BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27235_g1_i1 len=1870 path=[1848:0-1869]

Length=1870
                                                                      Score     E

ref|XP_009798487.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     783   0.0      
ref|XP_009605545.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     782   0.0      
ref|XP_006340657.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     775   0.0      
ref|XP_004232430.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     768   0.0      
emb|CDP01982.1|  unnamed protein product                                759   0.0      
ref|XP_010029758.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-li...    752   0.0      
ref|XP_010029757.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-li...    735   0.0      
ref|XP_010029756.1|  PREDICTED: cytochrome P450 90A1-like isoform X2    734   0.0      
ref|XP_004287873.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     721   0.0      
gb|KGN48862.1|  hypothetical protein Csa_6G504430                       719   0.0      
ref|XP_002269279.3|  PREDICTED: abscisic acid 8'-hydroxylase 3-li...    719   0.0      Vitis vinifera
ref|XP_002521537.1|  cytochrome P450, putative                          718   0.0      Ricinus communis
ref|XP_004150006.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     717   0.0      
ref|XP_008440758.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     717   0.0      
ref|XP_008241894.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     717   0.0      
ref|XP_004509304.1|  PREDICTED: cytochrome P450 716B1-like              717   0.0      
ref|XP_010649113.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-li...    715   0.0      
ref|XP_010029755.1|  PREDICTED: cytochrome P450 90A1-like isoform X1    716   0.0      
gb|AET03877.2|  cytochrome P450 family protein                          709   0.0      
ref|XP_007204348.1|  hypothetical protein PRUPE_ppa005680mg             705   0.0      
ref|XP_006425626.1|  hypothetical protein CICLE_v10027167mg             706   0.0      
ref|XP_003548874.1|  PREDICTED: cytochrome P450 716B1-like isofor...    706   0.0      
ref|XP_010649114.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-li...    705   0.0      
ref|XP_006467149.1|  PREDICTED: abscisic acid 8'-hydroxylase 2-like     704   0.0      
ref|XP_003629401.1|  Abscisic acid 8'-hydroxylase                       696   0.0      
ref|XP_006599361.1|  PREDICTED: cytochrome P450 716B1-like isofor...    686   0.0      
ref|XP_010909382.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     681   0.0      
ref|XP_007156078.1|  hypothetical protein PHAVU_003G256500g             678   0.0      
ref|XP_008785080.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     674   0.0      
emb|CBI17462.3|  unnamed protein product                                667   0.0      
ref|XP_011083191.1|  PREDICTED: cytochrome P450 85A1                    650   0.0      
ref|XP_002524333.1|  Ent-kaurenoic acid oxidase, putative               637   0.0      Ricinus communis
gb|EYU24120.1|  hypothetical protein MIMGU_mgv1a019906mg                630   0.0      
ref|XP_004303111.1|  PREDICTED: cytochrome P450 716B1-like              630   0.0      
gb|KDP36557.1|  hypothetical protein JCGZ_08324                         624   0.0      
ref|XP_008354232.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like     612   0.0      
gb|KEH20410.1|  cytochrome P450 family protein                          588   0.0      
ref|XP_010649115.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-li...    565   0.0      
gb|KDP44569.1|  hypothetical protein JCGZ_22151                         557   0.0      
gb|KCW56713.1|  hypothetical protein EUGRSUZ_I02403                     555   0.0      
gb|KEH20409.1|  cytochrome P450 family protein                          528   3e-180   
gb|KEH20408.1|  cytochrome P450 family protein                          528   3e-180   
ref|XP_010110046.1|  Abscisic acid 8'-hydroxylase 4                     473   4e-157   
ref|XP_010263599.1|  PREDICTED: abscisic acid 8'-hydroxylase 3          457   3e-151   
ref|XP_009365520.1|  PREDICTED: abscisic acid 8'-hydroxylase 1          452   7e-149   
ref|XP_008220838.1|  PREDICTED: abscisic acid 8'-hydroxylase 3 is...    451   2e-148   
ref|XP_008364981.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     447   5e-147   
ref|XP_002300756.1|  cytochrome P450 family protein                     447   6e-147   Populus trichocarpa [western balsam poplar]
ref|XP_008220837.1|  PREDICTED: abscisic acid 8'-hydroxylase 3 is...    446   3e-146   
ref|XP_011028878.1|  PREDICTED: abscisic acid 8'-hydroxylase 1          445   5e-146   
ref|XP_007226877.1|  hypothetical protein PRUPE_ppa016822mg             442   5e-145   
ref|XP_009785222.1|  PREDICTED: abscisic acid 8'-hydroxylase 2          442   5e-145   
ref|XP_004293199.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     439   2e-144   
ref|XP_007017598.1|  Cytochrome P450, family 722, subfamily A, po...    440   3e-144   
ref|XP_002510423.1|  cytochrome P450, putative                          435   1e-142   Ricinus communis
ref|XP_007017596.1|  Cytochrome P450, family 722, subfamily A, po...    435   1e-142   
ref|XP_004238286.1|  PREDICTED: abscisic acid 8'-hydroxylase 2 is...    429   4e-140   
ref|XP_002281158.1|  PREDICTED: abscisic acid 8'-hydroxylase 4          430   4e-140   Vitis vinifera
ref|XP_009621239.1|  PREDICTED: abscisic acid 8'-hydroxylase 2          429   7e-140   
ref|XP_007136626.1|  hypothetical protein PHAVU_009G060000g             426   9e-139   
ref|XP_004501123.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like     425   1e-138   
ref|XP_010060975.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...    426   1e-138   
ref|XP_009390176.1|  PREDICTED: abscisic acid 8'-hydroxylase 4          425   1e-138   
gb|KEH36179.1|  cytochrome P450 family protein                          424   4e-138   
ref|XP_006467169.1|  PREDICTED: abscisic acid 8'-hydroxylase 2-like     421   3e-137   
gb|KDO71226.1|  hypothetical protein CISIN_1g010899mg                   422   4e-137   
emb|CAN64558.1|  hypothetical protein VITISV_040162                     420   2e-136   Vitis vinifera
ref|XP_010906351.1|  PREDICTED: LOW QUALITY PROTEIN: abscisic aci...    415   1e-134   
gb|KFK44099.1|  hypothetical protein AALP_AA1G215700                    411   2e-133   
gb|AFK39117.1|  unknown                                                 412   2e-133   
ref|XP_006342223.1|  PREDICTED: abscisic acid 8'-hydroxylase 2-like     411   3e-133   
ref|XP_010230530.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like     410   1e-132   
ref|XP_010673149.1|  PREDICTED: abscisic acid 8'-hydroxylase 4 is...    409   2e-132   
ref|XP_007017599.1|  Abscisic acid 8'-hydroxylase 1 isoform 2           407   4e-132   
ref|NP_173393.5|  cytochrome P450, family 722, subfamily A, polyp...    408   5e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459635.1|  PREDICTED: cytochrome P450 90A1-like               407   1e-131   
ref|XP_006416485.1|  hypothetical protein EUTSA_v10007476mg             406   3e-131   
ref|XP_009110265.1|  PREDICTED: abscisic acid 8'-hydroxylase 1 is...    405   6e-131   
ref|XP_006307378.1|  hypothetical protein CARUB_v10009004mg             405   6e-131   
ref|XP_010477182.1|  PREDICTED: cytochrome P450 90A1-like               405   9e-131   
ref|XP_010501526.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     404   1e-130   
gb|KGN62620.1|  hypothetical protein Csa_2G361840                       398   3e-128   
gb|KHN45870.1|  Abscisic acid 8'-hydroxylase 3                          396   6e-128   
ref|XP_004168682.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like     397   2e-127   
ref|XP_004152773.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like     396   6e-127   
ref|XP_010539102.1|  PREDICTED: abscisic acid 8'-hydroxylase 4          395   6e-127   
ref|XP_008444740.1|  PREDICTED: abscisic acid 8'-hydroxylase 2          394   2e-126   
ref|XP_010320398.1|  PREDICTED: abscisic acid 8'-hydroxylase 2 is...    392   3e-126   
ref|XP_006579030.1|  PREDICTED: abscisic acid 8'-hydroxylase 1          392   8e-126   
ref|XP_004960948.1|  PREDICTED: abscisic acid 8'-hydroxylase 2-like     382   5e-121   
emb|CDX83746.1|  BnaC08g18990D                                          380   6e-121   
ref|XP_007046851.1|  Cytochrome P450, putative                          372   1e-120   
ref|XP_002893056.1|  CYP722A1                                           374   5e-119   
dbj|BAJ91618.1|  predicted protein                                      356   3e-112   
ref|XP_006425454.1|  hypothetical protein CICLE_v10027097mg             358   3e-112   
ref|XP_010673152.1|  PREDICTED: abscisic acid 8'-hydroxylase 4 is...    355   3e-112   
gb|KDO71004.1|  hypothetical protein CISIN_1g0156961mg                  345   4e-111   
ref|XP_009110266.1|  PREDICTED: abscisic acid 8'-hydroxylase 1 is...    337   6e-105   
ref|XP_006654892.1|  PREDICTED: abscisic acid 8'-hydroxylase 2-like     333   1e-102   
ref|XP_009110267.1|  PREDICTED: cytochrome P450 90A1 isoform X3         329   3e-102   
ref|NP_001183271.1|  putative cytochrome P450 superfamily protein       328   4e-100   
gb|AAF79438.1|AC025808_20  F18O14.38                                    308   4e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010927381.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     311   1e-94    
ref|XP_002466145.1|  hypothetical protein SORBIDRAFT_01g002160          310   3e-94    Sorghum bicolor [broomcorn]
gb|KDO83690.1|  hypothetical protein CISIN_1g012199mg                   309   4e-94    
gb|KEH25831.1|  cytochrome P450 family protein                          309   5e-94    
ref|XP_006472966.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     309   8e-94    
ref|XP_004237776.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     307   4e-93    
ref|XP_008665727.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-li...    306   5e-93    
emb|CDP11373.1|  unnamed protein product                                304   5e-92    
gb|EEE61996.1|  hypothetical protein OsJ_16777                          305   7e-92    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054381.1|  Os05g0101600                                       305   7e-92    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009616515.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     302   3e-91    
ref|XP_009784233.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     300   2e-90    
gb|EMS55131.1|  Abscisic acid 8'-hydroxylase 4                          294   2e-90    
ref|XP_008793990.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     300   3e-90    
ref|XP_011042838.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     298   1e-89    
gb|KDP43007.1|  hypothetical protein JCGZ_25193                         298   1e-89    
ref|XP_006434438.1|  hypothetical protein CICLE_v10003821mg             298   1e-89    
ref|XP_002533019.1|  cytochrome P450, putative                          297   2e-89    Ricinus communis
gb|AFK38360.1|  unknown                                                 289   2e-89    
ref|XP_004981142.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     296   6e-89    
