BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27240_g1_i1 len=496 path=[474:0-495]

Length=496
                                                                      Score     E

gb|ACU13843.1|  unknown                                               74.7    3e-14   Glycine max [soybeans]
ref|XP_009780051.1|  PREDICTED: defensin-like protein 1               72.0    2e-13   
ref|XP_009590912.1|  PREDICTED: defensin-like protein 1               68.6    4e-12   
gb|KGN62247.1|  hypothetical protein Csa_2G340400                     68.2    1e-11   
ref|XP_004147317.1|  PREDICTED: defensin-like protein-like            67.0    2e-11   
gb|AHA50468.1|  defensin-like protein 2                               65.9    4e-11   
ref|NP_001240040.1|  uncharacterized protein LOC100787787             65.1    1e-10   
ref|XP_002513261.1|  8.4 kDa sulfur-rich protein precursor, putative  63.9    2e-10   Ricinus communis
ref|XP_006384382.1|  hypothetical protein POPTR_0004s14520g           63.5    2e-10   
ref|XP_011001251.1|  PREDICTED: defensin-like protein 1               63.2    4e-10   
ref|XP_002325734.2|  defensin-like family protein                     61.6    1e-09   Populus trichocarpa [western balsam poplar]
gb|ABK93231.1|  unknown                                               61.2    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_004503014.1|  PREDICTED: defensin-like protein 6-like isof...  61.2    2e-09   
ref|XP_010675152.1|  PREDICTED: defensin-like protein 1 isoform X1    61.2    2e-09   
ref|XP_004503015.1|  PREDICTED: defensin-like protein 6-like isof...  61.2    2e-09   
ref|XP_007033927.1|  Scorpion toxin-like knottin superfamily protein  62.0    3e-09   
ref|XP_010675153.1|  PREDICTED: defensin-like protein 1 isoform X2    60.1    4e-09   
ref|XP_009631841.1|  PREDICTED: defensin-like protein 1               59.3    7e-09   
ref|XP_006394251.1|  hypothetical protein EUTSA_v10005235mg           59.3    7e-09   
gb|EYU18232.1|  hypothetical protein MIMGU_mgv1a015502mg              60.5    1e-08   
emb|CAN69975.1|  hypothetical protein VITISV_020776                   58.9    1e-08   Vitis vinifera
ref|XP_002272913.2|  PREDICTED: defensin-like protein 1 isoform X1    58.9    1e-08   Vitis vinifera
ref|XP_010653029.1|  PREDICTED: defensin-like protein 1 isoform X2    58.9    1e-08   
ref|XP_006426419.1|  hypothetical protein CICLE_v10026887mg           58.9    1e-08   
gb|KHN09675.1|  Defensin-like protein                                 58.5    1e-08   
ref|XP_009763849.1|  PREDICTED: defensin-like protein 1               58.9    1e-08   
ref|XP_006426420.1|  hypothetical protein CICLE_v10026887mg           58.9    1e-08   
sp|Q07502.1|DEF_SOYBN  RecName: Full=Defensin-like protein; AltNa...  58.5    1e-08   Glycine max [soybeans]
ref|XP_006466198.1|  PREDICTED: defensin-like protein 6-like          58.5    2e-08   
emb|CAA79164.1|  seed-specific low molecular weight sulfur-rich p...  58.5    2e-08   Glycine max [soybeans]
gb|AAG38520.1|AF283535_1  proteinase inhibitor se60-like protein      58.5    2e-08   Citrus x paradisi [grapefruit]
ref|XP_011001252.1|  PREDICTED: defensin-like protein 1               57.8    3e-08   
ref|XP_002325735.1|  hypothetical protein POPTR_0019s00770g           57.8    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_011099655.1|  PREDICTED: defensin-like protein 1               57.8    3e-08   
ref|XP_004242747.1|  PREDICTED: defensin-like protein                 57.4    4e-08   
gb|AAG17880.1|AF293407_1  Kunitz trypsin inhibitor protein            57.0    5e-08   Phaseolus coccineus [scarlet runner bean]
ref|XP_007137816.1|  hypothetical protein PHAVU_009G158000g           57.0    5e-08   
gb|KHG09995.1|  Defensin-like protein 1                               56.2    9e-08   
gb|AFJ04517.1|  low-molecular-weight cysteine-rich 69                 56.2    9e-08   
ref|XP_003630421.1|  Defensin                                         56.2    1e-07   
dbj|BAA95697.1|  thionin like protein                                 56.2    1e-07   Nicotiana tabacum [American tobacco]
gb|ACM90159.1|  low-molecular-weight cysteine-rich 69                 55.8    1e-07   Jatropha curcas
ref|XP_009593293.1|  PREDICTED: defensin-like protein P322            55.8    1e-07   
gb|EMT16291.1|  Defensin SD2                                          55.8    1e-07   
ref|XP_010908980.1|  PREDICTED: defensin Ec-AMP-D1-like               55.8    2e-07   
gb|ACB32234.1|  gamma-thionin/defensin                                55.5    2e-07   Solanum chacoense
ref|XP_006359485.1|  PREDICTED: defensin-like protein-like            55.8    2e-07   
gb|ABO36641.1|  defensin protein                                      55.5    2e-07   Solanum pimpinellifolium [currant tomato]
ref|XP_009769843.1|  PREDICTED: defensin-like protein P322            55.5    2e-07   
gb|ABO36637.1|  defensin protein                                      55.5    2e-07   Solanum lycopersicum
ref|NP_001234872.1|  gamma-thionin precursor                          55.1    2e-07   
gb|KEH35658.1|  low-molecular-weight cysteine-rich protein            54.7    2e-07   
gb|ACS96442.1|  defensin                                              55.1    3e-07   Jatropha curcas
emb|CDY39856.1|  BnaC02g42620D                                        54.7    3e-07   
sp|P83399.1|DEF1_VIGUN  RecName: Full=Defensin-like protein 1; Al...  54.3    3e-07   Vigna unguiculata
ref|NP_201171.1|  defensin-like protein 6                             54.7    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010910081.1|  PREDICTED: defensin Ec-AMP-D2-like               54.7    4e-07   
ref|XP_006466199.1|  PREDICTED: defensin-like protein-like            54.7    4e-07   
ref|XP_004301463.1|  PREDICTED: defensin-like protein-like            54.3    4e-07   
gb|EPS67569.1|  gamma-thionin                                         53.9    5e-07   
gb|KHG15212.1|  Defensin-like protein 1                               54.3    5e-07   
ref|XP_004297786.1|  PREDICTED: defensin-like protein 2-like          54.3    5e-07   
gb|AGT51230.1|  defensin                                              53.5    6e-07   
ref|XP_004297787.1|  PREDICTED: defensin-like protein 2-like          53.9    6e-07   
ref|XP_007223487.1|  hypothetical protein PRUPE_ppa013508mg           54.7    6e-07   
ref|XP_008793609.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X1    53.9    7e-07   
ref|XP_008793610.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X2    53.9    7e-07   
gb|AAL35366.1|AF442388_1  defensin protein precursor                  53.9    7e-07   Capsicum annuum
gb|KHN06998.1|  Defensin-like protein                                 53.9    8e-07   
sp|P82659.1|DFSD2_HELAN  RecName: Full=Defensin SD2; AltName: Ful...  53.5    9e-07   Helianthus annuus
ref|XP_004509603.1|  PREDICTED: defensin-like protein-like            53.5    1e-06   
ref|XP_006367978.1|  PREDICTED: defensin-like protein P322-like       53.5    1e-06   
ref|XP_006359486.1|  PREDICTED: defensin-like protein-like            53.5    1e-06   
ref|XP_004242748.1|  PREDICTED: defensin-like protein                 53.5    1e-06   
gb|AIA66987.1|  defensin                                              53.5    1e-06   
ref|XP_010025674.1|  PREDICTED: defensin-like protein 1               53.1    1e-06   
ref|XP_004503912.1|  PREDICTED: defensin-like protein-like            53.1    1e-06   
emb|CAH58740.1|  defensin                                             53.1    1e-06   Plantago major [cart-track plant]
ref|XP_006585876.1|  PREDICTED: defensin-like protein-like            54.3    1e-06   
ref|XP_009599356.1|  PREDICTED: defensin-like protein                 53.1    1e-06   
ref|XP_010270777.1|  PREDICTED: defensin-like protein                 53.1    1e-06   
ref|XP_002864860.1|  predicted protein                                53.1    1e-06   
ref|XP_009792224.1|  PREDICTED: defensin-like protein P322            53.1    1e-06   
dbj|BAC10287.1|  defensin                                             53.1    2e-06   Triticum aestivum [Canadian hard winter wheat]
gb|KHN16909.1|  Defensin J1-2                                         53.1    2e-06   
gb|ABA86589.1|  putative defensin 1                                   52.8    2e-06   Aquilegia pyrenaica
ref|XP_006359487.1|  PREDICTED: defensin-like protein-like            52.8    2e-06   
ref|XP_003629332.1|  Defensin                                         52.8    2e-06   
ref|XP_007033367.1|  Scorpion toxin-like knottin superfamily protein  52.8    2e-06   
gb|ABA86586.1|  putative defensin 1                                   52.4    2e-06   Aquilegia formosa
gb|ABA81896.1|  putative defensin                                     52.4    2e-06   Aquilegia formosa
ref|XP_003630422.1|  Defensin                                         52.4    2e-06   
ref|XP_002274353.1|  PREDICTED: defensin Ec-AMP-D2                    52.4    2e-06   Vitis vinifera
dbj|BAJ89304.1|  predicted protein                                    52.4    2e-06   
ref|XP_010246429.1|  PREDICTED: defensin-like protein                 52.4    2e-06   
ref|XP_004509604.1|  PREDICTED: defensin-like protein P322-like       52.4    2e-06   
sp|Q40901.1|DEF_PETIN  RecName: Full=Defensin-like protein; AltNa...  52.4    2e-06   Petunia integrifolia [violet-flowered petunia]
ref|XP_009769844.1|  PREDICTED: defensin-like protein P322            52.4    3e-06   
gb|EPS66510.1|  kunitz trypsin inhibitor protein                      52.0    3e-06   
gb|AFQ69079.1|  defensin precursor                                    52.0    3e-06   
ref|XP_007033370.1|  Scorpion toxin-like knottin superfamily protein  52.0    4e-06   
ref|XP_006586320.1|  PREDICTED: defensin-like protein-like            51.6    4e-06   
gb|ACV84382.1|  defensin precursor                                    51.6    4e-06   Triticum turgidum subsp. durum
ref|XP_010319372.1|  PREDICTED: defensin Ec-AMP-D2-like               51.6    4e-06   
ref|XP_009593292.1|  PREDICTED: defensin-like protein P322            51.6    4e-06   
ref|XP_008340514.1|  PREDICTED: defensin Ec-AMP-D2-like               51.6    5e-06   
gb|EMT22721.1|  Defensin Tk-AMP-D2                                    51.6    5e-06   
gb|AIA66993.1|  defensin                                              51.6    5e-06   
ref|XP_008349481.1|  PREDICTED: defensin Ec-AMP-D2-like               51.2    6e-06   
gb|ACN93800.1|  defensin precursor                                    51.2    6e-06   Vigna unguiculata
ref|XP_004985852.1|  PREDICTED: defensin SD2-like                     51.2    6e-06   
dbj|BAK07043.1|  predicted protein                                    51.6    6e-06   
ref|XP_002459603.1|  hypothetical protein SORBIDRAFT_02g007390        51.2    6e-06   Sorghum bicolor [broomcorn]
ref|XP_003628977.1|  Defensin                                         51.2    7e-06   
gb|AFE88173.1|  g-thionin                                             50.8    8e-06   
ref|XP_010088525.1|  Defensin-like protein 2                          50.8    8e-06   
ref|XP_007156391.1|  hypothetical protein PHAVU_003G282500g           50.8    8e-06   
ref|XP_003599384.1|  Defensin                                         50.8    9e-06   
ref|XP_009802655.1|  PREDICTED: defensin-like protein                 50.8    9e-06   
gb|AGT51229.1|  defensin                                              50.4    1e-05   
gb|ADK36631.1|  defensin-like protein                                 50.1    1e-05   
gb|KEH35661.1|  Defensin                                              50.4    1e-05   
emb|CDP16306.1|  unnamed protein product                              50.4    1e-05   
ref|XP_008389119.1|  PREDICTED: defensin Ec-AMP-D2-like               50.4    1e-05   
gb|AAP80654.1|AF479035_1  proteinase inhibitor Rgpi9                  50.4    1e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002875116.1|  hypothetical protein ARALYDRAFT_904442           50.1    1e-05   
emb|CDP10468.1|  unnamed protein product                              50.1    1e-05   
ref|NP_178322.1|  defensin-like protein 10                            50.1    1e-05   Arabidopsis thaliana [mouse-ear cress]
gb|EMT03364.1|  Defensin SD2                                          50.1    2e-05   
ref|XP_002468581.1|  hypothetical protein SORBIDRAFT_01g048380        50.1    2e-05   Sorghum bicolor [broomcorn]
