

Query  1650  TPRLNCQLH  1676
             TPRL C L+
Sbjct  504   TPRLTCPLY  512



>emb|CAE47054.1| ferulate-5-hydroxylase [Arabidopsis lyrata subsp. petraea]
Length=355

 Score =   493 bits (1268),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 256/362 (71%), Positives = 306/362 (85%), Gaps = 8/362 (2%)
 Frame = +3

Query  432   ISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGS  611
             ISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V+ N G 
Sbjct  1     ISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDQMVRSVSCNVGK  60

Query  612   AVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCF  791
              +N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF P+    
Sbjct  61    PINVGEHIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNVADFIPYFGWI  118

Query  792   DLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFY  971
             D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  +TDMVD+LLAFY
Sbjct  119   DPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNAVDDGDVVDTDMVDDLLAFY  173

Query  972   SDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRL  1148
             S+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++PE+LKR+
Sbjct  174   SEEAKLVSEAADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSPEDLKRV  233

Query  1149  QQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPAR  1328
             QQEL + VGLDR+VEE+D+EKLT+LKC LKETLR+HPPIPLLLHETAE T ++G++IP +
Sbjct  234   QQELAEVVGLDRRVEEADIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTSIDGFFIPKK  293

Query  1329  SRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGL  1508
             SR +INA+AI RD  SW DPD+F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCPGMQLGL
Sbjct  294   SRVMINAFAIGRDPTSWADPDTFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCPGMQLGL  353

Query  1509  YA  1514
             YA
Sbjct  354   YA  355



>emb|CAE47052.1| ferulate-5-hydroxylase [Arabidopsis lyrata subsp. petraea]
 emb|CAE47055.1| ferulate-5-hydroxylase [Arabidopsis lyrata subsp. petraea]
 emb|CAE47056.1| ferulate-5-hydroxylase [Arabidopsis lyrata subsp. petraea]
Length=355

 Score =   492 bits (1267),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 256/362 (71%), Positives = 306/362 (85%), Gaps = 8/362 (2%)
 Frame = +3

Query  432   ISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGS  611
             ISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V+ N G 
Sbjct  1     ISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSVSCNVGK  60

Query  612   AVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCF  791
              +N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF P+    
Sbjct  61    PINVGEHIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNVADFIPYFGWI  118

Query  792   DLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFY  971
             D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  +TDMVD+LLAFY
Sbjct  119   DPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNAVDDGDVVDTDMVDDLLAFY  173

Query  972   SDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRL  1148
             S+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++PE+LKR+
Sbjct  174   SEEAKLVSEAADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSPEDLKRV  233

Query  1149  QQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPAR  1328
             QQEL + VGLDR+VEE+D+EKLT+LKC LKETLR+HPPIPLLLHETAE T ++G++IP +
Sbjct  234   QQELAEVVGLDRRVEEADIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTSIDGFFIPKK  293

Query  1329  SRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGL  1508
             SR +INA+AI RD  SW DPD+F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCPGMQLGL
Sbjct  294   SRVMINAFAIGRDPTSWADPDTFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCPGMQLGL  353

Query  1509  YA  1514
             YA
Sbjct  354   YA  355



>emb|CAE47053.1| ferulate-5-hydroxylase [Arabidopsis lyrata subsp. petraea]
Length=355

 Score =   492 bits (1267),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 256/362 (71%), Positives = 306/362 (85%), Gaps = 8/362 (2%)
 Frame = +3

Query  432   ISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGS  611
             ISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V+ N G 
Sbjct  1     ISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSVSCNIGK  60

Query  612   AVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCF  791
              +N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF P+    
Sbjct  61    PINVGEHIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNVADFIPYFGWI  118

Query  792   DLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFY  971
             D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  +TDMVD+LLAFY
Sbjct  119   DPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNAVDDGDVVDTDMVDDLLAFY  173

Query  972   SDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRL  1148
             S+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++PE+LKR+
Sbjct  174   SEEAKLVSEAADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSPEDLKRV  233

Query  1149  QQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPAR  1328
             QQEL + VGLDR+VEE+D+EKLT+LKC LKETLR+HPPIPLLLHETAE T ++G++IP +
Sbjct  234   QQELAEVVGLDRRVEEADIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTSIDGFFIPKK  293

Query  1329  SRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGL  1508
             SR +INA+AI RD  SW DPD+F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCPGMQLGL
Sbjct  294   SRVMINAFAIGRDPTSWADPDTFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCPGMQLGL  353

Query  1509  YA  1514
             YA
Sbjct  354   YA  355



>emb|CAE47051.1| ferulate-5-hydroxylase [Arabidopsis lyrata subsp. petraea]
Length=355

 Score =   492 bits (1266),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 256/362 (71%), Positives = 306/362 (85%), Gaps = 8/362 (2%)
 Frame = +3

Query  432   ISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGS  611
             ISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V+ N G 
Sbjct  1     ISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSVSCNVGK  60

Query  612   AVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCF  791
              +N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF P+    
Sbjct  61    PINVGEHIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNVADFIPYFGWI  118

Query  792   DLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFY  971
             D QG+N RL KAR  LDGFID IID+HI     ++ +N      GD  +TDMVD+LLAFY
Sbjct  119   DPQGINKRLVKARNDLDGFIDDIIDEHI-----KKKENQNAVDDGDVVDTDMVDDLLAFY  173

Query  972   SDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRL  1148
             S+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++P++LKR+
Sbjct  174   SEEAKLVSEAADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSPDDLKRV  233

Query  1149  QQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPAR  1328
             QQEL + VGLDR+VEE+D+EKLT+LKC LKETLR+HPPIPLLLHETAE T ++G++IP +
Sbjct  234   QQELAEVVGLDRRVEEADIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTSIDGFFIPKK  293

Query  1329  SRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGL  1508
             SR +INA+AI RD  SW DPD+F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCPGMQLGL
Sbjct  294   SRVMINAFAIGRDPTSWADPDTFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCPGMQLGL  353

Query  1509  YA  1514
             YA
Sbjct  354   YA  355



>emb|CAE47043.1| ferulate-5-hydroxylase [Arabidopsis halleri subsp. halleri]
 emb|CAE47044.1| ferulate-5-hydroxylase [Arabidopsis halleri subsp. halleri]
 emb|CAE47045.1| ferulate-5-hydroxylase [Arabidopsis halleri subsp. halleri]
 emb|CAE47046.1| ferulate-5-hydroxylase [Arabidopsis halleri subsp. halleri]
 emb|CAE47047.1| ferulate-5-hydroxylase [Arabidopsis halleri subsp. halleri]
 emb|CAE47048.1| ferulate-5-hydroxylase [Arabidopsis halleri subsp. halleri]
 emb|CAE47049.1| ferulate-5-hydroxylase [Arabidopsis halleri subsp. halleri]
 emb|CAE47050.1| ferulate-5-hydroxylase [Arabidopsis halleri subsp. halleri]
Length=355

 Score =   492 bits (1266),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 256/362 (71%), Positives = 305/362 (84%), Gaps = 8/362 (2%)
 Frame = +3

Query  432   ISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGS  611
             ISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V+ N G 
Sbjct  1     ISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSVSCNVGK  60

Query  612   AVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCF  791
              +N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF P+    
Sbjct  61    PINVGEQIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNVADFIPYFGWI  118

Query  792   DLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFY  971
             D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  +TDMVD+LL FY
Sbjct  119   DPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNAVDDGDVVDTDMVDDLLGFY  173

Query  972   SDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRL  1148
             S+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++PE+LKR+
Sbjct  174   SEEAKLVSEAADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSPEDLKRV  233

Query  1149  QQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPAR  1328
             QQEL + VGLDR+VEESD+EKLT+LKC LKETLR+HPPIPLLLHETAE T ++G++IP +
Sbjct  234   QQELAEVVGLDRRVEESDIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTSIDGFFIPKK  293

Query  1329  SRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGL  1508
             SR +INA+AI RD  SW DPD+F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCPGMQLGL
Sbjct  294   SRVMINAFAIGRDPTSWADPDTFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCPGMQLGL  353

Query  1509  YA  1514
             YA
Sbjct  354   YA  355



>ref|XP_002461434.1| hypothetical protein SORBIDRAFT_02g002630 [Sorghum bicolor]
 gb|EER97955.1| hypothetical protein SORBIDRAFT_02g002630 [Sorghum bicolor]
Length=521

 Score =   498 bits (1281),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 261/483 (54%), Positives = 344/483 (71%), Gaps = 22/483 (5%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGN+  MD ++HRGLAKLA+ +GG  HL +G  ++ VVS P+ AR++LQ Q  +FS+RP
Sbjct  55    VIGNLLSMDQFTHRGLAKLAKVHGGFFHLPIGFANVFVVSSPETAREILQEQAGVFSHRP  114

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
                A++Y+SYD ADMAFA YGPFWRQMRKLCVVKLFSR R +SW +VR EVD  VR++A 
Sbjct  115   VTAAMAYVSYDLADMAFARYGPFWRQMRKLCVVKLFSRGRDQSWRTVRAEVDGLVRSLA-  173

Query  600   NCGSAV--NIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFF  773
               G+ V  N+GEL F    NIT RAAFG+   S + + EF+ I++E S+ F AFNV+DF 
Sbjct  174   EAGAVVVANVGELAFKFATNITLRAAFGA--RSQEDEAEFVAIIRELSQTFLAFNVADFV  231

Query  774   PFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVD  953
             PF+   DL G+N R   AR ALD FID+IID+H+      R KN      GD A  DMVD
Sbjct  232   PFVGFLDLNGINRRTRAARHALDVFIDRIIDEHVA-----RWKN------GDVAAADMVD  280

Query  954   ELLAFYSDEMKVN---DSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMK  1124
             +++A+ ++    +   D  +L++ ++LTR+NIKG+IMD+MFGGTETVA+ +EW+M EL++
Sbjct  281   DMIAYLAETPGRDTRADGVELKD-LRLTRENIKGLIMDIMFGGTETVAATLEWSMVELLR  339

Query  1125  TPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEV  1304
             +P  L+R Q EL   VGLDRKV+ESD+EKL +L+C  KE LRLHPP+PLL  E+ +   V
Sbjct  340   SPGELERAQDELAGVVGLDRKVDESDVEKLPYLRCICKEVLRLHPPLPLLHRESLQDCAV  399

Query  1305  NGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRS  1484
              G+ +P  SR  IN WA+ RD+  WED D+F+P RF   G     G +F ++PFG GRRS
Sbjct  400   GGHAVPRNSRVWINIWAMGRDERHWEDADAFRPSRFAGAGAG--VGGDFWYLPFGHGRRS  457

Query  1485  CPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLN  1664
             CPGMQLG YA EL +A+L HCF W LPDG+ PSDLD+ DVFGLTAP+A RL+ +P+PRL+
Sbjct  458   CPGMQLGTYAVELGLANLLHCFRWSLPDGVAPSDLDVGDVFGLTAPRAQRLLAVPSPRLS  517

Query  1665  CQL  1673
             C L
Sbjct  518   CPL  520



>dbj|BAJ92908.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=509

 Score =   493 bits (1269),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 261/481 (54%), Positives = 330/481 (69%), Gaps = 22/481 (5%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM + D  +HRGLA LA+QYGGLLHL++GSL +  VS P+ AR+VLQ QD+ F  RP
Sbjct  48    IIGNMMMADQLTHRGLAALAKQYGGLLHLRLGSLRIFAVSTPEYAREVLQAQDSDFWYRP  107

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A++AI YL+Y  +DMAFAH GP+WRQMRKLCV KLFSRRR E+W +VRD      R V  
Sbjct  108   ASIAIRYLTYGCSDMAFAHDGPYWRQMRKLCVTKLFSRRRDETWLAVRDGYGELARAVGR  167

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
             + G AVN+GELIF  T +I +RAAFG      +G DEFI + +EFS L  AF++ DFFP+
Sbjct  168   SSGEAVNLGELIFKHTVSIIFRAAFGVRDV--EGLDEFIPMFKEFSNLLEAFHLGDFFPW  225

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             LS    +G + RL   R AL  F+DKIID+H+     RR KN       + A+ DMVD L
Sbjct  226   LSWIGRRGFDGRLRTVRGALGTFVDKIIDEHV-----RRGKNP------EDADADMVDGL  274

Query  960   LAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENL  1139
             LAF +D    N  DD +     TRDN++ ++MD++FGG +TV   IEWAMAE+M  P  L
Sbjct  275   LAFLAD---ANGKDDFRG---YTRDNVRAMMMDMLFGGPDTVGFTIEWAMAEMMHCPSIL  328

Query  1140  KRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYI  1319
             +R+Q EL D VGLDR V+ESDL+KL FLKC +KETLR+HPPIP+ LH T +   +  Y +
Sbjct  329   QRVQHELIDIVGLDRIVDESDLDKLPFLKCVVKETLRMHPPIPIHLHGTTKDCILGAYSV  388

Query  1320  PARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMP---DFKGSNFEFIPFGSGRRSCP  1490
             P  SR  INAWAI RD  +W+DPD+F+P RFL +G     D KGS +E + FGSGRRSCP
Sbjct  389   PRGSRVFINAWAINRDGEAWQDPDTFRPSRFLSDGEAKGVDLKGSCYELLSFGSGRRSCP  448

Query  1491  GMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQ  1670
                LG +A E A+A L H F W LPDGMKP++LDM D+ G+T  +ATRL  +PTPRL C 
Sbjct  449   AQGLGQHAVEFAIAQLVHGFNWSLPDGMKPTELDMSDMIGVTVSRATRLYAVPTPRLTCP  508

Query  1671  L  1673
             L
Sbjct  509   L  509



>emb|CAE47058.1| ferulate-5-hydroxylase [Arabidopsis lyrata subsp. petraea]
 gb|AFK29446.1| ferulate-5-hydroxylase, partial [Arabidopsis lyrata subsp. lyrata]
Length=351

 Score =   483 bits (1244),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 252/358 (70%), Positives = 302/358 (84%), Gaps = 8/358 (2%)
 Frame = +3

Query  432   ISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGS  611
             ISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V+ N G 
Sbjct  1     ISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSVSCNVGK  60

Query  612   AVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCF  791
              +N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF P+    
Sbjct  61    PINVGEHIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNVADFIPYFGWI  118

Query  792   DLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFY  971
             D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  +TDMVD+LLAFY
Sbjct  119   DPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNAVDDGDVVDTDMVDDLLAFY  173

Query  972   SDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRL  1148
             S+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++PE+LKR+
Sbjct  174   SEEAKLVSEAADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSPEDLKRV  233

Query  1149  QQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPAR  1328
             QQEL + VGLDR+VEE+D+EKLT+LKC LKETLR+HPPIPLLLHETAE T ++G++IP +
Sbjct  234   QQELAEVVGLDRRVEEADIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTSIDGFFIPKK  293

Query  1329  SRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQL  1502
             SR +INA+AI RD  SW DPD+F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCPGMQL
Sbjct  294   SRVMINAFAIGRDPTSWADPDTFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCPGMQL  351



>gb|AFK29443.1| ferulate-5-hydroxylase, partial [Arabidopsis halleri subsp. halleri]
 gb|AFK29444.1| ferulate-5-hydroxylase, partial [Arabidopsis halleri subsp. gemmifera]
Length=351

 Score =   483 bits (1243),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 252/358 (70%), Positives = 301/358 (84%), Gaps = 8/358 (2%)
 Frame = +3

Query  432   ISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGS  611
             ISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V+ N G 
Sbjct  1     ISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSVSCNVGK  60

Query  612   AVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCF  791
              +N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF P+    
Sbjct  61    PINVGEQIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNVADFIPYFGWI  118

Query  792   DLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFY  971
             D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  +TDMVD+LL FY
Sbjct  119   DPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNAVDDGDVVDTDMVDDLLGFY  173

Query  972   SDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRL  1148
             S+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++PE+LKR+
Sbjct  174   SEEAKLVSEAADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSPEDLKRV  233

Query  1149  QQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPAR  1328
             QQEL + VGLDR+VEESD+EKLT+LKC LKETLR+HPPIPLLLHETAE T ++G++IP +
Sbjct  234   QQELAEVVGLDRRVEESDIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTSIDGFFIPKK  293

Query  1329  SRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQL  1502
             SR +INA+AI RD  SW DPD+F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCPGMQL
Sbjct  294   SRVMINAFAIGRDPTSWADPDTFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCPGMQL  351



>emb|CAE47057.1| ferulate-5-hydroxylase [Arabidopsis lyrata subsp. petraea]
Length=351

 Score =   482 bits (1240),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 251/358 (70%), Positives = 301/358 (84%), Gaps = 8/358 (2%)
 Frame = +3

Query  432   ISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGS  611
             ISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V+ N G 
Sbjct  1     ISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSVSCNVGK  60

Query  612   AVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCF  791
              +N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+D  P+    
Sbjct  61    PINVGEHIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNVADLIPYFGWI  118

Query  792   DLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFY  971
             D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  +TDMVD+LLAFY
Sbjct  119   DPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNAVDDGDVVDTDMVDDLLAFY  173

Query  972   SDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRL  1148
             S+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++PE+LKR+
Sbjct  174   SEEAKLVSEAADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSPEDLKRV  233

Query  1149  QQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPAR  1328
             QQEL + VGLDR+VEE+D+EKLT+LKC LKETLR+HPPIPLLLHETAE T ++G++IP +
Sbjct  234   QQELAEVVGLDRRVEEADIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTSIDGFFIPKK  293

Query  1329  SRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQL  1502
             SR +INA+AI RD  SW DPD+F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCPGMQL
Sbjct  294   SRVMINAFAIGRDPTSWADPDTFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCPGMQL  351



>emb|CAE47059.1| ferulate-5-hydroxylase [Arabidopsis lyrata subsp. petraea]
 emb|CAE47060.1| ferulate-5-hydroxylase [Arabidopsis lyrata subsp. petraea]
Length=351

 Score =   482 bits (1240),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 251/358 (70%), Positives = 302/358 (84%), Gaps = 8/358 (2%)
 Frame = +3

Query  432   ISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGS  611
             ISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V+ N G 
Sbjct  1     ISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSVSCNVGK  60

Query  612   AVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCF  791
              +N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF P+    
Sbjct  61    PINVGEHIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNVADFIPYFGWI  118

Query  792   DLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFY  971
             D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  +TDMVD+LLAFY
Sbjct  119   DPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNAVDDGDVVDTDMVDDLLAFY  173

Query  972   SDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRL  1148
             S+E K V+++ DLQN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++P++LKR+
Sbjct  174   SEEAKLVSEAADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSPDDLKRV  233

Query  1149  QQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPAR  1328
             QQEL + VGLDR+VEE+D+EKLT+LKC LKETLR+HPPIPLLLHETAE T ++G++IP +
Sbjct  234   QQELAEVVGLDRRVEEADIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTSIDGFFIPKK  293

Query  1329  SRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQL  1502
             SR +INA+AI RD  SW DPD+F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCPGMQL
Sbjct  294   SRVMINAFAIGRDPTSWADPDTFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCPGMQL  351



>gb|EMT18242.1| Cytochrome P450 84A1 [Aegilops tauschii]
Length=505

 Score =   488 bits (1255),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 259/481 (54%), Positives = 330/481 (69%), Gaps = 20/481 (4%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGN+ + D  +HRGLA LA+QYGGLLHL++GSL +  VS P+ AR+VLQ QD+ F  RP
Sbjct  42    IIGNLMMADQLTHRGLAALAKQYGGLLHLRLGSLRVFAVSTPEYAREVLQAQDSDFWYRP  101

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A++A+ YL+Y  +DMAFA  G +WRQMRKLCV KLFSRRRAE+W +VRD      R V  
Sbjct  102   ASIAVRYLTYGCSDMAFARDGRYWRQMRKLCVTKLFSRRRAETWLAVRDGYGELARAVGR  161

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
             + G AVN+GELIF  T +I +RAAFG      QG DEFI + +EFSKL  AF+V DFFP+
Sbjct  162   SSGEAVNLGELIFKHTVSIIFRAAFGVRDV--QGLDEFIPMFKEFSKLLEAFHVGDFFPW  219