ref|XP_009368539.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     295   2e-88    
gb|KHN15438.1|  Abscisic acid 8'-hydroxylase 3                          295   2e-88    
ref|XP_004516648.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     295   2e-88    
ref|XP_008243633.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     294   3e-88    
ref|XP_008339194.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     293   6e-88    
gb|EYU17448.1|  hypothetical protein MIMGU_mgv1a024410mg                292   6e-88    
gb|AAF98400.1|AC024609_1  Hypothetical protein                          289   9e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007199302.1|  hypothetical protein PRUPE_ppa023168mg             292   1e-87    
ref|XP_010108653.1|  Abscisic acid 8'-hydroxylase 3                     291   2e-87    
ref|XP_003634499.1|  PREDICTED: abscisic acid 8'-hydroxylase 3 is...    292   2e-87    
ref|XP_003548125.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     291   3e-87    
ref|XP_010063878.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     291   3e-87    
ref|NP_001242618.1|  uncharacterized protein LOC100803766               291   6e-87    
ref|XP_007152048.1|  hypothetical protein PHAVU_004G097400g             290   1e-86    
ref|XP_004290536.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     289   2e-86    
ref|XP_002300926.1|  hypothetical protein POPTR_0002s07030g             288   3e-86    Populus trichocarpa [western balsam poplar]
gb|KDO71003.1|  hypothetical protein CISIN_1g0156962mg                  276   2e-85    
ref|XP_007019464.1|  Cytochrome P450                                    282   2e-83    
emb|CBI18551.3|  unnamed protein product                                281   2e-83    
ref|XP_009598210.1|  PREDICTED: abscisic acid 8'-hydroxylase 2-like     269   4e-83    
ref|XP_004139645.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     279   1e-82    
ref|XP_006575810.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     279   2e-82    
ref|XP_010229421.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     278   3e-82    
ref|XP_006574443.1|  PREDICTED: uncharacterized protein LOC100803...    274   2e-81    
ref|XP_008461511.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-li...    275   3e-81    
ref|XP_008461509.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-li...    275   6e-81    
ref|XP_002440395.1|  hypothetical protein SORBIDRAFT_09g000270          275   2e-80    Sorghum bicolor [broomcorn]
ref|XP_011069606.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     267   3e-79    
gb|KDO71227.1|  hypothetical protein CISIN_1g010899mg                   263   5e-78    
ref|XP_009419410.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     254   3e-72    
emb|CDY67982.1|  BnaCnng57170D                                          245   4e-71    
gb|EAY96198.1|  hypothetical protein OsI_18083                          242   2e-70    Oryza sativa Indica Group [Indian rice]
ref|XP_010673159.1|  PREDICTED: abscisic acid 8'-hydroxylase 4 is...    241   1e-68    
ref|XP_006854521.1|  hypothetical protein AMTR_s00030p00013570          238   5e-68    
gb|EEC76480.1|  hypothetical protein OsI_14219                          242   7e-68    Oryza sativa Indica Group [Indian rice]
gb|KHN15436.1|  Abscisic acid 8'-hydroxylase 3                          233   3e-66    
gb|KHN00517.1|  Taxane 13-alpha-hydroxylase                             225   3e-66    
ref|XP_004308741.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       236   4e-66    
ref|NP_001173703.1|  Os03g0836100                                       237   4e-66    
gb|AHA85935.1|  abscisic acid 8-hydroxylase 3                           228   1e-65    
ref|XP_010921143.1|  PREDICTED: taxane 13-alpha-hydroxylase-like ...    234   3e-65    
ref|XP_010921144.1|  PREDICTED: cytochrome P450 716B1-like isofor...    232   6e-65    
ref|XP_009373442.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    233   6e-65    
ref|XP_009373441.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    233   9e-65    
dbj|BAG71199.1|  ent-kaurenoic acid oxidase                             232   1e-64    Lactuca sativa [cultivated lettuce]
ref|XP_002526524.1|  Ent-kaurenoic acid oxidase, putative               231   1e-64    Ricinus communis
ref|XP_002968540.1|  hypothetical protein SELMODRAFT_89153              229   4e-64    
ref|XP_010065107.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     226   9e-64    
ref|XP_011013095.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       228   3e-63    
gb|KCW71147.1|  hypothetical protein EUGRSUZ_F042432                    225   4e-63    
ref|XP_010097724.1|  Ent-kaurenoic acid oxidase 1                       228   4e-63    
ref|XP_002975946.1|  hypothetical protein SELMODRAFT_104642             227   5e-63    
gb|AGI65630.1|  ent-kaurenoic acid oxidase                              228   5e-63    
gb|AGZ93669.1|  ent-kaurene acid oxidase                                228   6e-63    
ref|XP_002264215.1|  PREDICTED: ent-kaurenoic acid oxidase 1            226   9e-63    Vitis vinifera
ref|XP_004510262.1|  PREDICTED: beta-amyrin 11-oxidase-like             226   1e-62    
ref|XP_002984649.1|  hypothetical protein SELMODRAFT_120725             226   1e-62    
ref|XP_009376861.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       226   1e-62    
ref|XP_008354800.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       226   2e-62    
gb|KDP28926.1|  hypothetical protein JCGZ_14697                         226   2e-62    
gb|AGF25266.1|  ent-kaurenoic acid oxidase                              226   3e-62    
ref|XP_004517250.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      225   4e-62    
gb|ABK25038.1|  unknown                                                 225   4e-62    Picea sitchensis
ref|XP_009347589.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       224   8e-62    
ref|XP_010064128.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     220   8e-62    
ref|XP_010469584.1|  PREDICTED: ent-kaurenoic acid oxidase 2            224   8e-62    
ref|XP_006418058.1|  hypothetical protein EUTSA_v10009356mg             224   1e-61    
ref|XP_010691952.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       223   1e-61    
ref|XP_010933628.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       223   1e-61    
emb|CBV36747.1|  ent-kaurenoic acid oxidase                             223   2e-61    
ref|XP_008356451.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       223   3e-61    
emb|CDY49505.1|  BnaC05g03170D                                          222   5e-61    
ref|XP_007141387.1|  hypothetical protein PHAVU_008G191000g             222   5e-61    
ref|XP_003617455.1|  Taxane 13-alpha-hydroxylase                        221   6e-61    
ref|XP_009119194.1|  PREDICTED: ent-kaurenoic acid oxidase 1            221   8e-61    
gb|AHF49536.1|  CYP450 716-like protein                                 221   9e-61    
sp|Q50EK1.1|C16B1_PICSI  RecName: Full=Cytochrome P450 716B1; Alt...    221   9e-61    Picea sitchensis
emb|CBV36749.1|  ent-kaurenoic acid oxidase                             221   1e-60    
sp|Q50EK0.1|C16B2_PICSI  RecName: Full=Cytochrome P450 716B2; Alt...    221   2e-60    Picea sitchensis
emb|CDY48265.1|  BnaA05g10890D                                          221   2e-60    
ref|XP_009143990.1|  PREDICTED: ent-kaurenoic acid oxidase 2            220   2e-60    
ref|XP_011010024.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    220   2e-60    
ref|XP_010413993.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       220   3e-60    
emb|CDY12205.1|  BnaC04g12350D                                          220   3e-60    
ref|XP_002980510.1|  hypothetical protein SELMODRAFT_233532             218   3e-60    
ref|XP_009142864.1|  PREDICTED: taxadiene 5-alpha hydroxylase           219   3e-60    
ref|XP_008454553.1|  PREDICTED: LOW QUALITY PROTEIN: taxadiene 5-...    219   4e-60    
ref|XP_008238332.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       219   5e-60    
ref|XP_003518515.2|  PREDICTED: taxadiene 5-alpha hydroxylase-like      219   5e-60    
ref|XP_004486504.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    219   6e-60    
emb|CDY50827.1|  BnaC04g52640D                                          219   6e-60    
ref|XP_011040241.1|  PREDICTED: cytochrome P450 716B1-like              218   6e-60    
ref|XP_002265630.1|  PREDICTED: ent-kaurenoic acid oxidase 2            219   7e-60    Vitis vinifera
ref|NP_001267981.1|  hypodontia, autosomal recessive (2)                218   7e-60    
gb|KDP26990.1|  hypothetical protein JCGZ_22182                         219   8e-60    
ref|XP_010058307.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      218   8e-60    
ref|XP_010517830.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      219   8e-60    
ref|XP_010691953.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       219   8e-60    
dbj|BAQ20602.1|  ent-kaurenoic acid oxidase 1                           219   9e-60    
gb|EYU19246.1|  hypothetical protein MIMGU_mgv1a005723mg                218   1e-59    
ref|XP_010510015.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    218   1e-59    
ref|XP_008644980.1|  PREDICTED: cytochrome P450 716B1-like              218   1e-59    
ref|XP_008375674.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       216   1e-59    
ref|XP_009414347.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     217   1e-59    
ref|XP_006484839.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      217   2e-59    
ref|XP_002879389.1|  ent-kaurenoic acid hydroxylase                     218   2e-59    
ref|XP_004510263.1|  PREDICTED: beta-amyrin 11-oxidase-like             218   2e-59    
ref|XP_004229509.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    218   2e-59    
ref|XP_002278616.2|  PREDICTED: cytochrome P450 716B1-like              217   3e-59    Vitis vinifera
ref|XP_004486505.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    217   3e-59    
ref|XP_007039941.1|  Cytochrome P450, family 88, subfamily A, pol...    217   3e-59    
ref|XP_011098383.1|  PREDICTED: taxadiene 5-alpha hydroxylase           217   4e-59    
ref|XP_002319447.1|  ent-kaurenoic acid oxidase family protein          217   4e-59    Populus trichocarpa [western balsam poplar]
gb|EMT01609.1|  Ent-kaurenoic acid oxidase 1                            217   4e-59    
sp|B5BSX1.1|BAMO_GLYUR  RecName: Full=Beta-amyrin 11-oxidase; Alt...    217   4e-59    Glycyrrhiza uralensis [Chinese licorice]
ref|XP_010556999.1|  PREDICTED: ent-kaurenoic acid oxidase 1            217   5e-59    
ref|XP_002437500.1|  hypothetical protein SORBIDRAFT_10g028220          216   5e-59    Sorghum bicolor [broomcorn]
gb|AEH41592.1|  abscisic acid 8'-hydroxylase                            216   5e-59    
ref|XP_007209946.1|  hypothetical protein PRUPE_ppa004753mg             216   5e-59    
ref|XP_006398206.1|  hypothetical protein EUTSA_v10000876mg             216   6e-59    
ref|XP_006294074.1|  hypothetical protein CARUB_v10023069mg             216   6e-59    
ref|XP_008232239.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       216   6e-59    
emb|CDP09339.1|  unnamed protein product                                216   7e-59    