gb|ACV84379.1|  defensin precursor                                    50.1    2e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004976261.1|  PREDICTED: defensin-like protein P322-like       50.1    2e-05   
ref|XP_009604566.1|  PREDICTED: defensin J1-2-like                    50.1    2e-05   
ref|XP_009614488.1|  PREDICTED: defensin J1-2-like                    50.1    2e-05   
gb|EMS68062.1|  Defensin Tm-AMP-D1.2                                  49.7    2e-05   
gb|EYU27577.1|  hypothetical protein MIMGU_mgv1a024490mg              49.7    2e-05   
ref|NP_001146997.1|  flower-specific gamma-thionin                    49.3    2e-05   Zea mays [maize]
gb|AAL15885.1|AF417297_1  putative gamma-thionin                      49.7    2e-05   Castanea sativa
ref|XP_010250779.1|  PREDICTED: defensin Ec-AMP-D2-like               49.7    3e-05   
gb|AAS65426.1|  Kunitz-type trypsin inhibitor                         49.7    3e-05   Ipomoea batatas [batate]
ref|NP_001146981.1|  flower-specific gamma-thionin precursor          49.7    3e-05   Zea mays [maize]
gb|KHN23780.1|  Defensin SD2                                          49.3    3e-05   
ref|XP_010043884.1|  PREDICTED: defensin Ec-AMP-D2-like               49.3    3e-05   
ref|NP_178320.1|  defensin-like protein 4                             49.3    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178319.1|  defensin-like protein 2                             49.3    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006649329.1|  PREDICTED: defensin J1-2-like                    49.3    3e-05   
ref|NP_001234987.1|  protease inhibitor precursor                     49.3    3e-05   
ref|XP_009383785.1|  PREDICTED: defensin-like protein 1               49.3    3e-05   
gb|EMT03363.1|  hypothetical protein F775_43918                       49.3    3e-05   
ref|XP_004151187.1|  PREDICTED: defensin J1-2-like                    48.9    4e-05   
gb|ABX84378.1|  amylase inhibitor-like protein                        49.3    4e-05   Triticum aestivum [Canadian hard winter wheat]
gb|ABX84377.1|  amylase inhibitor-like protein                        49.3    4e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006292136.1|  hypothetical protein CARUB_v10018340mg           48.9    4e-05   
gb|ADQ43196.1|  unknown                                               48.9    4e-05   
ref|XP_009129168.1|  PREDICTED: defensin-like protein 1               48.9    4e-05   
gb|ABA86587.1|  putative defensin 1                                   48.9    4e-05   Aquilegia chrysantha
gb|ACV84381.1|  defensin precursor                                    48.9    4e-05   Triticum turgidum subsp. durum
ref|NP_178321.1|  defensin-like protein 1                             48.9    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875115.1|  hypothetical protein ARALYDRAFT_484136           48.9    5e-05   
gb|ACV84384.1|  defensin precursor                                    48.9    5e-05   Triticum turgidum subsp. durum
gb|AIA66989.1|  defensin                                              48.9    5e-05   
ref|XP_007045354.1|  Defensin-like protein isoform 2                  48.5    5e-05   
ref|XP_008437687.1|  PREDICTED: defensin J1-2-like                    48.5    5e-05   
gb|EMT22729.1|  Defensin Tk-AMP-D2                                    48.5    5e-05   
gb|AIA67000.1|  defensin                                              48.5    6e-05   
gb|ACB20518.1|  defensin precursor                                    48.5    6e-05   Saccharum officinarum [noble cane]
ref|XP_006420697.1|  hypothetical protein CICLE_v10006362mg           48.5    6e-05   
ref|XP_003575412.1|  PREDICTED: defensin Tm-AMP-D1.2-like             48.5    6e-05   
gb|ADK91098.1|  PCP17C2                                               48.1    6e-05   
emb|CEJ09690.1|  Defensin protein                                     48.5    6e-05   
ref|XP_004953175.1|  PREDICTED: defensin-like protein 2-like          48.5    7e-05   
ref|XP_010513973.1|  PREDICTED: defensin-like protein 1               48.1    7e-05   
ref|XP_010495961.1|  PREDICTED: defensin-like protein 1               48.1    7e-05   
ref|XP_006301968.1|  hypothetical protein CARUB_v10022448mg           48.1    7e-05   
ref|XP_010502227.1|  PREDICTED: defensin-like protein 2               48.1    8e-05   
ref|XP_009351646.1|  PREDICTED: defensin Ec-AMP-D2-like               48.1    8e-05   
gb|ADK87340.1|  defensin                                              48.1    8e-05   
ref|XP_003526900.1|  PREDICTED: defensin-like protein 6-like          48.1    8e-05   
gb|EMT18782.1|  Defensin-like protein                                 51.2    8e-05   
gb|AFK47422.1|  unknown                                               47.8    9e-05   
ref|XP_009397593.1|  PREDICTED: defensin Ec-AMP-D1 {ECO:0000303|P...  48.1    9e-05   
gb|EMT06279.1|  Defensin-like protein 2                               48.1    9e-05   
ref|XP_007137817.1|  hypothetical protein PHAVU_009G158100g           49.3    9e-05   
gb|EMS64594.1|  Defensin Tm-AMP-D1.2                                  48.1    1e-04   
gb|AIA66994.1|  defensin                                              47.8    1e-04   
ref|XP_011099999.1|  PREDICTED: defensin Ec-AMP-D2-like               47.8    1e-04   
ref|XP_002446801.1|  hypothetical protein SORBIDRAFT_06g022870        47.8    1e-04   Sorghum bicolor [broomcorn]
gb|ACG25019.1|  low-molecular-weight cysteine-rich protein LCR69 ...  47.8    1e-04   Zea mays [maize]
ref|NP_001147001.1|  LOC100280611 precursor                           47.8    1e-04   Zea mays [maize]
ref|XP_007045353.1|  Defensin-like protein isoform 1                  47.8    1e-04   
ref|XP_009114206.1|  PREDICTED: defensin-like protein 1               47.8    1e-04   
gb|ABM89231.1|  defensin                                              47.8    1e-04   Setaria italica
gb|EMT22728.1|  Defensin Tm-AMP-D1.2                                  47.8    1e-04   
gb|ACG30752.1|  low-molecular-weight cysteine-rich protein LCR69 ...  47.8    1e-04   Zea mays [maize]
gb|AIA67012.1|  defensin                                              47.8    1e-04   
gb|AAL85480.1|  defensin protein 1                                    47.8    1e-04   Prunus persica
ref|XP_007223891.1|  hypothetical protein PRUPE_ppa014246mg           47.4    1e-04   
ref|XP_004976259.1|  PREDICTED: defensin-like protein-like            47.8    1e-04   
gb|AFW90621.1|  protease inhibitor-related protein                    47.4    1e-04   
dbj|BAJ86109.1|  predicted protein                                    47.4    1e-04   
ref|XP_007159918.1|  hypothetical protein PHAVU_002G278600g           47.4    2e-04   
gb|AIA67010.1|  defensin                                              47.4    2e-04   
gb|AIA66992.1|  defensin                                              47.4    2e-04   
emb|CDY48618.1|  BnaC09g20670D                                        47.4    2e-04   
gb|EMT03365.1|  Defensin-like protein 1                               47.4    2e-04   
ref|XP_009101271.1|  PREDICTED: defensin-like protein 10              47.0    2e-04   
ref|XP_002513755.1|  Low-molecular-weight cysteine-rich protein L...  47.4    2e-04   Ricinus communis
gb|EMT22726.1|  Defensin Tm-AMP-D1.2                                  47.4    2e-04   
gb|AIT42148.1|  defensin-like protein                                 47.4    2e-04   
ref|XP_011070574.1|  PREDICTED: defensin J1-2-like                    47.0    2e-04   
ref|XP_009413079.1|  PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|P...  47.0    2e-04   
ref|NP_001047493.1|  Os02g0629800                                     47.0    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001150374.1|  low-molecular-weight cysteine-rich protein L...  47.0    2e-04   Zea mays [maize]
gb|KDP32807.1|  hypothetical protein JCGZ_12099                       47.0    2e-04   
ref|XP_002452484.1|  hypothetical protein SORBIDRAFT_04g026670        47.0    2e-04   Sorghum bicolor [broomcorn]
ref|XP_006395808.1|  hypothetical protein EUTSA_v10005229mg           47.0    2e-04   
gb|ACV84385.1|  defensin precursor                                    47.0    2e-04   Triticum turgidum subsp. durum
ref|XP_009800136.1|  PREDICTED: defensin J1-2-like                    47.0    2e-04   
ref|XP_009389205.1|  PREDICTED: defensin Tk-AMP-D2-like               47.0    2e-04   
ref|XP_006395809.1|  hypothetical protein EUTSA_v10005228mg           47.0    2e-04   
ref|XP_004242750.1|  PREDICTED: defensin-like protein P322            47.0    2e-04   
gb|ADB02899.1|  gamma-thionin PPT precursor defensin 1-like protein   47.0    2e-04   
ref|XP_004509637.1|  PREDICTED: defensin J1-2-like                    46.6    2e-04   
ref|NP_001048853.1|  Os03g0130300                                     47.0    2e-04   Oryza sativa Japonica Group [Japonica rice]
sp|P82781.2|DEF03_ARATH  RecName: Full=Putative defensin-like pro...  46.6    2e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CBI24167.3|  unnamed protein product                              46.2    2e-04   
gb|AIA66990.1|  defensin                                              47.0    2e-04   
gb|ACJ26760.1|  protease inhibitor-related protein                    46.6    3e-04   Solanum tuberosum [potatoes]
sp|P86518.1|DEF1_ECHCG  RecName: Full=Defensin Ec-AMP-D1              46.2    3e-04   
gb|EMS65297.1|  Defensin SD2                                          46.6    3e-04   
ref|XP_011070572.1|  PREDICTED: defensin J1-2-like                    46.6    3e-04   
sp|P20346.1|DF322_SOLTU  RecName: Full=Defensin-like protein P322...  46.6    3e-04   Solanum tuberosum [potatoes]
ref|XP_002263380.3|  PREDICTED: defensin-like protein 1               47.0    3e-04   Vitis vinifera
ref|XP_009784025.1|  PREDICTED: defensin J1-2                         46.6    3e-04   
ref|XP_010513972.1|  PREDICTED: defensin-like protein 2               46.6    3e-04   
ref|XP_006292846.1|  hypothetical protein CARUB_v10019106mg           46.6    3e-04   
sp|P86519.1|DEF2_ECHCG  RecName: Full=Defensin Ec-AMP-D2              45.8    4e-04   
ref|XP_007159919.1|  hypothetical protein PHAVU_002G278700g           46.2    4e-04   
emb|CEJ09689.1|  Defensin protein                                     46.2    4e-04   
gb|AFK44299.1|  unknown                                               46.2    4e-04   
ref|XP_006292781.1|  hypothetical protein CARUB_v10019030mg           46.2    5e-04   
ref|XP_004954814.1|  PREDICTED: defensin SD2-like                     46.2    5e-04   
gb|AAA91049.1|  protease inhibitor II                                 46.2    5e-04   Brassica rapa
ref|XP_009101273.1|  PREDICTED: defensin-like protein 2               46.2    5e-04   
dbj|BAK07823.1|  predicted protein                                    46.6    5e-04   
gb|AIT42152.1|  defensin-like protein                                 45.8    5e-04   
ref|XP_003628979.1|  Defensin                                         45.8    5e-04   
gb|AGT51228.1|  defensin                                              45.8    5e-04   
gb|AIT42153.1|  defensin-like protein                                 45.8    5e-04   
gb|AIT42149.1|  defensin-like protein                                 45.8    5e-04   
gb|AIT42147.1|  defensin-like protein                                 45.8    5e-04   
ref|XP_011086335.1|  PREDICTED: defensin-like protein 1               46.2    6e-04   
ref|XP_006647552.1|  PREDICTED: defensin-like protein P322-like       45.8    6e-04   
ref|XP_003628978.1|  Defensin                                         45.8    6e-04   
ref|NP_001148158.1|  LOC100281766 precursor                           45.4    7e-04   Zea mays [maize]
ref|XP_010671291.1|  PREDICTED: defensin Ec-AMP-D2-like               45.4    7e-04   
ref|XP_009610211.1|  PREDICTED: defensin J1-2                         45.4    7e-04   
ref|NP_001147137.1|  LOC100280744 precursor                           45.4    8e-04   Zea mays [maize]
gb|EAY86781.1|  hypothetical protein OsI_08161                        48.5    8e-04   Oryza sativa Indica Group [Indian rice]
gb|EMS49334.1|  Defensin-like protein                                 45.4    8e-04   
gb|AIT42150.1|  defensin-like protein                                 45.1    8e-04   
gb|AHA50472.1|  defensin-like protein 5                               45.4    8e-04   
sp|P21924.1|DEF2_SORBI  RecName: Full=Defensin-like protein 2; Al...  44.7    9e-04   Sorghum bicolor [broomcorn]
ref|XP_009114204.1|  PREDICTED: defensin-like protein 2               45.1    0.001   