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDEL  959
             LS    +G + RL   R AL  F+DKIID+H+     RR KN       D A+ DMVD L
Sbjct  220   LSWMGRRGFDRRLRTVRGALGTFVDKIIDEHV-----RRGKNP------DDADADMVDGL  268

Query  960   LAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENL  1139
             LA  +D  + +  DDL    + TRDN++ ++MD++FGG +TV   IEWAMAE+M  P+ L
Sbjct  269   LALLADANQASGEDDL----RFTRDNVRAMMMDMLFGGPDTVGFTIEWAMAEMMHCPDIL  324

Query  1140  KRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYI  1319
              RLQQEL D VGLDR V+ESDL KL FLKC +KETLR+HPPIP+ LH   +   + GY +
Sbjct  325   LRLQQELVDIVGLDRTVDESDLGKLPFLKCVIKETLRMHPPIPIHLHGNTKDCVLGGYSV  384

Query  1320  PARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMP---DFKGSNFEFIPFGSGRRSCP  1490
             P  SR  INAWAI RD  +W+DP++F+P RF+ +G     D KG  +E + FGSGRRSCP
Sbjct  385   PRGSRVFINAWAINRDGEAWKDPNAFRPSRFMPDGEATGLDLKGGCYELLSFGSGRRSCP  444

Query  1491  GMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQ  1670
                LG +A E A+A L H F W+LP  MKP++LDM D+ G+T  +ATRL  +PTPRLNC 
Sbjct  445   AQGLGQHAVEFAIAQLVHGFNWKLPGDMKPTELDMSDMNGVTVSRATRLYAVPTPRLNCP  504

Query  1671  L  1673
             L
Sbjct  505   L  505



>gb|AFK29445.1| ferulate-5-hydroxylase, partial [Arabidopsis kamchatica]
Length=351

 Score =   481 bits (1238),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 251/358 (70%), Positives = 301/358 (84%), Gaps = 8/358 (2%)
 Frame = +3

Query  432   ISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGS  611
             ISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V+ N G 
Sbjct  1     ISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSVSCNVGK  60

Query  612   AVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCF  791
              +N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF P+    
Sbjct  61    PINVGEHIFALTRNITYRAAFGSA--CEKGQDEFIRILQEFSKLFGAFNVADFIPYFGWI  118

Query  792   DLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFY  971
             D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  +TDMVD+LLAFY
Sbjct  119   DPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNAVDDGDVVDTDMVDDLLAFY  173

Query  972   SDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRL  1148
             S+E K V+++ D QN+IKLTRDNIK IIMDVMFGGTETVASAIEWA+ EL+++PE+LKR+
Sbjct  174   SEEAKLVSEAADPQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSPEDLKRV  233

Query  1149  QQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPAR  1328
             QQEL + VGLDR+VEE+D+EKLT+LKC LKETLR+HPPIPLLLHETAE T ++G++IP +
Sbjct  234   QQELAEVVGLDRRVEEADIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTSIDGFFIPKK  293

Query  1329  SRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQL  1502
             SR +INA+AI RD  SW DPD+F+P RFL+ G+PDFKGSNFEFIPFGSGRRSCPGMQL
Sbjct  294   SRVMINAFAIGRDPTSWADPDTFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCPGMQL  351



>gb|EPS73804.1| ferulate 5-hydroxylase, partial [Genlisea aurea]
Length=351

 Score =   479 bits (1233),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 233/346 (67%), Positives = 276/346 (80%), Gaps = 14/346 (4%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGP+GWPLIGN ++MD  +HRGLAKLAE+YGG+LHL++G LH V +S  + ARQVL
Sbjct  8     KNLPPGPRGWPLIGNFDMMDQLTHRGLAKLAEKYGGVLHLRIGYLHTVAISSAEAARQVL  67

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             Q  DNIFSNRP N+AI YL+YDRADMAFAHYGPFWRQMRKLCV+KLFS +R ESW +VRD
Sbjct  68    QVHDNIFSNRPVNIAIRYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSPKRTESWVAVRD  127

Query  567   EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLF  746
             EVD  +RT A++ G+AVN+GEL+FGLT +ITYRAAFGS  +S QG++EFIKILQEFSKLF
Sbjct  128   EVDAMIRTAAVSSGTAVNVGELVFGLTSDITYRAAFGS--NSKQGRNEFIKILQEFSKLF  185

Query  747   GAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSG  926
             GAFN+SDF P+L   D QGL  RL KAR +LDGFID IIDDH+ +T              
Sbjct  186   GAFNISDFIPWLGWIDPQGLKNRLIKARNSLDGFIDVIIDDHMRKT----------SPEN  235

Query  927   DGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
             D  ETDMVDELLAFYSD  +  D     N+IKLTR NIK IIMDVMFGGTETVASAIEWA
Sbjct  236   DSVETDMVDELLAFYSDGPQ--DHSASPNSIKLTRVNIKAIIMDVMFGGTETVASAIEWA  293

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKET  1244
             ++ LMK+PE++K++Q+EL   VGL+RKVEESDLEKLT+ +CCLKE 
Sbjct  294   LSYLMKSPEDMKKVQEELAQVVGLNRKVEESDLEKLTYFRCCLKEV  339



>ref|XP_003562202.1| PREDICTED: cytochrome P450 84A1-like [Brachypodium distachyon]
Length=540

 Score =   462 bits (1190),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 259/487 (53%), Positives = 346/487 (71%), Gaps = 14/487 (3%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM +M   +HRGLA LA ++GGL HL++G +H VVVS P  AR+VL  QD  FS RP
Sbjct  59    VIGNMLMMGRLTHRGLAALAGRHGGLFHLRLGRVHAVVVSSPAHAREVLSVQDAAFSGRP  118

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             A+ A++YL+Y RADMAFA YG FWRQ+R+L   +LFS RR++SW +VRDE    VR +A 
Sbjct  119   ASAAVAYLTYGRADMAFAPYGRFWRQVRRLSSTRLFSSRRSQSWLAVRDESAALVRAIAE  178

Query  600   NCGSA---VNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDF  770
             + GS    V++GEL+F LT+N+ +RAAFG+  S G+ Q+E ++ L EFS+L G F+V DF
Sbjct  179   SSGSGGEVVDVGELMFVLTKNVVFRAAFGAGESRGRRQEELVERLHEFSELMGVFSVGDF  238

Query  771   FPFLSCFD-LQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDM  947
             FP+L   D L+G+N RL +AR  LD  +D IID+H+ + ++R+       V    A  D 
Sbjct  239   FPWLRWVDGLRGVNGRLRRARGGLDELVDGIIDEHV-EGKKRKGDVDADMVDDMFAFLD-  296

Query  948   VDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKT  1127
              D+L A  + ++K +  +D  + ++LTRDNIK IIMD MFGGTETVA+A+EWAMAEL+++
Sbjct  297   DDDLAA--AGKIKDDGDND-DDGLRLTRDNIKAIIMDFMFGGTETVAAAMEWAMAELLRS  353

Query  1128  PENLKRLQQELTDTVGLDRKVEESDL---EKLTFLKCCLKETlrlhppiplllhETAEAT  1298
             P +L+R+QQELT+T+GLDR VEE+D+   + L FL+C +KETLRLHPP+PLLLHE+    
Sbjct  354   PNDLRRVQQELTETIGLDRTVEETDINTPDSLPFLRCIVKETLRLHPPVPLLLHESMTDC  413

Query  1299  EVNGYYIPARSRAIINAWAIARDKNSWE-DPDSFKPDRFLKEGM-PDFKGSNFEFIPFGS  1472
              V GY +P RSR I+N WAI RD+++W  D D+F+P RF+ E    D KG  FE +PFGS
Sbjct  414   VVGGYTVPRRSRVIVNLWAIGRDRSAWGLDADTFRPARFVGEAAHVDLKGGCFELLPFGS  473

Query  1473  GRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPT  1652
             GRR+CP M  G+Y  ELA+A L H F W LPDG+KP +LDM DVFGLT P+A RL  +P 
Sbjct  474   GRRACPAMVFGMYEMELALARLLHAFEWALPDGVKPEELDMGDVFGLTLPRAVRLRAVPK  533

Query  1653  PRLNCQL  1673
              RL C L
Sbjct  534   LRLTCSL  540



>ref|XP_003562195.1| PREDICTED: cytochrome P450 84A1-like [Brachypodium distachyon]
Length=538

 Score =   451 bits (1160),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 264/501 (53%), Positives = 346/501 (69%), Gaps = 35/501 (7%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             +IGNM +M   +HRGLA LA +YGGL HL++G +H VVVS P  AR+VL  QD  FSNRP
Sbjct  50    VIGNMLMMGQLTHRGLAALAGRYGGLFHLRLGRVHAVVVSSPAHAREVLGVQDAAFSNRP  109

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSR---RRAESWDSVRDEVDNTVRT  590
             A+ A+++L+Y RADMAFAHYG FWRQ+RKL   +LFSR   R A SW +VRDE    VR 
Sbjct  110   ASAAVAFLTYGRADMAFAHYGRFWRQVRKLSSARLFSRRGSRAARSWLAVRDESAKLVRA  169

Query  591   V-AMNCGS-----AVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGA  752
             + A   GS     AV+IGEL+F LT+N+ +RAAFG      + +DE  ++L+EFS+L GA
Sbjct  170   IDAEISGSGGGEAAVDIGELLFVLTKNVVFRAAFGD--RGRRQEDELGELLREFSELMGA  227

Query  753   FNVSDFFPFLSCFD-LQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             F+V DF P+L   D L+G++ RL KARA +D  +D+IID+H+           G + S D
Sbjct  228   FSVGDFIPWLRWVDGLRGVDERLRKARAGIDELLDRIIDEHL----------EGKKKSKD  277

Query  930   GAETDMVDELLAFYSDE------MKVNDSDDLQN--AIKLTRDNIKGIIMDVMFGGTETV  1085
               + DM+D++L F+ ++       K +  D+  N   ++LTR+NIK I MD MFGG ETV
Sbjct  278   DVDADMLDDMLEFFEEDDDDPAAGKKDGGDEPHNDKGLRLTRNNIKAITMDFMFGGMETV  337

Query  1086  ASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDL----EKLTFLKCCLKETlrl  1253
             A+A+EWAMAEL+++P+NL+R+QQEL +T+GLDR V +SD+    + L FL+C +KETLRL
Sbjct  338   AAAMEWAMAELLRSPDNLRRVQQELAETIGLDRTVLDSDINTVPDSLPFLRCIVKETLRL  397

Query  1254  hppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMP-  1430
             HPPIPLLLHETA    V GY +P RSR I+N WAI RD+++W DPD+F+P RF+ E    
Sbjct  398   HPPIPLLLHETATDCVVGGYAVPRRSRVIVNLWAIGRDRSAWVDPDTFRPARFMAEAAEV  457

Query  1431  DFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFG  1610
             D KG +FE +PFGSGRR+CP +  GLY  ELA+A L H F W LP    P DLDMDDVFG
Sbjct  458   DLKGGSFELLPFGSGRRACPAIVFGLYEMELALARLLHAFEWALPASEVPEDLDMDDVFG  517

Query  1611  LTAPKATRLVVIPTPRLNCQL  1673
             L+AP+A RL  +P  RL C L
Sbjct  518   LSAPRAVRLRAVPKLRLTCPL  538



>gb|EEE65665.1| hypothetical protein OsJ_21269 [Oryza sativa Japonica Group]
Length=480

 Score =   430 bits (1106),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 224/484 (46%), Positives = 307/484 (63%), Gaps = 60/484 (12%)
 Frame = +3

Query  249   NMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANV  428
             N+  +  ++HRGLAKL++ +GG  HL++G  ++ VVS P+  R+++   D++FS+ P   
Sbjct  47    NLLSVHQFTHRGLAKLSKIHGGFFHLRVGQPNVFVVSSPETVREIIHENDSVFSHCPVTA  106

Query  429   AISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCG  608
             A+ Y+SYD ADMAFAHYGPFWRQMRKLCV+KLFS RR  SW  VR EVD  VR+VA    
Sbjct  107   AMVYVSYDLADMAFAHYGPFWRQMRKLCVLKLFSPRRDVSWRVVRGEVDALVRSVAELRR  166

Query  609   SAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSC  788
              A ++G+L+F    N+T+RAAFG+   S + +  F+ I+ E S++F AFN+ D+ P L  
Sbjct  167   VAGSVGDLVFKFATNVTFRAAFGA--QSREDEKVFVDIILELSEIFMAFNMGDYIPCLGW  224

Query  789   FDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAF  968
              DL G+  R+A AR ALD FID+IID+H+ + R           +GD + +DMVD+++A+
Sbjct  225   LDLNGIGKRMAAARHALDVFIDRIIDEHLAKLR-----------NGDVSASDMVDDMIAY  273

Query  969   YSD----EMKVNDSDDLQNAIKLTRDNIKGIIM---DVMFGGTETVASAIEWAMAELMKT  1127
               D      K  D  +L + + LTRDNIKG+IM   D+MFGGT+TVAS +EWA++EL++ 
Sbjct  274   LVDAPGGRHKRADGVELGD-LHLTRDNIKGLIMARNDIMFGGTKTVASTVEWALSELLRN  332

Query  1128  PENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVN  1307
             P+ LKR Q EL   VGL R+V + DL+ L  L+C  KE                      
Sbjct  333   PDELKRAQDELAGVVGLRRRVNQDDLDNLPHLRCVTKE----------------------  370

Query  1308  GYYIPARSRAIINAWAIARDKNSW-EDPDSFKPDRFLKE-GMPDFKGSNFEFIPFGSGRR  1481
                            A+ RD+  W  D  +F+P RF  E    +FKG +F+++PFGSGRR
Sbjct  371   ---------------AMCRDEALWGTDAAAFRPSRFADESARVEFKGGDFQYLPFGSGRR  415

Query  1482  SCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRL  1661
             SCPGMQLG++A EL +A L HCF W LP G +P +LDMDDVFGLTAPKA RL  +P+PRL
Sbjct  416   SCPGMQLGMFAVELGLAELLHCFDWSLPAGTEPLELDMDDVFGLTAPKAERLCAVPSPRL  475

Query  1662  NCQL  1673
             +C L
Sbjct  476   SCPL  479



>ref|NP_001174774.1| Os06g0349700 [Oryza sativa Japonica Group]
 dbj|BAF43422.1| ferulate-5-hydroxylase [Oryza sativa Japonica Group]
 dbj|BAH93502.1| Os06g0349700 [Oryza sativa Japonica Group]
Length=529

 Score =   430 bits (1106),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 224/484 (46%), Positives = 307/484 (63%), Gaps = 60/484 (12%)
 Frame = +3

Query  249   NMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANV  428
             N+  +  ++HRGLAKL++ +GG  HL++G  ++ VVS P+  R+++   D++FS+ P   
Sbjct  96    NLLSVHQFTHRGLAKLSKIHGGFFHLRVGQPNVFVVSSPETVREIIHENDSVFSHCPVTA  155

Query  429   AISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCG  608
             A+ Y+SYD ADMAFAHYGPFWRQMRKLCV+KLFS RR  SW  VR EVD  VR+VA    
Sbjct  156   AMVYVSYDLADMAFAHYGPFWRQMRKLCVLKLFSPRRDVSWRVVRGEVDALVRSVAELRR  215

Query  609   SAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSC  788
              A ++G+L+F    N+T+RAAFG+   S + +  F+ I+ E S++F AFN+ D+ P L  
Sbjct  216   VAGSVGDLVFKFATNVTFRAAFGA--QSREDEKVFVDIILELSEIFMAFNMGDYIPCLGW  273

Query  789   FDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAF  968
              DL G+  R+A AR ALD FID+IID+H+ + R           +GD + +DMVD+++A+
Sbjct  274   LDLNGIGKRMAAARHALDVFIDRIIDEHLAKLR-----------NGDVSASDMVDDMIAY  322

Query  969   YSD----EMKVNDSDDLQNAIKLTRDNIKGIIM---DVMFGGTETVASAIEWAMAELMKT  1127
               D      K  D  +L + + LTRDNIKG+IM   D+MFGGT+TVAS +EWA++EL++ 
Sbjct  323   LVDAPGGRHKRADGVELGD-LHLTRDNIKGLIMARNDIMFGGTKTVASTVEWALSELLRN  381

Query  1128  PENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVN  1307
             P+ LKR Q EL   VGL R+V + DL+ L  L+C  KE                      
Sbjct  382   PDELKRAQDELAGVVGLRRRVNQDDLDNLPHLRCVTKE----------------------  419

Query  1308  GYYIPARSRAIINAWAIARDKNSW-EDPDSFKPDRFLKE-GMPDFKGSNFEFIPFGSGRR  1481
                            A+ RD+  W  D  +F+P RF  E    +FKG +F+++PFGSGRR
Sbjct  420   ---------------AMCRDEALWGTDAAAFRPSRFADESARVEFKGGDFQYLPFGSGRR  464

Query  1482  SCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRL  1661
             SCPGMQLG++A EL +A L HCF W LP G +P +LDMDDVFGLTAPKA RL  +P+PRL
Sbjct  465   SCPGMQLGMFAVELGLAELLHCFDWSLPAGTEPLELDMDDVFGLTAPKAERLCAVPSPRL  524

Query  1662  NCQL  1673
             +C L
Sbjct  525   SCPL  528



>gb|EMT32980.1| Cytochrome P450 84A1 [Aegilops tauschii]
Length=493

 Score =   426 bits (1095),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 250/410 (61%), Positives = 306/410 (75%), Gaps = 18/410 (4%)
 Frame = +3

Query  462   MAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFG  641
             MAFAHYGPFWRQMRKLCV+KLFSRRRA +W +VRDE     R VA   G +VN+GELIF 
Sbjct  1     MAFAHYGPFWRQMRKLCVMKLFSRRRAGTWLAVRDESAALARAVARRSGESVNLGELIFN  60

Query  642   LTRNITYRAAFGSSPSSGQGQ-DEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRL  818
             LT+N+T+RAAFG+  +   G+ DEFI I+QEFS+LFG  ++ DF P+L   D QGLN R 
Sbjct  61    LTKNVTFRAAFGADAAGDAGKRDEFIAIMQEFSQLFGGSSIGDFIPWLGWAD-QGLNVRA  119

Query  819   AKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSD-EMKVND  995
               ARAALD FIDKIID+H+     +R+KN       D  + DMVD++LAF  + + K   
Sbjct  120   RAARAALDEFIDKIIDEHM-----KRSKN------PDDVDADMVDDMLAFLPEAKPKKAA  168

Query  996   SDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVG  1175
              DDLQN+++LTR+NIK +IMDVMFGGTETVAS IEWAM E+M +P++L+RLQQELTD VG
Sbjct  169   GDDLQNSLRLTRENIKAMIMDVMFGGTETVASGIEWAMTEMMHSPDDLRRLQQELTDMVG  228

Query  1176  LDRKVEESDLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWA  1355
             LDR V+ESDL+KL FLKC +KETLRLHPPIP+L HE AE   + GY +P  S  +IN +A
Sbjct  229   LDRNVDESDLDKLPFLKCVIKETLRLHPPIPILHHENAEDCVIGGYLVPQGSSVMINVFA  288

Query  1356  IARDKNSWEDPDSFKPDRFLK-EGMP---DFKGSNFEFIPFGSGRRSCPGMQLGLYAFEL  1523
             I RD   W+D D+F+P RF+  EG     DFKG+ FEF+PFGSGRRSCPGM LG+Y+ E 
Sbjct  289   IGRDAKVWKDADTFRPSRFMTGEGETARLDFKGNCFEFLPFGSGRRSCPGMALGIYSLEF  348

Query  1524  AVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             AVA L H F+W LPDGMKPS+LDM D+FGLTAP+ TRL  +PTPRL   L
Sbjct  349   AVAQLAHGFSWALPDGMKPSELDMTDIFGLTAPRVTRLCAVPTPRLTYPL  398