ref|XP_010547851.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-li...    215   9e-59    
emb|CDY39421.1|  BnaAnng05520D                                          215   9e-59    
ref|XP_009602928.1|  PREDICTED: taxadiene 5-alpha hydroxylase           216   9e-59    
ref|XP_007217929.1|  hypothetical protein PRUPE_ppa004901mg             216   9e-59    
gb|ABR16707.1|  unknown                                                 216   9e-59    Picea sitchensis
ref|XP_006354607.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       216   9e-59    
emb|CDP09338.1|  unnamed protein product                                216   1e-58    
ref|XP_004168072.1|  PREDICTED: LOW QUALITY PROTEIN: ent-kaurenoi...    216   1e-58    
ref|XP_007219798.1|  hypothetical protein PRUPE_ppa026558mg             216   1e-58    
emb|CDP09336.1|  unnamed protein product                                216   1e-58    
ref|XP_006410376.1|  hypothetical protein EUTSA_v10016575mg             215   1e-58    
gb|EMT03540.1|  Ent-kaurenoic acid oxidase 1                            215   1e-58    
ref|XP_010273405.1|  PREDICTED: taxadiene 5-alpha hydroxylase           215   2e-58    
ref|XP_010102173.1|  Taxadiene 5-alpha hydroxylase                      214   2e-58    
ref|XP_008232238.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       215   2e-58    
ref|XP_008232229.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       215   2e-58    
dbj|BAJ98009.1|  predicted protein                                      215   2e-58    
ref|XP_006411556.1|  hypothetical protein EUTSA_v10016578mg             214   3e-58    
ref|XP_006437195.1|  hypothetical protein CICLE_v10031591mg             213   3e-58    
gb|KHG22736.1|  Cytochrome P450                                         214   3e-58    
dbj|BAJ95047.1|  predicted protein                                      214   3e-58    
ref|NP_181813.1|  cytochrome P450, family 718                           214   4e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006338854.1|  PREDICTED: cytochrome P450 90A1-like               214   4e-58    
ref|XP_004152028.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      214   4e-58    
ref|XP_004158484.1|  PREDICTED: LOW QUALITY PROTEIN: taxadiene 5-...    214   5e-58    
emb|CDX87793.1|  BnaC02g31560D                                          213   5e-58    
gb|EYU31573.1|  hypothetical protein MIMGU_mgv1a020910mg                214   5e-58    
ref|XP_002318613.2|  hypothetical protein POPTR_0012s07300g             213   5e-58    Populus trichocarpa [western balsam poplar]
ref|XP_007217930.1|  hypothetical protein PRUPE_ppa004910mg             213   6e-58    
ref|XP_006445516.1|  hypothetical protein CICLE_v10019986mg             213   6e-58    
ref|XP_008238293.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       214   7e-58    
ref|XP_007020904.1|  Cytochrome P450                                    213   7e-58    
ref|XP_008797268.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     213   8e-58    
gb|KDO85362.1|  hypothetical protein CISIN_1g010697mg                   213   8e-58    
gb|KDO60927.1|  hypothetical protein CISIN_1g035672mg                   212   8e-58    
emb|CDP09340.1|  unnamed protein product                                213   9e-58    
emb|CDY38984.1|  BnaC07g18360D                                          213   9e-58    
dbj|BAG68926.1|  cytochrome P450 88D3                                   213   9e-58    
gb|AEF32085.1|  ent-kaurenoic acid oxidase                              213   1e-57    
gb|KHN38311.1|  Taxadiene 5-alpha hydroxylase                           211   1e-57    
ref|XP_008382035.1|  PREDICTED: abscisic acid 8'-hydroxylase 1          213   1e-57    
ref|XP_003533093.1|  PREDICTED: ent-kaurenoic acid oxidase 2            213   1e-57    
gb|KCW44674.1|  hypothetical protein EUGRSUZ_L01790                     206   1e-57    
ref|XP_008778846.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     212   1e-57    
ref|XP_010070515.1|  PREDICTED: taxadiene 5-alpha hydroxylase           213   1e-57    
ref|XP_010525407.1|  PREDICTED: taxadiene 5-alpha hydroxylase           213   1e-57    
ref|XP_006376822.1|  hypothetical protein POPTR_0012s07310g             213   1e-57    
ref|XP_009338812.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     212   1e-57    
gb|EPS66684.1|  hypothetical protein M569_08091                         212   1e-57    
ref|XP_010547852.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-li...    212   1e-57    
ref|XP_011026285.1|  PREDICTED: taxadiene 5-alpha hydroxylase           212   2e-57    
ref|XP_006464339.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       213   2e-57    
dbj|BAG12743.1|  ABA 8-oxidase                                          211   2e-57    
ref|XP_004307312.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       213   2e-57    
ref|XP_008229454.1|  PREDICTED: taxadiene 5-alpha hydroxylase           212   2e-57    
ref|XP_004133946.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       212   2e-57    
ref|XP_011095373.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      211   2e-57    
gb|KEH37115.1|  cytochrome P450 family ent-kaurenoic acid oxidase       212   2e-57    
ref|XP_003612492.1|  Abscisic acid 8'-hydroxylase                       211   3e-57    
ref|XP_002991753.1|  hypothetical protein SELMODRAFT_161932             211   3e-57    
ref|XP_008782776.1|  PREDICTED: cytochrome P450 716B1-like              212   3e-57    
ref|XP_004140249.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      211   3e-57    
gb|AJD25242.1|  cytochrome P450 CYP707A102                              211   3e-57    
ref|XP_006295434.1|  hypothetical protein CARUB_v10024533mg             211   3e-57    
dbj|BAG68928.1|  cytochrome P450 88D5                                   211   4e-57    
ref|XP_007008706.1|  Cytochrome P450, family 88, subfamily A, pol...    211   4e-57    
gb|EYU29121.1|  hypothetical protein MIMGU_mgv1a005972mg                211   4e-57    
gb|KCW72390.1|  hypothetical protein EUGRSUZ_E00840                     210   4e-57    
ref|XP_011072199.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     210   5e-57    
ref|XP_009758604.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      211   5e-57    
ref|XP_011030804.1|  PREDICTED: cytochrome P450 716B1-like              211   5e-57    
gb|AES94940.2|  cytochrome P450 family protein                          211   6e-57    
ref|XP_002880006.1|  CYP718                                             211   6e-57    
ref|XP_007008707.1|  Ent-kaurenoic acid oxidase 1 isoform 2             212   7e-57    
ref|XP_007146884.1|  hypothetical protein PHAVU_006G078600g             211   7e-57    
ref|XP_009101608.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     210   7e-57    
ref|XP_007147426.1|  hypothetical protein PHAVU_006G123600g             211   7e-57    
ref|XP_002302147.1|  cytochrome P450 family protein                     210   7e-57    
ref|XP_007209137.1|  hypothetical protein PRUPE_ppa005745mg             209   8e-57    
gb|KEH20767.1|  cytochrome P450 family 88 protein                       211   8e-57    
ref|XP_010092132.1|  Cytochrome P450                                    210   8e-57    
ref|XP_004164866.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      210   8e-57    
emb|CDY67937.1|  BnaCnng57040D                                          210   9e-57    
ref|XP_010052709.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       210   9e-57    
gb|KCW76778.1|  hypothetical protein EUGRSUZ_D01134                     210   9e-57    
ref|XP_010508516.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      210   1e-56    
gb|EYU42301.1|  hypothetical protein MIMGU_mgv1a005890mg                209   1e-56    
ref|XP_002989743.1|  hypothetical protein SELMODRAFT_130337             209   1e-56    
ref|XP_003546291.1|  PREDICTED: ent-kaurenoic acid oxidase 2            210   1e-56    
ref|XP_003611982.1|  Cytochrome P450                                    211   1e-56    
gb|KHN14287.1|  Ent-kaurenoic acid oxidase 2                            210   1e-56    
ref|XP_010677318.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       210   2e-56    
ref|XP_004301697.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       210   2e-56    
gb|EYU35888.1|  hypothetical protein MIMGU_mgv1a023958mg                209   2e-56    
gb|EYU25425.1|  hypothetical protein MIMGU_mgv1a005650mg                209   2e-56    
ref|XP_008449518.1|  PREDICTED: taxadiene 5-alpha hydroxylase           209   2e-56    
gb|KFK31124.1|  hypothetical protein AALP_AA6G071000                    209   2e-56    
ref|XP_008788752.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       207   2e-56    
gb|AAG41777.1|AF212991_1  ent-kaurenoic acid oxidase                    209   2e-56    
ref|XP_007218023.1|  hypothetical protein PRUPE_ppa005937mg             208   2e-56    
ref|XP_010441747.1|  PREDICTED: abscisic acid 8'-hydroxylase 3 is...    208   2e-56    
ref|XP_006307341.1|  hypothetical protein CARUB_v10008960mg             209   2e-56    
ref|XP_010676702.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     208   2e-56    
dbj|BAF56238.1|  cytochrome P450 enzyme                                 209   3e-56    
ref|XP_010933004.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     209   3e-56    
ref|XP_003607975.1|  Abscisic acid 8'-hydroxylase                       208   3e-56    
ref|XP_009365701.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     208   3e-56    
ref|XP_010491100.1|  PREDICTED: cytochrome P450 90A1-like               208   3e-56    
ref|XP_011093453.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       209   3e-56    
ref|XP_009589784.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    209   3e-56    
ref|XP_007219847.1|  hypothetical protein PRUPE_ppa027023mg             209   4e-56    
ref|XP_006283694.1|  hypothetical protein CARUB_v10004758mg             208   4e-56    
gb|KHN36124.1|  Cytochrome P450 90B1                                    209   4e-56    
ref|XP_011085042.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       209   4e-56    
gb|KDP23025.1|  hypothetical protein JCGZ_01688                         208   4e-56    
ref|XP_008337780.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...    209   4e-56    
ref|XP_007217282.1|  hypothetical protein PRUPE_ppa017753mg             207   4e-56    
ref|XP_006280421.1|  hypothetical protein CARUB_v10026354mg             207   5e-56    
ref|NP_180803.1|  Ent-kaurenoic acid oxidase 2                          208   5e-56    
ref|XP_008665726.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-li...    209   5e-56    
ref|XP_004512329.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     207   6e-56    
gb|AAO23063.1|  ent-kaurenoic acid oxidase                              208   6e-56    
ref|XP_009392783.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       208   6e-56    
gb|AAO23064.1|  ent-kaurenoic acid oxidase                              208   6e-56    
ref|XP_008803662.1|  PREDICTED: cytochrome P450 716B1-like              208   6e-56    
gb|KHG23511.1|  Abscisic acid 8'-hydroxylase 1 -like protein            207   7e-56    
ref|XP_009391355.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     207   7e-56    