>gb|ACU13843.1| unknown [Glycine max]
Length=90

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = -3

Query  335  QPLVQKQRRRNPTQSPPEKPSLRQTIAQL*SLKHVPWKWWLCDMHTLPSTPPFSRCEANT  156
            Q LVQKQRRR P   PPEKPS  QT AQL SL H PW  WLCD HTLPS    +  EA T
Sbjct  5    QILVQKQRRRKPLHLPPEKPSFLQTKAQLWSLLHKPWNPWLCDSHTLPSVCTTT-WEAKT  63

Query  155  MMRSKKKSPNVFLAILLIR  99
              RS KK P+ FL  +  +
Sbjct  64   RRRSNKKKPHDFLISMFTK  82



>ref|XP_009780051.1| PREDICTED: defensin-like protein 1 [Nicotiana sylvestris]
Length=74

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 1/61 (2%)
 Frame = +1

Query  112  MARKTFGlffllliivlASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            M RKTFGLFFLLLI+  AS +    VEGRVCISQSH + GTC+ DHNCA+VCR+EGFSGG
Sbjct  1    MERKTFGLFFLLLIVF-ASQMAISRVEGRVCISQSHGYHGTCVHDHNCALVCRNEGFSGG  59

Query  292  D  294
            D
Sbjct  60   D  60



>ref|XP_009590912.1| PREDICTED: defensin-like protein 1 [Nicotiana tomentosiformis]
Length=74

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = +1

Query  112  MARKTFGlffllliivlASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            M RKTFGL FLLLI+  AS +     EGRVCISQSH ++G C+ DHNCA+VCR+EGFSGG
Sbjct  1    MERKTFGLIFLLLIVF-ASQMAIQRAEGRVCISQSHGYRGPCVHDHNCALVCRNEGFSGG  59

Query  292  D  294
            D
Sbjct  60   D  60



>gb|KGN62247.1| hypothetical protein Csa_2G340400 [Cucumis sativus]
Length=107

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  181  GGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            GG E R+C SQSHHF G C+RDHNCA+VCR+EGFSGG+
Sbjct  56   GGAEARMCQSQSHHFHGPCVRDHNCALVCRTEGFSGGE  93



>ref|XP_004147317.1| PREDICTED: defensin-like protein-like [Cucumis sativus]
 ref|XP_004170998.1| PREDICTED: defensin-like protein-like [Cucumis sativus]
Length=79

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  163  ASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            +  +  GG E R+C SQSHHF G C+RDHNCA+VCR+EGFSGG+
Sbjct  22   SEEMMGGGAEARMCQSQSHHFHGPCVRDHNCALVCRTEGFSGGE  65



>gb|AHA50468.1| defensin-like protein 2 [Citrullus lanatus]
Length=78

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  181  GGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            G  EGRVC SQSH F G C+RDHNCA+VCR+EGFSGGD
Sbjct  27   GRAEGRVCKSQSHSFHGPCMRDHNCAVVCRTEGFSGGD  64



>ref|NP_001240040.1| uncharacterized protein LOC100787787 [Glycine max]
 gb|ACU24448.1| unknown [Glycine max]
Length=90

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -3

Query  335  QPLVQKQRRRNPTQSPPEKPSLRQTIAQL*SLKHVPWKWWLCDMHTLPSTPPFSRCEANT  156
            Q LVQKQRRR P   PPEKPS  QT AQL SL H PW  WLCD HTLPS    +  EA T
Sbjct  5    QILVQKQRRRKPLHLPPEKPSFLQTKAQLWSLLHKPWNPWLCDSHTLPSVCT-TTWEAKT  63

Query  155  MMRSKKKSPNVFLAILLIR  99
              RSKKK P+ FL  +  +
Sbjct  64   RRRSKKKKPHDFLISMFTK  82



>ref|XP_002513261.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
 gb|EEF49129.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
Length=74

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E RVC SQSH+F+G CLRDHNCAMVCR+E FSGG
Sbjct  26   EARVCESQSHYFKGPCLRDHNCAMVCRNEAFSGG  59



>ref|XP_006384382.1| hypothetical protein POPTR_0004s14520g [Populus trichocarpa]
 gb|ERP62179.1| hypothetical protein POPTR_0004s14520g [Populus trichocarpa]
Length=74

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E RVC+SQSHH++G CLR HNCAMVC++EGF+GG+
Sbjct  25   AEARVCLSQSHHYKGPCLRGHNCAMVCKTEGFAGGE  60



>ref|XP_011001251.1| PREDICTED: defensin-like protein 1 [Populus euphratica]
Length=75

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E RVC+SQSH+F+G C RDHNCA VCR+EGFSGG
Sbjct  27   EARVCLSQSHYFKGPCARDHNCAWVCRNEGFSGG  60



>ref|XP_002325734.2| defensin-like family protein [Populus trichocarpa]
 gb|EEF00116.2| defensin-like family protein [Populus trichocarpa]
Length=76

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E RVC SQSH+F+G C RDHNCA VCR+EGFSGG
Sbjct  28   EARVCQSQSHYFKGPCARDHNCAWVCRNEGFSGG  61



>gb|ABK93231.1| unknown [Populus trichocarpa]
Length=75

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E RVC SQSH+F+G C RDHNCA VCR+EGFSGG
Sbjct  27   EARVCQSQSHYFKGPCARDHNCAWVCRNEGFSGG  60



>ref|XP_004503014.1| PREDICTED: defensin-like protein 6-like isoform X1 [Cicer arietinum]
Length=75

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             EGRVC SQSH F+G C+ DHNCA+VCR+EGFSGG+
Sbjct  26   AEGRVCASQSHAFKGPCVGDHNCALVCRNEGFSGGN  61



>ref|XP_010675152.1| PREDICTED: defensin-like protein 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=73

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +1

Query  112  MARKTFGlffllliivlASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            M R+ FGL  L L++  +  ++    EGRVC S+SH+F+G C RDHNCA VCR+EGFSGG
Sbjct  1    MDRRLFGLCILFLVLFASPEVKQA--EGRVCQSRSHYFKGPCARDHNCAYVCRNEGFSGG  58



>ref|XP_004503015.1| PREDICTED: defensin-like protein 6-like isoform X2 [Cicer arietinum]
Length=74

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             EGRVC SQSH F+G C+ DHNCA+VCR+EGFSGG+
Sbjct  25   AEGRVCASQSHAFKGPCVGDHNCALVCRNEGFSGGN  60



>ref|XP_007033927.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
 gb|EOY04853.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
Length=141

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  163  ASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            AS       EGRVC S+SH F+G CL DHNCA+VCR+EGFSGG
Sbjct  84   ASQWVAQPAEGRVCESKSHKFKGPCLGDHNCALVCRNEGFSGG  126



>ref|XP_010675153.1| PREDICTED: defensin-like protein 1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=72

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             EGRVC S+SH+F+G C RDHNCA VCR+EGFSGG
Sbjct  23   AEGRVCQSRSHYFKGPCARDHNCAYVCRNEGFSGG  57



>ref|XP_009631841.1| PREDICTED: defensin-like protein 1 [Nicotiana tomentosiformis]
Length=62

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE RVC+S SH + G C  DHNCA+VCR+EGFSGGD
Sbjct  13   VEARVCMSPSHGYHGPCWHDHNCALVCRNEGFSGGD  48



>ref|XP_006394251.1| hypothetical protein EUTSA_v10005235mg [Eutrema salsugineum]
 gb|ESQ31537.1| hypothetical protein EUTSA_v10005235mg [Eutrema salsugineum]
Length=73

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  184  GVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            G+EGR+C S+SHHF+  C  DHNCA++CR+EGFSGG
Sbjct  23   GIEGRMCQSKSHHFKHMCWSDHNCAIICRNEGFSGG  58



>gb|EYU18232.1| hypothetical protein MIMGU_mgv1a015502mg [Erythranthe guttata]
Length=156

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -3

Query  335  QPLVQKQRRRNPTQSPPEKPSLRQTIAQL*SLKHVPWKWWLCDMHTLPS  189
            Q LVQKQRRR P QSPPEKPSL QT  QL SL   P K WLCD H L S
Sbjct  86   QCLVQKQRRRKPWQSPPEKPSLWQTNLQLVSLTQGPLKRWLCDKHVLAS  134



>emb|CAN69975.1| hypothetical protein VITISV_020776 [Vitis vinifera]
Length=74

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E RVC SQSH F+G C+ DHNCA+VCR+EGFSGG
Sbjct  26   EARVCESQSHKFEGACMGDHNCALVCRNEGFSGG  59



>ref|XP_002272913.2| PREDICTED: defensin-like protein 1 isoform X1 [Vitis vinifera]
 emb|CBI27688.3| unnamed protein product [Vitis vinifera]
Length=75

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E RVC SQSH F+G C+ DHNCA+VCR+EGFSGG
Sbjct  27   EARVCESQSHKFEGACMGDHNCALVCRNEGFSGG  60



>ref|XP_010653029.1| PREDICTED: defensin-like protein 1 isoform X2 [Vitis vinifera]
Length=74

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E RVC SQSH F+G C+ DHNCA+VCR+EGFSGG
Sbjct  26   EARVCESQSHKFEGACMGDHNCALVCRNEGFSGG  59



>ref|XP_006426419.1| hypothetical protein CICLE_v10026887mg [Citrus clementina]
 gb|ESR39659.1| hypothetical protein CICLE_v10026887mg [Citrus clementina]
Length=72

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             EGRVC SQSHHF G C   HNCA VCR+EGFSGG 
Sbjct  23   AEGRVCQSQSHHFHGACFSHHNCAFVCRNEGFSGGK  58



>gb|KHN09675.1| Defensin-like protein, partial [Glycine soja]
Length=59

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            EGRVC SQSH F G C RDHNCA+VCR+EGFSGG
Sbjct  11   EGRVCESQSHGFHGLCNRDHNCALVCRNEGFSGG  44



>ref|XP_009763849.1| PREDICTED: defensin-like protein 1 [Nicotiana sylvestris]
Length=76

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE RVC+S SH + G C  DHNCA+VCR+EGFSGGD
Sbjct  27   VEARVCMSPSHGYHGPCWHDHNCALVCRNEGFSGGD  62



>ref|XP_006426420.1| hypothetical protein CICLE_v10026887mg [Citrus clementina]
 gb|ESR39660.1| hypothetical protein CICLE_v10026887mg [Citrus clementina]
Length=73

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             EGRVC SQSHHF G C   HNCA VCR+EGFSGG 
Sbjct  24   AEGRVCQSQSHHFHGACFSHHNCAFVCRNEGFSGGK  59



>sp|Q07502.1|DEF_SOYBN RecName: Full=Defensin-like protein; AltName: Full=8.4 kDa sulfur-rich 
protein; AltName: Full=Probable proteinase inhibitor 
P322; AltName: Full=Protein SE60; Flags: Precursor [Glycine 
max]
 emb|CAA78359.1| a protein similar to potato tuber protein p322 homolgous to Bowman-Birk 
Proteinase Inhibitor [Glycine max]
Length=74

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             EGRVC SQSH F G C RDHNCA+VCR+EGFSGG
Sbjct  26   TEGRVCESQSHGFHGLCNRDHNCALVCRNEGFSGG  60



>ref|XP_006466198.1| PREDICTED: defensin-like protein 6-like [Citrus sinensis]
Length=73

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             EGRVC SQSHHF G C   HNCA VCR+EGFSGG 
Sbjct  24   AEGRVCQSQSHHFHGACFSHHNCAFVCRNEGFSGGK  59



>emb|CAA79164.1| seed-specific low molecular weight sulfur-rich protein [Glycine 
max]
Length=75

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             EGRVC SQSH F G C RDHNCA+VCR+EGFSGG
Sbjct  26   TEGRVCESQSHGFHGLCNRDHNCALVCRNEGFSGG  60



>gb|AAG38520.1|AF283535_1 proteinase inhibitor se60-like protein [Citrus x paradisi]
Length=73

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             EGRVC SQSHHF G C   HNCA VCR+EGFSGG 
Sbjct  24   AEGRVCQSQSHHFHGACFSHHNCAFVCRNEGFSGGK  59



>ref|XP_011001252.1| PREDICTED: defensin-like protein 1 [Populus euphratica]
Length=74

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E RVC+SQSH+F+G C+R HNCA VC++EGF GG+
Sbjct  25   TEARVCLSQSHNFKGPCVRGHNCANVCKTEGFPGGE  60



>ref|XP_002325735.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
 gb|ABK93028.1| unknown [Populus trichocarpa]
 gb|ABK93041.1| unknown [Populus trichocarpa]
 gb|ABK93536.1| unknown [Populus trichocarpa]
 gb|ABK93961.1| unknown [Populus trichocarpa]
 gb|ABK94429.1| unknown [Populus trichocarpa]
 gb|ABK94555.1| unknown [Populus trichocarpa]
 gb|EEF00117.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
Length=74

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E RVC+SQSH F+G C+R HNCA VC++EGF GG+
Sbjct  25   AEARVCLSQSHSFKGPCVRGHNCASVCKTEGFPGGE  60



>ref|XP_011099655.1| PREDICTED: defensin-like protein 1 [Sesamum indicum]
Length=74

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = +1

Query  112  MARKTFGlffllliivlASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFS  285
            M RK FG+FFLL I++  S +     E RVC SQSH ++G CLR+HNCA+VCR+EGFS
Sbjct  1    MERKAFGIFFLLFIVL-VSQVTIPQAEARVCQSQSHGYRGPCLRNHNCALVCRNEGFS  57



>ref|XP_004242747.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36635.1| defensin protein [Solanum lycopersicum]
 gb|ABO36640.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C SQSHHF+G CL D NC  VCR+EGF+GG+
Sbjct  27   VEARTCESQSHHFKGNCLSDTNCGSVCRTEGFTGGN  62



>gb|AAG17880.1|AF293407_1 Kunitz trypsin inhibitor protein [Phaseolus coccineus]
Length=73