>gb|ADR31587.1| cytochrome P450 [Populus trichocarpa]
 gb|ADR31592.1| cytochrome P450 [Populus trichocarpa]
Length=296

 Score =   409 bits (1051),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 200/283 (71%), Positives = 233/283 (82%), Gaps = 12/283 (4%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG PL+G+M++MD  +HRGLAKLA+QYGGL H++MG LHMV VS P+ ARQVLQ
Sbjct  25    PYPPGPKGLPLVGSMHMMDQITHRGLAKLAKQYGGLFHMRMGYLHMVTVSSPEIARQVLQ  84

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPAN+AI YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDE
Sbjct  85    VQDNIFSNRPANIAIRYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDE  144

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD+ ++TV  N G  VN+GELIF LT NITYRAAFG   +  +GQDEFIKILQEFSKLFG
Sbjct  145   VDSMLKTVEANIGKPVNLGELIFTLTMNITYRAAFG---AKNEGQDEFIKILQEFSKLFG  201

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN+SDF P+L   D QGL+ RL KAR ALD FID IIDDHI    ++R +N+  E    
Sbjct  202   AFNMSDFIPWLGWIDPQGLSARLVKARKALDKFIDSIIDDHI----QKRKQNNFSE----  253

Query  930   GAETDMVDELLAFYSDEM-KVNDSDDLQNAIKLTRDNIKGIIM  1055
              AETDMVD++LAFYS+E  KV++SDDLQ AI LT+DNIK IIM
Sbjct  254   DAETDMVDDMLAFYSEEARKVDESDDLQKAISLTKDNIKAIIM  296



>gb|ADR31576.1| cytochrome P450 [Populus trichocarpa]
 gb|ADR31577.1| cytochrome P450 [Populus trichocarpa]
 gb|ADR31578.1| cytochrome P450 [Populus trichocarpa]
 gb|ADR31579.1| cytochrome P450 [Populus trichocarpa]
 gb|ADR31580.1| cytochrome P450 [Populus trichocarpa]
 gb|ADR31581.1| cytochrome P450 [Populus trichocarpa]
 gb|ADR31582.1| cytochrome P450 [Populus trichocarpa]
 gb|ADR31583.1| cytochrome P450 [Populus trichocarpa]
 gb|ADR31584.1| cytochrome P450 [Populus trichocarpa]
 gb|ADR31585.1| cytochrome P450 [Populus trichocarpa]
 gb|ADR31586.1| cytochrome P450 [Populus trichocarpa]
 gb|ADR31588.1| cytochrome P450 [Populus trichocarpa]
 gb|ADR31589.1| cytochrome P450 [Populus trichocarpa]
 gb|ADR31590.1| cytochrome P450 [Populus trichocarpa]
 gb|ADR31591.1| cytochrome P450 [Populus trichocarpa]
Length=296

 Score =   409 bits (1051),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 200/283 (71%), Positives = 233/283 (82%), Gaps = 12/283 (4%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             PYPPGPKG PL+G+M++MD  +HRGLAKLA+QYGGL H++MG LHMV VS P+ ARQVLQ
Sbjct  25    PYPPGPKGLPLVGSMHMMDQITHRGLAKLAKQYGGLFHMRMGYLHMVTVSSPEIARQVLQ  84

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
              QDNIFSNRPAN+AI YL+YDRADMAFAHYGPFWRQMRKLCV+KLFSR+RAESW+SVRDE
Sbjct  85    VQDNIFSNRPANIAIRYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDE  144

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VD+ ++TV  N G  VN+GELIF LT NITYRAAFG   +  +GQDEFIKILQEFSKLFG
Sbjct  145   VDSMLKTVEANIGKPVNLGELIFTLTMNITYRAAFG---AKNEGQDEFIKILQEFSKLFG  201

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN+SDF P+L   D QGL+ RL KAR ALD FID IIDDHI    ++R +N+  E    
Sbjct  202   AFNMSDFIPWLGWIDPQGLSARLVKARKALDKFIDSIIDDHI----QKRKQNNFSE----  253

Query  930   GAETDMVDELLAFYSDEM-KVNDSDDLQNAIKLTRDNIKGIIM  1055
              AETDMVD++LAFYS+E  KV++SDDLQ AI LT+DNIK IIM
Sbjct  254   DAETDMVDDMLAFYSEEARKVDESDDLQKAISLTKDNIKAIIM  296



>emb|CDX72583.1| BnaC07g46050D [Brassica napus]
Length=329

 Score =   390 bits (1002),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 190/289 (66%), Positives = 231/289 (80%), Gaps = 8/289 (3%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             + YPPGP+GWP+IGNM +MD  +HRGLA LA++YGGL HL+MG LHM  VS P  ARQVL
Sbjct  37    RSYPPGPRGWPIIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPHVARQVL  96

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             Q QD+IFSNRPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRD
Sbjct  97    QVQDSIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRD  156

Query  567   EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLF  746
             EVD  +R+V+ N G ++N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLF
Sbjct  157   EVDKMIRSVSSNVGKSINVGEQIFALTRNITYRAAFGSACE--KGQDEFIRILQEFSKLF  214

Query  747   GAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSG  926
             GAFNV+DF P+    D QG++ RL KAR  LDGFID IID+H+     ++ +N      G
Sbjct  215   GAFNVADFIPYFGWIDPQGISKRLVKARNDLDGFIDDIIDEHM-----KKKENQNTVDDG  269

Query  927   DGAETDMVDELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIMDVMFG  1070
             D  +TDMVD+LLAFYS+E K V+++ DLQN+IKLTRDNIK IIM  + G
Sbjct  270   DVGDTDMVDDLLAFYSEEAKLVSETTDLQNSIKLTRDNIKAIIMLTLRG  318



>ref|XP_004168594.1| PREDICTED: cytochrome P450 84A1-like, partial [Cucumis sativus]
Length=314

 Score =   382 bits (981),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 185/283 (65%), Positives = 227/283 (80%), Gaps = 6/283 (2%)
 Frame = +3

Query  210   PYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQ  389
             P+PPGPKG P IGNM ++D  +HRGLAKLA +YGG+ +++MG L+M  V+ PD ARQVLQ
Sbjct  37    PFPPGPKGLPFIGNMLMIDQLTHRGLAKLAARYGGIFYMRMGFLNMFTVADPDIARQVLQ  96

Query  390   TQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDE  569
               D+I SNRPA +AISYL+Y RADMAFA+YGPFWRQMRK+CV+KLFSR+RAESW SVRD 
Sbjct  97    VHDSICSNRPATIAISYLTYSRADMAFANYGPFWRQMRKICVMKLFSRKRAESWQSVRDV  156

Query  570   VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFG  749
             VDNTV+ VA+  G+AVN+GEL+F LTR+ITYRAAFG+  S+ QGQDEFI ILQEFSKLFG
Sbjct  157   VDNTVKKVAVQTGTAVNVGELVFELTRDITYRAAFGT--STLQGQDEFISILQEFSKLFG  214

Query  750   AFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD  929
             AFN++DF P L   D QGLN RL +AR +LD FID IID+HI++ R   +K    ++   
Sbjct  215   AFNIADFIPGLRWIDPQGLNKRLIEARQSLDKFIDSIIDEHIMKKRNASSKLSNYKLE--  272

Query  930   GAETDMVDELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIM  1055
               E+DMVDELLAFYSD+   +N+S+D+QN IKL RDNIKGIIM
Sbjct  273   -TESDMVDELLAFYSDDSSIINESNDIQNNIKLNRDNIKGIIM  314



>gb|EMT06970.1| Cytochrome P450 84A1 [Aegilops tauschii]
Length=356

 Score =   383 bits (984),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 216/331 (65%), Positives = 254/331 (77%), Gaps = 19/331 (6%)
 Frame = +3

Query  705   DEFIKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQT  884
             DEFI ILQEFSKLFGAFN+ DFFP+LS  D QG+N RL  ARAALD FIDKIID+H+ + 
Sbjct  25    DEFIAILQEFSKLFGAFNIGDFFPWLSWADPQGINVRLRAARAALDEFIDKIIDEHMTRG  84

Query  885   RRRRNKNHGGEVSGDGAETDMVDELLAFYSD----EMKVNDSDDLQNAIKLTRDNIKGII  1052
             +           S D  + DMVD++LAF  +    +   +  D+LQN ++LTRDNIK II
Sbjct  85    K-----------SPDDVDADMVDDMLAFLPEAKPKKAAGDGGDELQNTLRLTRDNIKAII  133

Query  1053  MDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCC  1232
             MDVMFGGTETVASAIEWAMAE+M +P++L+RLQ+EL DTVGLDR V+ESDL+KL FLKC 
Sbjct  134   MDVMFGGTETVASAIEWAMAEMMHSPDDLRRLQKELADTVGLDRNVDESDLDKLPFLKCV  193

Query  1233  LKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRF  1412
             +KETLRLHPPIPLLLHETAE   V GY +P  SR +IN +AI RD  +W+DPD+F+P RF
Sbjct  194   IKETLRLHPPIPLLLHETAEDCVVGGYSVPRGSRVMINVFAIGRDAKAWKDPDTFRPSRF  253

Query  1413  LK-EGMP---DFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKP  1580
             +  EG     DFKG  FEF+PFGSGRRSCPGM LGLYA ELAVA L H FTW LPDGMKP
Sbjct  254   MAGEGEAAGVDFKGGCFEFLPFGSGRRSCPGMALGLYALELAVAQLTHGFTWALPDGMKP  313

Query  1581  SDLDMDDVFGLTAPKATRLVVIPTPRLNCQL  1673
             S+LDM D+FGLTAP+ATRL  +PTPRL C L
Sbjct  314   SELDMSDIFGLTAPRATRLYAVPTPRLTCPL  344



>ref|XP_010099912.1| Cytochrome P450 71A1 [Morus notabilis]
 gb|EXB80841.1| Cytochrome P450 71A1 [Morus notabilis]
Length=500

 Score =   386 bits (992),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 206/492 (42%), Positives = 308/492 (63%), Gaps = 29/492 (6%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGPKG+PL G+++L+  + H  L KLA+QYG ++H+++G +  V+VS P+ A   L
Sbjct  30    KKLPPGPKGFPLFGSLHLLGKFPHHDLQKLAKQYGPIMHMRLGLIPTVIVSSPEAAELFL  89

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             +T D +F+ RP + A  ++S+++ +++FA YG +WR +RK+C ++L S  +  ++  +R 
Sbjct  90    KTHDLVFATRPPHEAAKHISWEQRNLSFAPYGSYWRDIRKMCTLELLSSHKISTFSEMRK  149

Query  567   E----VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDE-FIKILQE  731
             E       ++R  A++   AV++   I  L  ++T R  FG   S  +  +  F  ++QE
Sbjct  150   EEIGLSIKSIREAALD-HVAVDLSARITCLNADMTCRMVFGKKYSDEEFDERGFKAVVQE  208

Query  732   FSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHG  911
                L    N+ D+ PF++  DLQG   R+ K R   D F +KIID+HI      ++K+  
Sbjct  209   GMHLAATPNLGDYIPFIAPLDLQGFTKRMKKVRRVFDEFFEKIIDEHI------QSKDDA  262

Query  912   GEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVAS  1091
             G+        D VD +L+F   +         ++  ++ R NIK II+D++ G  +T ++
Sbjct  263   GKTK------DFVDVMLSFMGSK---------ESEYRIERTNIKAIILDMVAGSMDTSST  307

Query  1092  AIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppipl  1271
             A EWA++EL+K P  LK++Q+EL   VG+DR VEESDLE+L +L   +KETLRLHP  PL
Sbjct  308   ATEWAISELIKNPRVLKKVQKELETVVGMDRTVEESDLERLEYLDMVVKETLRLHPVAPL  367

Query  1272  llhETA-EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSN  1448
             L+   A E   VNG++IP +SR +IN +AI RD NSW DP+ F P+RF+   + D +G +
Sbjct  368   LIPHAAMEDCIVNGFHIPNKSRVMINVYAIGRDPNSWTDPEKFFPERFVGSSV-DLRGRD  426

Query  1449  FEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKA  1628
             F+ IPFGSGRR CPGMQLGL    L VA L HCF WELP+GM P++LDM++ FGLT P+A
Sbjct  427   FQLIPFGSGRRGCPGMQLGLTVVRLLVAQLVHCFDWELPNGMLPAELDMEEEFGLTTPRA  486

Query  1629  TRLVVIPTPRLN  1664
               L+ IPT RL 
Sbjct  487   NHLMAIPTCRLQ  498



>ref|XP_002280620.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=498

 Score =   385 bits (990),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 200/491 (41%), Positives = 303/491 (62%), Gaps = 29/491 (6%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGP+G P++GN++++    H+ L +LA++YG +++++   +  +VVS P  A Q L
Sbjct  29    KRLPPGPRGIPILGNLHMLGELPHQDLLRLAKKYGPIMYMRFALVPTIVVSSPQAAEQFL  88

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSV-R  563
             +T D +F+ RP +     +SYDR  ++F  YGP+WR MRKLC + L S  R  S+  + R
Sbjct  89    KTNDLVFAGRPPHEGSRIVSYDRKGISFTDYGPYWRNMRKLCTLGLLSNLRISSFQPLRR  148

Query  564   DEVDNTVRTV--AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDE--FIKILQE  731
             +E+D  ++++  A    +AV++   I  L+ +++ R  FG      +  DE  F  ++QE
Sbjct  149   EELDLLIKSLKEAALARTAVDLSAKISSLSADMSCRMIFGKK-YMDKDIDERGFKAVIQE  207

Query  732   FSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHG  911
               +L GA N+ D+ PF++  DLQGL  R+       D F +KIIDDHI + +        
Sbjct  208   GMQLAGAPNIGDYIPFVAPLDLQGLARRMKAISKVFDAFFEKIIDDHIHEPKE-------  260

Query  912   GEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVAS  1091
                  +G   D++D +L +   +         +N  ++ R NIK +++D++ G  +T A+
Sbjct  261   -----EGQPKDLIDVMLGYMGSK---------ENEFQIERSNIKALVLDMLAGSMDTSAT  306

Query  1092  AIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlh-ppip  1268
             AIEWA+AEL+K P  +K++Q+EL   VG++RKVEESDLE L +L   +KETLRLH     
Sbjct  307   AIEWALAELLKNPRIMKKVQEELEKVVGMERKVEESDLESLEYLDMVVKETLRLHPVAPL  366

Query  1269  lllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSN  1448
             L+ HE+ E   VNG++IP +SR ++N +AI RD N W D + F P+RF+   + D +G +
Sbjct  367   LIPHESLEDCTVNGFHIPQKSRVMVNTYAIGRDPNVWTDAEKFLPERFIGSSI-DLRGRD  425

Query  1449  FEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKA  1628
             F+ IPFGSGRR CPGMQLGL    L +A L HCF WELP+GM PS+LDM + FGLT P+A
Sbjct  426   FQLIPFGSGRRGCPGMQLGLTVVRLVLAQLVHCFDWELPNGMMPSELDMTEEFGLTVPRA  485

Query  1629  TRLVVIPTPRL  1661
               ++ +PT RL
Sbjct  486   KHILAVPTYRL  496



>ref|XP_002305459.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE85970.1| cytochrome P450 family protein [Populus trichocarpa]
Length=424

 Score =   383 bits (983),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 205/397 (52%), Positives = 266/397 (67%), Gaps = 44/397 (11%)
 Frame = +3

Query  228   KGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIF  407
             +G+P+IGNM +MD  +HRGLA+L+ QYGGL HL+M  LH+VVVS P+ AR+VLQ QD +F
Sbjct  41    RGYPIIGNMGMMDQLTHRGLARLSRQYGGLCHLQMRGLHVVVVSTPEIAREVLQVQDIVF  100

Query  408   SNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVR  587
             +NRPANVAI YL+YDRAD+  A+YG FW QMRK+CV+KLFSR+RAESW SVRDEV+  +R
Sbjct  101   ANRPANVAIVYLTYDRADLGCANYGSFWCQMRKVCVMKLFSRKRAESWASVRDEVEFIIR  160

Query  588   TVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSD  767
              V    G  VNIGEL+  L                 +GQ+EF+ ILQEFSKLFGA+NV+D
Sbjct  161   QVLKKTGEPVNIGELVLLLAH------------LQMKGQEEFVSILQEFSKLFGAYNVAD  208

Query  768   FFPFLSCFDLQGLNPRLAKAR--------------AALDGFIDKIIDDHILQTRRRRNKN  905
             FFP+L     +  N RLAKA                +LDGFI+ IID+H+++ +   + N
Sbjct  209   FFPWLGWIHARDFNKRLAKAGNPEDGQGPKFVNYFGSLDGFIETIIDEHLIKKKTSESLN  268

Query  906   HGGEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETV  1085
                E   +  +TDMVDELLAFYS++   N+ D+ ++ IK  +DNIK +IMDVMFGGTETV
Sbjct  269   SKDE--NEEVDTDMVDELLAFYSEDASKNNFDESKSTIKFNKDNIKALIMDVMFGGTETV  326

Query  1086  ASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppi  1265
             ASAIE A+AELMK+P++LKR+QQEL D VG +RK  +  +  L  L   +K+        
Sbjct  327   ASAIERAVAELMKSPDDLKRVQQELEDVVGFNRK--KPYVSTLQSLSSYMKQLKIY----  380

Query  1266  plllhETAEATEVNGYYIPARSRAIINAWAIARDKNS  1376
                       T +NGY +PARSR +INAWAI RD N+
Sbjct  381   ----------TILNGYRVPARSRVMINAWAIGRDPNA  407



>ref|XP_009336569.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=507

 Score =   383 bits (983),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 209/489 (43%), Positives = 294/489 (60%), Gaps = 27/489 (6%)
 Frame = +3

Query  216   PPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQ  395
             PPGP   P+IGN++++    HR L  LA++YG ++ + +GS+  +VVS P  A+  L+T 
Sbjct  35    PPGPSALPVIGNLHMLGDLPHRSLQNLAKKYGPIMSMHLGSIPTIVVSSPKTAKLFLKTH  94

Query  396   DNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSV-RDEV  572
             D IF++RP   A  Y++Y    MAF  YGP+WR +RKLC ++L    + ES+  + R+EV
Sbjct  95    DTIFASRPKLQASEYMAYGTKAMAFTEYGPYWRHIRKLCTLQLLCPSKIESFAPLRREEV  154

Query  573   DNTVRT--VAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEF-IK-ILQEFSK  740
                V++  VA   G  V+  E +  L   ITYR   G      +  D F +K I++E   
Sbjct  155   GLLVQSLKVAAEAGEVVDFSEKVGELVEGITYRMVLGR-----KNDDMFDLKGIIEEALF  209

Query  741   LFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEV  920
             L GAFN+SD+ PFLS  DLQGL  R+ +    +D  ++KII DH L +RR + K+H    
Sbjct  210   LTGAFNISDYVPFLSPLDLQGLTKRMKRVSKTVDQLLEKIIQDHELVSRREQGKHH----  265

Query  921   SGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIE  1100
                    D VD LL+     +  ND    +    L R N K I++D++ G  +T A+AI 
Sbjct  266   ------KDFVDVLLSSIHQPLNPND----EEVYMLERTNAKAILLDMIAGAFDTSATAII  315

Query  1101  WAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlh-ppiplll  1277
             W +AEL++ P+ +KRLQ+EL   +G+DR VEESDL KL +L   +KE+LRLH     L+ 
Sbjct  316   WTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLSMVVKESLRLHPVAPLLVP  375

Query  1278  hETAEATEVNGYYIPARSRAIINAWAIARDKNSWED-PDSFKPDRFLKEGMPDFKGSNFE  1454
             H++ E   V+GY+IP +SR  IN W I RD + W D  + F P+RF+   + D +G +F+
Sbjct  376   HQSMEDITVDGYHIPKKSRIFINIWTIGRDPSVWSDNVEEFYPERFMNSNV-DLRGHDFQ  434

Query  1455  FIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATR  1634
              IPFGSGRR CP MQLGL    LA+ +L HCF WELP GM P DLDM + FGL+  KA  
Sbjct  435   LIPFGSGRRGCPAMQLGLTTVRLALGNLLHCFNWELPSGMLPKDLDMTEKFGLSLSKAKH  494