ref|XP_009348190.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       207   8e-56    
ref|XP_003517233.1|  PREDICTED: cytochrome P450 90B1-like isoform X1    207   8e-56    
ref|XP_004295817.1|  PREDICTED: cytochrome P450 716B1-like              207   9e-56    
ref|XP_003538460.1|  PREDICTED: cytochrome P450 90A1                    207   9e-56    
ref|XP_006856023.1|  hypothetical protein AMTR_s00059p00056420          207   9e-56    
ref|XP_010111775.1|  Abscisic acid 8'-hydroxylase 1                     207   1e-55    
ref|XP_010935406.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       207   1e-55    
ref|XP_004500365.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      207   1e-55    
gb|KFK31572.1|  hypothetical protein AALP_AA6G129600                    207   1e-55    
dbj|BAF56239.1|  cytochrome P450 enzyme                                 207   1e-55    
ref|XP_010452477.1|  PREDICTED: cytochrome P450 90A1                    207   1e-55    
ref|XP_004512039.1|  PREDICTED: cytochrome P450 90B1-like isoform X2    207   1e-55    
ref|XP_002518804.1|  cytochrome P450, putative                          206   1e-55    
gb|KCW71158.1|  hypothetical protein EUGRSUZ_F04255                     200   1e-55    
sp|Q05JG2.1|ABAH1_ORYSJ  RecName: Full=Abscisic acid 8'-hydroxyla...    206   1e-55    
ref|XP_004240946.1|  PREDICTED: cytochrome P450 90A1                    207   1e-55    
ref|XP_004301170.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       206   2e-55    
ref|XP_008241479.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      206   2e-55    
ref|XP_009398465.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     207   2e-55    
ref|XP_008438234.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       207   2e-55    
ref|XP_010923918.1|  PREDICTED: cytochrome P450 716B2-like              206   2e-55    
gb|AAK11565.1|AF318501_1  ent-kaurenoic acid hydroxylase                207   2e-55    
ref|XP_004512038.1|  PREDICTED: cytochrome P450 90B1-like isoform X1    207   2e-55    
ref|XP_010275286.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       207   2e-55    
gb|AFP74115.1|  ABA 8'-hydroxylase CYP707A2                             206   2e-55    
ref|XP_010494633.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     206   2e-55    
ref|XP_010481600.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     206   2e-55    
ref|XP_007039557.1|  Ent-kaurenoic acid hydroxylase 2                   207   2e-55    
emb|CDX83755.1|  BnaC08g18900D                                          197   2e-55    
ref|XP_004300683.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     206   2e-55    
ref|XP_010506129.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      206   2e-55    
ref|XP_004305825.1|  PREDICTED: cytochrome P450 716B1-like              206   2e-55    
gb|AFA52657.1|  abscisic acid 8'-hydroxylase                            206   2e-55    
ref|XP_010423443.1|  PREDICTED: cytochrome P450 90A1-like               206   2e-55    
ref|XP_010060379.1|  PREDICTED: cytochrome P450 716B1-like              206   3e-55    
ref|NP_172008.1|  ent-kaurenoic acid oxidase 1                          206   3e-55    
ref|XP_006375612.1|  hypothetical protein POPTR_0014s17720g             204   3e-55    
ref|XP_007011311.1|  Cytochrome P450, putative                          211   3e-55    
ref|XP_010440783.1|  PREDICTED: beta-amyrin 28-oxidase-like             206   3e-55    
emb|CDJ80018.1|  ABA 8'-hydroxylase                                     206   3e-55    
ref|NP_001169802.1|  putative cytochrome P450 superfamily protein...    206   3e-55    
ref|XP_009612478.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     206   3e-55    
gb|KHG19443.1|  Abscisic acid 8'-hydroxylase 1 -like protein            204   3e-55    
ref|XP_004153984.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       204   3e-55    
gb|AJD25254.1|  cytochrome P450 CYP728D17                               206   3e-55    
ref|XP_010323137.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    204   3e-55    
ref|XP_008346457.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     206   3e-55    
emb|CBI16745.3|  unnamed protein product                                204   3e-55    
gb|KFK28590.1|  hypothetical protein AALP_AA7G017200                    205   3e-55    
gb|KHN41770.1|  Abscisic acid 8'-hydroxylase 1                          205   4e-55    
gb|AAK11564.1|AF318500_1  ent-kaurenoic acid hydroxylase                206   4e-55    
ref|XP_009113867.1|  PREDICTED: abscisic acid 8'-hydroxylase 3          205   4e-55    
ref|XP_007163533.1|  hypothetical protein PHAVU_001G242200g             205   4e-55    
ref|XP_011001398.1|  PREDICTED: taxane 13-alpha-hydroxylase-like        206   4e-55    
gb|KCW89702.1|  hypothetical protein EUGRSUZ_A01964                     204   4e-55    
ref|XP_003538851.1|  PREDICTED: cytochrome P450 90B1-like               206   4e-55    
emb|CDY13061.1|  BnaA09g17560D                                          205   4e-55    
ref|XP_010907100.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-li...    205   4e-55    
gb|AAF89209.1|AF279252_1  cytochrome P450                               205   4e-55    
dbj|BAN15742.1|  ABA 8'-hydroxylase                                     205   5e-55    
ref|XP_010941218.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       206   5e-55    
ref|XP_010252179.1|  PREDICTED: beta-amyrin 28-oxidase-like             205   5e-55    
ref|XP_009334824.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    205   6e-55    
ref|XP_010450437.1|  PREDICTED: beta-amyrin 28-oxidase-like             205   6e-55    
ref|XP_004172432.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       204   6e-55    
ref|XP_007040870.1|  Abscisic acid 8'-hydroxylase 1                     207   6e-55    
ref|NP_001237490.1|  abscisic acid 8'-hydroxylase                       205   6e-55    
ref|XP_003561220.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    206   6e-55    
ref|XP_007009007.1|  Cytochrome P450 superfamily protein isoform 1      205   6e-55    
ref|XP_008797969.1|  PREDICTED: abscisic acid 8'-hydroxylase 1          205   6e-55    
ref|XP_007210577.1|  hypothetical protein PRUPE_ppa005059mg             205   6e-55    
ref|XP_002868459.1|  CYP716A1                                           205   6e-55    
ref|XP_010043506.1|  PREDICTED: abscisic acid 8'-hydroxylase 2          206   7e-55    
emb|CDP12987.1|  unnamed protein product                                205   7e-55    
ref|XP_002462489.1|  hypothetical protein SORBIDRAFT_02g026600          205   7e-55    
ref|XP_010256885.1|  PREDICTED: abscisic acid 8'-hydroxylase 2-like     205   7e-55    
emb|CDP07213.1|  unnamed protein product                                204   7e-55    
gb|ABB47392.1|  Cytochrome P450 family protein, expressed               205   7e-55    
ref|NP_001063366.1|  Os09g0457100                                       205   8e-55    
ref|XP_006385155.1|  cytochrome P450 family protein                     204   8e-55    
ref|XP_006359952.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-li...    204   9e-55    
ref|NP_567581.1|  abscisic acid 8'-hydroxylase 1                        204   9e-55    
ref|XP_002280969.1|  PREDICTED: beta-amyrin 28-oxidase                  204   9e-55    
gb|KEH37117.1|  cytochrome P450 family ent-kaurenoic acid oxidase       204   9e-55    
ref|XP_009358120.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       204   1e-54    
sp|A2Z212.1|ABAH3_ORYSI  RecName: Full=Abscisic acid 8'-hydroxyla...    205   1e-54    
ref|XP_009374386.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      204   1e-54    
ref|XP_009137004.1|  PREDICTED: abscisic acid 8'-hydroxylase 1          204   1e-54    
gb|KDO72259.1|  hypothetical protein CISIN_1g038621mg                   204   1e-54    
ref|XP_010475187.1|  PREDICTED: ent-kaurenoic acid oxidase 1            204   1e-54    
ref|NP_001268115.1|  cytochrome P450 CYP716A15                          204   1e-54    
gb|EYU37482.1|  hypothetical protein MIMGU_mgv1a006536mg                203   1e-54    
ref|XP_002972057.1|  hypothetical protein SELMODRAFT_96503              204   1e-54    
ref|XP_008457111.1|  PREDICTED: cytochrome P450 716B1-like              204   1e-54    
ref|XP_009767637.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     204   1e-54    
ref|XP_006430894.1|  hypothetical protein CICLE_v10011655mg             204   1e-54    
dbj|BAN15043.1|  putative cytochrome P450 monooxygenase CYP88D7         204   1e-54    
gb|KGN47995.1|  hypothetical protein Csa_6G423370                       203   1e-54    
ref|XP_010457591.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    204   1e-54    
ref|XP_006376949.1|  hypothetical protein POPTR_0012s11470g             204   1e-54    
gb|EEC66846.1|  hypothetical protein OsI_33321                          204   1e-54    
ref|XP_009770822.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     204   1e-54    
gb|ABC86558.1|  abscisic acid 8'-hydroxylase                            204   1e-54    
emb|CDY23132.1|  BnaC09g18860D                                          204   1e-54    
ref|XP_006573760.1|  PREDICTED: cytochrome P450 87A3-like               204   1e-54    
gb|EMT32327.1|  Abscisic acid 8'-hydroxylase 1                          199   1e-54    
ref|XP_010922745.1|  PREDICTED: taxane 13-alpha-hydroxylase-like        204   1e-54    
ref|NP_001064479.1|  Os10g0378100                                       205   1e-54    
ref|XP_008345868.1|  PREDICTED: cytochrome P450 716B1-like              203   2e-54    
emb|CDY68433.1|  BnaAnng27240D                                          204   2e-54    
ref|XP_008373932.1|  PREDICTED: cytochrome P450 90A1-like isoform X2    204   2e-54    
ref|XP_011028493.1|  PREDICTED: abscisic acid 8'-hydroxylase 1          204   2e-54    
ref|XP_004953596.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     204   2e-54    
ref|XP_002987404.1|  hypothetical protein SELMODRAFT_126145             204   2e-54    
ref|XP_010536060.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     203   2e-54    
ref|XP_011097890.1|  PREDICTED: cytochrome P450 716B1-like isofor...    204   2e-54    
ref|XP_007158078.1|  hypothetical protein PHAVU_002G122200g             203   2e-54    
ref|NP_851136.1|  abscisic acid 8'-hydroxylase 3                        203   2e-54    
ref|XP_010457593.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    204   2e-54    
ref|XP_007210937.1|  hypothetical protein PRUPE_ppa025181mg             203   2e-54    
ref|XP_010510536.1|  PREDICTED: abscisic acid 8'-hydroxylase 2          204   2e-54    
ref|XP_009132702.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like     203   2e-54    
ref|XP_007147425.1|  hypothetical protein PHAVU_006G123500g             203   2e-54    
gb|KFK23969.1|  hypothetical protein AALP_AAs58682U000100               203   3e-54    
ref|XP_004509297.1|  PREDICTED: cytochrome P450 90B1-like               203   3e-54    
ref|XP_010053586.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       204   3e-54    
dbj|BAG12742.1|  ABA 8-oxidase                                          203   3e-54    
ref|XP_004296016.1|  PREDICTED: taxadiene 5-alpha hydroxylase-like      203   3e-54    