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E RVC SQSH F+G C  DHNCA+VCR+EGFSGG+
Sbjct  24   TEARVCESQSHGFKGACTGDHNCALVCRNEGFSGGN  59



>ref|XP_007137816.1| hypothetical protein PHAVU_009G158000g [Phaseolus vulgaris]
 emb|CAL68581.1| gamma-thionin [Phaseolus vulgaris]
 gb|ESW09810.1| hypothetical protein PHAVU_009G158000g [Phaseolus vulgaris]
Length=73

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E RVC SQSH F+G C  DHNCA+VCR+EGFSGG+
Sbjct  24   TEARVCESQSHGFKGACTGDHNCALVCRNEGFSGGN  59



>gb|KHG09995.1| Defensin-like protein 1 [Gossypium arboreum]
Length=75

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 2/43 (5%)
 Frame = +1

Query  163  ASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            ASH   G VEGR+C S+SH F+G CL DHNC +VCR+EGF  G
Sbjct  20   ASH--GGVVEGRICESKSHRFKGVCLSDHNCGLVCRNEGFLDG  60



>gb|AFJ04517.1| low-molecular-weight cysteine-rich 69 [Vernicia fordii]
Length=73

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C SQSH F+GTCL + NCA VC++EGF+GGD
Sbjct  24   TEARTCESQSHKFKGTCLSETNCASVCKTEGFTGGD  59



>ref|XP_003630421.1| Defensin [Medicago truncatula]
 gb|AET04897.1| Defensin MtDef4.6 [Medicago truncatula]
Length=74

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             EGR C S+SH F+G C RD NCA VCR EGF+GGD
Sbjct  25   AEGRRCESKSHKFKGPCSRDSNCASVCRGEGFTGGD  60



>dbj|BAA95697.1| thionin like protein [Nicotiana tabacum]
Length=78

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C SQSH F+G C RD NCA VC +EGFSGGD
Sbjct  29   AEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGD  64



>gb|ACM90159.1| low-molecular-weight cysteine-rich 69 [Jatropha curcas]
 gb|KDP32806.1| hypothetical protein JCGZ_12098 [Jatropha curcas]
Length=77

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  163  ASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            A+ + +   E R C SQSH F+GTCL + NCA VC++EGF+GGD
Sbjct  20   ATEIGSKMAEARTCESQSHKFKGTCLSETNCANVCKTEGFTGGD  63



>ref|XP_009593293.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C SQSH F+G C RD NCA VC +EGFSGGD
Sbjct  29   AEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGD  64



>gb|EMT16291.1| Defensin SD2 [Aegilops tauschii]
 gb|AIA66995.1| defensin [Triticum aestivum]
Length=82

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C+SQSH F+GTCL D NCA VCR+E F  G+
Sbjct  31   VEARTCLSQSHKFKGTCLSDSNCAGVCRTENFPDGE  66



>ref|XP_010908980.1| PREDICTED: defensin Ec-AMP-D1-like [Elaeis guineensis]
 gb|AAN52490.1|AF322914_1 defensin EGAD1 [Elaeis guineensis]
Length=77

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R C SQSH FQGTCLR+ NCA VC++EGF GG
Sbjct  28   AEARTCESQSHKFQGTCLRESNCANVCQTEGFQGG  62



>gb|ACB32234.1| gamma-thionin/defensin [Solanum chacoense]
Length=76

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C SQSH F+G C+ + NCA VC +EGFSGGD
Sbjct  27   VEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGD  62



>ref|XP_006359485.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=79

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  178  NGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            +GG E R C SQSH F+G C+ D NCA VC++EGF GGD
Sbjct  27   SGGAEARTCESQSHSFKGPCVGDTNCASVCQTEGFIGGD  65



>gb|ABO36641.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C SQSH F+G C+ + NCA VC +EGFSGGD
Sbjct  27   VEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGD  62



>ref|XP_009769843.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C SQSH F+G C RD NCA VC +EGFSGGD
Sbjct  29   AEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGD  64



>gb|ABO36637.1| defensin protein [Solanum lycopersicum]
Length=76

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C SQSH F+G C+ + NCA VC +EGFSGGD
Sbjct  27   VEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGD  62



>ref|NP_001234872.1| gamma-thionin precursor [Solanum lycopersicum]
 emb|CAB42006.1| gamma-thionin [Solanum lycopersicum]
Length=72

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C SQSH F+G C+ + NCA VC +EGFSGGD
Sbjct  23   VEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGD  58



>gb|KEH35658.1| low-molecular-weight cysteine-rich protein [Medicago truncatula]
Length=52

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R+C SQSH F+G C+ DHNCA+VCR+EGFSGG
Sbjct  3    AEARMCESQSHGFKGACVGDHNCALVCRNEGFSGG  37



>gb|ACS96442.1| defensin [Jatropha curcas]
Length=77

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  163  ASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            A+ + +   E R C SQ+H F+GTCL + NCA VC++EGF+GGD
Sbjct  20   ATEIGSKMAEARTCESQTHKFKGTCLSETNCANVCKTEGFTGGD  63



>emb|CDY39856.1| BnaC02g42620D [Brassica napus]
 emb|CDY31356.1| BnaA02g33850D [Brassica napus]
Length=73

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  184  GVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            G+EGR+C S+SHHF+  CL +HNCA +CR E FSGG
Sbjct  23   GIEGRMCQSRSHHFRSICLSNHNCANICRGERFSGG  58



>sp|P83399.1|DEF1_VIGUN RecName: Full=Defensin-like protein 1; AltName: Full=Cp-thionin 
I; AltName: Full=Cp-thionin-1; AltName: Full=Gamma-thionin 
I [Vigna unguiculata]
Length=47

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  196  RVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            RVC SQSH F+G C  DHNCA+VCR+EGFSGG+
Sbjct  1    RVCESQSHGFKGACTGDHNCALVCRNEGFSGGN  33



>ref|NP_201171.1| defensin-like protein 6 [Arabidopsis thaliana]
 sp|Q9FFP8.1|DEF06_ARATH RecName: Full=Defensin-like protein 6; AltName: Full=Low-molecular-weight 
cysteine-rich protein 74; Short=Protein LCR74; 
AltName: Full=Plant defensin 2.5; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10459.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97782.1| defensin-like protein 6 [Arabidopsis thaliana]
Length=73

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  184  GVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            G EGR C S+SHHF+  C  +HNCA+VCR+EGFSGG
Sbjct  23   GGEGRTCQSKSHHFKYMCTSNHNCAIVCRNEGFSGG  58



>ref|XP_010910081.1| PREDICTED: defensin Ec-AMP-D2-like [Elaeis guineensis]
Length=77

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +1

Query  163  ASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            AS +    VE R C SQSH F+G CLR  NCA VC++EGF GG 
Sbjct  20   ASEMATMMVEARTCESQSHKFKGPCLRASNCANVCKTEGFHGGK  63



>ref|XP_006466199.1| PREDICTED: defensin-like protein-like [Citrus sinensis]
Length=75

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  112  MARKTFGlffllliivlASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFS  285
            M  ++FGL  LLL+I+L S +     E R+C SQSH F GTC+R HNC +VCR+EGF+
Sbjct  1    MDSRSFGLLPLLLLILLTSQMTVLQTEARLCESQSHRFHGTCVRSHNCDLVCRTEGFT  58



>ref|XP_004301463.1| PREDICTED: defensin-like protein-like [Fragaria vesca subsp. 
vesca]
Length=75

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFS  285
            E RVC SQSH F GTC+R HNCA+VCR EGFS
Sbjct  27   EARVCESQSHGFHGTCIRAHNCALVCRHEGFS  58



>gb|EPS67569.1| gamma-thionin, partial [Genlisea aurea]
Length=50

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            VE R C SQS+ FQGTCL +HNC +VCR+EGFS G
Sbjct  1    VEARTCESQSNGFQGTCLSNHNCGLVCRNEGFSDG  35



>gb|KHG15212.1| Defensin-like protein 1 [Gossypium arboreum]
Length=74

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  163  ASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFS  285
            AS       E RVC SQSH F G C+  HNCAMVCR+EGFS
Sbjct  17   ASQWGVQPTEARVCQSQSHKFHGACVSSHNCAMVCRNEGFS  57



>ref|XP_004297786.1| PREDICTED: defensin-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=79

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            E R C + SH F+GTCLR+ NCA VC++EGF+GGD
Sbjct  31   EARTCETLSHKFKGTCLRESNCASVCQTEGFTGGD  65



>gb|AGT51230.1| defensin [Brassica napus]
Length=58

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  184  GVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            G+EGR+C S+SHHF+  CL +HNCA +CR E FSGG
Sbjct  8    GIEGRMCQSRSHHFRSICLSNHNCANICRGERFSGG  43



>ref|XP_004297787.1| PREDICTED: defensin-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=79

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            E R C S SH F+GTCL + NCA VC++EGFSGGD
Sbjct  31   EARTCESLSHKFKGTCLSETNCASVCKTEGFSGGD  65



>ref|XP_007223487.1| hypothetical protein PRUPE_ppa013508mg [Prunus persica]
 gb|EMJ24686.1| hypothetical protein PRUPE_ppa013508mg [Prunus persica]
Length=119

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFS  285
            E RVC SQSH F+G C+R HNCA+VCR+EGFS
Sbjct  71   EARVCQSQSHGFRGPCIRHHNCALVCRNEGFS  102



>ref|XP_008793609.1| PREDICTED: defensin Ec-AMP-D1-like isoform X1 [Phoenix dactylifera]
Length=78

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            VE R C SQSH F+GTCLR  NCA VC++EGF GG
Sbjct  29   VEARTCESQSHRFKGTCLRASNCANVCQTEGFQGG  63



>ref|XP_008793610.1| PREDICTED: defensin Ec-AMP-D1-like isoform X2 [Phoenix dactylifera]
Length=77

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            VE R C SQSH F+GTCLR  NCA VC++EGF GG
Sbjct  28   VEARTCESQSHRFKGTCLRASNCANVCQTEGFQGG  62



>gb|AAL35366.1|AF442388_1 defensin protein precursor [Capsicum annuum]
 gb|AAR90845.1| defensin precursor [Capsicum annuum]
Length=78

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C SQSH F+G C  + NCA VC++EGFSGGD
Sbjct  29   VEARTCESQSHRFKGVCASETNCASVCQTEGFSGGD  64



>gb|KHN06998.1| Defensin-like protein [Glycine soja]
Length=84

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E R C SQSH F+G CL D NC  VCR+EGFSGG
Sbjct  30   EARTCESQSHRFKGPCLSDTNCGSVCRTEGFSGG  63



>sp|P82659.1|DFSD2_HELAN RecName: Full=Defensin SD2; AltName: Full=Flower-specific gamma-thionin; 
Flags: Precursor [Helianthus annuus]
 gb|AAF66591.1|AF141131_1 defensin [Helianthus annuus]
 gb|AAF72042.1|AF178634_1 defensin SD2 [Helianthus annuus]
Length=78

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 29/43 (67%), Gaps = 3/43 (7%)
 Frame = +1

Query  175  ENGG---VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            E GG   VE R C SQSH F+GTCL D NCA VC SE FSGG 
Sbjct  22   EMGGPLVVEARTCESQSHKFKGTCLSDTNCANVCHSERFSGGK  64



>ref|XP_004509603.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=78

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            E R C S S+ F+G C+RDHNCA+VC++EGF+GG 
Sbjct  30   EARTCESLSYSFKGLCVRDHNCAVVCQTEGFTGGQ  64



>ref|XP_006367978.1| PREDICTED: defensin-like protein P322-like [Solanum tuberosum]
Length=79

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            +E R+C S S  F+G CL D NCA VC +EGF+GGD
Sbjct  29   IEARICESPSQRFKGPCLTDRNCASVCETEGFTGGD  64



>ref|XP_006359486.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=78

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C SQS+ F+GTC+RD NCA VC++EGF GG+
Sbjct  29   AEARTCESQSNRFKGTCVRDSNCATVCQTEGFIGGN  64



>ref|XP_004242748.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36638.1| defensin protein [Solanum lycopersicum]
 gb|ABO36642.1| defensin protein [Solanum pimpinellifolium]
Length=79

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C SQS+ F+GTC+RD NCA VC++EGF GG+
Sbjct  30   AEARTCESQSNSFKGTCVRDSNCATVCQTEGFIGGN  65



>gb|AIA66987.1| defensin [Triticum aestivum]
Length=82

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F+GTCL D NCA VCR+E F  G+
Sbjct  31   AEARTCLSQSHKFKGTCLSDSNCAGVCRTENFPDGE  66



>ref|XP_010025674.1| PREDICTED: defensin-like protein 1 [Eucalyptus grandis]
 gb|KCW62396.1| hypothetical protein EUGRSUZ_H05052 [Eucalyptus grandis]
Length=73

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFS  285
            EGRVC SQSH F G+C+  HNCA+VCR+EGFS
Sbjct  25   EGRVCESQSHGFHGSCVSGHNCALVCRNEGFS  56



>ref|XP_004503912.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=76

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C S+SH F+GTCL D  CA  CR+EGFSGGD
Sbjct  27   AEARTCESRSHRFKGTCLSDTTCAHACRNEGFSGGD  62



>emb|CAH58740.1| defensin [Plantago major]
Length=72

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            E R C S SH F+GTCL D NCA VC++EGF GGD
Sbjct  24   EARKCRSASHRFKGTCLSDTNCASVCKTEGFPGGD  58