Query  1635  LVVIPTPRL  1661
             L+ +PT RL
Sbjct  495   LLAMPTCRL  503



>ref|XP_010027781.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54384.1| hypothetical protein EUGRSUZ_I00335 [Eucalyptus grandis]
Length=500

 Score =   380 bits (976),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 205/493 (42%), Positives = 302/493 (61%), Gaps = 29/493 (6%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGP G+P++GN+ L+    H  L KLA++YG L++L++G +H +VVS P+ A Q L
Sbjct  29    KKLPPGPIGYPILGNLPLLGQNPHHDLHKLAQKYGPLMYLRLGFVHTIVVSSPELAEQFL  88

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSV-R  563
             +T D +F++RP + A  ++SY++  +AFA YGP+WR +RK+C ++L S  +  S+ S+ R
Sbjct  89    KTHDLVFASRPPHEASKHISYEQRSLAFAPYGPYWRNIRKMCTLELLSNAKINSFKSMRR  148

Query  564   DEVDNTVRTV--AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDE-FIKILQEF  734
             +EV   V  +  A +  +A+++   IF L+ +++ R  FG      +  +  F  ++QE 
Sbjct  149   EEVGLLVNFLKDAAHDHTAIDLTSKIFSLSADMSCRMVFGKKYMDKEFDERGFKAVIQEG  208

Query  735   SKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGG  914
               L    N+ D+ P+L+ FDLQGL  R+       D F +KIID+H+   +         
Sbjct  209   MVLGATPNIGDYVPYLARFDLQGLTKRMKAVSKVFDAFFEKIIDEHMKSMKE--------  260

Query  915   EVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASA  1094
                 +G   D VD +L F    M +N+ +       + R +IK II+D++ G  +T A+A
Sbjct  261   ----EGESKDFVDVMLGF----MGLNEGE-----YHIDRPHIKAIILDMLSGSMDTSATA  307

Query  1095  IEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlh-ppipl  1271
             I+WAM EL++ P  +KR+Q EL   VG++R VEESDLE L +L   +KET+RLH     L
Sbjct  308   IDWAMTELVRHPSAMKRVQDELEKAVGMNRAVEESDLEGLHYLDMVIKETMRLHPVAPLL  367

Query  1272  llhETAEATEVNGYYIPARSRAIINAWAIARDKNSW--EDPDSFKPDRFLKEGMPDFKGS  1445
             L HE  E   VNG++IP +SR I+N W+I RD   W   DP+ F P+RFL   M D KG 
Sbjct  368   LPHEATEDCTVNGFHIPLKSRVIVNVWSIGRDPKVWTTHDPEEFIPERFLGSSM-DVKGR  426

Query  1446  NFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPK  1625
             +F+ +PFG+GRR CPGMQLGL      +A L HCF W+LP G+ PS+LDM + FGLTAP+
Sbjct  427   DFQLLPFGAGRRGCPGMQLGLTIVRFVLAQLVHCFDWDLPAGISPSELDMTEEFGLTAPR  486

Query  1626  ATRLVVIPTPRLN  1664
             A  LVV+P  RL+
Sbjct  487   AKHLVVMPRYRLS  499



>ref|XP_002276487.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=494

 Score =   378 bits (971),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 202/492 (41%), Positives = 297/492 (60%), Gaps = 29/492 (6%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGP+G P++GNM+++    HR L  L+++YG ++++++G +  +VVS P  A Q L
Sbjct  25    KRLPPGPRGIPILGNMHMLGSLPHRALQALSKKYGPIMYMRLGFVPAIVVSSPQAAEQFL  84

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSV-R  563
             +T D +F+NRP +    ++ YD   ++F+ YGP+WR MRKLC ++L + R+  S+  + R
Sbjct  85    KTHDLVFANRPPHECSRHMLYDGKGISFSGYGPYWRSMRKLCTLELLTSRKINSFKPMRR  144

Query  564   DEVDNTVRTV--AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDE--FIKILQE  731
             +EV   +++   A   G+AV++   +  L+ +++ R  FG      +  DE  F  ++QE
Sbjct  145   EEVGLLIKSFEEAARAGAAVDVSAKVALLSADMSCRMVFGKK-YMDKDLDERGFKAVIQE  203

Query  732   FSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHG  911
               +L    N+ D+ P L   DLQGL  R+       D F +KIID+HI + +        
Sbjct  204   AMQLAATPNIGDYIPCLLGLDLQGLTRRIKATGKVFDDFFEKIIDEHIHKPKE-------  256

Query  912   GEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVAS  1091
                  +G   D+VD +L     E         +    + R NIK I +D+M    +T A+
Sbjct  257   -----EGQTKDLVDVMLDLMGSE---------ETEYNIQRANIKAISLDMMAASMDTSAT  302

Query  1092  AIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlh-ppip  1268
              IEWA++EL+K P  +K++  EL   VG++R VEESDLE L +L   +KETLRLH     
Sbjct  303   MIEWALSELIKHPPMMKKVINELEKVVGMERMVEESDLESLEYLNMVVKETLRLHPVAPL  362

Query  1269  lllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSN  1448
             L+ HE+ E   V+G++IP +SR I+N WAI RD N+W D D F P+RF++  + DF+G +
Sbjct  363   LIPHESMEDCTVDGFHIPQKSRVIVNVWAIGRDPNAWTDADKFLPERFMESDI-DFRGQH  421

Query  1449  FEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKA  1628
             F+FIPFGSGRR CPGMQLGL    L +A L HCF WELPD M PS+LDM + FGLT P+A
Sbjct  422   FQFIPFGSGRRGCPGMQLGLTVVRLVLAQLVHCFDWELPDNMLPSELDMTEEFGLTLPRA  481

Query  1629  TRLVVIPTPRLN  1664
               LV IPT RL+
Sbjct  482   KHLVAIPTCRLH  493



>ref|XP_010099909.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|EXB80838.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=498

 Score =   377 bits (968),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 199/490 (41%), Positives = 299/490 (61%), Gaps = 26/490 (5%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGPKG+PL G+M+L+  + H  L KLA++YG ++H+++G +  ++VS P+ A   L
Sbjct  30    KKLPPGPKGFPLFGSMHLLGKFLHHDLHKLAKKYGPIMHMRLGLIPTIIVSSPEAAELFL  89

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR-  563
             +T D +F++RP   A  Y+ ++  D+ FA YG +WR MRK+C ++L +  +  S+ ++R 
Sbjct  90    KTHDLVFASRPHIEAAKYMFWEYRDLVFAPYGSYWRYMRKMCTLELLNSVKISSFKAIRK  149

Query  564   DEVDNTVRTV--AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDE-FIKILQEF  734
             +E+   + T+  A     +V++   +  L  +++ R  FG      +  +  F  ++QE 
Sbjct  150   EEIGQLIDTIQKAARERVSVDLSAKVTTLNADMSCRMVFGKKYLDKEFDERGFKVVIQEA  209

Query  735   SKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGG  914
               L    N+ DF PF++  DLQG   R+       D F +KII+DHIL            
Sbjct  210   MHLAAIPNLGDFIPFIAPLDLQGYTKRMKVVAKVFDDFFEKIIEDHILSK----------  259

Query  915   EVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASA  1094
                 D    D VD +L+     M+  DS+      ++ R NIK +++D++    +T ASA
Sbjct  260   --DEDSKTKDFVDVMLSL----MESADSE-----YRIERPNIKAVMLDMLVASMDTSASA  308

Query  1095  IEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppipll  1274
             IEWA++EL+K P  L ++Q+EL   VG++R VEE+DLE L +L   +KETLRLHP +PL 
Sbjct  309   IEWAISELIKQPRVLMKVQKELETVVGMERMVEETDLEMLEYLDMVVKETLRLHPVVPLF  368

Query  1275  lhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFE  1454
              H   E   +NG++IP +SR I+NAWAI RD N+W DP+ F P+RFL   + D KG +F+
Sbjct  369   HHAAMEECTINGFHIPKKSRVIVNAWAIGRDPNAWNDPEKFIPERFLGSSI-DLKGRDFQ  427

Query  1455  FIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATR  1634
              IPFG+GRR CPG+QLGL   +L VA L HCF WELP+G+ P++LDM + FGLT P+A  
Sbjct  428   LIPFGAGRRHCPGLQLGLIVVKLVVAQLVHCFDWELPNGVIPTELDMTEEFGLTTPRANH  487

Query  1635  LVVIPTPRLN  1664
             L+ IPT RL+
Sbjct  488   LLAIPTYRLH  497



>ref|XP_006428071.1| hypothetical protein CICLE_v10027549mg [Citrus clementina]
 ref|XP_006464323.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
 gb|ESR41311.1| hypothetical protein CICLE_v10027549mg [Citrus clementina]
Length=498

 Score =   377 bits (968),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 199/491 (41%), Positives = 296/491 (60%), Gaps = 28/491 (6%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGPKG+P+ G ++L+  + HR L KLAE+YG ++HL++G    +VVS P  A   L
Sbjct  30    KKLPPGPKGFPIFGCLHLLGQFPHRALHKLAERYGPIMHLRLGLTPTIVVSSPQAAELFL  89

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR-  563
             +T D IF++RP   A  ++SY++  +A + YG +WR +RK+C ++L S  +  S+ ++R 
Sbjct  90    KTHDLIFASRPPLKAAKHISYEQKGLALSPYGSYWRTIRKICTLELLSSFKINSFQAMRK  149

Query  564   DEVDNTVRTV--AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDE-FIKILQEF  734
             +E+D  + ++  A      V++   +  ++ ++T R  FG   S  +  +  F  ++QE 
Sbjct  150   EELDLLIASIKEAACARCVVDLSTKVSAMSADMTCRMVFGKKYSDDEFDERGFKTVIQEG  209

Query  735   SKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGG  914
              +L    N+ D+ P ++  DLQGL  R+       DGF++KIID+H+      R K    
Sbjct  210   MELAAKPNLGDYIPQIAGLDLQGLTKRMKSVAKVFDGFLEKIIDEHVQSKDENRTK----  265

Query  915   EVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASA  1094
                      D VD +L+F   E         +   K+ R++IK II+D++    +T A+A
Sbjct  266   ---------DFVDVMLSFEGSE---------ETEHKIEREHIKAIILDMLSAAMDTSATA  307

Query  1095  IEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlh-ppipl  1271
             +EWA++EL+K P+ +K+LQ+EL   VGL R VEESDLE L +L   +KETLRLH     L
Sbjct  308   VEWALSELIKHPKVMKKLQKELEKIVGLCRMVEESDLENLEYLDMVVKETLRLHPVAPLL  367

Query  1272  llhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNF  1451
             + HE+ E   VNG+YIP  SR I+N WAI RD  SW DP+ F P+RF+   + D +G +F
Sbjct  368   IPHESTEDCTVNGFYIPKNSRVIVNVWAIGRDTESWSDPEIFFPERFVGSSI-DLRGHDF  426

Query  1452  EFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKAT  1631
             + +PFGSGRR CPGMQLGL   +  +A L HCF WELP GM P++LD+ + F L  PKA 
Sbjct  427   QLLPFGSGRRGCPGMQLGLTIVKQVIAQLVHCFDWELPGGMLPTELDLTEEFSLVTPKAK  486

Query  1632  RLVVIPTPRLN  1664
              L+ IP+ RLN
Sbjct  487   HLLAIPSYRLN  497



>ref|XP_004301061.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=504

 Score =   376 bits (966),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 205/489 (42%), Positives = 292/489 (60%), Gaps = 25/489 (5%)
 Frame = +3

Query  216   PPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQ  395
             PPGP+  P+IGN++++ +  HR L  LA+QYG ++ +++G++  +V+S P  A   L+T 
Sbjct  33    PPGPRPLPIIGNLHMLGNLPHRTLQNLAKQYGDIMSIRLGNVPTIVISSPKAAELFLKTH  92

Query  396   DNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR-DEV  572
             D  F++RP   A  YLSY    MAF+ YGP+WR +RKLC ++LF   + E++  +R +E+
Sbjct  93    DTNFASRPKIQASEYLSYGTKGMAFSEYGPYWRHVRKLCTLQLFCSAKLEAFAPLRKEEL  152

Query  573   DNTVRTV--AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEF--IKILQEFSK  740
                V  +  A   G  V++ E I  +   ITYR   G      +  D F    I++E   
Sbjct  153   GGLVGKLKKAAEEGEVVDVSEKIGEMNEGITYRMVLGC-----KRDDRFDLKAIVEEMFF  207

Query  741   LFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEV  920
             L GAFN+SDF P LS FD+QGL  RL K    +D  +DKIIDDH      +  +  GG+ 
Sbjct  208   LVGAFNISDFIPSLSAFDIQGLTKRLKKVSRTVDQLLDKIIDDH-----EQAAETEGGK-  261

Query  921   SGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIE  1100
                G   D VD LL+F    +  ND    +    L R+N+K I++D++    +T A+ I 
Sbjct  262   --QGQHEDFVDVLLSFTKQPLNPND----EQVHFLDRENVKAILLDMITAAFDTSATTII  315

Query  1101  WAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKET-lrlhppiplll  1277
             W++AELM+ P  +K+LQ+EL   VG+DR VEESDL KL +L   +KE+         LL 
Sbjct  316   WSLAELMRHPRIMKQLQEELQIVVGMDRGVEESDLPKLDYLNLVVKESFRLHPVAPLLLP  375

Query  1278  hETAEATEVNGYYIPARSRAIINAWAIARDKNSW-EDPDSFKPDRFLKEGMPDFKGSNFE  1454
             HE+ +   ++GY IP +SR I+N W+IARD N W E+ + F P+RF    + D +G +++
Sbjct  376   HESIKDITIDGYDIPKKSRLIVNFWSIARDPNVWSENVEEFCPERFTNSNI-DLQGHDYQ  434

Query  1455  FIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATR  1634
              IPFG+GRR CPGMQLGL    L +A L HCF WELP+GM P DLDM + FGL+  KA  
Sbjct  435   LIPFGTGRRGCPGMQLGLTTVRLVLAQLMHCFNWELPNGMLPQDLDMTEKFGLSLSKAKH  494

Query  1635  LVVIPTPRL  1661
             L+  PT RL
Sbjct  495   LLAKPTYRL  503



>ref|XP_009337209.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=506

 Score =   376 bits (966),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 207/487 (43%), Positives = 291/487 (60%), Gaps = 21/487 (4%)
 Frame = +3

Query  216   PPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQ  395
             PPGP+  P+IGN++++ +  HR L  LA++YG ++ +++GS   +VVS P  A   L+T 
Sbjct  36    PPGPRALPIIGNLHMLGNLPHRSLQNLAKKYGPIMSMRLGSKTTIVVSSPKAAELFLKTH  95

Query  396   DNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR-DEV  572
             D IF++RP   +  ++SY    MAF+ YGP+WR +RKLC ++L S  R E++  +R +EV
Sbjct  96    DTIFASRPQVQSSKHMSYGTKAMAFSEYGPYWRHVRKLCTLQLLSPSRIEAFAPLRKEEV  155

Query  573   DNTVRT--VAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLF  746
                V++  VA   G  V++ E +  L   ITYR   G          +   I++E   L 
Sbjct  156   GLLVQSLKVAAEAGEVVDLSEKVSDLVVGITYRMVLG---RKNNEMFDLKGIIEEVMFLS  212

Query  747   GAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSG  926
             GAFN+SD+ PFL   DLQGL  R+ +    +D   +KII DH   +R         +V G
Sbjct  213   GAFNISDYVPFLIPLDLQGLTKRMKRISKTVDQLFEKIIQDHEQVSRSE-------QVQG  265

Query  927   DGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
             +  + D VD LL+     +  ND    +      R N K I++D++ G  +T A+AI W 
Sbjct  266   NHHK-DFVDVLLSLIHQPLNPND----EEVYMFERTNAKAILLDMISGSFDTSATAIVWT  320

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhpp-iplllhE  1283
             +AEL++ PE +KRLQ+EL   VG+DR VEESDL KL +L   +KETLRLHP    L+ H+
Sbjct  321   LAELLRHPEVMKRLQKELQSVVGVDRMVEESDLPKLDYLSMVVKETLRLHPVGPLLIPHQ  380

Query  1284  TAEATEVNGYYIPARSRAIINAWAIARDKNSWED-PDSFKPDRFLKEGMPDFKGSNFEFI  1460
             + E   V+GY+IP +SR  IN W I RD N W D  + F P+RF+   + D +G +F+ I
Sbjct  381   SMEDVIVDGYHIPKKSRVFINIWTIGRDPNVWSDNVEEFYPERFMNSNV-DLQGHDFQLI  439

Query  1461  PFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLV  1640
             PFGSGRR CP MQLGL    LA+ +L HCF WELP GM P DLDM + FGL+  KA  L+
Sbjct  440   PFGSGRRRCPAMQLGLTTVRLALGNLVHCFNWELPTGMLPKDLDMTEKFGLSLSKAKHLL  499

Query  1641  VIPTPRL  1661
              +PT RL
Sbjct  500   AMPTHRL  506



>gb|ACM89788.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
 gb|ACN89833.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
Length=495

 Score =   376 bits (965),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 199/492 (40%), Positives = 297/492 (60%), Gaps = 29/492 (6%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGP+G P++GNM+++    HR L  L+++YG ++++++G +  +VVS P  A Q L
Sbjct  26    KRLPPGPRGIPILGNMHMLGSLPHRALQALSKKYGPIMYMRLGFVPAIVVSSPQAAEQFL  85

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSV-R  563
             +T D +F+NRP +    ++ YD   ++F+ YGP+WR MRKLC+++L S  +  S+  + R
Sbjct  86    KTHDLVFANRPPHECSRHMLYDGKGISFSGYGPYWRSMRKLCILELLSSHKINSFKPMRR  145

Query  564   DEVDNTVRTV--AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDE--FIKILQE  731
             +EV   +++   A   G+AV++   +  L+ +++ R  FG      +  DE  F  +++E
Sbjct  146   EEVGLLIKSFEEAARAGAAVDVSAKVALLSADMSCRMVFGKK-YMDKDLDERGFKAVIKE  204

Query  732   FSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHG  911
               +L    N+ D+ P L   DLQGL  R+       D F +KIID+HI + +        
Sbjct  205   VMQLAATPNIGDYIPCLLGLDLQGLTRRIKATAKVFDDFFEKIIDEHIHKPKE-------  257

Query  912   GEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVAS  1091
                  +G   D+VD +L     E         +    + R NIK I +D+M    +T A+
Sbjct  258   -----EGQTKDLVDVMLDLMGSE---------ETEYNIQRANIKAISLDMMAASMDTSAT  303

Query  1092  AIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlh-ppip  1268
              IEWA++EL+K P  +K+++ EL   VG++R VEESDLE L +L   +KETLRLH     
Sbjct  304   TIEWALSELIKHPPMMKKVRNELEKVVGMERMVEESDLESLEYLNMVVKETLRLHPVVPL  363

Query  1269  lllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSN  1448
             L+ HE+ E   V+G++IP +SR I+N WAI RD N+W D D F P+RF++  + DF+G +
Sbjct  364   LIPHESIEDCTVDGFHIPQKSRVIVNVWAIGRDPNAWTDADKFLPERFMESDI-DFRGQH  422

Query  1449  FEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKA  1628
             F+FIPFGSGRR CPGMQLGL    L +A L HCF WELPD M  S+LDM++ FGLT P+A
Sbjct  423   FQFIPFGSGRRGCPGMQLGLTVVRLVLAQLVHCFDWELPDNMLASELDMNEEFGLTLPRA  482

Query  1629  TRLVVIPTPRLN  1664
               LV IPT R +
Sbjct  483   KHLVAIPTCRFH  494



>ref|XP_009346975.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=507

 Score =   375 bits (964),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 205/489 (42%), Positives = 293/489 (60%), Gaps = 27/489 (6%)
 Frame = +3