>ref|XP_009798487.1| PREDICTED: abscisic acid 8'-hydroxylase 1-like [Nicotiana sylvestris]
Length=486

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/488 (77%), Positives = 420/488 (86%), Gaps = 7/488 (1%)
 Frame = -2

Query  1776  LRMVFGSMVSHYYYDVFLGLLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLS  1597
             L M +  ++   YYD+ L  ++ I I +Y + G+T  +KSCI PG LGIPF+GETF+LLS
Sbjct  4     LSMEYILLLVRNYYDILLASILFISITLYKVSGRTKDAKSCI-PGSLGIPFVGETFALLS  62

Query  1596  ATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSM  1417
             ATNS KGCYDFVR RR WHG+WFKTRIFGKIHVFVPSV+GAKTIF NDF LFNKGYVKSM
Sbjct  63    ATNSVKGCYDFVRLRREWHGKWFKTRIFGKIHVFVPSVEGAKTIFTNDFTLFNKGYVKSM  122

Query  1416  ADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTV  1237
             ADAVGKKSLLCVP ESHKRIRRLLSDPFSMNSLS FVQ+FD ML +RL++  + GK FTV
Sbjct  123   ADAVGKKSLLCVPQESHKRIRRLLSDPFSMNSLSKFVQRFDNMLSERLKKVQKEGKRFTV  182

Query  1236  LDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGR  1057
             LDFNMKITFDAMC+MLMSI D  LL +IERDC+ VSDAMLSFPVMIP TRYYKGIKAR R
Sbjct  183   LDFNMKITFDAMCDMLMSIKDALLLEQIERDCTAVSDAMLSFPVMIPTTRYYKGIKARTR  242

Query  1056  LMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAG  877
             LMETFK +I SRR     G E  ED  FLQ MLE+DS P ++KL+DEEIMDNLLTLIIAG
Sbjct  243   LMETFKAMITSRRN----GKEYHED--FLQSMLEKDSCPVNQKLDDEEIMDNLLTLIIAG  296

Query  876   QTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKET  697
             QTTTAAAMMWSVK L E+ E+Q+RLREEQ+SIL++KP GAL+TL+DLN+M+YASKVVKET
Sbjct  297   QTTTAAAMMWSVKFLHEHGEVQDRLREEQISILKSKPNGALLTLDDLNSMSYASKVVKET  356

Query  696   LRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQ  517
             LRMSNVLLWFPRVALD+C IEGF+IKKGWH NIDA+CIHYDPA+YKDP  FNPSRFDEMQ
Sbjct  357   LRMSNVLLWFPRVALDDCNIEGFEIKKGWHANIDASCIHYDPALYKDPMQFNPSRFDEMQ  416

Query  516   RPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGC  337
             +PYSYIPFGSGPRTCLGINMAKVTMLV+LHRLTS YKW VDD DPSLERKAHIPRLRSGC
Sbjct  417   KPYSYIPFGSGPRTCLGINMAKVTMLVFLHRLTSGYKWKVDDLDPSLERKAHIPRLRSGC  476

Query  336   PITLTAFN  313
             PITLT   
Sbjct  477   PITLTVLQ  484



>ref|XP_009605545.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Nicotiana tomentosiformis]
Length=488

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/478 (78%), Positives = 417/478 (87%), Gaps = 9/478 (2%)
 Frame = -2

Query  1740  YYDVFLGLLVGIGIAVYL--LRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYD  1567
             YYD+ L  ++ I I +YL  + G+   +KSCI PG LGIPF+GETF+LLSATNS KGCYD
Sbjct  16    YYDILLASILVISITLYLSKVSGKPKDAKSCI-PGSLGIPFVGETFALLSATNSVKGCYD  74

Query  1566  FVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLL  1387
             FVR RR WHG+WFKTRIFGKIHVFVPSV+GAKTIF NDF LFNKGYVKSMADAVGKKSLL
Sbjct  75    FVRLRREWHGKWFKTRIFGKIHVFVPSVEGAKTIFTNDFTLFNKGYVKSMADAVGKKSLL  134

Query  1386  CVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFD  1207
             CVP ESHKRIRRLLSDPFSM+SLS FVQ+FD MLC+RL++  + GKSFTVLDFNMKITFD
Sbjct  135   CVPQESHKRIRRLLSDPFSMHSLSKFVQRFDNMLCERLKKVQKEGKSFTVLDFNMKITFD  194

Query  1206  AMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIID  1027
             AMC+MLMSI D SLL +IERDC+ VSDAMLSFPVMIP TRYYKGIKAR RLMETF  +I 
Sbjct  195   AMCDMLMSIKDASLLEQIERDCTAVSDAMLSFPVMIPTTRYYKGIKARTRLMETFNAMIT  254

Query  1026  SRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMW  847
             +RR     G E  ED  FLQ MLE+DS P ++KL+DEEIMDNLLTLIIAGQTTTAAAMMW
Sbjct  255   NRRN----GKEYHED--FLQSMLEKDSCPANQKLDDEEIMDNLLTLIIAGQTTTAAAMMW  308

Query  846   SVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWF  667
             SVK L E+ E+Q+RLREEQ+SILRNKP GAL+TL+DLN+M+YASKVVKETLRMSNVLLWF
Sbjct  309   SVKFLHEHGEVQDRLREEQISILRNKPNGALLTLDDLNSMSYASKVVKETLRMSNVLLWF  368

Query  666   PRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGS  487
             PRVALD+C IE F+IKKGWH NIDATCIHYDPA+YKDP  FNPSRFDEMQ+PYSYIPFGS
Sbjct  369   PRVALDDCNIEDFEIKKGWHANIDATCIHYDPALYKDPMQFNPSRFDEMQKPYSYIPFGS  428

Query  486   GPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFN  313
             G RTCLGINMAKVTMLV+LHRLTS Y+W+VDDPDPSLE+KAHIPRLRSGCPITLT   
Sbjct  429   GLRTCLGINMAKVTMLVFLHRLTSGYEWTVDDPDPSLEKKAHIPRLRSGCPITLTVLQ  486



>ref|XP_006340657.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Solanum tuberosum]
Length=486

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/477 (78%), Positives = 418/477 (88%), Gaps = 9/477 (2%)
 Frame = -2

Query  1740  YYDVFLGLLVGIGI-AVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDF  1564
             YYD+ L  ++ I I A+YL +G     K+CI PG LGIPF+GETF+LLSATNS KGCY+F
Sbjct  16    YYDILLVSILVISITALYLSKGAK-NEKNCI-PGSLGIPFVGETFALLSATNSVKGCYEF  73

Query  1563  VRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLC  1384
             VR RR WHG+WFKTRIFGKIHVFVPSV+GAK IF NDFALFNKGYVKSMADAVGKKSLLC
Sbjct  74    VRLRREWHGKWFKTRIFGKIHVFVPSVEGAKAIFTNDFALFNKGYVKSMADAVGKKSLLC  133

Query  1383  VPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDA  1204
             VP ESHKRIRRLLSDPFSMNSLS FVQ+FD+ML +RL++  + GKSFTVLDFNMKITFDA
Sbjct  134   VPQESHKRIRRLLSDPFSMNSLSKFVQRFDKMLYERLKKVQKEGKSFTVLDFNMKITFDA  193

Query  1203  MCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDS  1024
             MC+MLMSI D SLL +IE+DC+ +SDAMLSFPVMIPGTRY+KGIKARGRLMETFK +I +
Sbjct  194   MCDMLMSIKDSSLLEQIEKDCTAISDAMLSFPVMIPGTRYFKGIKARGRLMETFKGMITA  253

Query  1023  RRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWS  844
             RR     G E  ED  FLQ MLE+DS P ++ L+DEEIMDNLLTLIIAGQTTTAAAMMWS
Sbjct  254   RRN----GKEYYED--FLQSMLEKDSCPANQMLDDEEIMDNLLTLIIAGQTTTAAAMMWS  307

Query  843   VKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFP  664
             VK LDE+   QNRLREEQLSILR+KP GAL+T++DLN+M+YASKVVKETLRMSNVLLWFP
Sbjct  308   VKFLDEHRGAQNRLREEQLSILRSKPNGALLTMDDLNSMSYASKVVKETLRMSNVLLWFP  367

Query  663   RVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSG  484
             RVAL++C IEGF+IKKGWH NIDATCIHYDP +YKDP  FNPSRFDE+Q+PYSYIPFGSG
Sbjct  368   RVALNDCSIEGFEIKKGWHANIDATCIHYDPTVYKDPMQFNPSRFDEIQKPYSYIPFGSG  427

Query  483   PRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFN  313
             PRTCLGINMAKVTMLV+LHRLT+ YKW+VDDPD SLERKAHIPRLRSGCPITLTA  
Sbjct  428   PRTCLGINMAKVTMLVFLHRLTTGYKWTVDDPDRSLERKAHIPRLRSGCPITLTALQ  484



>ref|XP_004232430.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Solanum lycopersicum]
Length=486

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/476 (78%), Positives = 417/476 (88%), Gaps = 9/476 (2%)
 Frame = -2

Query  1740  YYDVFLGLLVGIGI-AVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDF  1564
             YYD+ L  ++ I I A+YL +G    +KSCI PG LGIPF+GETF+LLSATNS KGCY+F
Sbjct  16    YYDILLVSILVISITALYLSKGAK-NAKSCI-PGSLGIPFVGETFALLSATNSVKGCYEF  73

Query  1563  VRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLC  1384
             VR RR  HG+WFKTRIFGKIHVFVPSV+GAK IF NDFALFNKGYVKSMADAVGKKSLLC
Sbjct  74    VRLRRERHGKWFKTRIFGKIHVFVPSVEGAKAIFTNDFALFNKGYVKSMADAVGKKSLLC  133

Query  1383  VPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDA  1204
             VP ESHKRIRRLLSDPFSMNSLS FVQ+FD ML +RL++  +  KSFTVLDFNMK TFDA
Sbjct  134   VPQESHKRIRRLLSDPFSMNSLSKFVQRFDEMLYERLKKVQKQRKSFTVLDFNMKTTFDA  193