>ref|XP_006585876.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=127

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R C SQSH F+G CL D NC  VCR+EGFSGG
Sbjct  29   AEARTCESQSHRFKGPCLSDTNCGSVCRTEGFSGG  63



>ref|XP_009599356.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C SQSH F GTC+RD NCA +C++EGF GG+
Sbjct  26   AEARTCESQSHRFHGTCVRDSNCASICQTEGFIGGN  61



>ref|XP_010270777.1| PREDICTED: defensin-like protein [Nelumbo nucifera]
 sp|A3FPF2.1|DEF_NELNU RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog; Flags: Precursor [Nelumbo nucifera]
 gb|ABN46979.1| defensin [Nelumbo nucifera]
Length=77

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C SQSH F+G CL D NCA VC++EGF  GD
Sbjct  28   AEARTCESQSHRFKGACLSDTNCASVCQTEGFPAGD  63



>ref|XP_002864860.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41119.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=73

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  184  GVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            G +GR C S+SHHF+  C   HNCA+VCR+EGFSGG
Sbjct  23   GSDGRTCQSKSHHFKYMCTSSHNCAIVCRNEGFSGG  58



>ref|XP_009792224.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C SQ H F+G C RD NCA VC +EGFSGGD
Sbjct  29   AEARTCESQRHRFKGPCSRDGNCATVCLTEGFSGGD  64



>dbj|BAC10287.1| defensin [Triticum aestivum]
 gb|EMS52103.1| Defensin Tk-AMP-D2 [Triticum urartu]
 gb|AGX26528.1| defensin [Triticum aestivum]
 gb|AIA66998.1| defensin [Triticum aestivum]
Length=82

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F+GTCL + NCA VCR+E F  G+
Sbjct  31   AEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGE  66



>gb|KHN16909.1| Defensin J1-2 [Glycine soja]
Length=84

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            EGR C S+SH F+G C  D NCA VCR+EGF+GGD
Sbjct  36   EGRDCSSKSHGFKGLCFSDTNCAHVCRTEGFTGGD  70



>gb|ABA86589.1| putative defensin 1 [Aquilegia pyrenaica]
 gb|ABA86590.1| putative defensin 1 [Aquilegia olympica]
Length=70

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R C SQSH F+GTC+R  NCA VC+SEGF+GG
Sbjct  19   AEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGG  53



>ref|XP_006359487.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=76

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S+SHHF+G CL D NC  VC +EGF+GG+
Sbjct  27   VEARTCESKSHHFKGKCLSDTNCGSVCHTEGFTGGN  62



>ref|XP_003629332.1| Defensin [Medicago truncatula]
 gb|AET03808.1| Defensin MtDef4.5 [Medicago truncatula]
Length=81

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            VE R C+SQSH F+G CL D NCA VC +EGF+ G
Sbjct  29   VEARKCLSQSHSFKGLCLSDQNCATVCLTEGFTDG  63



>ref|XP_007033367.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
 gb|EOY04293.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
Length=76

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E R C S+SH F+G CL DHNC +VCR+EGF  G
Sbjct  28   EARTCESKSHAFKGPCLSDHNCGLVCRNEGFPDG  61



>gb|ABA86586.1| putative defensin 1 [Aquilegia formosa]
Length=70

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R C SQSH F+GTC+R  NCA VC+SEGF+GG
Sbjct  19   AEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGG  53



>gb|ABA81896.1| putative defensin [Aquilegia formosa]
 gb|ABA86588.1| putative defensin 1 [Aquilegia brevistyla]
Length=70

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R C SQSH F+GTC+R  NCA VC+SEGF+GG
Sbjct  19   AEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGG  53



>ref|XP_003630422.1| Defensin [Medicago truncatula]
 gb|AET04898.1| Defensin MtDef4.7 [Medicago truncatula]
Length=74

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +1

Query  112  MARKTFGlffllliivlASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            M RKT G+ F+L +++ A+ +     EGR C SQSH F+G C+ D NC  VCR EGF GG
Sbjct  1    MERKTLGILFMLFLVL-AADVAVKTAEGRRCESQSHKFKGPCVSDSNCGSVCRGEGFIGG  59

Query  292  D  294
            D
Sbjct  60   D  60



>ref|XP_002274353.1| PREDICTED: defensin Ec-AMP-D2 [Vitis vinifera]
 emb|CBI27507.3| unnamed protein product [Vitis vinifera]
Length=77

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C SQSH F+GTC+R  NCA VC++EGF GG+
Sbjct  28   AEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGN  63



>dbj|BAJ89304.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=83

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  184  GVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
              E R C+SQSH F+GTCL + NCA VCR+E F  G+
Sbjct  31   AAEARTCLSQSHKFKGTCLSNSNCAGVCRTENFPDGE  67



>ref|XP_010246429.1| PREDICTED: defensin-like protein [Nelumbo nucifera]
Length=82

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C SQSH F+G CL D NC  +C++EGF  GD
Sbjct  28   VEARTCESQSHRFKGACLSDTNCLSICQTEGFPAGD  63



>ref|XP_004509604.1| PREDICTED: defensin-like protein P322-like [Cicer arietinum]
Length=78

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            E R+C SQS+ F+G C+ DH+CA+VC++EGF+GG 
Sbjct  30   EARICDSQSNTFKGPCVIDHSCAIVCQTEGFTGGQ  64



>sp|Q40901.1|DEF_PETIN RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog PPT; Flags: Precursor [Petunia integrifolia]
 gb|AAA64740.1| gamma-thionin homolog [Petunia integrifolia subsp. inflata]
Length=78

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C SQSH F GTC+R+ NCA VC++EGF GG+
Sbjct  29   AEARTCESQSHRFHGTCVRESNCASVCQTEGFIGGN  64



>ref|XP_009769844.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C S+S  F+G C+R+ NCA VC +EGFSGGD
Sbjct  29   AEARRCESKSQRFRGPCVREKNCAAVCETEGFSGGD  64



>gb|EPS66510.1| kunitz trypsin inhibitor protein, partial [Genlisea aurea]
Length=66

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  175  ENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E    E R C SQSH F+G CL DHNC +VCR+EGF+ G
Sbjct  13   ECEAAEARTCESQSHGFKGRCLSDHNCGLVCRNEGFTNG  51



>gb|AFQ69079.1| defensin precursor, partial [Triticum aestivum]
Length=81

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F+GTC+ D NCA VCR+E F  G+
Sbjct  30   AEARTCLSQSHKFKGTCISDSNCAGVCRTENFPDGE  65



>ref|XP_007033370.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
 gb|EOY04296.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
Length=76

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            + R+C S+SH F+G CL DHNC MVC +EGFSGG
Sbjct  28   KARLCESKSHGFKGACLSDHNCGMVCSNEGFSGG  61



>ref|XP_006586320.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=74

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            EGR C S+SH F+G C  D NCA VCR+EGF+GGD
Sbjct  26   EGRDCSSKSHGFKGLCFSDTNCAHVCRTEGFTGGD  60



>gb|ACV84382.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  184  GVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
              E R C+SQSH F+G+CL   NCA +CR+E F GG+
Sbjct  30   AAEARDCLSQSHKFKGSCLSSSNCASICRTENFPGGE  66



>ref|XP_010319372.1| PREDICTED: defensin Ec-AMP-D2-like [Solanum lycopersicum]
Length=73

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R C SQSH ++G C+R +NCA VC++EGFSGG
Sbjct  24   TEARTCESQSHRYKGPCVRKNNCANVCKTEGFSGG  58



>ref|XP_009593292.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C SQS  F+G C+R+ NCA VC +EGFSGGD
Sbjct  29   AEARHCESQSQRFRGLCVREKNCAAVCETEGFSGGD  64



>ref|XP_008340514.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=78

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             EGR C SQS  F+GTCL   NCA VC++EGF GG+
Sbjct  29   AEGRTCESQSRKFKGTCLSKTNCASVCQTEGFPGGN  64



>gb|EMT22721.1| Defensin Tk-AMP-D2 [Aegilops tauschii]
Length=82

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F+GTCL + NCA VCR+E F  G+
Sbjct  31   AEARTCLSQSHKFKGTCLSNSNCAGVCRTENFPDGE  66



>gb|AIA66993.1| defensin [Triticum aestivum]
Length=83

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F+GTCL + NCA VCR+E F  G+
Sbjct  32   AEARTCLSQSHKFKGTCLSNSNCAGVCRTENFPDGE  67



>ref|XP_008349481.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008344620.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008363304.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 gb|AFH74424.1| defensin [Malus domestica]
Length=75

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            EGR C SQS+ F+GTC+   NCA VC++EGF GG+
Sbjct  27   EGRTCESQSNRFKGTCVSKSNCAAVCQTEGFPGGN  61



>gb|ACN93800.1| defensin precursor [Vigna unguiculata]
Length=78

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E R C SQSH F+G C+ D NCA VCR+E FSGG
Sbjct  30   EARTCESQSHRFKGPCVSDTNCASVCRTERFSGG  63



>ref|XP_004985852.1| PREDICTED: defensin SD2-like [Setaria italica]
Length=81

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  181  GGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            G  E R C+SQSH F+G C+R  NCA VCR+EGF  G 
Sbjct  28   GVAEARTCLSQSHKFRGPCVRRANCANVCRTEGFPDGK  65



>dbj|BAK07043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=104

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C S SH F+G C+R HNCA VCR+EGF GG+
Sbjct  53   AEARRCESPSHMFRGPCVRGHNCANVCRTEGFPGGN  88



>ref|XP_002459603.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
 gb|EER96124.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
Length=79

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  196  RVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            R C S SH FQG C RD NCA VCR+EGF+GG
Sbjct  33   RKCESPSHRFQGPCSRDANCATVCRTEGFTGG  64



>ref|XP_003628977.1| Defensin [Medicago truncatula]
 ref|XP_003636614.1| Defensin [Medicago truncatula]
 gb|AET03453.1| Defensin MtDef4.2 [Medicago truncatula]
 gb|AFK35827.1| unknown [Medicago truncatula]
Length=76

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E R C SQSH F+G C  DHNCA VC++E FSGG
Sbjct  28   EARTCESQSHKFKGPCASDHNCASVCQTERFSGG  61



>gb|AFE88173.1| g-thionin [Panax ginseng]
Length=75

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 29/44 (66%), Gaps = 2/44 (5%)
 Frame = +1

Query  163  ASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            A+ LE    EGR C SQSH F+GTC    NCA VC++EGF GG 
Sbjct  20   ATGLEP--AEGRTCESQSHKFKGTCASGTNCANVCKTEGFPGGK  61



>ref|XP_010088525.1| Defensin-like protein 2 [Morus notabilis]
 gb|EXB36442.1| Defensin-like protein 2 [Morus notabilis]
Length=76

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             + R C S SH F+GTC+R+ NCA +CR+EGF GG+
Sbjct  27   ADARTCQSASHRFKGTCVRNSNCANICRTEGFQGGN  62



>ref|XP_007156391.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
 gb|ADR30067.1| defensin D2 [Phaseolus vulgaris]
 gb|ESW28385.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
Length=78

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E R C SQSH F+G C+ D NCA VCR+E FSGG
Sbjct  30   EARTCESQSHRFKGPCVSDTNCASVCRTERFSGG  63



>ref|XP_003599384.1| Defensin [Medicago truncatula]
 gb|AES69635.1| gamma-thionin/defensin [Medicago truncatula]
Length=80

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 2/43 (5%)
 Frame = +1

Query  163  ASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             +H+E    E R C SQSH F+G C   HNCA VC++EGF+GG
Sbjct  25   PTHVEEP--EARTCDSQSHSFKGVCWIKHNCANVCKTEGFTGG  65



>ref|XP_009802655.1| PREDICTED: defensin-like protein [Nicotiana sylvestris]
Length=75

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C SQSH F GTC+R  NCA VC++EGF GG+
Sbjct  26   AEARTCESQSHRFHGTCVRGSNCASVCQTEGFIGGN  61



>gb|AGT51229.1| defensin [Brassica napus]
 emb|CDY51475.1| BnaC02g47680D [Brassica napus]
Length=77

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C SQSH F+G C+ D+NCA VC +EGF GG 
Sbjct  28   VEARTCESQSHRFKGPCVSDNNCANVCHNEGFGGGK  63



>gb|ADK36631.1| defensin-like protein, partial [Solanum lycopersicum var. cerasiforme]
Length=48

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  193  GRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             R C SQSH F+G C+ + NCA VC +EGFSGGD
Sbjct  1    ARTCESQSHRFKGPCVSEKNCASVCETEGFSGGD  34



>gb|KEH35661.1| Defensin [Medicago truncatula]
Length=73

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             EGR C S+SH F+G C+ DHNCA VC  EGF GG+
Sbjct  24   TEGRHCESKSHRFKGMCMSDHNCASVCHVEGFPGGN  59



>emb|CDP16306.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  181  GGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGF  282
            G  E R+C SQSH F+G C+R  NCA VC++EGF
Sbjct  27   GVAEARICESQSHRFKGPCIRKDNCAAVCQTEGF  60



>ref|XP_008389119.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=77

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             EGR C SQSH F+G+C+   NCA VC++EGF GG
Sbjct  28   AEGRTCDSQSHRFKGSCVSKSNCATVCQTEGFRGG  62



>gb|AAP80654.1|AF479035_1 proteinase inhibitor Rgpi9, partial [Triticum aestivum]
Length=90