Query  216   PPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQ  395
             PPGP   P+IGN++++    HR L  LA++YG ++ +++GS+  +VVS P  A+  L+T 
Sbjct  35    PPGPMALPIIGNLHMLGDLPHRSLQNLAKKYGPIMSMRLGSIPTIVVSSPKTAKLFLKTH  94

Query  396   DNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSV-RDEV  572
             D IF++RP   A  Y++Y    MAF+ YGP+WR +RKLC ++L    + ES+  + R+EV
Sbjct  95    DTIFASRPKLQASEYMAYGTKAMAFSEYGPYWRHIRKLCTLQLLCPSKIESFAPLRREEV  154

Query  573   DNTVRT--VAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEF-IK-ILQEFSK  740
                V++  VA   G  V+  E +  L   ITYR   G      +  D F +K I++E   
Sbjct  155   GLLVQSLKVAAEAGEVVDFSEKVGELVEGITYRMVLGR-----KNDDMFDLKGIIEEALF  209

Query  741   LFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEV  920
             L GAFN+SD+ PFLS  D+QGL  R+ +    +D  ++KII DH   +R  +  +H    
Sbjct  210   LTGAFNISDYVPFLSPLDVQGLTKRMKRVSKTVDQLLEKIIQDHEQGSRSEQGNHH----  265

Query  921   SGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIE  1100
                    D VD LL+     +K ND    +    L R N K I++D++ G  +T A+AI 
Sbjct  266   ------KDFVDVLLSSIHQPLKPND----EEVYMLERTNAKAILLDMIAGAFDTSATAII  315

Query  1101  WAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlh-ppiplll  1277
             W +AEL++ P+ +KRLQ+EL   +G+DR VEESDL KL +L   +KE+LRLH     L+ 
Sbjct  316   WTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLSMVVKESLRLHPVAPLLVP  375

Query  1278  hETAEATEVNGYYIPARSRAIINAWAIARDKNSWED-PDSFKPDRFLKEGMPDFKGSNFE  1454
             H++ E   V+GY+IP +SR  IN W I RD + W D  + F P+RF+   + D +G +F+
Sbjct  376   HQSMEDITVDGYHIPKKSRIFINIWTIGRDPSVWSDNVEEFYPERFMNSNV-DLRGHDFQ  434

Query  1455  FIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATR  1634
              IPFGSGRR CP MQLGL     A+ +L HCF WELP GM P DLDM + FGL+  KA  
Sbjct  435   LIPFGSGRRGCPAMQLGLTTVRFALGNLLHCFNWELPSGMLPKDLDMTEKFGLSLSKAKH  494

Query  1635  LVVIPTPRL  1661
             L+ +PT RL
Sbjct  495   LLAMPTCRL  503



>ref|XP_010027875.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54512.1| hypothetical protein EUGRSUZ_I00454 [Eucalyptus grandis]
Length=500

 Score =   375 bits (963),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 202/493 (41%), Positives = 304/493 (62%), Gaps = 29/493 (6%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGP+G+P++GN+ L+    +  L KLA++YG L++L++G +H +VVS P+ A Q L
Sbjct  29    KKLPPGPRGYPILGNLPLLGQNPNHDLHKLAQKYGPLMYLRLGFVHTIVVSSPEVAEQFL  88

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSV-R  563
             +T D +F++RP + A  ++SY++  +AFA YGP+WR +RK+C ++L S  +  S+ S+ R
Sbjct  89    KTHDLVFASRPPHEASKHISYEQRSLAFAPYGPYWRNIRKMCTLELLSNAKINSFKSMRR  148

Query  564   DEVDNTVRTV--AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDE-FIKILQEF  734
             +EV   V  +  A +  +A+++   I  L+ +++ R  FG      +  +  F  ++QEF
Sbjct  149   EEVGLLVNFLKDAAHDHTAIDLSSKISSLSADMSCRMVFGKKYMDKEFDERGFKAVIQEF  208

Query  735   SKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGG  914
               L    N+ D+ P+L+ FDLQGL  R+       D F +KIID+H+      ++K   G
Sbjct  209   MVLGATPNIGDYVPYLARFDLQGLTKRMKAVSKVFDAFFEKIIDEHM------KSKKEEG  262

Query  915   EVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASA  1094
             E        D VD +L F    M +N+ +       + R +IK II+D++ G  +T A+A
Sbjct  263   E------SKDFVDVMLGF----MGLNEGE-----YHIDRPHIKAIILDMLLGSMDTSATA  307

Query  1095  IEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlh-ppipl  1271
             I+WAM EL++ P  +K++Q EL   VG++R VEESDLE L +L   +KET+RLH     L
Sbjct  308   IDWAMTELVRHPSAMKKVQDELEKAVGMNRAVEESDLEGLHYLDMVIKETMRLHPVAPLL  367

Query  1272  llhETAEATEVNGYYIPARSRAIINAWAIARDKNSW--EDPDSFKPDRFLKEGMPDFKGS  1445
             L HE  E   VNG+++P +SR I+N W+I RD   W   +P+ F P+RFL   M D KG 
Sbjct  368   LPHEATEDCTVNGFHMPLKSRVIVNVWSIGRDPKVWTTHNPEEFIPERFLGLSM-DVKGR  426

Query  1446  NFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPK  1625
             +F+ +PFG+GRR CPGMQLGL      +A L HCF W+LP G+ PS+LDM + FGLT P+
Sbjct  427   DFQLLPFGAGRRGCPGMQLGLTVVRFVLAQLVHCFDWDLPAGISPSELDMTEEFGLTTPR  486

Query  1626  ATRLVVIPTPRLN  1664
             A  LVV+P  RL+
Sbjct  487   AKHLVVMPQYRLS  499



>gb|AAL66194.1|AF386512_1 cytochrome P450 [Pyrus communis]
Length=506

 Score =   375 bits (963),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 202/488 (41%), Positives = 284/488 (58%), Gaps = 26/488 (5%)
 Frame = +3

Query  216   PPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQ  395
             PPGP   P+IGN++++    HR L  LA++YG ++ +++GS+  +VVS P  A+  L+T 
Sbjct  35    PPGPAALPIIGNLHMLGDLPHRSLQNLAKKYGPIMSMRLGSVPTIVVSSPKTAKLFLKTH  94

Query  396   DNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSV-RDEV  572
             D IF++RP   A  Y++Y    MAF  YGP+WR +RKLC ++L    + ES+  + R+EV
Sbjct  95    DTIFASRPKLQASEYMAYGTKAMAFTEYGPYWRHIRKLCTLQLLCPSKIESFAPLRREEV  154

Query  573   DNTVRT--VAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEF-IK-ILQEFSK  740
                V++  VA   G  V+  E +  L   ITYR   G      +  D F +K I++E   
Sbjct  155   GLLVQSLKVAAEAGEVVDFSEKVGELVEGITYRMVLGR-----KNDDMFDLKGIIEEALF  209

Query  741   LFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEV  920
             L GAFN+SD+ PFLS  DLQGL  R+ +    +D   +KII DH  Q  R    NH    
Sbjct  210   LTGAFNISDYVPFLSPLDLQGLTKRMKRVSKTVDQLFEKIIQDH-EQVSRSEQGNH----  264

Query  921   SGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIE  1100
                    D VD LL+     +K ND    +    L R N K  ++D++ G  +T A+AI 
Sbjct  265   -----HKDFVDVLLSSIHQTLKPND----EEVYMLERTNAKATLLDMIAGAFDTSATAII  315

Query  1101  WAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKET-lrlhppiplll  1277
             W +AEL++ P+ +KRLQ+EL   +G+DR VEESDL KL +L   +KE+         L+ 
Sbjct  316   WTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLSMVVKESFRLHPVAPLLVP  375

Query  1278  hETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEF  1457
             H++ E   V+GY+ P +SR  IN W I RD  SW++ + F P+RF+   + D +G +F+ 
Sbjct  376   HQSMEDITVDGYHTPKKSRIFINIWTIGRDPKSWDNAEEFYPERFMNRNV-DLRGHDFQL  434

Query  1458  IPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRL  1637
             IPFGSGRR CP MQLGL    LA+ +L HC  WELP GM P DLDM + FGL+  KA  L
Sbjct  435   IPFGSGRRGCPAMQLGLTTVRLALGNLLHCSNWELPSGMLPKDLDMTEKFGLSLSKAKHL  494

Query  1638  VVIPTPRL  1661
             +  PT RL
Sbjct  495   LATPTCRL  502



>ref|XP_010030392.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54382.1| hypothetical protein EUGRSUZ_I00333 [Eucalyptus grandis]
Length=499

 Score =   374 bits (961),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 207/493 (42%), Positives = 299/493 (61%), Gaps = 29/493 (6%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGP+G+P++GN+ L+    H  L KLA++YG L++L++G +  ++VS P+ A Q L
Sbjct  28    KKLPPGPRGFPILGNLPLLGKNPHHDLHKLAKKYGPLMYLRLGFVPTILVSSPEVAEQFL  87

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSV-R  563
             +T D IF++RP + A  ++SY++  +AFA YGP+WR +RK+C ++L S  +  S+ S+ R
Sbjct  88    KTHDLIFASRPPHEAAKHISYEQRSLAFAPYGPYWRNIRKMCTLELLSNAKIYSFRSMRR  147

Query  564   DEVDNTVRTV--AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDE-FIKILQEF  734
             DEV   V  +  A +   A+++   I  L+ +++    FG      +  +  F  ++QE 
Sbjct  148   DEVSLLVNFLKDASHDHMAIDLSAKISSLSADMSCLMVFGKKYMDREFDERGFKAVVQEV  207

Query  735   SKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGG  914
               L    N+ D+ PFL+ FDLQGL  R+       D F +KIID+H L+T++        
Sbjct  208   MVLTATPNIGDYVPFLASFDLQGLTKRMKAVSRVFDAFFEKIIDEH-LETKKE-------  259

Query  915   EVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASA  1094
                 +G   D VD +L      M +N+ +       + R +IK II+D++ G  +T A+A
Sbjct  260   ----EGQTKDFVDVMLGI----MGLNEGE-----YHIDRPHIKAIILDMLAGSMDTSATA  306

Query  1095  IEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlh-ppipl  1271
             IEWAMAEL+K P  +K+L++EL    GL+R VEESDLE L +L   +KET+RLH     L
Sbjct  307   IEWAMAELIKHPRAMKKLREELEKAAGLNRVVEESDLEGLDYLHMVIKETMRLHPVAPLL  366

Query  1272  llhETAEATEVNGYYIPARSRAIINAWAIARDKNSW--EDPDSFKPDRFLKEGMPDFKGS  1445
             L HE  E   VNG++IP +SR I+N W+I RD   W   DP+ F P+RFL   + D KG 
Sbjct  367   LPHEATEDCTVNGFHIPYKSRVIVNVWSIGRDPKVWTTHDPEEFVPERFLGSSV-DVKGR  425

Query  1446  NFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPK  1625
             +F+ +PFG+GRR CPGMQLGL      VA L HCF WELP GM PS+LDM + FGL  P+
Sbjct  426   DFQLLPFGTGRRGCPGMQLGLTVVRFVVAQLVHCFDWELPSGMSPSELDMTEKFGLATPR  485

Query  1626  ATRLVVIPTPRLN  1664
             A  LVV P  RL+
Sbjct  486   AKHLVVTPRYRLS  498



>emb|CAD37906.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37907.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37908.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37909.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37910.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37911.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37924.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37927.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37928.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
Length=304

 Score =   367 bits (942),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 184/275 (67%), Positives = 221/275 (80%), Gaps = 8/275 (3%)
 Frame = +3

Query  234   WPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSN  413
             WP+IGNM +MD  +HRGLA LA++YGGL HL+MG LHM  VS P+ ARQVLQ QD++FSN
Sbjct  37    WPIIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPEVARQVLQVQDSVFSN  96

Query  414   RPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTV  593
             RPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V
Sbjct  97    RPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSV  156

Query  594   AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFF  773
             + N G  +N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF 
Sbjct  157   SCNVGKTINVGEQIFALTRNITYRAAFGSACE--KGQDEFIRILQEFSKLFGAFNVADFI  214

Query  774   PFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVD  953
             P+    D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  +TDMVD
Sbjct  215   PYFGWIDPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNAVDDGDVVDTDMVD  269

Query  954   ELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIM  1055
             +LLAFYS+E K V+++ DLQN+IKLTRDNIK IIM
Sbjct  270   DLLAFYSEEAKLVSETADLQNSIKLTRDNIKAIIM  304



>ref|XP_004304846.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=499

 Score =   374 bits (960),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 199/491 (41%), Positives = 300/491 (61%), Gaps = 29/491 (6%)
 Frame = +3

Query  216   PPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQ  395
             PPGP+G+P+IGN+ ++  + H  L +L++++G +++L++G +  +VVS P  A   L+T 
Sbjct  32    PPGPRGFPIIGNLLMLGEFPHVDLHRLSQKHGDIMYLRLGLVPTIVVSSPQAAELFLKTH  91

Query  396   DNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR-DEV  572
             D+ F+ RP + A  ++SY + ++++A YGP+WR +RK+C ++L S  +  S   +R +E+
Sbjct  92    DHSFATRPPHEAAKHISYGQRNLSYAEYGPYWRTIRKMCTLELLSNHKINSLKPMRKEEL  151

Query  573   DNTVRTVAMNC--GSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDE-FIKILQEFSKL  743
             D  +  +   C   +AV++   +  L  ++T R  FG      +  ++ F   + E   L
Sbjct  152   DLFMNFIQEACRDRAAVDLSAKVSSLNTDMTCRLVFGKKYMDKEFDEKGFQAWIVEGMHL  211

Query  744   FGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHIL-QTRRRRNKNHGGEV  920
              G  N  D+ PFL+ FDLQGL  R+   R   D F +KIID+HI  Q  + R K      
Sbjct  212   AGTPNFGDYLPFLAPFDLQGLTKRMKAVRKVFDDFFEKIIDEHIKSQDDQERTK------  265

Query  921   SGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIE  1100
                    D VD +L F   +         ++  K+ R NIK II+D++ G  +T A+AIE
Sbjct  266   -------DFVDVMLCFMGSK---------ESEYKIERSNIKAIILDMVAGAMDTSATAIE  309

Query  1101  WAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllh  1280
             W ++ELM+ P  +K++Q+EL D VG+DR V+ESDLEKL +L   +KE LRLHP  PLL+ 
Sbjct  310   WTLSELMRHPRVMKKVQKELEDVVGMDRMVDESDLEKLEYLNMVVKENLRLHPVAPLLIP  369

Query  1281  ETA-EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEF  1457
               A E   VNG++IP +SR ++N WA+ RD ++W DPD F P+RF+   + D +G +F+ 
Sbjct  370   HAAIEDCTVNGFHIPKKSRVMVNVWAVGRDPSAWTDPDKFIPERFVGSNI-DLRGRDFQL  428

Query  1458  IPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRL  1637
             +PFGSGRR CPGM LGL    L VA L HCF WELPD + P++LDM + FGLT P+A  L
Sbjct  429   LPFGSGRRGCPGMHLGLTVVHLVVAQLVHCFDWELPDNILPTELDMTEEFGLTVPRAKHL  488

Query  1638  VVIPTPRLNCQ  1670
             + IP+ RL  Q
Sbjct  489   LAIPSYRLRQQ  499



>gb|ACM89789.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
 gb|ACN89832.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
Length=495

 Score =   374 bits (960),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 198/492 (40%), Positives = 297/492 (60%), Gaps = 29/492 (6%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGP+G P++GNM+++    HR L  L+++YG ++++++G +  +VVS P  A Q L
Sbjct  26    KRLPPGPRGIPILGNMHMLGSLPHRALQALSKKYGPIMYMRLGFVPAIVVSSPQAAEQFL  85

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSV-R  563
             +T D +F+NRP +    ++ +D   ++F+ YGP+WR MRKLC+++L S  +  S+  + R
Sbjct  86    KTHDLVFANRPPHECSRHMLHDGKGISFSGYGPYWRSMRKLCILELLSSHKINSFKPMRR  145

Query  564   DEVDNTVRTV--AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDE--FIKILQE  731
             +EV   +++   A   G+AV++   +  L+ +++ R  FG      +  DE  F  +++E
Sbjct  146   EEVGLLIKSFEEAARAGAAVDVSAKVALLSADMSCRMVFGKK-YMDKDLDERGFKAVIKE  204

Query  732   FSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHG  911
               +L    N+ D+ P L   DLQGL  R+       D F +KIID+HI + +        
Sbjct  205   VMQLAATPNIGDYIPCLLGLDLQGLTRRIKATAKVFDDFFEKIIDEHIHKPKE-------  257

Query  912   GEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVAS  1091
                  +G   D+VD +L     E         +    + R NIK I +D+M    +T A+
Sbjct  258   -----EGQTKDLVDVMLDLMGSE---------ETEYNIQRANIKAISLDMMAASMDTSAT  303

Query  1092  AIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlh-ppip  1268
              IEWA++EL+K P  +K+++ EL   VG++R VEESDLE L +L   +KETLRLH     
Sbjct  304   TIEWALSELIKHPPMMKKVRNELEKVVGMERMVEESDLESLEYLNMVVKETLRLHPVVPL  363

Query  1269  lllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSN  1448
             L+ HE+ E   V+G++IP +SR I+N WAI RD N+W D D F P+RF++  + DF+G +
Sbjct  364   LIPHESIEDCTVDGFHIPQKSRVIVNVWAIGRDPNAWTDADKFLPERFMESDI-DFRGQH  422

Query  1449  FEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKA  1628
             F+FIPFGSGRR CPGMQLGL    L +A L HCF WELPD M  S+LDM++ FGLT P+A
Sbjct  423   FQFIPFGSGRRGCPGMQLGLTVVRLVLAQLVHCFDWELPDNMLASELDMNEEFGLTLPRA  482

Query  1629  TRLVVIPTPRLN  1664
               LV IPT R +
Sbjct  483   KHLVAIPTCRFH  494



>emb|CAD37901.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37936.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37990.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37991.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37902.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37903.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37904.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37905.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37912.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37913.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37914.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37915.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37916.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37917.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37918.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37919.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37920.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37921.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37922.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37923.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37926.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37929.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37930.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37931.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37932.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37933.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37934.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
 emb|CAD37935.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
Length=304

 Score =   367 bits (941),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 184/275 (67%), Positives = 221/275 (80%), Gaps = 8/275 (3%)
 Frame = +3

Query  234   WPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSN  413
             WP+IGNM +MD  +HRGLA LA++YGGL HL+MG LHM  VS P+ ARQVLQ QD++FSN
Sbjct  37    WPIIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPEVARQVLQVQDSVFSN  96

Query  414   RPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTV  593
             RPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V
Sbjct  97    RPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSV  156

Query  594   AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFF  773
             + N G  +N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF 
Sbjct  157   SCNVGKPINVGEQIFALTRNITYRAAFGSACE--KGQDEFIRILQEFSKLFGAFNVADFI  214

Query  774   PFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVD  953
             P+    D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  +TDMVD
Sbjct  215   PYFGWIDPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNAVDDGDVVDTDMVD  269

Query  954   ELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIM  1055
             +LLAFYS+E K V+++ DLQN+IKLTRDNIK IIM
Sbjct  270   DLLAFYSEEAKLVSETADLQNSIKLTRDNIKAIIM  304



>ref|XP_007208656.1| hypothetical protein PRUPE_ppa022041mg [Prunus persica]
 gb|EMJ09855.1| hypothetical protein PRUPE_ppa022041mg [Prunus persica]
Length=498

 Score =   373 bits (958),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 200/493 (41%), Positives = 295/493 (60%), Gaps = 28/493 (6%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGP+G+PL GN++++  + HR L +LA+++G ++++++G   +VV S P  A   L
Sbjct  29    KRLPPGPRGFPLFGNLHMLGEFPHRDLHRLAQKHGDIMYMRLGLAPVVVASSPQAAELFL  88

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             +T D +F++RP   A  ++SY + +++F  YG +WR MRK+C ++L S  +  S+  +R 
Sbjct  89    KTHDLVFASRPPLQAAEHISYGQRNLSFGAYGSYWRTMRKMCTLELLSSHKTNSFKPMRK  148