Query  1203  MCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDS  1024
             MC+MLMSI D S++ +IE+DC+ +SDAMLSFPVMIPGTRY+KGIKARGRLMETFK +I +
Sbjct  194   MCDMLMSIKDSSVVEQIEKDCTAISDAMLSFPVMIPGTRYFKGIKARGRLMETFKGMIAA  253

Query  1023  RRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWS  844
             RR     G E  ED  FLQ MLE+DS P ++KL+DEEIMDNLLTLIIAGQTTTAAAMMWS
Sbjct  254   RRN----GKEYYED--FLQSMLEKDSCPANQKLDDEEIMDNLLTLIIAGQTTTAAAMMWS  307

Query  843   VKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFP  664
             VK LDE+ E QNRLREEQLSILR+KP GAL+T++DLN+M+YASKVVKETLRMSNVLLWFP
Sbjct  308   VKFLDEHREAQNRLREEQLSILRSKPTGALLTMDDLNSMSYASKVVKETLRMSNVLLWFP  367

Query  663   RVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSG  484
             RVAL++C IEGF+IKKGWH NIDATCIHYDP +YKDP  FNPSRFDE+Q+PYSYIPFGSG
Sbjct  368   RVALNDCSIEGFEIKKGWHANIDATCIHYDPTLYKDPMQFNPSRFDEIQKPYSYIPFGSG  427

Query  483   PRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAF  316
             PRTCLGINMAKVTMLV+LHRLT+ YKW+VDDPD SLERKAHIPRLRSGCPITLTA 
Sbjct  428   PRTCLGINMAKVTMLVFLHRLTTGYKWTVDDPDRSLERKAHIPRLRSGCPITLTAL  483



>emb|CDP01982.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/480 (76%), Positives = 409/480 (85%), Gaps = 9/480 (2%)
 Frame = -2

Query  1755  MVSHYYYDVFLGLLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKG  1576
             ++ +Y+Y + L  ++ +G+ V L +G T R KS I PG LGIPFLGET S LSA NS KG
Sbjct  9     LLGNYHY-ILLASVLALGVTVLLSKG-TKRGKSGI-PGSLGIPFLGETLSFLSANNSNKG  65

Query  1575  CYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKK  1396
             CY+FVR RR W+G+WFKTRIFGKIHV+VPSVDGAKTIFANDFALFNKGYVKSMADAVGK 
Sbjct  66    CYEFVRLRRSWYGKWFKTRIFGKIHVYVPSVDGAKTIFANDFALFNKGYVKSMADAVGKN  125

Query  1395  SLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKI  1216
             SLLCVPHESH+RIRRLLS+PFSMNSLS FVQK D ML +RLE+  R G+SF VLDFNMK+
Sbjct  126   SLLCVPHESHRRIRRLLSEPFSMNSLSKFVQKIDCMLSKRLEKLERDGQSFVVLDFNMKM  185

Query  1215  TFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKT  1036
             TFDAMC+MLMS+TD SLL +IER C+ VSDAMLSFPVM PGTRYYKGIKAR RLMETFK 
Sbjct  186   TFDAMCDMLMSVTDASLLEQIERHCTAVSDAMLSFPVMTPGTRYYKGIKARRRLMETFKG  245

Query  1035  IIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAA  856
             +I  RR        S    DFLQ ML+RD +P++EKL DEEIMDNLLTLIIAGQTTTAAA
Sbjct  246   MIACRR------TGSRHPEDFLQSMLQRDQYPDNEKLSDEEIMDNLLTLIIAGQTTTAAA  299

Query  855   MMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVL  676
             MMWSVK LDE+  +Q+RLREEQLSILRNKP GAL+TLEDLN M+YASKVVKETLRMSN+L
Sbjct  300   MMWSVKFLDEHQGVQDRLREEQLSILRNKPNGALLTLEDLNNMSYASKVVKETLRMSNIL  359

Query  675   LWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIP  496
             LWFPRVALDNC IEGF+IKKGWHVN+DATCIH DP IYKDP  FNPSRFDEMQ+PYSYIP
Sbjct  360   LWFPRVALDNCTIEGFEIKKGWHVNVDATCIHQDPEIYKDPMLFNPSRFDEMQKPYSYIP  419

Query  495   FGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAF  316
             FGSGPRTCLGINMAK+TMLV+LHRLT+ Y W+VDD DP LE KAHIPRLRSGCPITL A 
Sbjct  420   FGSGPRTCLGINMAKLTMLVFLHRLTTGYMWTVDDLDPHLEGKAHIPRLRSGCPITLMAL  479



>ref|XP_010029758.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like isoform X4 [Eucalyptus 
grandis]
 gb|KCW56712.1| hypothetical protein EUGRSUZ_I02403 [Eucalyptus grandis]
Length=486

 Score =   752 bits (1942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/475 (74%), Positives = 405/475 (85%), Gaps = 6/475 (1%)
 Frame = -2

Query  1740  YYDVFLGLLVGIGIAVYL-LRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDF  1564
             YYDV   +LV +G   Y   + + +  +   IPG+LG+PF+GETFS LSATNSTKGCY+F
Sbjct  16    YYDVLFAVLVSVGFMFYFSAKAKKISGERDHIPGRLGVPFVGETFSFLSATNSTKGCYEF  75

Query  1563  VRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLC  1384
             VR RRLW+G+WFKTRIFGK+HVF+P+  GAKT+FA+DFA FNKGYVKSMADAVGKKSLLC
Sbjct  76    VRLRRLWYGKWFKTRIFGKVHVFIPTTGGAKTVFASDFAQFNKGYVKSMADAVGKKSLLC  135

Query  1383  VPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDA  1204
             VPHESHKRIR LLSDPFSM SLS FV KFD+MLCQRL++    GK F VLDFNMKI FDA
Sbjct  136   VPHESHKRIRHLLSDPFSMPSLSKFVTKFDKMLCQRLKKLEEHGKRFVVLDFNMKIAFDA  195

Query  1203  MCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDS  1024
             MC MLMS+T+ S+L++IE+DC+ VS+AMLSFPVMIPGTRYY+GIKAR RLMETF+ +I+ 
Sbjct  196   MCEMLMSVTEESMLQQIEKDCTDVSNAMLSFPVMIPGTRYYRGIKARNRLMETFREMIEE  255

Query  1023  RRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWS  844
             RR   GRG  + ED  FLQ ML+RDS P  EKL+D EIMDNLLTLIIAGQTTTAAAMMWS
Sbjct  256   RR---GRGKGAPED--FLQSMLDRDSLPPEEKLDDSEIMDNLLTLIIAGQTTTAAAMMWS  310

Query  843   VKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFP  664
             VK LDEN E Q+RLREEQL+ILR KP+GA +TLEDLN+M+Y  KV KETLRMSNVLLW+P
Sbjct  311   VKFLDENPEAQDRLREEQLAILRKKPQGAALTLEDLNSMSYGLKVAKETLRMSNVLLWYP  370

Query  663   RVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSG  484
             RVA+ +C IEG  IKKGWHVN+DATCIHYDP+IYKDP  FNPSRFDEMQ+PYS+IPFGSG
Sbjct  371   RVAITDCTIEGHSIKKGWHVNVDATCIHYDPSIYKDPVQFNPSRFDEMQKPYSFIPFGSG  430

Query  483   PRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTA  319
             PRTCLG+NMAKVTML +LHRLTS Y+W+VDDPD SLE+KAHIPRLRSGCPITL A
Sbjct  431   PRTCLGMNMAKVTMLAFLHRLTSGYRWTVDDPDTSLEKKAHIPRLRSGCPITLKA  485



>ref|XP_010029757.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like isoform X3 [Eucalyptus 
grandis]
Length=521

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/510 (69%), Positives = 405/510 (79%), Gaps = 41/510 (8%)
 Frame = -2

Query  1740  YYDVFLGLLVGIGIAVYL-LRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDF  1564
             YYDV   +LV +G   Y   + + +  +   IPG+LG+PF+GETFS LSATNSTKGCY+F
Sbjct  16    YYDVLFAVLVSVGFMFYFSAKAKKISGERDHIPGRLGVPFVGETFSFLSATNSTKGCYEF  75

Query  1563  VRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLC  1384
             VR RRLW+G+WFKTRIFGK+HVF+P+  GAKT+FA+DFA FNKGYVKSMADAVGKKSLLC
Sbjct  76    VRLRRLWYGKWFKTRIFGKVHVFIPTTGGAKTVFASDFAQFNKGYVKSMADAVGKKSLLC  135

Query  1383  VPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDA  1204
             VPHESHKRIR LLSDPFSM SLS FV KFD+MLCQRL++    GK F VLDFNMKI FDA
Sbjct  136   VPHESHKRIRHLLSDPFSMPSLSKFVTKFDKMLCQRLKKLEEHGKRFVVLDFNMKIAFDA  195

Query  1203  MCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDS  1024
             MC MLMS+T+ S+L++IE+DC+ VS+AMLSFPVMIPGTRYY+GIKAR RLMETF+ +I+ 
Sbjct  196   MCEMLMSVTEESMLQQIEKDCTDVSNAMLSFPVMIPGTRYYRGIKARNRLMETFREMIEE  255

Query  1023  RRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWS  844
             RR   GRG  + E  DFLQ ML+RDS P  EKL+D EIMDNLLTLIIAGQTTTAAAMMWS
Sbjct  256   RR---GRGKGAPE--DFLQSMLDRDSLPPEEKLDDSEIMDNLLTLIIAGQTTTAAAMMWS  310

Query  843   VKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASK----------------  712
             VK LDEN E Q+RLREEQL+ILR KP+GA +TLEDLN+M+Y  K                
Sbjct  311   VKFLDENPEAQDRLREEQLAILRKKPQGAALTLEDLNSMSYGLKVTISLSHAWVQILTSF  370

Query  711   -------------------VVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDAT  589
                                V KETLRMSNVLLW+PRVA+ +C IEG  IKKGWHVN+DAT
Sbjct  371   HGQCGMCDQSNADILMKFQVAKETLRMSNVLLWYPRVAITDCTIEGHSIKKGWHVNVDAT  430

Query  588   CIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRY  409
             CIHYDP+IYKDP  FNPSRFDEMQ+PYS+IPFGSGPRTCLG+NMAKVTML +LHRLTS Y
Sbjct  431   CIHYDPSIYKDPVQFNPSRFDEMQKPYSFIPFGSGPRTCLGMNMAKVTMLAFLHRLTSGY  490

Query  408   KWSVDDPDPSLERKAHIPRLRSGCPITLTA  319
             +W+VDDPD SLE+KAHIPRLRSGCPITL A
Sbjct  491   RWTVDDPDTSLEKKAHIPRLRSGCPITLKA  520