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C S SH F G CLR HNCA VCR+EGF GG 
Sbjct  40   AEARKCESLSHRFAGLCLRGHNCANVCRTEGFPGGK  75



>ref|XP_002875116.1| hypothetical protein ARALYDRAFT_904442 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51375.1| hypothetical protein ARALYDRAFT_904442 [Arabidopsis lyrata subsp. 
lyrata]
Length=73

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  181  GGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            G VE R C S S+ FQG CL   +CA  C SEGFSGG
Sbjct  24   GPVEARTCESPSNKFQGVCLNSQSCAKACPSEGFSGG  60



>emb|CDP10468.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C S SH F+GTC+R  NCA VC++EGF GG 
Sbjct  29   AEARTCESLSHRFKGTCVRGSNCAAVCQTEGFPGGQ  64



>ref|NP_178322.1| defensin-like protein 10 [Arabidopsis thaliana]
 sp|Q9ZUL8.1|DEF10_ARATH RecName: Full=Defensin-like protein 10; AltName: Full=Low-molecular-weight 
cysteine-rich protein 72; Short=Protein LCR72; 
AltName: Full=Plant defensin 2.6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97220.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAM64623.1| protease inhibitor II [Arabidopsis thaliana]
 gb|ABI49429.1| At2g02140 [Arabidopsis thaliana]
 gb|AEC05550.1| defensin-like protein 10 [Arabidopsis thaliana]
Length=73

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  181  GGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            G VE R C S S+ FQG CL   +CA  C SEGFSGG
Sbjct  24   GPVEARTCESPSNKFQGVCLNSQSCAKACPSEGFSGG  60



>gb|EMT03364.1| Defensin SD2 [Aegilops tauschii]
 gb|AIA67006.1| defensin [Triticum aestivum]
Length=81

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C S SH F G CLR HNCA VCR+EGF GG 
Sbjct  31   AEARKCESLSHRFAGLCLRGHNCANVCRTEGFPGGK  66



>ref|XP_002468581.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
 gb|EER95579.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
Length=80

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C SQSH F+G C+R  NCA VCR+EGF  G 
Sbjct  29   AEARTCQSQSHRFRGPCVRRENCANVCRTEGFPDGK  64



>gb|ACV84379.1| defensin precursor [Triticum aestivum]
 gb|EMT06280.1| Defensin-like protein 5 [Aegilops tauschii]
 gb|AIA66986.1| defensin [Triticum aestivum]
Length=81

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH+F+G CL   NCA VCR+E F  G+
Sbjct  30   AEARNCLSQSHNFKGACLSSSNCAAVCRTENFPDGE  65



>ref|XP_004976261.1| PREDICTED: defensin-like protein P322-like [Setaria italica]
Length=83

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F+GTC R  NC  VC++EGF  G+
Sbjct  32   AEARHCVSQSHKFEGTCTRKSNCENVCKTEGFPWGE  67



>ref|XP_009604566.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  118  RKTFGlffllliivlASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            +K F   FL+L+++ A+ +     E R C SQSH F+G C+R  NCA VC++EGF GG
Sbjct  5    KKLFATVFLMLMLIFATEMGTMVAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGG  62



>ref|XP_009614488.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  118  RKTFGlffllliivlASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            +K F   FL+L++V A+ +     E R C SQSH F+G C+R  NCA VC++EGF GG
Sbjct  5    KKLFATVFLMLMLVFATEMGTMVAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGG  62



>gb|EMS68062.1| Defensin Tm-AMP-D1.2 [Triticum urartu]
Length=74

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+S+SH F+G CL   NCA +CR+E F GG+
Sbjct  9    AEARDCLSKSHKFKGACLSSSNCASICRTENFPGGE  44



>gb|EYU27577.1| hypothetical protein MIMGU_mgv1a024490mg [Erythranthe guttata]
Length=71

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            +GR C SQS +F+G C+ DHNC  VC SEGF+ GD
Sbjct  23   KGRTCESQSFNFRGPCVIDHNCKAVCESEGFTDGD  57



>ref|NP_001146997.1| flower-specific gamma-thionin [Zea mays]
 gb|ACG24979.1| flower-specific gamma-thionin precursor [Zea mays]
 tpg|DAA43154.1| TPA: flower-specific gamma-thionin [Zea mays]
Length=65

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFS  285
             E R C SQSH F+G CLR  NCA VCR+EGF 
Sbjct  15   AEARTCQSQSHRFRGPCLRRSNCANVCRTEGFP  47



>gb|AAL15885.1|AF417297_1 putative gamma-thionin [Castanea sativa]
Length=78

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C SQSH F+G C+R  NCA VC++EGF GG 
Sbjct  29   AEARTCESQSHRFKGPCVRKSNCASVCQTEGFHGGQ  64



>ref|XP_010250779.1| PREDICTED: defensin Ec-AMP-D2-like [Nelumbo nucifera]
Length=78

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E R C SQSH F+G C+R  NCA VC++EGF GG
Sbjct  29   EARTCESQSHRFKGICVRKSNCAAVCQTEGFHGG  62



>gb|AAS65426.1| Kunitz-type trypsin inhibitor [Ipomoea batatas]
Length=80

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R+C S S  F+G C RD NCA VC +EGF+GGD
Sbjct  31   AEARMCESASSKFKGPCSRDSNCATVCHTEGFTGGD  66



>ref|NP_001146981.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG24882.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG40169.1| flower-specific gamma-thionin precursor [Zea mays]
 tpg|DAA43153.1| TPA: flower-specific gamma-thionin [Zea mays]
Length=79

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFS  285
             E R C SQSH F+G CLR  NCA VCR+EGF 
Sbjct  29   AEARTCQSQSHRFRGPCLRRSNCANVCRTEGFP  61



>gb|KHN23780.1| Defensin SD2 [Glycine soja]
Length=79

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E R C SQSH F+G CL D NC  VCR+E F+GG
Sbjct  31   EARTCESQSHRFKGPCLSDTNCGSVCRTERFTGG  64



>ref|XP_010043884.1| PREDICTED: defensin Ec-AMP-D2-like [Eucalyptus grandis]
 gb|KCW85903.1| hypothetical protein EUGRSUZ_B02620 [Eucalyptus grandis]
Length=77

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +1

Query  163  ASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            A+ +E   VE R C SQS  F+G C+   NCA VC++EGF GG
Sbjct  20   ATEMEPMVVEARTCESQSQRFKGACVSKTNCASVCQTEGFHGG  62



>ref|NP_178320.1| defensin-like protein 4 [Arabidopsis thaliana]
 sp|Q41914.2|DEF04_ARATH RecName: Full=Defensin-like protein 4; AltName: Full=Low-molecular-weight 
cysteine-rich protein 70; Short=Protein LCR70; 
AltName: Full=Plant defensin 2.1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97222.1| protease inhibitor II [Arabidopsis thaliana]
 dbj|BAC42603.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAO42893.1| At2g02120 [Arabidopsis thaliana]
 gb|AEC05548.1| defensin-like protein 4 [Arabidopsis thaliana]
Length=77

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C SQS  F+G C+ D NC  VC +EGF GGD
Sbjct  28   VEARTCASQSQRFKGKCVSDTNCENVCHNEGFPGGD  63



>ref|NP_178319.1| defensin-like protein 2 [Arabidopsis thaliana]
 sp|Q39182.1|DEF02_ARATH RecName: Full=Defensin-like protein 2; AltName: Full=Low-molecular-weight 
cysteine-rich protein 69; Short=Protein LCR69; 
AltName: Full=Plant defensin 2.2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK44170.1|AF370355_1 putative protease inhibitor II [Arabidopsis thaliana]
 emb|CAA48892.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAC97223.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAX39303.1| defensin-like protein [Arabidopsis thaliana]
 gb|AEC05546.1| defensin-like protein 2 [Arabidopsis thaliana]
Length=77

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C SQSH F+GTC+   NCA VC +EGF GG+
Sbjct  28   VEARTCESQSHRFKGTCVSASNCANVCHNEGFVGGN  63



>ref|XP_006649329.1| PREDICTED: defensin J1-2-like [Oryza brachyantha]
Length=80

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R C SQSH F G C+R  NCA VC +EGF+GG
Sbjct  31   AEARTCESQSHRFNGVCVRSSNCASVCSTEGFTGG  65



>ref|NP_001234987.1| protease inhibitor precursor [Glycine max]
 gb|AAC97524.1| protease inhibitor [Glycine max]
Length=79

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E R C SQSH F+G CL D NC  VCR+E F+GG
Sbjct  31   EARTCESQSHRFKGPCLSDTNCGSVCRTERFTGG  64



>ref|XP_009383785.1| PREDICTED: defensin-like protein 1 [Musa acuminata subsp. malaccensis]
Length=76

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +1

Query  163  ASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            AS L   GVE RVC   S  F+G C  D NCA VC++EGF+GG
Sbjct  18   ASQLMMPGVEARVCRYASRSFRGLCFSDTNCAHVCQTEGFNGG  60



>gb|EMT03363.1| hypothetical protein F775_43918 [Aegilops tauschii]
Length=82

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C S+SH F+G C+R  NCA VCR+EGFS G+
Sbjct  31   AEARTCESRSHRFRGPCVRRSNCANVCRTEGFSDGE  66



>ref|XP_004151187.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
 ref|XP_004171498.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
Length=74

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E RVC S SH+F+G C  D NC  +C++EGFSGG
Sbjct  25   EARVCESPSHNFKGLCFSDTNCGNICKTEGFSGG  58



>gb|ABX84378.1| amylase inhibitor-like protein [Triticum aestivum]
 gb|AIA66996.1| defensin [Triticum aestivum]
Length=82

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+S+SH F+G CL   NCA +CR+E F GG+
Sbjct  31   AEARDCLSKSHKFKGACLSSSNCASICRTENFPGGE  66



>gb|ABX84377.1| amylase inhibitor-like protein [Triticum aestivum]
 gb|AIA66997.1| defensin [Triticum aestivum]
Length=82

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+S+SH F+G CL   NCA +CR+E F GG+
Sbjct  31   AEARDCLSKSHKFKGACLSSSNCASICRTENFPGGE  66



>ref|XP_006292136.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
 gb|EOA25034.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
Length=77

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S+SH F+GTCL + NC  VC +EGF GG+
Sbjct  28   VEARTCESKSHRFKGTCLSESNCKNVCHNEGFQGGN  63



>gb|ADQ43196.1| unknown [Eutrema parvulum]
Length=76

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C SQSH F+G CL D NC  VC +EGF GG 
Sbjct  27   VEARTCESQSHRFKGKCLSDGNCGNVCHNEGFGGGK  62



>ref|XP_009129168.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY09389.1| BnaA02g26210D [Brassica napus]
Length=77

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C SQSH F+G C+ ++NCA VC +EGF GG 
Sbjct  28   VEARTCESQSHRFKGPCVSENNCANVCHNEGFGGGK  63



>gb|ABA86587.1| putative defensin 1 [Aquilegia chrysantha]
Length=70

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  196  RVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            R C SQSH F+GTC+R  NCA VC SEGF+GG
Sbjct  22   RDCESQSHKFKGTCIRXSNCASVCXSEGFNGG  53



>gb|ACV84381.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH+F+G CL   NC  VCR+E F  G+
Sbjct  31   AEARDCVSQSHNFKGACLSSSNCPAVCRTENFPDGE  66



>ref|NP_178321.1| defensin-like protein 1 [Arabidopsis thaliana]
 sp|Q9ZUL7.1|DEF01_ARATH RecName: Full=Defensin-like protein 1; AltName: Full=Low-molecular-weight 
cysteine-rich protein 68; Short=Protein LCR68; 
AltName: Full=Plant defensin 2.3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97221.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAK93656.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAL85136.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AEC05549.1| defensin-like protein 1 [Arabidopsis thaliana]
Length=77

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S+SH F+G C+  HNCA VC +EGF GG 
Sbjct  28   VEARTCESKSHRFKGPCVSTHNCANVCHNEGFGGGK  63



>ref|XP_002875115.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51374.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
Length=77

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S+SH F+G C+  HNCA VC +EGF GG 
Sbjct  28   VEARTCESKSHRFKGPCVSTHNCANVCHNEGFGGGK  63



>gb|ACV84384.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F+G CL   NCA VCR+E F  G+
Sbjct  31   AEARDCLSQSHKFKGACLSSSNCAAVCRTENFPDGE  66



>gb|AIA66989.1| defensin [Triticum aestivum]
Length=82

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F+G CL   NCA VCR+E F  G+
Sbjct  31   AEARDCLSQSHKFKGACLSSSNCAAVCRTENFPDGE  66



>ref|XP_007045354.1| Defensin-like protein isoform 2 [Theobroma cacao]
 gb|EOY01186.1| Defensin-like protein isoform 2 [Theobroma cacao]
Length=77

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = +1

Query  163  ASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            A+ +     E R C SQSH F+G C+R  NCA VC++EGF  G
Sbjct  20   ATEMGPKAAEARTCQSQSHRFKGMCMRKSNCAAVCQTEGFHSG  62



>ref|XP_008437687.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=77

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E RVC S SH+F+G C  D NC  +C++EGFSGG
Sbjct  27   AEARVCESPSHNFKGLCFSDTNCGNICKTEGFSGG  61