Query  567   EVDNTVRTVAMNCGS---AVNIGELIFGLTRNITYRAAFGSSPSSGQGQDE-FIKILQEF  734
             E    +        S    V++   +  LT +++    FG      +  +  F  ++QE 
Sbjct  149   EELALLTKFIQEAASDRVTVDLSGKVASLTADMSCLMVFGKKYMDKEFDERGFKAVIQEG  208

Query  735   SKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGG  914
               L    N  DF PF++  DLQGL  R+       D F +KIID+HI  T + R K    
Sbjct  209   MHLAATPNFGDFIPFIAPLDLQGLTKRMKGVSKVFDAFFEKIIDEHIQSTDQERTK----  264

Query  915   EVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASA  1094
                      D VD +L F   E         ++  ++ R NIK II+D++ G  +T A+A
Sbjct  265   ---------DFVDVMLGFMGSE---------ESEYRIERSNIKAIILDMLAGAMDTTATA  306

Query  1095  IEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppipll  1274
             IEW ++EL+K P  +K++Q+EL + VG++R+VEESDLEKL +L   +KET+RLHP  PLL
Sbjct  307   IEWTLSELIKHPRVMKKVQKELENVVGMEREVEESDLEKLEYLDMVVKETMRLHPVAPLL  366

Query  1275  lhETA-EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNF  1451
             L   A E   VNG++IP +SR IIN +AI RD + W D + F P+RF    + DF+G +F
Sbjct  367   LPHAAIEDCNVNGFHIPRKSRVIINIFAIGRDPSIWTDAEKFIPERFDGSNI-DFRGRDF  425

Query  1452  EFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKAT  1631
             +FIPFGSGRR CPGMQLG+   +L VA L HCF WELP+ M PS+LDM + FGLT P+A 
Sbjct  426   QFIPFGSGRRGCPGMQLGITMVQLVVAQLVHCFDWELPNNMLPSELDMTEEFGLTVPRAK  485

Query  1632  RLVVIPTPRLNCQ  1670
              L+ +PT RL  Q
Sbjct  486   HLLAVPTYRLQQQ  498



>ref|XP_008440670.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=497

 Score =   373 bits (958),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 205/490 (42%), Positives = 301/490 (61%), Gaps = 26/490 (5%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGPKG+P+ G+++L+    HR L  L+++YG ++H+K+G +H ++VS P  A+  L
Sbjct  27    KNLPPGPKGFPIFGSLHLIGKLPHRDLHHLSQKYGPIMHMKLGLVHTIIVSSPHAAKLFL  86

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR-  563
             +T D +F++RP     + +SY + D+ FA YG +WR +RK+C ++LFS  +  S+ S+R 
Sbjct  87    KTHDQVFASRPLIHTSNIMSYGQKDLVFAPYGSYWRNIRKMCTLELFSPVKINSFKSMRK  146

Query  564   DEVDNTVRTV--AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQ-GQDEFIKILQEF  734
             +EV   +  +  A     AV +   +  L+ ++T   AFG      + G+  F  ++QE 
Sbjct  147   EEVRELIEYLKTASRDRVAVRVSSKVSSLSADMTCLMAFGKKYRDEEFGERGFKAVIQEA  206

Query  735   SKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGG  914
              +L  A N++D+ PF++ FD+QGLN R        DGF+++II++HI      RNK    
Sbjct  207   MQLAIAPNLADYIPFVASFDIQGLNRRATFVGKEFDGFLERIIEEHIESKDGNRNK----  262

Query  915   EVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASA  1094
                      D VD LL      M   ++D+ Q    + R NIK I +DV+    +T A+A
Sbjct  263   ---------DFVDYLLDIM---MSSQEADEYQ----IDRSNIKAIALDVLSAAMDTSATA  306

Query  1095  IEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlh-ppipl  1271
             I+WA+AEL+K P+ +K LQ EL   VGL+R VEES LE L +L+  +KE LRLH P   L
Sbjct  307   IDWALAELIKHPQAMKELQVELEKVVGLNRMVEESHLEHLKYLEMVIKEVLRLHPPAPLL  366

Query  1272  llhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNF  1451
             + HE+ E   V+G++IP +SR I+NAW+I +D N W DP  F P+RF+   + D KG +F
Sbjct  367   VPHESLEDCTVDGFHIPKKSRIIVNAWSIGQDPNVWTDPQKFFPERFI-HSLTDVKGRDF  425

Query  1452  EFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKAT  1631
             + IPFGSGRR CPG+QLGL    L VA+L HCF WELP+ M   DLDM++ FGLT P+A 
Sbjct  426   QLIPFGSGRRGCPGIQLGLLIVSLVVANLVHCFDWELPNCMLAIDLDMEEEFGLTCPRAQ  485

Query  1632  RLVVIPTPRL  1661
              L++IP  RL
Sbjct  486   ELMLIPAYRL  495



>gb|KDP39257.1| hypothetical protein JCGZ_01014 [Jatropha curcas]
Length=485

 Score =   373 bits (957),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 191/487 (39%), Positives = 299/487 (61%), Gaps = 24/487 (5%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMN-LMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQV  383
             K  PPGP+  P+IGN++ L+    H  L  LA+++GG++HL++G +  +V+S P+ A++V
Sbjct  12    KNLPPGPRKLPIIGNIHQLIGSLPHHCLRDLAKKHGGIMHLQLGEVSNIVISSPEAAKEV  71

Query  384   LQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR  563
             ++T D +F+ RP  +A S +SY+  D+AF+ Y  +WRQ+RK+C+++L S +R +S+  +R
Sbjct  72    MKTHDIVFAQRPFLLAASIISYNFTDIAFSPYADYWRQLRKICILELLSAKRVQSFRFIR  131

Query  564   -DEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSK  740
              +EV N +  ++ + G A N    +F LT  I  RA FG      + Q+EFI I++E ++
Sbjct  132   EEEVSNLITAISSSSGKAFNFSRKLFSLTYGIAARATFG---EKCEDQEEFIPIVEEITE  188

Query  741   LFGAFNVSDFFPFLSCF-DLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGE  917
             + G F+++D FP +     + G+  RL + +   D  I  IIDDH       R KN  G+
Sbjct  189   VAGGFSLADLFPSVKFLHSISGMRSRLIRLQKEADRVIGNIIDDH-------RAKNKTGK  241

Query  918   VSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAI  1097
             V G+G + D+VD LL       ++ +  +L+    LT DNIK +I+D+   G+ET ++ +
Sbjct  242   VGGEGQDDDLVDVLL-------RLQEHGNLE--FPLTTDNIKAVILDIFVAGSETSSTTV  292

Query  1098  EWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKET-lrlhppipll  1274
             EWAM+E+++ P  + + Q+E+         VEE+DL++  +LK  +KET     P   LL
Sbjct  293   EWAMSEMLRNPRVMYKAQEEVRKLFDKKGNVEETDLQESKYLKLVIKETLRLHPPAPLLL  352

Query  1275  lhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFE  1454
               E+ E  E+NGY IP +S+ I+NAWAI RD N W + ++F P+RFL   + D+KG+NFE
Sbjct  353   PRESTEKCEINGYDIPEKSKVIVNAWAIGRDPNHWTEAETFYPERFLDSSI-DYKGNNFE  411

Query  1455  FIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATR  1634
             FIPFG+GRR CPG+  G+   EL +A L + F WELP G+K   LDM + FG T  +   
Sbjct  412   FIPFGAGRRMCPGILFGIANVELPLAQLLYHFDWELPSGLKAETLDMIESFGATVRRKND  471

Query  1635  LVVIPTP  1655
             L +IP P
Sbjct  472   LHLIPNP  478



>emb|CAD37925.1| ferulate-5-hydroxylase [Arabidopsis thaliana]
Length=304

 Score =   366 bits (939),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 184/275 (67%), Positives = 221/275 (80%), Gaps = 8/275 (3%)
 Frame = +3

Query  234   WPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSN  413
             WP+IGNM +MD  +HRGLA LA++YGGL HL+MG LHM  VS P+ ARQVLQ QD++FSN
Sbjct  37    WPIIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPEVARQVLQVQDSVFSN  96

Query  414   RPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTV  593
             RPA +AISYL+YDRADMAFAHYGPFWRQMRK+CV+K+FSR+RAESW SVRDEVD  VR+V
Sbjct  97    RPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSV  156

Query  594   AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFF  773
             + N G  +N+GE IF LTRNITYRAAFGS+    +GQDEFI+ILQEFSKLFGAFNV+DF 
Sbjct  157   SCNVGKPINVGEQIFALTRNITYRAAFGSACE--KGQDEFIRILQEFSKLFGAFNVADFI  214

Query  774   PFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVD  953
             P+    D QG+N RL KAR  LDGFID IID+H+     ++ +N      GD  +TDMVD
Sbjct  215   PYFGWIDPQGINKRLVKARNDLDGFIDDIIDEHM-----KKKENQNAVDDGDVVDTDMVD  269

Query  954   ELLAFYSDEMK-VNDSDDLQNAIKLTRDNIKGIIM  1055
             +LLAFYS+E K V+++ DLQN+IKLTRDNIK IIM
Sbjct  270   DLLAFYSEEAKLVSETADLQNSIKLTRDNIKAIIM  304



>ref|XP_002512986.1| ferulate-5-hydroxylase, putative [Ricinus communis]
 gb|EEF49489.1| ferulate-5-hydroxylase, putative [Ricinus communis]
Length=313

 Score =   366 bits (939),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 181/275 (66%), Positives = 216/275 (79%), Gaps = 12/275 (4%)
 Frame = +3

Query  240   LIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQDNIFSNRP  419
             + GNMN++D  +HRGLA+LA+QYGGL HL+MG LH+V VS P+ AR+VLQ QD IFSNRP
Sbjct  47    IFGNMNIVDQLTHRGLARLAKQYGGLFHLQMGGLHVVAVSTPEMAREVLQVQDGIFSNRP  106

Query  420   ANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAM  599
             ANVAI+YL+YDRADMAFA+YGPFWRQMRK+CV+KLFSRRRAESW SVR+EVD+ VR V  
Sbjct  107   ANVAITYLTYDRADMAFANYGPFWRQMRKICVMKLFSRRRAESWASVREEVDSMVRIVME  166

Query  600   NCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPF  779
               GS VNIGEL+F LTRNITYRAAFGS   S +GQDEF+KILQEFSKLFGAFNV+DFFP 
Sbjct  167   KTGSQVNIGELVFALTRNITYRAAFGS--VSDEGQDEFMKILQEFSKLFGAFNVADFFPR  224

Query  780   LSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSGD--GAETDMVD  953
             +     Q  N RL +AR +LDGFIDK+ID+H+        K +  +++ D    ETDMVD
Sbjct  225   MGWMHAQDFNKRLTRARQSLDGFIDKVIDEHM-------GKKNSSKITKDENEEETDMVD  277

Query  954   ELLAFYSDE-MKVNDSDDLQNAIKLTRDNIKGIIM  1055
             EL+AFYS+E +  N   D Q+ IKLTRDNIK IIM
Sbjct  278   ELMAFYSEEDVAKNGIYDSQSTIKLTRDNIKAIIM  312



>ref|XP_002522721.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39572.1| cytochrome P450, putative [Ricinus communis]
Length=499

 Score =   372 bits (956),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 194/507 (38%), Positives = 301/507 (59%), Gaps = 24/507 (5%)
 Frame = +3

Query  147   MVIYFVIPflflfllsrlrrKPYPPGPKGWPLIGNMN-LMDHYSHRGLAKLAEQYGGLLH  323
             + IY V+             K  PPGP   PLIGNM+ L+    H  L  LA++YG ++H
Sbjct  11    IFIYMVLKLWKRSNSKHSTLKNLPPGPTKLPLIGNMHQLLGSLPHHRLRDLAKKYGSIMH  70

Query  324   LKMGSLHMVVVSGPDEARQVLQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMR  503
             L++G +  VVVS P+ A++V++T D +F+ RP  +A S ++Y+  D+AF+ Y  +WRQ+R
Sbjct  71    LQLGEVPHVVVSSPEAAKEVMKTHDIVFAQRPFLLAASVITYNFTDIAFSPYSDYWRQLR  130

Query  504   KLCVVKLFSRRRAESWDSVR-DEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGS  680
             K+CV++L S +R +S+ S+R +EV N + T+    G   N    +F  T  I  RA+FG 
Sbjct  131   KICVLELLSAKRVQSFRSIREEEVSNLINTLTSFSGKPFNFSRKLFSSTYGIAARASFG-  189

Query  681   SPSSGQGQDEFIKILQEFSKLFGAFNVSDFFPFLSCFD-LQGLNPRLAKARAALDGFIDK  857
                  + Q+EFIK+ Q+ +++ G F+++D FP ++    + G+  RL + R   D  ++ 
Sbjct  190   --KKYKDQEEFIKVAQQMTEVAGGFSLADLFPSIAFLHVISGMKSRLLRLRDDGDNILEN  247

Query  858   IIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDN  1037
             IIDDH       R +N  G+ SG+G + D+VD LL F             Q    LT +N
Sbjct  248   IIDDH-------RARNMTGKTSGEGEDDDLVDVLLRFQKGG---------QLEFPLTTNN  291

Query  1038  IKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLT  1217
             IK +I+D+   G+ET ++ +EWAM+E+++ P  +++ Q+E+    G    V+E++L +L 
Sbjct  292   IKAVILDIFIAGSETSSTTVEWAMSEMLRNPRVMEKAQEEVRRVFGKKGNVDEAELHELN  351

Query  1218  FLKCCLKET-lrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDS  1394
             +LK  +KET     P   LL  E+ E+ E+NGYYIP  S+ I+NAWAI RD N+W + ++
Sbjct  352   YLKLVIKETLRLHPPAPLLLPRESRESCEINGYYIPVNSKVIVNAWAIGRDPNNWTEAET  411

Query  1395  FKPDRFLKEGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGM  1574
             F P+RFL   + D+KG+ FEFIPFG+GRR CPG+  G+   EL +A   + F W+LPDG+
Sbjct  412   FYPERFLDSAI-DYKGNYFEFIPFGAGRRMCPGILFGMANVELPLAQFLYHFDWKLPDGL  470

Query  1575  KPSDLDMDDVFGLTAPKATRLVVIPTP  1655
             +   LDM + FG T  +   L +I  P
Sbjct  471   EAESLDMMEGFGATVRRKNDLHLIAIP  497



>gb|ACN40196.1| unknown [Picea sitchensis]
Length=517

 Score =   373 bits (957),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 208/491 (42%), Positives = 303/491 (62%), Gaps = 31/491 (6%)
 Frame = +3

Query  216   PPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQ  395
             PPGP  +P+IGN++LM    H+ LA L+ +YG L  L++GS   +VVS PD A++ L+T 
Sbjct  46    PPGPFRFPIIGNLHLMGRLQHKALAALSVKYGPLFSLRLGSALTLVVSSPDMAKEFLKTH  105

Query  396   DNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR-DEV  572
             D +F++RP + A  YL Y+ +D+ F+ YG +WRQMR+L V +L S RR +S+  +R +EV
Sbjct  106   DLVFASRPPSTATKYLWYNSSDVTFSPYGRYWRQMRRLFVSQLLSSRRVDSFRFIREEEV  165

Query  573   DNTVRTVAMNC--GS-AVNIGELIFGLTRNITYRAAFGSSPSSGQGQD--EFIKILQEFS  737
                +R++ ++   GS  VNIG+++  L  +I  R AFG   +  Q  D      ++QE  
Sbjct  166   SAMIRSIIISYHEGSLPVNIGKIVSVLGIDIICRIAFGRKYTDQQLMDGRGIHSMIQETF  225

Query  738   KLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGE  917
              L G+FN+ D+ P+L+  DLQGLN RL       D  ++KI+++H  Q +          
Sbjct  226   LLAGSFNIGDYIPYLAWMDLQGLNRRLKNIHKTQDALLEKIVEEHFSQNK----------  275

Query  918   VSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAI  1097
                  A  D++D LLA  +DE            +++TRDNIK  + D++  G++T +++I
Sbjct  276   ---PNAMPDLLDVLLAASADE---------NLGLQITRDNIKSAVYDILSAGSDTSSTSI  323

Query  1098  EWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplll  1277
             EWAM+E+++ P  LK++Q+EL   VG+ R V ESDL +L +L+  +KETLRLHPP PLLL
Sbjct  324   EWAMSEVLRNPPVLKKIQEELERVVGMGRMVHESDLPRLVYLQAVVKETLRLHPPGPLLL  383

Query  1278  hETA-EATEVNGYYIPARSRAIINAWAIARDKNSW-EDPDSFKPDRFLKEGMPDFKGSNF  1451
                + E   V GY IP+ +R ++N WAI R+  SW ED +SFKP+RF++ G  D K  NF
Sbjct  384   PHISIETCNVLGYKIPSGTRLLVNVWAIGRNPKSWGEDAESFKPERFMEAGFLDAKVENF  443

Query  1452  EFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDV-FGLTAPKA  1628
             E+IPFG+GRR CPG Q+ +   E AVA L HCF W LPD M    LDM +   G+T  +A
Sbjct  444   EWIPFGAGRRGCPGQQMAMIVVEFAVAQLLHCFNWRLPDDMDEQKLDMSEKNHGITVSRA  503

Query  1629  TRLVVIPTPRL  1661
               L  +PTPRL
Sbjct  504   HELFAVPTPRL  514



>ref|XP_008227122.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=496

 Score =   371 bits (953),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 196/499 (39%), Positives = 312/499 (63%), Gaps = 42/499 (8%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMD-HYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQV  383
             K  PPGP+G+P+ G+++L+   + ++ L +LA++YG ++++++G +  +VVS P  A+  
Sbjct  26    KRLPPGPRGFPIFGSLHLLSGEFPNKDLHRLAQKYGDVMYMRLGLMPTIVVSSPQAAKLF  85

Query  384   LQTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR  563
             L+T D +F++RP +    ++S+ + +++FA YGP+WR MRK+C ++L S  +  S+ S+R
Sbjct  86    LKTHDLVFASRPPHEGAKHISFGQRNLSFAEYGPYWRDMRKMCTLELLSNHKINSFKSMR  145

Query  564   DE----VDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDE------F  713
              E       ++R  A     AV++ +++  L+ +++ R   G      + +DE      F
Sbjct  146   REEVALCVESIRDAAYKGHVAVDLSDIVSSLSVDMSCRMVLGK-----KYRDEDFDTRGF  200

Query  714   IKILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRR  893
               +++E  +L GA N++D+ PF++  DLQG   R+     A D F +KII++H+      
Sbjct  201   RSVIKEGLQLAGASNLADYIPFIAPLDLQGFTKRMKSVNKAFDTFFEKIIEEHL------  254

Query  894   RNKNHGGEVSGDGAET-DMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFG  1070
                      S DG  T D VD ++ F   E         ++  ++ R +IK IIMD++  
Sbjct  255   --------QSNDGERTKDFVDVMVGFMGSE---------ESEYQIERPHIKAIIMDMLVA  297

Query  1071  GTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlr  1250
               +T ++ ++WA++ELM+ P+ +K++Q+EL D VGL+R VEESDLEKL +L   +KETLR
Sbjct  298   SMDTSSTTVDWALSELMRHPKAMKQVQKELEDVVGLERMVEESDLEKLDYLSMVVKETLR  357

Query  1251  lhppiplllhETA-EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGM  1427
             LHP  PLL+   A E   VNGY+IP +SR IINAWAI RD ++W D + F P+RF    +
Sbjct  358   LHPVAPLLVPHAATEDCTVNGYHIPKKSRVIINAWAIGRDPSAWTDAEEFIPERFEGSDV  417

Query  1428  PDFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVF  1607
              D +G++F+ IPFGSGRR CPG+QLGL   +L +A L HCF WELP+ M P +LDM +VF
Sbjct  418   -DVRGNHFQLIPFGSGRRRCPGIQLGLTVVQLMLAQLVHCFDWELPNNMLPEELDMSEVF  476