>ref|XP_010029756.1| PREDICTED: cytochrome P450 90A1-like isoform X2 [Eucalyptus grandis]
Length=525

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/514 (68%), Positives = 405/514 (79%), Gaps = 45/514 (9%)
 Frame = -2

Query  1740  YYDVFLGLLVGIGIAVYL-LRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDF  1564
             YYDV   +LV +G   Y   + + +  +   IPG+LG+PF+GETFS LSATNSTKGCY+F
Sbjct  16    YYDVLFAVLVSVGFMFYFSAKAKKISGERDHIPGRLGVPFVGETFSFLSATNSTKGCYEF  75

Query  1563  VRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLC  1384
             VR RRLW+G+WFKTRIFGK+HVF+P+  GAKT+FA+DFA FNKGYVKSMADAVGKKSLLC
Sbjct  76    VRLRRLWYGKWFKTRIFGKVHVFIPTTGGAKTVFASDFAQFNKGYVKSMADAVGKKSLLC  135

Query  1383  VPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDA  1204
             VPHESHKRIR LLSDPFSM SLS FV KFD+MLCQRL++    GK F VLDFNMKI FDA
Sbjct  136   VPHESHKRIRHLLSDPFSMPSLSKFVTKFDKMLCQRLKKLEEHGKRFVVLDFNMKIAFDA  195

Query  1203  MCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDS  1024
             MC MLMS+T+ S+L++IE+DC+ VS+AMLSFPVMIPGTRYY+GIKAR RLMETF+ +I+ 
Sbjct  196   MCEMLMSVTEESMLQQIEKDCTDVSNAMLSFPVMIPGTRYYRGIKARNRLMETFREMIEE  255

Query  1023  RRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWS  844
             RR   GRG  + E  DFLQ ML+RDS P  EKL+D EIMDNLLTLIIAGQTTTAAAMMWS
Sbjct  256   RR---GRGKGAPE--DFLQSMLDRDSLPPEEKLDDSEIMDNLLTLIIAGQTTTAAAMMWS  310

Query  843   VKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFP  664
             VK LDEN E Q+RLREEQL+ILR KP+GA +TLEDLN+M+Y  KV KETLRMSNVLLW+P
Sbjct  311   VKFLDENPEAQDRLREEQLAILRKKPQGAALTLEDLNSMSYGLKVAKETLRMSNVLLWYP  370

Query  663   RVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFD--------------  526
             RVA+ +C IEG  IKKGWHVN+DATCIHYDP+IYKDP  FNPSRFD              
Sbjct  371   RVAITDCTIEGHSIKKGWHVNVDATCIHYDPSIYKDPVQFNPSRFDVNMPSSPPFVSLSC  430

Query  525   -------------------------EMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRL  421
                                      EMQ+PYS+IPFGSGPRTCLG+NMAKVTML +LHRL
Sbjct  431   NFLDQHVTDEHFKALTIALPATNLQEMQKPYSFIPFGSGPRTCLGMNMAKVTMLAFLHRL  490

Query  420   TSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTA  319
             TS Y+W+VDDPD SLE+KAHIPRLRSGCPITL A
Sbjct  491   TSGYRWTVDDPDTSLEKKAHIPRLRSGCPITLKA  524



>ref|XP_004287873.1| PREDICTED: abscisic acid 8'-hydroxylase 1-like [Fragaria vesca 
subsp. vesca]
Length=481

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/475 (71%), Positives = 399/475 (84%), Gaps = 9/475 (2%)
 Frame = -2

Query  1740  YYDVFLGLLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFV  1561
             +Y+ F+  ++ IG+   + +   +  K+  I G+LG+PF+GETFS LSATNSTKGCY+FV
Sbjct  16    HYETFILAVLSIGVTFLVCK---LGWKTVAIRGRLGLPFIGETFSFLSATNSTKGCYEFV  72

Query  1560  RTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCV  1381
             R RR W+G+WFKTRIFGKIHVFVPS DGAK IF+NDFA FNKGYVKSMAD VGK SLLCV
Sbjct  73    RLRRQWYGKWFKTRIFGKIHVFVPSTDGAKFIFSNDFAKFNKGYVKSMADCVGKNSLLCV  132

Query  1380  PHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAM  1201
             PHE H+RIRRLLSDPFSMNSLS FVQKFD+MLCQ+L++    GKSF VL+F+MK+TFDAM
Sbjct  133   PHEKHRRIRRLLSDPFSMNSLSQFVQKFDKMLCQKLKKLEEGGKSFVVLEFSMKMTFDAM  192

Query  1200  CNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSR  1021
             C+ML S+T+ SLLR+IE+DC+T+SDAMLS PVMIPGTRYYKGIKAR RLM TFK +ID R
Sbjct  193   CSMLASVTEDSLLRKIEKDCNTISDAMLSIPVMIPGTRYYKGIKARRRLMTTFKNMIDRR  252

Query  1020  RRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSV  841
             R      N  +   DFLQ ML++DS+P +EKL+D EIMDNLLTLIIAGQTTTAAA+MWSV
Sbjct  253   R------NRKEYREDFLQSMLDKDSYPPNEKLQDSEIMDNLLTLIIAGQTTTAAAIMWSV  306

Query  840   KLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPR  661
             K LDEN E Q+RLREEQLSI ++KP  + +TLED+  M+Y  KVVKETLRM+NVLLWFPR
Sbjct  307   KFLDENKEAQDRLREEQLSISKSKPAKSSVTLEDIKDMSYCLKVVKETLRMANVLLWFPR  366

Query  660   VALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGP  481
             +AL +C I+GF+IKKGWH NIDATCIHYDP +Y +P  FNP RFDEMQ+PYS+IPFGSGP
Sbjct  367   IALSDCTIQGFEIKKGWHANIDATCIHYDPDLYAEPMQFNPDRFDEMQKPYSFIPFGSGP  426

Query  480   RTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAF  316
             RTCLGINMAKVTMLV+LHRLTS Y+W+VDD D SLE+KAHIPRLRSGCPITL A 
Sbjct  427   RTCLGINMAKVTMLVFLHRLTSGYRWTVDDLDTSLEKKAHIPRLRSGCPITLKAL  481



>gb|KGN48862.1| hypothetical protein Csa_6G504430 [Cucumis sativus]
Length=484

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/478 (72%), Positives = 402/478 (84%), Gaps = 8/478 (2%)
 Frame = -2

Query  1752  VSHYYYDVFLGLLVGIGIAVYLLR-GQTVRSKS-CIIPGKLGIPFLGETFSLLSATNSTK  1579
             ++  Y++  +  L+ I + V + +    VRSK+   IPG LG+PF+GETFS LSA NST+
Sbjct  10    IAQMYFNPTVAALLSIAVLVLVSKVWWRVRSKNDGGIPGYLGLPFVGETFSFLSANNSTR  69

Query  1578  GCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGK  1399
             GCY FVR RRLWHGRWFKTR+FGKIHVFVPS +GAK IF+NDF  FNKGYVKSM DAVG+
Sbjct  70    GCYHFVRLRRLWHGRWFKTRLFGKIHVFVPSAEGAKAIFSNDFVQFNKGYVKSMGDAVGE  129

Query  1398  KSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMK  1219
             KSLLCV HE+H+RIRRLLSDPFSM SLS FV++FD ML +RL++  + GKSF +LDF+MK
Sbjct  130   KSLLCVSHENHRRIRRLLSDPFSMTSLSKFVKEFDDMLSKRLKKLEKDGKSFVLLDFSMK  189

Query  1218  ITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFK  1039
             ITFD++CNMLMS+ D S LR+IE+DC+ VS+AMLSFP MIPGTRYYKGIKAR RLMETF+
Sbjct  190   ITFDSICNMLMSLRDESTLRQIEKDCTAVSEAMLSFPFMIPGTRYYKGIKARKRLMETFR  249

Query  1038  TIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAA  859
              II  RRR    G ES ED  FL+ ML+RDS+P +EKL+D EIMDNLLTLIIAGQTTTAA
Sbjct  250   EIISRRRR----GEESPED--FLESMLQRDSYPSNEKLDDSEIMDNLLTLIIAGQTTTAA  303

Query  858   AMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNV  679
             AMMW +K LDEN E Q RLREEQLSIL+ K  G L+TLEDL  M+Y SKVVKETLRMSNV
Sbjct  304   AMMWCIKFLDENKEAQERLREEQLSILQKKEDGELLTLEDLKKMSYGSKVVKETLRMSNV  363

Query  678   LLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYI  499
             LLWFPRVAL +C++E F+IKKGWHVNIDATCIHYDP +YKDP  FNPSRFDE+Q+PYS+I
Sbjct  364   LLWFPRVALGDCRLEDFEIKKGWHVNIDATCIHYDPDVYKDPMKFNPSRFDEIQKPYSFI  423

Query  498   PFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITL  325
             PFGSGPRTCLGINMAK+TMLV+LHR+T  Y+W+VDDPDPSLE+KAHIPRLRSGCPITL
Sbjct  424   PFGSGPRTCLGINMAKLTMLVFLHRMTGGYRWTVDDPDPSLEKKAHIPRLRSGCPITL  481



>ref|XP_002269279.3| PREDICTED: abscisic acid 8'-hydroxylase 3-like isoform X2 [Vitis 
vinifera]
Length=491

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/497 (70%), Positives = 408/497 (82%), Gaps = 10/497 (2%)
 Frame = -2

Query  1791  VELGKLRMVFGSMVSHYYYDVFLGLLVGIGIAVYLLRG-QTVRSKSCIIPGKLGIPFLGE  1615
             + L + ++VF   +   + ++ +  +  +G+ + + +  + + S+  +IPG+LG+P LGE
Sbjct  2     INLPRNKLVF---LVQNHIEIMMVAVFSLGVMLIVQKALRRLTSEKSVIPGRLGLPLLGE  58

Query  1614  TFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNK  1435
             TFS LSAT STKGCYDFVR RRLWHG+WFKTRIFGK+HVFVP+ DGAKTIFAND  LFNK
Sbjct  59    TFSFLSATGSTKGCYDFVRLRRLWHGKWFKTRIFGKVHVFVPTTDGAKTIFANDLVLFNK  118

Query  1434  GYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRI  1255
             GYVKSMAD VGKKSLLCVP ESHKRIRRLLSDPFSMNSLS FV +FD ML QRL +    
Sbjct  119   GYVKSMADVVGKKSLLCVPQESHKRIRRLLSDPFSMNSLSKFVMEFDNMLYQRLNKLEEG  178

Query  1254  GKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKG  1075
             GKSF V DF MKI FDA+CN L+S+T+  LL+ IERDC+ VS+AMLSFP+MIPGTRYYKG
Sbjct  179   GKSFVVFDFCMKIAFDAICNRLISVTEAPLLQEIERDCTYVSNAMLSFPLMIPGTRYYKG  238