>gb|EMT22729.1| Defensin Tk-AMP-D2 [Aegilops tauschii]
Length=76

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R C SQSH F+G C  D NCA VCR+E F  G
Sbjct  25   AEARTCESQSHKFKGPCFSDSNCATVCRTENFPRG  59



>gb|AIA67000.1| defensin [Triticum aestivum]
Length=84

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R C SQSH F+G C  D NCA VCR+E F  G
Sbjct  33   AEARTCESQSHKFKGPCFSDSNCATVCRTENFPRG  67



>gb|ACB20518.1| defensin precursor [Saccharum officinarum]
Length=80

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F+G C+   NCA VC++E F GG+
Sbjct  29   AEARYCLSQSHRFKGLCMSSSNCANVCQTENFPGGE  64



>ref|XP_006420697.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 ref|XP_006470884.1| PREDICTED: defensin-like protein-like [Citrus sinensis]
 gb|ESR33937.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 gb|KDO53542.1| hypothetical protein CISIN_1g034999mg [Citrus sinensis]
Length=76

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +1

Query  163  ASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            AS +     E R+C SQSH F+G C+   NCA VC++EGF GG
Sbjct  19   ASEMGLRAAEARICESQSHRFKGPCVSKSNCAAVCQTEGFHGG  61



>ref|XP_003575412.1| PREDICTED: defensin Tm-AMP-D1.2-like [Brachypodium distachyon]
Length=80

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F+GTC+R  NCA VC++E F  G+
Sbjct  29   AEARHCLSQSHKFKGTCVRSGNCANVCKTENFPDGE  64



>gb|ADK91098.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91099.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91100.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91101.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91102.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91103.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91104.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91105.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91106.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91107.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91108.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91109.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91110.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91111.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91112.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91113.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91114.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91115.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91117.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91118.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91119.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91120.1| PCP17C2 [Arabidopsis halleri]
Length=55

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C SQSH F+GTC+   NCA VC +EGF GG+
Sbjct  6    VEARTCESQSHRFKGTCVSASNCANVCHNEGFIGGN  41



>emb|CEJ09690.1| Defensin protein [Zea mays]
Length=80

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            E R C+SQSH F+G C+  +NCA VC++E F GG+
Sbjct  30   EARHCLSQSHRFKGLCMSSNNCANVCQTENFPGGE  64



>ref|XP_004953175.1| PREDICTED: defensin-like protein 2-like [Setaria italica]
Length=80

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            E R C+SQSHHF+G CL   NCA VCR E F  G+
Sbjct  30   EARHCLSQSHHFKGLCLSSSNCANVCRVERFPDGE  64



>ref|XP_010513973.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S+SH F+G C+  HNC  VC +EGFSGG 
Sbjct  28   VEARTCESKSHRFRGPCVSRHNCGNVCHNEGFSGGK  63



>ref|XP_010495961.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S+SH F+G C+  HNC  VC +EGFSGG 
Sbjct  28   VEARTCESKSHRFRGPCVSRHNCGNVCHNEGFSGGK  63



>ref|XP_006301968.1| hypothetical protein CARUB_v10022448mg [Capsella rubella]
 gb|EOA34866.1| hypothetical protein CARUB_v10022448mg [Capsella rubella]
Length=72

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VEGR C S S+ F G CL + NCA VC +EGF  GD
Sbjct  23   VEGRTCESSSNLFSGPCLSESNCANVCNTEGFPDGD  58



>ref|XP_010502227.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C SQSH F+G C  + NC  VC +EGFSGG+
Sbjct  28   VEARTCESQSHRFKGKCFSETNCRNVCHNEGFSGGN  63



>ref|XP_009351646.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             EGR C SQS  F+G CL   NCA VC++EGF GG
Sbjct  29   AEGRTCESQSRKFKGACLSRSNCASVCQTEGFPGG  63



>gb|ADK87340.1| defensin [Pyrus pyrifolia]
 gb|AGC00408.1| defensin 1 [Pyrus pyrifolia]
Length=78

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             EGR C SQS  F+G CL   NCA VC++EGF GG
Sbjct  29   AEGRTCESQSRKFKGACLSRSNCASVCQTEGFPGG  63



>ref|XP_003526900.1| PREDICTED: defensin-like protein 6-like [Glycine max]
 gb|ACU20671.1| unknown [Glycine max]
 gb|KHN09676.1| Defensin-like protein 6 [Glycine soja]
Length=73

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             EGR C S+SH F+G CL  HNCA VC  EGF+GG 
Sbjct  24   TEGRHCESKSHRFKGMCLSKHNCASVCHLEGFTGGK  59



>gb|EMT18782.1| Defensin-like protein [Aegilops tauschii]
Length=404

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            E R C+S+SH F+G CL   NCA +CR+E F GG+
Sbjct  10   EARDCLSKSHKFKGACLSSSNCASICRTENFPGGE  44



>gb|AFK47422.1| unknown [Lotus japonicus]
Length=74

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = +1

Query  163  ASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            ASH      EGR C S+SH F G CL  HNCA VC  EGF+GG 
Sbjct  17   ASHQMVVQTEGRHCESKSHRFHGLCLSHHNCASVCHLEGFTGGK  60



>ref|XP_009397593.1| PREDICTED: defensin Ec-AMP-D1 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=77

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            VEGR C S S  F+GTC+R  NCA VC+ EGF  G
Sbjct  28   VEGRTCESASTRFKGTCVRSSNCASVCQGEGFPDG  62



>gb|EMT06279.1| Defensin-like protein 2 [Aegilops tauschii]
Length=82

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F+G CL   NCA VCR+E F  G+
Sbjct  31   AEARDCLSQSHKFKGACLSSSNCAGVCRTENFPDGE  66



>ref|XP_007137817.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
 gb|ESW09811.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
Length=145

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             EGR C S+SH F+G CL D NCA VC  EGF+GG+
Sbjct  96   TEGRHCESKSHRFKGMCLSDRNCASVCHLEGFTGGN  131



>gb|EMS64594.1| Defensin Tm-AMP-D1.2 [Triticum urartu]
Length=87

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH+F+G CL   NCA VCR++ F  G+
Sbjct  36   AEARDCVSQSHNFKGACLSSSNCAAVCRTDNFPDGE  71



>gb|AIA66994.1| defensin [Triticum aestivum]
Length=82

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F+G CL   NCA VCR+E F  G+
Sbjct  31   AEARDCLSQSHKFKGACLSSSNCAGVCRTENFPDGE  66



>ref|XP_011099999.1| PREDICTED: defensin Ec-AMP-D2-like [Sesamum indicum]
Length=82

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +1

Query  166  SHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             H+E    E ++CI++S+ F+G CL+D  C  VC++EGF+GG
Sbjct  24   PHVE-AKAEPKLCIAKSNKFKGFCLKDPKCVSVCKTEGFTGG  64



>ref|XP_002446801.1| hypothetical protein SORBIDRAFT_06g022870 [Sorghum bicolor]
 gb|EES11129.1| hypothetical protein SORBIDRAFT_06g022870 [Sorghum bicolor]
Length=82

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F G CL   NCA VCR+EGF  G+
Sbjct  31   AEARHCLSQSHKFVGACLSKRNCANVCRTEGFPWGE  66



>gb|ACG25019.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
Length=80

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F+G C+  +NCA VC++E F GG+
Sbjct  29   AEARHCLSQSHRFKGLCMSSNNCANVCQTENFPGGE  64



>ref|NP_001147001.1| LOC100280611 precursor [Zea mays]
 gb|ACG29535.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|ACG30746.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|ACG30775.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|ACG34029.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|ACG43919.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|AFW72423.1| low-molecular-weight cysteine-rich protein LCR69 [Zea mays]
Length=80

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F+G C+  +NCA VC++E F GG+
Sbjct  29   AEARHCLSQSHRFKGLCMSSNNCANVCQTENFPGGE  64



>ref|XP_007045353.1| Defensin-like protein isoform 1 [Theobroma cacao]
 gb|EOY01185.1| Defensin-like protein isoform 1 [Theobroma cacao]
Length=78

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  184  GVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
              E R C SQSH F+G C+R  NCA VC++EGF  G
Sbjct  28   AAEARTCQSQSHRFKGMCMRKSNCAAVCQTEGFHSG  63



>ref|XP_009114206.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY04121.1| BnaA09g18990D [Brassica napus]
Length=77

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S+SH F+G C+  HNCA VC +EGF GG 
Sbjct  28   VEARTCESKSHKFRGPCVSRHNCANVCHNEGFHGGK  63



>gb|ABM89231.1| defensin [Setaria italica]
 gb|AEG19551.1| defensin [Zea mays subsp. mays]
 emb|CDK12932.1| defensin [Zea mays subsp. mays]
 gb|AHG97966.1| defensin 1 [Zea mays]
 emb|CEJ09692.1| Defensin protein [Zea mays]
Length=80

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F+G C+  +NCA VC++E F GG+
Sbjct  29   AEARHCLSQSHRFKGLCMSSNNCANVCQTENFPGGE  64



>gb|EMT22728.1| Defensin Tm-AMP-D1.2 [Aegilops tauschii]
Length=82

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R C SQSH F+G C  D NCA VCR+E F  G
Sbjct  31   AEARTCQSQSHKFKGACFSDTNCASVCRTEKFPRG  65



>gb|ACG30752.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
Length=80

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F+G C+  +NCA VC++E F GG+
Sbjct  29   AEARHCLSQSHRFKGLCMSSNNCANVCQTENFPGGE  64



>gb|AIA67012.1| defensin [Triticum aestivum]
Length=82

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R C S+SH F+G C+R  NCA VCR+EGFS G
Sbjct  31   AEARTCESRSHRFRGPCVRRSNCANVCRTEGFSDG  65



>gb|AAL85480.1| defensin protein 1 [Prunus persica]
Length=79

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R C SQS+ F+GTC+   NCA VC++EGF GG
Sbjct  30   AEARTCESQSNRFKGTCVSTSNCASVCQTEGFPGG  64



>ref|XP_007223891.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
 ref|XP_008220985.1| PREDICTED: defensin Ec-AMP-D2-like [Prunus mume]
 gb|EMJ25090.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
Length=78

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R C SQS+ F+GTC+   NCA VC++EGF GG
Sbjct  29   AEARTCESQSNRFKGTCVSTSNCASVCQTEGFPGG  63



>ref|XP_004976259.1| PREDICTED: defensin-like protein-like [Setaria italica]
Length=84

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F G+C+R  NC  VC++EGF  G+
Sbjct  32   AEARRCVSQSHKFVGSCMRKSNCQHVCQTEGFPWGE  67



>gb|AFW90621.1| protease inhibitor-related protein [Solanum tuberosum]
 gb|AIT42151.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C S SH F+G C RD NCA VC +E FSGG+
Sbjct  29   AEARNCESLSHRFKGPCTRDSNCASVCETERFSGGN  64



>dbj|BAJ86109.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=84

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R C SQSH F+G C  D NCA VCR+E F  G
Sbjct  33   AEARTCESQSHKFKGACFSDTNCASVCRTEDFPRG  67



>ref|XP_007159918.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
 gb|ESW31912.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
Length=75

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E R+C S SH F+G C  D NCA VC +EGF+GG
Sbjct  27   EARLCESPSHSFKGLCFNDRNCANVCLTEGFTGG  60



>gb|AIA67010.1| defensin [Triticum aestivum]
Length=84

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C ++SH F+G C+R  NCA VC++EGF GG 
Sbjct  33   AEARTCEAKSHRFRGPCVRHRNCANVCKTEGFPGGK  68



>gb|AIA66992.1| defensin [Triticum aestivum]
Length=82

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F+G CL   NCA VCR+E F  G+
Sbjct  31   AEARDCLSQSHKFKGACLSSSNCAGVCRTENFPDGE  66



>emb|CDY48618.1| BnaC09g20670D [Brassica napus]
Length=77

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S+SH F+G C+  HNCA VC +EGF GG 
Sbjct  28   VEARTCESKSHKFRGLCVSRHNCANVCHNEGFHGGK  63



>gb|EMT03365.1| Defensin-like protein 1 [Aegilops tauschii]
Length=82

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C ++SH F+G C+R  NCA VC++EGF GG 
Sbjct  31   AEARTCEAKSHRFRGPCVRHRNCANVCKTEGFPGGK  66



>ref|XP_009101271.1| PREDICTED: defensin-like protein 10 [Brassica rapa]
 emb|CDY17612.1| BnaA06g34310D [Brassica napus]
 emb|CDY03075.1| BnaC07g21520D [Brassica napus]
Length=73

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S S  FQG CL   NCA VC  EGF+GG 
Sbjct  26   VEARTCESPSTKFQGVCLNAKNCAGVCTGEGFTGGQ  61



>ref|XP_002513755.1| Low-molecular-weight cysteine-rich protein LCR69 precursor, putative 
[Ricinus communis]
 gb|EEF48338.1| Low-molecular-weight cysteine-rich protein LCR69 precursor, putative 
[Ricinus communis]
Length=77

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGF  282
             E R C SQSH F+GTCL   NCA +C++EGF
Sbjct  28   AEARTCESQSHKFKGTCLSTTNCANICKTEGF  59



>gb|EMT22726.1| Defensin Tm-AMP-D1.2 [Aegilops tauschii]
Length=82

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R C SQSH+F+G C  D NCA VCR+E F  G
Sbjct  31   AEARTCESQSHNFKGACFSDTNCASVCRTENFPRG  65