Query  1608  GLTAPKATRLVVIPTPRLN  1664
             G+T  +A RL+ IP+ RL+
Sbjct  477   GITVARAKRLIAIPSYRLH  495



>ref|XP_002275826.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=506

 Score =   371 bits (953),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 196/487 (40%), Positives = 296/487 (61%), Gaps = 23/487 (5%)
 Frame = +3

Query  216   PPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQ  395
             PPGP   P+ GN++++ +  HR L++LA +YG ++ +++G +  +VVS P+ A   L+T 
Sbjct  34    PPGPWALPIFGNLHMLGNLPHRNLSRLARKYGPIMSMRLGYVPTIVVSSPEAAELFLKTH  93

Query  396   DNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR-DEV  572
             D +F++RP   A  YL Y R  MAF  YGP+WR  RKLC ++L ++ + +S+ ++R +E+
Sbjct  94    DAVFASRPKIQASEYLCYGRKGMAFTEYGPYWRNARKLCTLELLTKVKIDSFAAMRKEEL  153

Query  573   DNTVRTVAMNCGS--AVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLF  746
                V+++     +   VNI + +  L  ++T+R  FG      +   +   ++QE   L 
Sbjct  154   GVLVQSLKQMAAAREVVNISKKVGELIEDMTHRMLFGRCKDYQRA--DLKALVQETLILV  211

Query  747   GAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSG  926
             GAFN++D+ PFL   DLQGL  R+     A+D  ++K+ID+H         K    E  G
Sbjct  212   GAFNIADYVPFLGALDLQGLKRRMKAISGAVDHILEKVIDEH---------KQDASENQG  262

Query  927   DGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
             +    D VD +L+   +EMK   +   + +  + ++NIKGI+ D++ G  +T A+ IEW 
Sbjct  263   N--HKDFVDVMLSLM-NEMK---NFHQEPSYLIEQENIKGIVWDIIIGAIDTSATTIEWL  316

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKE-TlrlhppiplllhE  1283
             ++EL + P  +++LQ+EL + +G++R VEE DL  L +L   LKE          LL HE
Sbjct  317   LSELFRHPRVMRQLQEELENVIGMERMVEEVDLANLVYLDMVLKEGLRLHPAGPLLLPHE  376

Query  1284  TAEATEVNGYYIPARSRAIINAWAIARDKNSWE-DPDSFKPDRFLKEGMPDFKGSNFEFI  1460
             + E   +NGYYIP +SR IINAWAI RD N W  + + F P+RF+   + DF+G +F+FI
Sbjct  377   SIEDITLNGYYIPKKSRIIINAWAIGRDPNIWSNNVEDFFPERFIGSNI-DFQGKDFQFI  435

Query  1461  PFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLV  1640
             PFGSGRR CPGMQLGL    L +A L HCF W+LP+GM PS+LDM + FGL  P+AT L 
Sbjct  436   PFGSGRRKCPGMQLGLINVRLVLAQLVHCFDWKLPNGMLPSELDMSEEFGLALPRATHLH  495

Query  1641  VIPTPRL  1661
              +PT RL
Sbjct  496   ALPTYRL  502



>ref|XP_004153472.1| PREDICTED: cytochrome P450 71B13-like [Cucumis sativus]
 ref|XP_004162329.1| PREDICTED: cytochrome P450 71B13-like [Cucumis sativus]
 gb|KGN48795.1| hypothetical protein Csa_6G501350 [Cucumis sativus]
Length=498

 Score =   370 bits (951),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 203/491 (41%), Positives = 298/491 (61%), Gaps = 28/491 (6%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGPKG+P+ G+++L+    HR L +L+++YG ++H+K+G +H ++VS P  A+  L
Sbjct  28    KNLPPGPKGFPIFGSLHLIGKLPHRDLHRLSQKYGPIMHMKLGLVHTIIVSSPHAAKLFL  87

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             +T D++F++RP     S ++Y + D+ FA YG +WR +RK+C ++LFS  +  S+ S+R 
Sbjct  88    KTHDHVFASRPLIHTSSIMTYGKKDLVFAPYGSYWRNIRKMCTLELFSSLKINSFKSMRK  147

Query  567   ----EVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQ-GQDEFIKILQE  731
                 E+   ++T + +    V +   +  L  ++T   AFG      + G+  F  ++QE
Sbjct  148   KEVRELIEYLKTASTD-RMVVRLSSKVTSLIADMTCLMAFGKKYRDEEFGERGFKAVIQE  206

Query  732   FSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHG  911
               +L  A N++D+ PF++ FD+QGLN R        DGF ++II++HI      RNK   
Sbjct  207   GMQLVIAPNLADYIPFVAPFDIQGLNRRATFVLKEFDGFFERIIEEHIESKDGNRNK---  263

Query  912   GEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVAS  1091
                       D +D LL      M   D D  Q    + R NIK I +DV+    +T A+
Sbjct  264   ----------DFMDHLLDIM---MSSQDPDGYQ----IDRSNIKAIALDVLSAAMDTSAT  306

Query  1092  AIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlh-ppip  1268
             AI+WA+AEL+K P+ +K LQ EL   VGL+R VEES LE L +L   +KE LRLH P   
Sbjct  307   AIDWALAELIKHPQAMKELQVELEKVVGLNRMVEESHLEHLQYLGMVIKEVLRLHPPAPL  366

Query  1269  lllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSN  1448
             L+ HE+ E   V+G++IP +SR  +NAW+I +D N W DP  F P+RF+   + D KG +
Sbjct  367   LVPHESLEDCTVDGFHIPKKSRIFVNAWSIGQDPNVWIDPQKFFPERFI-HSLADVKGRD  425

Query  1449  FEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKA  1628
             F  IPFGSGRRSCPG+ LGL    L VA+L HCF WELP+ M  +DLDM++ FGLT P+A
Sbjct  426   FHLIPFGSGRRSCPGIHLGLLIVSLVVANLVHCFDWELPNCMLATDLDMEEEFGLTCPRA  485

Query  1629  TRLVVIPTPRL  1661
               L++IPT RL
Sbjct  486   QELMLIPTYRL  496



>gb|EMS53883.1| Cytochrome P450 84A1 [Triticum urartu]
Length=351

 Score =   365 bits (937),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 206/326 (63%), Positives = 247/326 (76%), Gaps = 19/326 (6%)
 Frame = +3

Query  720   ILQEFSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRN  899
             +  EFSKLFGAFN+ DFFP+LS  D QG+N RL  ARAALD FIDKIID+H+ + +    
Sbjct  25    VFVEFSKLFGAFNIGDFFPWLSWADPQGINVRLRAARAALDEFIDKIIDEHMARGK----  80

Query  900   KNHGGEVSGDGAETDMVDELLAFYSD----EMKVNDSDDLQNAIKLTRDNIKGIIMDVMF  1067
                    S D  + DMVD++LAF  +    +   +  D+LQ+ ++LTRDNIK IIMDVMF
Sbjct  81    -------SPDDVDADMVDDMLAFLPEAKPKKATGDGGDELQSTLRLTRDNIKAIIMDVMF  133

Query  1068  GGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETl  1247
             GGTETVASAIEWAMAE+M +P++L+RLQ+EL DTVG DR V+ESDL+KL FLKC +KETL
Sbjct  134   GGTETVASAIEWAMAEMMHSPDDLRRLQKELADTVGFDRNVDESDLDKLPFLKCVIKETL  193

Query  1248  rlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLK-EG  1424
             RLHPPIPLLLHETAE   V GY +P  SR +IN +AI RD  +W+DPD+F+P RF+  EG
Sbjct  194   RLHPPIPLLLHETAEDCVVGGYAVPRASRVMINVFAIGRDDKAWKDPDTFRPSRFVAGEG  253

Query  1425  MP---DFKGSNFEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDM  1595
                  DFKG  FEF+PFGSGRRSCPGM LGLYA ELAVA L H F+W LPDGMKPS+LDM
Sbjct  254   EAAGVDFKGGCFEFLPFGSGRRSCPGMALGLYALELAVAQLAHGFSWALPDGMKPSELDM  313

Query  1596  DDVFGLTAPKATRLVVIPTPRLNCQL  1673
              D+FGLTAP+ATRL  +PTPRL C L
Sbjct  314   SDIFGLTAPRATRLYAVPTPRLTCPL  339



>ref|XP_011100886.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=520

 Score =   371 bits (953),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 197/491 (40%), Positives = 300/491 (61%), Gaps = 28/491 (6%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGP+G P++G+++L+    H+ L  LA+++G ++ L++G +  VVVS P  A  VL
Sbjct  50    KRLPPGPRGLPILGHLHLLGKNPHQNLYHLAQKHGPIMGLRLGFVPTVVVSSPAGAELVL  109

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             +T D +F+NRP N A  Y+ Y++ D+AF  YGP+WR MRKLC ++L S RR   + ++R 
Sbjct  110   KTHDLVFANRPRNEASKYIMYEQKDLAFGQYGPYWRNMRKLCTLELLSNRRINEFGAMRK  169

Query  567   -EVDNTVRTV--AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDE--FIKILQE  731
              E++  V ++  A      V++   + GL  ++T    F    +      E  F  ++ E
Sbjct  170   VELELLVSSLKRAAEMREIVDLSARVSGLIGDVTCLMVFRRKYADKDLDHEKGFKTLIME  229

Query  732   FSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHG  911
               +  G FN++D+FP++  FDLQG+N ++       D F++K+IDDH+            
Sbjct  230   ALEFAGKFNLADYFPYVGFFDLQGMNRKMKSLSKTFDRFLEKLIDDHVKNK---------  280

Query  912   GEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVAS  1091
                       D VD +       M++ +S + +   +  R ++K +++D++  G +T  S
Sbjct  281   ---QKKKQTKDFVDTM-------MEIMESGNAE--FQFDRRHVKAVLLDILIAGIDTSTS  328

Query  1092  AIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhpp-ip  1268
             AIEWA+AEL++ P  +K+LQ+EL   VG+D+ VEES L  L +L   +KETLRLHP    
Sbjct  329   AIEWALAELIRHPRVMKKLQKELETVVGMDQMVEESHLHGLEYLDFVVKETLRLHPVGPL  388

Query  1269  lllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSN  1448
             L+ HE+ E   ++GY+IP  SRAI+N WAI RD N W DP+ FKP+RF+   + D +G +
Sbjct  389   LIPHESMEDCVIDGYHIPKGSRAIVNVWAIGRDPNVWPDPEVFKPERFIGSNI-DLRGRD  447

Query  1449  FEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKA  1628
             F+ +PFGSGRRSCPG+QLGL   +L ++ L HCF W+LP+GM+PSDLDM + FGLT  +A
Sbjct  448   FQLLPFGSGRRSCPGLQLGLTMVQLVLSQLVHCFDWQLPNGMQPSDLDMSEHFGLTVARA  507

Query  1629  TRLVVIPTPRL  1661
               LV IP+ RL
Sbjct  508   KHLVAIPSYRL  518



>ref|XP_004299223.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=504

 Score =   370 bits (951),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 198/487 (41%), Positives = 290/487 (60%), Gaps = 21/487 (4%)
 Frame = +3

Query  216   PPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQ  395
             PPGP+  P+IGN++++ +  HR L  LA+QYG ++ L++G++  +V+S P  A   L+T 
Sbjct  33    PPGPRPLPIIGNLHMLGNLPHRTLQNLAKQYGDIMSLRLGNVPTIVISSPKAAELFLKTH  92

Query  396   DNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR-DEV  572
             D  F++RP   A  YL+Y    +AF+ YGP+WR +RK+C ++LF   + E++  +R +E+
Sbjct  93    DTNFASRPKIQASEYLAYGTKGLAFSEYGPYWRHVRKICTLQLFCPAKLEAFAPLRKEEL  152

Query  573   DNTVRTV--AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEFIKILQEFSKLF  746
                V  +  A   G  V++ E I  +  +ITYR   G           F+   +E   L 
Sbjct  153   GGLVGKLKRAAEEGEVVDVSEKIGEMNEDITYRMVLGCKRDDKFDLKAFV---EEMFFLV  209

Query  747   GAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVSG  926
             GAFN+SDF P LS FD+QGL  RL K     D  +DKII+DH      +  +  GG+   
Sbjct  210   GAFNISDFIPSLSAFDIQGLTKRLKKVSKTADQLLDKIINDH-----EQAAETKGGK---  261

Query  927   DGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEWA  1106
              G   D VD LL+F +  +  ND    +    L R+N+K I++D++    +T A+ I W+
Sbjct  262   QGQHEDFVDVLLSFTNQLLNPND----EQVHFLDRENVKAILLDMITAAFDTSATTIIWS  317

Query  1107  MAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKET-lrlhppiplllhE  1283
             +AELM+ P  +K+LQ+EL   VG+DR VEESDL KL +L   +KE+         L+ HE
Sbjct  318   LAELMRHPRIMKQLQEELQTVVGMDRMVEESDLPKLDYLNLVVKESFRLHPVAPLLVPHE  377

Query  1284  TAEATEVNGYYIPARSRAIINAWAIARDKNSW-EDPDSFKPDRFLKEGMPDFKGSNFEFI  1460
             + +   ++GY IP +SR I+N W+IARD N W E+ + F P+RF    + D +G +++ I
Sbjct  378   SIKDITIDGYDIPKKSRLIVNFWSIARDPNVWSENVEEFYPERFTNSNI-DLRGHDYQLI  436

Query  1461  PFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLV  1640
             PFG+GRR CPGMQLGL    L +A L HCF WELP+GM P DL+M + FGL+  KA  L+
Sbjct  437   PFGTGRRGCPGMQLGLTTVRLVLAQLVHCFNWELPNGMLPQDLNMTEKFGLSLSKAKHLL  496

Query  1641  VIPTPRL  1661
               PT RL
Sbjct  497   AKPTYRL  503



>gb|AAF78943.1|AF267140_1 ferulate-5-hydroxylase [Arabidopsis thaliana]
Length=323

 Score =   363 bits (933),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 202/336 (60%), Positives = 253/336 (75%), Gaps = 17/336 (5%)
 Frame = +3

Query  492   RQMRKLCVVKLFSRRRAESWDSVRDEVDNTVRTVAMNCGSAVNIGELIFGLTRNITYRAA  671
             R+MRKL V+ LFSR+RAESW SV +EV  +VR VA N G  +NI +L F L+R+IT+RAA
Sbjct  1     RRMRKLYVMMLFSRKRAESWVSVDEEVHKSVRLVASNVGKPLNICKLAFSLSRDITFRAA  60

Query  672   FGSSPSSGQGQ--DEFIKILQEFSKLFGAFNVSDFFP-FLSCFDLQGLNPRLAKARAALD  842
             FGSS S+      DEF++I+QEFSKLFG FNV+D+ P +LS  D QG+N R+ KAR +LD
Sbjct  61    FGSSSSTSDESRLDEFLEIIQEFSKLFGEFNVADYVPSWLSWIDPQGINGRVEKARKSLD  120

Query  843   GFIDKIIDDHILQTRRRRNKNHGGEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIK  1022
             GFI+ +IDDH+ + +R        E      ETDMVD+LLAFY +E+KVN+S       K
Sbjct  121   GFIESVIDDHLHKKKR--------EHDNVDEETDMVDQLLAFYEEEVKVNNS-----VTK  167

Query  1023  LTRDNIKGIIMDVMFGGTETVASAIEWAMAELMKTPENLKRLQQELTDTVGLDR-KVEES  1199
             +  DNIKGIIMDVMFGGTETVA AIEW + E++++PEN+KR+Q ELT  VGLDR +VE++
Sbjct  168   INLDNIKGIIMDVMFGGTETVALAIEWVLTEILRSPENMKRVQDELTSVVGLDRWRVEDT  227

Query  1200  DLEKLTFLKCCLKETlrlhppiplllhETAEATEVNGYYIPARSRAIINAWAIARDKNSW  1379
              LEKLTFLKC LKETLRLHPP PLLLHET + TE++GY+IP  SR ++N +A+ RD NSW
Sbjct  228   HLEKLTFLKCILKETLRLHPPFPLLLHETVKDTEISGYFIPKGSRVMVNTYALGRDPNSW  287

Query  1380  EDPDSFKPDRFLKEGMPDFKGSNFEFIPFGSGRRSC  1487
              DP+SF P RFL    PD KG+NFEF+PFGSGRRSC
Sbjct  288   SDPESFNPGRFLNPIAPDLKGNNFEFVPFGSGRRSC  323



>gb|KDP35215.1| hypothetical protein JCGZ_09374 [Jatropha curcas]
Length=499

 Score =   370 bits (949),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 195/487 (40%), Positives = 297/487 (61%), Gaps = 28/487 (6%)
 Frame = +3

Query  216   PPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQ  395
             PPGP+G+P+ GN++L+  + HR L +LA++YG + HL++G +  +VVS P+ A   L+T 
Sbjct  34    PPGPRGFPIFGNLHLLGKFPHRALHQLAQKYGPITHLRLGLVTTIVVSSPNAAESFLKTN  93

Query  396   DNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR-DEV  572
             D +F++RP + +  Y+SY + +++FA YGP+WR +RK+C ++L S  +  S+  +R +E+
Sbjct  94    DIVFASRPPHESAKYISYQQKNLSFASYGPYWRNVRKMCTLELLSNHKINSFKFIRKEEL  153

Query  573   DNTVRTV--AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDE-FIKILQEFSKL  743
             D  ++ +  A     AV++   +  L+ +++ R  FG      +     F  ++QE  KL
Sbjct  154   DLLIKYIKEASFQREAVDLSAKVASLSADMSCRMVFGKKYMDDEFDARGFKVVIQEGMKL  213

Query  744   FGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEVS  923
               A N+ D+ P ++  DLQGL  R+       DGF +KIID+HI      R K       
Sbjct  214   AAAPNLGDYIPQIAWLDLQGLTKRMKAVSKVFDGFFEKIIDEHIQFKDESRTK-------  266

Query  924   GDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIEW  1103
                   D VD +L F   E+         +   + RD+IK II+D++ G  +T A+ IEW
Sbjct  267   ------DFVDVMLEFVGSEV---------SEYHIGRDHIKAIILDMLAGSMDTSAAVIEW  311

Query  1104  AMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppiplllhE  1283
             A++EL+K P  +K++Q+EL   VGL++ VEESDLE L +L+  +KET RLHP  PLL+  
Sbjct  312   ALSELLKHPRIMKKVQKELELKVGLNKMVEESDLENLEYLEMVIKETFRLHPVAPLLIPH  371

Query  1284  TA-EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFEFI  1460
              A + T V+GY IP  S  +IN WAI RD ++W DP+ F P+RF    + DF+G +F+ +
Sbjct  372   QATQDTIVDGYLIPKNSHIVINTWAIGRDPSAWTDPERFLPERFAGNNV-DFRGRDFQLL  430

Query  1461  PFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATRLV  1640
             PFGSGRR CPG+QLG+    L +A L HCF WELP+ M P++LDM + F L  P+A  L+
Sbjct  431   PFGSGRRGCPGIQLGVTVVRLVLAQLVHCFDWELPNDMLPNELDMSEEFSLVTPRAKHLL  490

Query  1641  VIPTPRL  1661
              +PT RL
Sbjct  491   ALPTYRL  497



>ref|XP_009767392.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=495

 Score =   369 bits (947),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 192/490 (39%), Positives = 301/490 (61%), Gaps = 27/490 (6%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGP G P++G+++L+   +H+ L KLA++YG  ++L++G +  ++VS P+   +VL
Sbjct  27    KKLPPGPIGIPILGHLHLIGKNAHQDLYKLAKKYGPFMYLRLGLVPTIIVSSPETVEKVL  86

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR-  563
             +T D++F++RP N A  Y+SY + ++ F+ YG +WR MRKLC ++L + ++  S+ S R 
Sbjct  87    KTYDHVFASRPHNEASQYISYGQRNLIFSKYGSYWRNMRKLCTLQLLTSQKVNSYQSSRK  146