>gb|AIT42148.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C S SH F+G C RD NCA VC +E FSGG+
Sbjct  29   AEARNCESLSHRFKGPCTRDSNCASVCETERFSGGN  64



>ref|XP_011070574.1| PREDICTED: defensin J1-2-like [Sesamum indicum]
Length=74

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E R C SQSH F+G CLR  NCA VC++EGF  G
Sbjct  26   EARKCESQSHRFKGICLRKANCAAVCQTEGFHSG  59



>ref|XP_009413079.1| PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=81

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            VE R C S SH F+G C R  NCA VC++EGF GG
Sbjct  28   VEARKCESASHKFKGLCFRASNCANVCKTEGFHGG  62



>ref|NP_001047493.1| Os02g0629800 [Oryza sativa Japonica Group]
 dbj|BAD23741.1| putative defensin [Oryza sativa Japonica Group]
 dbj|BAF09407.1| Os02g0629800 [Oryza sativa Japonica Group]
 gb|EEE57415.1| hypothetical protein OsJ_07607 [Oryza sativa Japonica Group]
Length=80

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            E R C+SQSH F+G C+  +NCA VCR+E F  G+
Sbjct  30   EARHCLSQSHRFKGMCVSSNNCANVCRTESFPDGE  64



>ref|NP_001150374.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 ref|NP_001152951.1| LOC100285747 precursor [Zea mays]
 gb|ACG38843.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|ACG45818.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
Length=84

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE  +C+SQSH F+G CL + NC  VC++E F+GG+
Sbjct  33   VEETLCLSQSHAFKGVCLSNTNCDNVCKTEKFTGGE  68



>gb|KDP32807.1| hypothetical protein JCGZ_12099 [Jatropha curcas]
Length=77

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R C S SH F+G C+R+ NCA +C++EGF GG
Sbjct  28   AEARTCESLSHRFKGICVRNSNCAAICQTEGFQGG  62



>ref|XP_002452484.1| hypothetical protein SORBIDRAFT_04g026670 [Sorghum bicolor]
 gb|EES05460.1| hypothetical protein SORBIDRAFT_04g026670 [Sorghum bicolor]
Length=82

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F+G C+   NCA VC++E F GG+
Sbjct  31   AEARHCLSQSHRFKGLCMSSTNCANVCQTENFPGGE  66



>ref|XP_006395808.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
 gb|ACQ90607.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33094.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
Length=77

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S+SH F+G CL + NC  VC +EGF+GG+
Sbjct  28   VEARKCESKSHRFKGKCLSETNCKNVCHNEGFTGGN  63



>gb|ACV84385.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH+F+G CL   NCA VC +E F GG+
Sbjct  31   AEARDCLSQSHNFKGACLSSSNCAGVCHTESFPGGE  66



>ref|XP_009800136.1| PREDICTED: defensin J1-2-like [Nicotiana sylvestris]
Length=77

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +1

Query  118  RKTFGlffllliivlASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            +K F   FL+L++V A+ +     + R C SQSH F+G C+R  NCA VC++EGF  G
Sbjct  5    KKLFATVFLVLMLVFATEMGTMVADARTCESQSHRFKGPCVRKSNCAAVCQTEGFHAG  62



>ref|XP_009389205.1| PREDICTED: defensin Tk-AMP-D2-like [Musa acuminata subsp. malaccensis]
Length=79

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            V GR C SQSH F G C+R  NC  VC++EGF GG
Sbjct  28   VNGRTCESQSHKFVGPCVRKANCGNVCQTEGFHGG  62



>ref|XP_006395809.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
 gb|ACQ90606.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33095.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
Length=77

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S+SH F+G CL + NC  VC +EGF GG+
Sbjct  28   VEARTCESKSHRFKGACLSETNCKNVCHNEGFRGGN  63



>ref|XP_004242750.1| PREDICTED: defensin-like protein P322 [Solanum lycopersicum]
 gb|ABO36643.1| defensin protein [Solanum pimpinellifolium]
Length=78

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S SH F+G C+ D NCA VC +E FSGG+
Sbjct  29   VEARHCESLSHRFKGPCVSDKNCASVCETERFSGGN  64



>gb|ADB02899.1| gamma-thionin PPT precursor defensin 1-like protein [Jatropha 
curcas]
Length=92

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R C S SH F+G C+R+ NCA +C++EGF GG
Sbjct  28   AEARTCESLSHRFKGICVRNSNCAAICQTEGFQGG  62



>ref|XP_004509637.1| PREDICTED: defensin J1-2-like [Cicer arietinum]
Length=58

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E R+C S+S  ++G C+ D NCA+VCR+EGF GG
Sbjct  8    EARICESKSLSYKGLCVFDRNCALVCRTEGFVGG  41



>ref|NP_001048853.1| Os03g0130300 [Oryza sativa Japonica Group]
 gb|AAB17095.1| proteinase inhibitor [Oryza sativa Indica Group]
 gb|AAC00503.1| proteinase inhibitor [Oryza sativa Indica Group]
 dbj|BAA85411.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ABF93798.1| Gamma-thionin PPT precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10767.1| Os03g0130300 [Oryza sativa Japonica Group]
 dbj|BAH00191.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74445.1| hypothetical protein OsI_09847 [Oryza sativa Indica Group]
 gb|EEE58270.1| hypothetical protein OsJ_09283 [Oryza sativa Japonica Group]
Length=81

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R C SQSH F+G C R  NCA VC +EGF  G
Sbjct  31   AEARTCESQSHRFKGPCARKANCASVCNTEGFPDG  65



>sp|P82781.2|DEF03_ARATH RecName: Full=Putative defensin-like protein 3; AltName: Full=Putative 
low-molecular-weight cysteine-rich protein 71; Short=Protein 
LCR71; Flags: Precursor [Arabidopsis thaliana]
Length=62

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R+C S+S  F+G C+ + NCA VC +EGF  GD
Sbjct  13   VEARICKSRSQKFKGPCVSEDNCANVCHTEGFPDGD  48



>emb|CBI24167.3| unnamed protein product [Vitis vinifera]
Length=55

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGF  282
            E R+C SQSH F+G C+ +HNCA+VCR+E F
Sbjct  7    EARLCESQSHWFRGVCVSNHNCAVVCRNEHF  37



>gb|AIA66990.1| defensin [Triticum aestivum]
Length=82

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH+F+G CL   NCA VC +E F GG+
Sbjct  31   AEARDCLSQSHNFKGACLSSSNCAGVCHTESFPGGE  66



>gb|ACJ26760.1| protease inhibitor-related protein [Solanum tuberosum]
Length=78

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C S SH F+G C RD NCA VC +E FSGG+
Sbjct  29   AEARHCESLSHRFKGPCTRDSNCASVCETERFSGGN  64



>sp|P86518.1|DEF1_ECHCG RecName: Full=Defensin Ec-AMP-D1 [Echinochloa crus-galli]
Length=47

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  196  RVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            R C SQSH ++G C+ D NCA VC++EGFSGG
Sbjct  1    RECQSQSHRYKGACVHDTNCASVCQTEGFSGG  32



>gb|EMS65297.1| Defensin SD2 [Triticum urartu]
 gb|AIA67005.1| defensin [Triticum aestivum]
Length=78

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C S SH F G CLR HNCA VCR+EGF  G 
Sbjct  28   AEARRCESLSHRFAGLCLRGHNCANVCRTEGFPDGK  63



>ref|XP_011070572.1| PREDICTED: defensin J1-2-like [Sesamum indicum]
Length=74

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGF  282
            E R+C S+SH F+G C+R  NCA VC++EGF
Sbjct  26   EARICESKSHRFRGICVRKANCAAVCQTEGF  56



>sp|P20346.1|DF322_SOLTU RecName: Full=Defensin-like protein P322; AltName: Full=Probable 
protease inhibitor P322; Flags: Precursor [Solanum tuberosum]
 emb|CAA31577.1| unnamed protein product [Solanum tuberosum]
Length=74

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C S SH F+G C RD NCA VC +E FSGG+
Sbjct  25   AEARHCESLSHRFKGPCTRDSNCASVCETERFSGGN  60



>ref|XP_002263380.3| PREDICTED: defensin-like protein 1 [Vitis vinifera]
Length=93

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGF  282
             E R+C SQSH F+G C+ +HNCA+VCR+E F
Sbjct  44   TEARLCESQSHWFRGVCVSNHNCAVVCRNEHF  75



>ref|XP_009784025.1| PREDICTED: defensin J1-2 [Nicotiana sylvestris]
Length=77

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E R C SQSH F+G C+   NCA VC +EGF+GG
Sbjct  29   EARTCESQSHRFKGLCISKSNCASVCHTEGFNGG  62



>ref|XP_010513972.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
 ref|XP_010495963.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S+SH F+G C  + NC  VC +EGFSGG+
Sbjct  28   VEARTCESKSHRFKGKCFSETNCRNVCHNEGFSGGN  63



>ref|XP_006292846.1| hypothetical protein CARUB_v10019106mg [Capsella rubella]
 gb|EOA25744.1| hypothetical protein CARUB_v10019106mg [Capsella rubella]
Length=73

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 21/37 (57%), Gaps = 0/37 (0%)
 Frame = +1

Query  181  GGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            G VE R C S S  F G CL    CA  C SEGF+GG
Sbjct  24   GPVEARTCESPSSKFSGVCLNSQTCAKACPSEGFTGG  60



>sp|P86519.1|DEF2_ECHCG RecName: Full=Defensin Ec-AMP-D2 [Echinochloa crus-galli]
Length=47

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  196  RVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            R C SQSH ++G C+ D NCA VC++EGFSGG
Sbjct  1    RECQSQSHRYKGACVHDTNCASVCQTEGFSGG  32



>ref|XP_007159919.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
 gb|ESW31913.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
Length=74

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +1

Query  112  MARKTFGlffllliivlASHLENGGVEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            M RKT G  FLL +++ A+ +     E R+C S+S  F+G C  + NCA VC +EGF+GG
Sbjct  1    MERKTLGFIFLLFLVL-AADVAVKRAEARLCWSESQAFKGLCFSNDNCATVCLTEGFTGG  59



>emb|CEJ09689.1| Defensin protein [Zea mays]
 emb|CEJ09691.1| Defensin protein [Zea mays]
Length=80

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
             E R C+SQSH F+G C+  +NCA  C++E F GG+
Sbjct  29   AEARHCLSQSHRFKGLCMSSNNCANACQTENFPGGE  64



>gb|AFK44299.1| unknown [Lotus japonicus]
Length=78

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E R C SQSH F+G C+ D NCA VC  E FSGG
Sbjct  30   EARDCESQSHRFKGPCVSDTNCASVCHGEKFSGG  63



>ref|XP_006292781.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
 gb|EOA25679.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
Length=77

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S+SH F+G C  + NC  VC +EGF+GG+
Sbjct  28   VEARTCESKSHRFKGKCFSETNCKNVCHNEGFTGGN  63



>ref|XP_004954814.1| PREDICTED: defensin SD2-like [Setaria italica]
Length=82

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            E R C+SQSH F+G C    NCA VC+SE F GG 
Sbjct  32   EERHCLSQSHTFKGLCFSSENCASVCKSEKFPGGQ  66



>gb|AAA91049.1| protease inhibitor II [Brassica rapa]
Length=77

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S+SH F+GTC+   NC  VC +EGF GG 
Sbjct  28   VEARTCESKSHRFKGTCVSSTNCGNVCHNEGFGGGK  63



>ref|XP_009101273.1| PREDICTED: defensin-like protein 2 [Brassica rapa]
 emb|CDY17613.1| BnaA06g34320D [Brassica napus]
Length=77

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S+SH F+GTC+   NC  VC +EGF GG 
Sbjct  28   VEARTCESKSHRFKGTCVSSTNCGNVCHNEGFGGGK  63



>dbj|BAK07823.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=105

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
             E R C S+SH F+G C+R  NCA VC++EGF  G
Sbjct  54   AEARTCESRSHRFRGPCVRRSNCANVCKTEGFPDG  88



>gb|AIT42152.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S SH F+G C  D NCA VC +E FSGG+
Sbjct  29   VEARHCESLSHRFKGPCASDRNCASVCETERFSGGN  64



>ref|XP_003628979.1| Defensin [Medicago truncatula]
 ref|XP_003636616.1| Defensin [Medicago truncatula]
 gb|AET03455.1| Defensin MtDef4.4 [Medicago truncatula]
Length=78

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  190  EGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGG  291
            E R C + S++F+G C+ D NCA VC++EGF GG
Sbjct  30   EARTCETPSNNFKGLCVSDTNCASVCQTEGFPGG  63



>gb|AGT51228.1| defensin [Brassica napus]
 emb|CDY03076.1| BnaC07g21510D [Brassica napus]
Length=76

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S+SH F+GTC+   NC  VC +EGF GG 
Sbjct  27   VEARTCESKSHRFKGTCVSSTNCGNVCHNEGFGGGK  62



>gb|AIT42153.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S SH F+G C  D NCA VC +E FSGG+
Sbjct  29   VEARHCESLSHRFKGPCASDKNCASVCETERFSGGN  64



>gb|AIT42149.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  VEGRVCISQSHHFQGTCLRDHNCAMVCRSEGFSGGD  294
            VE R C S SH F+G C  D NCA VC +E FSGG+
Sbjct  29   VEARHCESLSHRFKGPCASDRNCASVCETERFSGGN  64



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508931117092