Query  564   DEVDNTVRTV--AMNCGSAVNIGELIFGLTRNITYRAAFGSS-PSSGQGQDEFIKILQEF  734
             +EV   V+++  A   G AV++   +  L  N++    FG         +  F  I+QE 
Sbjct  147   EEVYILVKSIKQAAQDGVAVDLSAKVSSLNANLSCLMVFGKKFMDEDLDKRGFKSIVQEV  206

Query  735   SKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGG  914
             + L    N+ DFFP+L   DLQGL  RL       D F++KII++H+ Q++ +R      
Sbjct  207   AHLAVTPNLGDFFPYLGVLDLQGLTGRLKALSKFFDEFLEKIIEEHV-QSKEQRETE---  262

Query  915   EVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASA  1094
                      D VD ++A              +   +  R ++K I++D++    +T A++
Sbjct  263   ---------DFVDTMMAIMQSG---------EAGFEFDRRHVKAILLDMLTASMDTSATS  304

Query  1095  IEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppipll  1274
             +EW ++EL++ P+ +K+LQ+EL + VGLDR VEESDLE L +L   +KE LRLH   PLL
Sbjct  305   VEWILSELLRHPQVMKKLQKELEEVVGLDRMVEESDLENLKYLDMVIKEALRLHSVAPLL  364

Query  1275  lhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFE  1454
              HE+ E   V+G+++   SR I+N +A  RD N+W +PD F P+RF++  + D +G +F+
Sbjct  365   NHESIEDCVVDGFFVQKGSRIIVNVYAAQRDSNAWPEPDKFFPERFVESNV-DLRGHDFQ  423

Query  1455  FIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATR  1634
              +PFGSGRRSCPGMQLG+    L VA L HCF WELP+GM+PS+LDM + FGL   +A  
Sbjct  424   LLPFGSGRRSCPGMQLGIIIVRLVVAQLVHCFDWELPNGMQPSELDMSEQFGLVTYRAKH  483

Query  1635  LVVIPTPRLN  1664
             L+ +PT RL+
Sbjct  484   LMAVPTYRLH  493



>ref|XP_007159747.1| hypothetical protein PHAVU_002G263700g [Phaseolus vulgaris]
 gb|ESW31741.1| hypothetical protein PHAVU_002G263700g [Phaseolus vulgaris]
Length=497

 Score =   368 bits (944),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 198/494 (40%), Positives = 297/494 (60%), Gaps = 29/494 (6%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGP+G P++G+++ +    HR L +LA +YG ++ L++G +  VVVS P  A   L
Sbjct  24    KKLPPGPRGLPILGSLHKLGANPHRNLHQLALKYGPVMFLRLGFMPTVVVSSPQAAELFL  83

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR-  563
             +T D +F++RP   A  Y+S+ + ++AFA YG +WR MRKLC ++L S+ +  S+ S+R 
Sbjct  84    KTHDLVFASRPRYQAEKYVSWGQRNLAFAEYGSYWRNMRKLCTLELLSQTKINSFRSMRE  143

Query  564   DEVDNTVRTV--AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDE--FIKILQE  731
             +E+D  ++ +  A N G+ V++   +  L+ +++ R   G      Q  DE  F  ++QE
Sbjct  144   EELDLLIKLLREAANAGATVDLSAKLSTLSADMSCRMVLGKK-YMDQDLDEKGFKAVMQE  202

Query  732   FSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHG  911
               +L    N+ D+ P+++  DLQG+  RL       D F DKIID+H+   +        
Sbjct  203   AMRLLATPNMGDYIPYIAALDLQGITKRLKANHKIFDHFFDKIIDEHMESDK--------  254

Query  912   GEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVAS  1091
                 G+    D VD +L FY  +         ++  ++ R NIK I+ D++ G  +T A+
Sbjct  255   ----GEDKTKDFVDVMLGFYGTQ---------ESEYRIERSNIKAILTDMLAGSMDTSAT  301

Query  1092  AIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlh-ppip  1268
             AIEW ++EL+K P  +K+LQ EL   VG+++KVEESDLEKL +L   +KE+LRLH     
Sbjct  302   AIEWTLSELLKNPRVMKKLQMELESVVGMEKKVEESDLEKLEYLDMVIKESLRLHPVAPL  361

Query  1269  lllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSN  1448
             L+ H++ E   V  ++IP +SR I+NAWAI RD ++W + + F P+RF    + D +G  
Sbjct  362   LIPHQSTEDCMVGDFFIPKKSRLIVNAWAIMRDPDAWIEAEKFWPERFEGSNI-DVRGRE  420

Query  1449  FEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKA  1628
             FE IPFGSGRR CPG+QLGL      VA L HCF W+LP+ M P +LDM D FGLT P+A
Sbjct  421   FELIPFGSGRRGCPGIQLGLTVIRHTVAQLVHCFDWKLPNDMMPDELDMADEFGLTMPRA  480

Query  1629  TRLVVIPTPRLNCQ  1670
               L+ IPT RL+ Q
Sbjct  481   NHLLAIPTYRLSIQ  494



>ref|XP_008234579.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=498

 Score =   367 bits (943),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 197/493 (40%), Positives = 294/493 (60%), Gaps = 28/493 (6%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGP+G+PL GN++++  + HR L +LA+++G +++L++G   +VV S P  A   L
Sbjct  29    KRLPPGPRGFPLFGNLHMLGEFPHRDLHRLAQKHGDIMYLRLGLAPVVVASSPQAAELFL  88

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVRD  566
             +T D +F++RP   A  ++SY + +++F  YG +WR MRK+C ++L S  +  S+  +R 
Sbjct  89    KTHDLVFASRPPLQAAEHISYGQRNLSFGAYGSYWRTMRKMCTLELLSSHKINSFKPMRK  148

Query  567   EVDNTVRTVAMNCGS---AVNIGELIFGLTRNITYRAAFGSSPSSGQGQDE-FIKILQEF  734
             E  + +             V++   +  LT +++    FG      +  +  F  ++QE 
Sbjct  149   EELSILTKFIQEAACDRVTVDLSGKVASLTADMSCLMVFGKKYMDKEFDERGFKAVIQEG  208

Query  735   SKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGG  914
               L    N  DF PF++  DLQGL  R+       D F +KIID+HI    + R K    
Sbjct  209   MHLAATPNFGDFIPFIAPLDLQGLTKRMKGVSKVFDAFFEKIIDEHIQSKDQERTK----  264

Query  915   EVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASA  1094
                      D VD +L F   E         ++  ++ R NIK II+D++ G  +T A+A
Sbjct  265   ---------DFVDVMLGFMGSE---------ESEYRIERSNIKAIILDMLAGAMDTTATA  306

Query  1095  IEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppipll  1274
             IEW ++EL+K P  +K++Q+EL + VG++R+VEESDLEKL +L   +KET+RLHP  PLL
Sbjct  307   IEWTLSELIKHPRVMKKVQKELENVVGMEREVEESDLEKLEYLDMVVKETMRLHPVAPLL  366

Query  1275  lhETA-EATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNF  1451
             L   A E   V+G++IP +SR +IN +AI RD + W D + F P+RF    + DF+G +F
Sbjct  367   LPHAAIEDCNVSGFHIPRKSRVMINIFAIGRDPSIWTDAEKFIPERFDGSNI-DFRGRDF  425

Query  1452  EFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKAT  1631
             +FIPFGSGRR CPGMQLG+   +L VA L HCF WELP+ M PS+LDM + FGLT P+A 
Sbjct  426   QFIPFGSGRRGCPGMQLGITMVQLVVAQLVHCFDWELPNNMLPSELDMTEEFGLTVPRAK  485

Query  1632  RLVVIPTPRLNCQ  1670
              L+ +PT RL  Q
Sbjct  486   HLLAVPTYRLQQQ  498



>ref|XP_008240284.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=509

 Score =   367 bits (943),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 204/493 (41%), Positives = 293/493 (59%), Gaps = 25/493 (5%)
 Frame = +3

Query  216   PPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQTQ  395
             PPGP+  P+IGN++++ +  HR L  LA++YG ++ +++G++  +VVS P  A   L+T 
Sbjct  34    PPGPRALPIIGNLHMLGNLPHRSLQHLAKKYGPIMSMRLGNIPAIVVSSPTAAELFLKTH  93

Query  396   DNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSV-RDEV  572
             D IF++RP   A  Y+SY    MAF  YGP+WR +RKLC ++L    + E    + R+EV
Sbjct  94    DTIFASRPKVQASEYMSYGTKGMAFTEYGPYWRHIRKLCTLQLLCPSKIEGSAPLRREEV  153

Query  573   DNTVRTV--AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEF-IK-ILQEFSK  740
                ++++  A   G  V++ E + GL  +ITYR   GS     +  D F +K  +QE   
Sbjct  154   GLFIQSLKKAAAAGEVVDLSEKVGGLVEDITYRMVLGS-----KNDDMFDLKGTIQEALF  208

Query  741   LFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGEV  920
             L GAFN+ D+ PFLS  DLQGL  R+ +    +D   +KII +H          +  G+V
Sbjct  209   LSGAFNIGDYVPFLSPLDLQGLAKRMKRISKTIDQLFEKIIGEH-------EQVSKSGQV  261

Query  921   SGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAIE  1100
              G  +  D VD LL+     +  ND    +    + R N+K I++D++ G  +T A+ I 
Sbjct  262   QGH-SHKDFVDVLLSLIHQPLNPND----EKVYMMERTNVKAILLDMISGAFDTSATTIV  316

Query  1101  WAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlh-ppiplll  1277
             W +AEL++ P  +K LQ+EL   +G+DR VEESDL KL +L   +KE+LRLH     L+ 
Sbjct  317   WTLAELLRHPRVMKHLQEELQSVIGMDRMVEESDLPKLCYLSMVVKESLRLHPVAPLLIP  376

Query  1278  hETAEATEVNGYYIPARSRAIINAWAIARDKNSW-EDPDSFKPDRFLKEGMPDFKGSNFE  1454
             HE+ E   V G+ IP +SR  IN WAI RD   W E+ + F  +RF+ +G  D +G +F+
Sbjct  377   HESMEDITVEGFDIPKKSRIFINTWAIGRDPKVWSENVEEFYTERFI-DGNIDLRGHDFQ  435

Query  1455  FIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATR  1634
              +PFGSGRR CP MQLGL    LA+A+L HCF WELP G+KP DLDM + FGL+  KA  
Sbjct  436   LLPFGSGRRGCPAMQLGLTTVCLALANLVHCFNWELPSGLKPKDLDMTEKFGLSLSKAKH  495

Query  1635  LVVIPTPRLNCQL  1673
             L  +PT RL  QL
Sbjct  496   LFAMPTYRLCNQL  508



>ref|XP_011013422.1| PREDICTED: cytochrome P450 CYP736A12-like [Populus euphratica]
Length=493

 Score =   367 bits (942),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 197/492 (40%), Positives = 296/492 (60%), Gaps = 30/492 (6%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGP+G+P+ G+++++  + HR L +LA++YG ++HL++G +  +VVS P+ A   L
Sbjct  25    KRLPPGPRGFPIFGSLHMLGKFPHRALHQLAQKYGPIMHLRLGLVPTIVVSSPEAAELFL  84

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR-  563
             +T D +F+ RP + A  Y SY +  M FA YGP+WR MRK+C ++L S  +  S+ S R 
Sbjct  85    KTHDLVFAGRPPHEAARYFSYGQKGMTFAQYGPYWRNMRKMCTIELLSSLKITSFKSTRM  144

Query  564   DEVDNTVRTV--AMNCGSAVNIGELIFGLTRNITYRAAFGSSPSSGQGQDE--FIKILQE  731
             +E+D  ++ +  A     AV++   +  L  +++ R  FG      +  DE  F  ++QE
Sbjct  145   EELDLLIKYIQEAARERVAVDLSAKVSSLNADMSCRMVFGKK-YLDEDLDERGFKSVMQE  203

Query  732   FSKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHG  911
                L  A ++ D+ P ++  DLQGL  R+      LD +++KIID+H     + +NK   
Sbjct  204   VMHLSAAPHLGDYIPQIAALDLQGLTKRMKAISKVLDVYLNKIIDEHAQYQEKGKNK---  260

Query  912   GEVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVAS  1091
                       D VD +L+F   E         +N   + +  +K I++D++ G  +T A+
Sbjct  261   ----------DFVDVMLSFMKSE---------ENEHLVDQGCMKAIMLDMLAGSMDTSAT  301

Query  1092  AIEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhpp-ip  1268
              I+WA +EL+K P  +K+LQ+EL + VG  R VEESDLE+L +L   +KETLRLHP    
Sbjct  302   VIDWAFSELIKNPRVMKKLQKELEEAVGKQRMVEESDLERLEYLDMVVKETLRLHPAGPL  361

Query  1269  lllhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSN  1448
             ++ HE  E   VNG++IP +S  IIN WAI RD  +W D + F P+RF+   + D +G N
Sbjct  362   MIPHEAMEDCIVNGFHIPKKSHVIINVWAIGRDPKAWTDAEKFYPERFVGSDI-DVRGRN  420

Query  1449  FEFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKA  1628
             F+ IPFG+GRRSCPGMQLGL    L +A L HCF WELP+G+ PS++DM + FGL   ++
Sbjct  421   FQLIPFGTGRRSCPGMQLGLTVVRLVLAQLVHCFDWELPNGILPSEVDMTEEFGLVMCRS  480

Query  1629  TRLVVIPTPRLN  1664
               LV IPT RLN
Sbjct  481   KHLVAIPTYRLN  492



>gb|KHN20714.1| Cytochrome P450 71D10 [Glycine soja]
Length=510

 Score =   367 bits (942),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 199/490 (41%), Positives = 287/490 (59%), Gaps = 26/490 (5%)
 Frame = +3

Query  213   YPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVLQT  392
             YPPGPK  P+IGN++++    HR L  LA+QYG ++ LK+G +  +V+S P+ A   L+T
Sbjct  33    YPPGPKTLPIIGNLHMLGKLPHRTLQSLAKQYGPIMSLKLGQVTTIVISSPETAELFLKT  92

Query  393   QDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR-DE  569
              D  F++RP +++  Y+SY    + F+ YGP+WR MRKLC V+L    + E +  +R  +
Sbjct  93    HDTTFASRPKSISSKYISYGGKGLVFSEYGPYWRNMRKLCTVQLLIASKVEMFSPLRSQQ  152

Query  570   VDNTVRTVAMNCGS--AVNIGELIFGLTRNITYRAAFGSSPSSGQGQDEF-IKIL-QEFS  737
             +   V+ +     S   V++ +++  L  NI ++  FG S       D F +K L  E  
Sbjct  153   LQELVKCLRKTASSREVVDLSDMVGDLIENINFQMIFGCS-----KDDRFDVKNLAHEIV  207

Query  738   KLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGGE  917
              L G FNV+D+ P+L  FDLQ L  RL K   + D  +++II DH  Q+   + K+    
Sbjct  208   NLAGTFNVADYMPWLRVFDLQELVRRLKKVSKSFDEVLEQIIKDH-EQSSDNKQKSQ---  263

Query  918   VSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASAI  1097
                   + D VD  LA     +   D    ++   L R N+K I+M ++    +T A+AI
Sbjct  264   -----RQKDFVDIFLALMHQPLDPQD----EHGHVLDRTNMKAIMMTMIVAAIDTSATAI  314

Query  1098  EWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlh-ppipll  1274
             EWAM+EL+K P  +K+LQ EL   VG++RKVEESD+EKL +L   +KETLRL+     L+
Sbjct  315   EWAMSELLKHPRVMKKLQDELESVVGMNRKVEESDMEKLPYLDLVVKETLRLYPVAPLLV  374

Query  1275  lhETAEATEVNGYYIPARSRAIINAWAIARDKNSWED-PDSFKPDRFLKEGMPDFKGSNF  1451
               E  E   ++GY I  RSR I+NAWAI RD   W D  + F P+RF    + D +G +F
Sbjct  375   PRECREEITIDGYCIKERSRIIVNAWAIGRDPKVWSDNAEVFYPERFANSNV-DMRGYDF  433

Query  1452  EFIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKAT  1631
               +PFGSGRR CPG+ LGL   ++ +A L HCF WELP GM P DLDM + FGLT P++ 
Sbjct  434   RLLPFGSGRRGCPGIHLGLTTVKIVLAQLVHCFNWELPLGMSPDDLDMTEKFGLTIPRSN  493

Query  1632  RLVVIPTPRL  1661
              L+ +PT RL
Sbjct  494   HLLAVPTYRL  503



>ref|XP_009608339.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=495

 Score =   366 bits (940),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 189/490 (39%), Positives = 296/490 (60%), Gaps = 27/490 (6%)
 Frame = +3

Query  207   KPYPPGPKGWPLIGNMNLMDHYSHRGLAKLAEQYGGLLHLKMGSLHMVVVSGPDEARQVL  386
             K  PPGP G P++G+++L+    H+   +LA++YG  ++L++G +  +VVS P+   +VL
Sbjct  27    KKLPPGPIGIPILGHLHLIGKNPHQTFYRLAKKYGPFMYLRLGLVPTIVVSSPETVEKVL  86

Query  387   QTQDNIFSNRPANVAISYLSYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAESWDSVR-  563
             +T D++F++RP + A  Y+ Y + ++ F+ YG +WR MRKLC ++L + ++  S+ S R 
Sbjct  87    KTYDHVFASRPHHEASQYICYGQRNLIFSKYGSYWRNMRKLCTLQLLTSQKINSYQSSRK  146

Query  564   DEVDNTVRTV--AMNCGSAVNIGELIFGLTRNITYRAAFGSS-PSSGQGQDEFIKILQEF  734
             +EV   V+++  A   G AV++   +  L  N++    FG         +  F  I+QE 
Sbjct  147   EEVSILVKSIKQAAQDGVAVDLSAKVSSLNANLSCLMVFGKKFMDEDLDKRGFKSIVQEV  206

Query  735   SKLFGAFNVSDFFPFLSCFDLQGLNPRLAKARAALDGFIDKIIDDHILQTRRRRNKNHGG  914
               L    N+ DFFP+L   DLQGL  RL       D F++KIID+H+ Q++ +R      
Sbjct  207   VHLAATPNLGDFFPYLGVLDLQGLTSRLKALSKVFDEFLEKIIDEHV-QSKEQRETE---  262

Query  915   EVSGDGAETDMVDELLAFYSDEMKVNDSDDLQNAIKLTRDNIKGIIMDVMFGGTETVASA  1094
                      D VD ++A              +   +  R +IK +++D++    +T A++
Sbjct  263   ---------DFVDTMMAIMQSG---------EAGFEFDRRHIKAVLLDMLMASMDTSATS  304

Query  1095  IEWAMAELMKTPENLKRLQQELTDTVGLDRKVEESDLEKLTFLKCCLKETlrlhppipll  1274
             +EW + EL++ P  +K+LQ+EL + VGLDR VEESDLE L +L   +KE LRLH   PLL
Sbjct  305   VEWTLTELLRHPHVMKKLQKELEEVVGLDRMVEESDLENLKYLDMVIKEALRLHSAAPLL  364

Query  1275  lhETAEATEVNGYYIPARSRAIINAWAIARDKNSWEDPDSFKPDRFLKEGMPDFKGSNFE  1454
             +HE+ E   V+G+Y+   SR I+N +A  RD N+W +PD F P+RF++  + D +G +F+
Sbjct  365   IHESIEDCVVDGFYVQKGSRIIVNVYAAQRDPNAWPEPDKFFPERFVESNV-DLRGHDFQ  423

Query  1455  FIPFGSGRRSCPGMQLGLYAFELAVAHLFHCFTWELPDGMKPSDLDMDDVFGLTAPKATR  1634
              +PFGSGRRSCPGMQLG+    L VA L HCF WELP+GM+PS+LDM + FG+   +A  
Sbjct  424   LLPFGSGRRSCPGMQLGIIIVRLVVAQLVHCFDWELPNGMQPSELDMSEQFGVVTCRAKH  483

Query  1635  LVVIPTPRLN  1664
             L+ +PT +L+
Sbjct  484   LIAVPTYKLH  493



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5635032212004