Query  1074  IKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLL  895
             IKAR RLMETF  +I SRR     G E  +D  FLQ ML+RDS+P SEKLED EIMDNLL
Sbjct  239   IKARKRLMETFGEMISSRRS----GKEYSDD--FLQSMLQRDSYPPSEKLEDSEIMDNLL  292

Query  894   TLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYAS  715
             TLIIAGQTTTAAAMMWSVK LDEN E+Q+RLREEQLSI+RNK +GAL+TLEDLN+M Y  
Sbjct  293   TLIIAGQTTTAAAMMWSVKFLDENEEVQDRLREEQLSIIRNKAEGALLTLEDLNSMCYGL  352

Query  714   KVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPS  535
             +VVKETLRMSNVLLWFPRVAL++C+IEGF+IKKGWH+NIDAT IH+D ++YKDP  FNPS
Sbjct  353   QVVKETLRMSNVLLWFPRVALNDCRIEGFEIKKGWHLNIDATYIHFDHSLYKDPIQFNPS  412

Query  534   RFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIP  355
             RFDE+ +PYS++PFGSGPRTCLGINMAK+TMLV+L RLTS +KW VDD DP LE+KAHIP
Sbjct  413   RFDEVPKPYSFMPFGSGPRTCLGINMAKMTMLVFLSRLTSGFKWRVDDRDPCLEKKAHIP  472

Query  354   RLRSGCPITLTAFNQGD  304
             RLRSGCPITL    + D
Sbjct  473   RLRSGCPITLRTLKKRD  489



>ref|XP_002521537.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40808.1| cytochrome P450, putative [Ricinus communis]
Length=492

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/485 (70%), Positives = 399/485 (82%), Gaps = 9/485 (2%)
 Frame = -2

Query  1755  MVSHYYYDVFLGLLVGIGIAVYLLRGQTVRS---KSCIIPGKLGIPFLGETFSLLSATNS  1585
             +V   Y  + +GL + + +A+  +  +  RS    +  IPG+LG+PF+GET S LSA NS
Sbjct  14    LVRKNYDTILVGLCLWLSMAIAYVVSKAWRSDGDSAGSIPGRLGLPFIGETLSFLSAANS  73

Query  1584  TKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAV  1405
             TKGCY+FVR RRLWHG+ FKTR+FGK+HVFVPS +GA+ IFANDF  FNKGYVKSMADAV
Sbjct  74    TKGCYEFVRLRRLWHGKCFKTRVFGKVHVFVPSPEGARKIFANDFVDFNKGYVKSMADAV  133

Query  1404  GKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFN  1225
             G+KSLLCVPH+SHKRIR LLS+PFSM SLS FVQKFD+ML   L++    GK FTVLDF+
Sbjct  134   GEKSLLCVPHDSHKRIRHLLSEPFSMPSLSKFVQKFDQMLAWELKKLEESGKCFTVLDFS  193

Query  1224  MKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMET  1045
             MK+TFDAMCNMLMS+T+ SLLR IE+DC+ +SD+MLS P+MIPGTRYY+GIKAR RLMET
Sbjct  194   MKMTFDAMCNMLMSVTEDSLLRGIEKDCTAISDSMLSIPLMIPGTRYYQGIKARQRLMET  253

Query  1044  FKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTT  865
              K IID RR  MG       D DFLQ ML+RDS+P  EKL+D EIMDNLLTLIIAGQTTT
Sbjct  254   LKGIIDKRRSEMG------SDEDFLQSMLQRDSYPSDEKLDDSEIMDNLLTLIIAGQTTT  307

Query  864   AAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMS  685
             AAA+MWSV  L +N E Q RLREEQLSI ++K  GA ++LEDLN M+Y  KV KETLRMS
Sbjct  308   AAALMWSVMFLHQNQEAQTRLREEQLSIAKHKQDGASLSLEDLNKMSYGLKVAKETLRMS  367

Query  684   NVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYS  505
             NVLLWFPRVAL++C I+GF+IKKGWHVNIDATCIHYDPA YKDP  FNPSRFDEMQ+PYS
Sbjct  368   NVLLWFPRVALNDCTIDGFEIKKGWHVNIDATCIHYDPAFYKDPELFNPSRFDEMQKPYS  427

Query  504   YIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITL  325
             ++PFGSGPRTCLG+NMAKVTMLV+LHRLTS YKW++ D DPSLE+KAHIPRLRSGCPITL
Sbjct  428   FVPFGSGPRTCLGMNMAKVTMLVFLHRLTSGYKWNIHDLDPSLEKKAHIPRLRSGCPITL  487

Query  324   TAFNQ  310
              A N+
Sbjct  488   EALNK  492



>ref|XP_004150006.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Cucumis sativus]
 ref|XP_004167445.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Cucumis sativus]
Length=472

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/474 (73%), Positives = 400/474 (84%), Gaps = 8/474 (2%)
 Frame = -2

Query  1740  YYDVFLGLLVGIGIAVYLLR-GQTVRSKS-CIIPGKLGIPFLGETFSLLSATNSTKGCYD  1567
             Y++  +  L+ I + V + +    VRSK+   IPG LG+PF+GETFS LSA NST+GCY 
Sbjct  2     YFNPTVAALLSIAVLVLVSKVWWRVRSKNDGGIPGYLGLPFVGETFSFLSANNSTRGCYH  61

Query  1566  FVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLL  1387
             FVR RRLWHGRWFKTR+FGKIHVFVPS +GAK IF+NDF  FNKGYVKSM DAVG+KSLL
Sbjct  62    FVRLRRLWHGRWFKTRLFGKIHVFVPSAEGAKAIFSNDFVQFNKGYVKSMGDAVGEKSLL  121

Query  1386  CVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFD  1207
             CV HE+H+RIRRLLSDPFSM SLS FV++FD ML +RL++  + GKSF +LDF+MKITFD
Sbjct  122   CVSHENHRRIRRLLSDPFSMTSLSKFVKEFDDMLSKRLKKLEKDGKSFVLLDFSMKITFD  181

Query  1206  AMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIID  1027
             ++CNMLMS+ D S LR+IE+DC+ VS+AMLSFP MIPGTRYYKGIKAR RLMETF+ II 
Sbjct  182   SICNMLMSLRDESTLRQIEKDCTAVSEAMLSFPFMIPGTRYYKGIKARKRLMETFREIIS  241

Query  1026  SRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMW  847
              RRR    G ES ED  FL+ ML+RDS+P +EKL+D EIMDNLLTLIIAGQTTTAAAMMW
Sbjct  242   RRRR----GEESPED--FLESMLQRDSYPSNEKLDDSEIMDNLLTLIIAGQTTTAAAMMW  295

Query  846   SVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWF  667
              +K LDEN E Q RLREEQLSIL+ K  G L+TLEDL  M+Y SKVVKETLRMSNVLLWF
Sbjct  296   CIKFLDENKEAQERLREEQLSILQKKEDGELLTLEDLKKMSYGSKVVKETLRMSNVLLWF  355

Query  666   PRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGS  487
             PRVAL +C++E F+IKKGWHVNIDATCIHYDP +YKDP  FNPSRFDE+Q+PYS+IPFGS
Sbjct  356   PRVALGDCRLEDFEIKKGWHVNIDATCIHYDPDVYKDPMKFNPSRFDEIQKPYSFIPFGS  415

Query  486   GPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITL  325
             GPRTCLGINMAK+TMLV+LHR+T  Y+W+VDDPDPSLE+KAHIPRLRSGCPITL
Sbjct  416   GPRTCLGINMAKLTMLVFLHRMTGGYRWTVDDPDPSLEKKAHIPRLRSGCPITL  469



>ref|XP_008440758.1| PREDICTED: abscisic acid 8'-hydroxylase 1-like [Cucumis melo]
Length=484

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/480 (71%), Positives = 399/480 (83%), Gaps = 8/480 (2%)
 Frame = -2

Query  1758  SMVSHYYYDVFLGLLVGIGIAVYLLR-GQTVRSKS-CIIPGKLGIPFLGETFSLLSATNS  1585
             + ++  Y++  +  L+ I I V + +    +RSK+   IPG LG+PF+GETFS LSA NS
Sbjct  8     AFIAQIYFNPTVAALLSIAILVLVSKVWWRLRSKNDGEIPGHLGLPFVGETFSFLSANNS  67

Query  1584  TKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAV  1405
             T+GCY FVR RRLWHGRWFKTR+FGKIHVFVPS +GAK IF NDF  FNKGYVKSM DAV
Sbjct  68    TRGCYHFVRLRRLWHGRWFKTRLFGKIHVFVPSAEGAKAIFTNDFVQFNKGYVKSMGDAV  127

Query  1404  GKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFN  1225
             G+KSLLCV HE+H+RIRRLLSDPFSM SLS FV++FD ML +RL++  + GKSF +LDF+
Sbjct  128   GEKSLLCVSHENHRRIRRLLSDPFSMTSLSKFVKEFDDMLSKRLKKLEKDGKSFVLLDFS  187

Query  1224  MKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMET  1045
             MKITFD+MCNMLMS+ D S LR+IE+DC  VSDAMLSFP MIPGTRYYKGIKAR RLME 
Sbjct  188   MKITFDSMCNMLMSLKDESTLRQIEKDCKAVSDAMLSFPFMIPGTRYYKGIKARNRLMEK  247

Query  1044  FKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTT  865
             F+ II  RRR    G ES ED  FL+ ML+RDS+P +EKL+D EIMDNLLTLIIAGQTTT
Sbjct  248   FREIISRRRR----GEESPED--FLESMLQRDSYPSNEKLDDSEIMDNLLTLIIAGQTTT  301

Query  864   AAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMS  685
             AAAMMWS+K LDEN E Q RLREEQLSIL+ K  G L+ LEDLN M+Y SKVVKETLRMS
Sbjct  302   AAAMMWSIKFLDENREAQERLREEQLSILQKKEDGELLCLEDLNKMSYGSKVVKETLRMS  361

Query  684   NVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYS  505
             NVLLWFPRVAL +C++E F+IKKGWHVNIDATCIHYDP +YKDP  +NPSRFDE+Q+PYS
Sbjct  362   NVLLWFPRVALGDCRLEDFEIKKGWHVNIDATCIHYDPDVYKDPMEYNPSRFDEIQKPYS  421

Query  504   YIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITL  325
             +IPFGSGPRTCLGINMAK+TMLV+LHR+T  Y+W+VDDPDP LE+K HIPRLRSGCPITL
Sbjct  422   FIPFGSGPRTCLGINMAKLTMLVFLHRMTGGYRWTVDDPDPCLEKKTHIPRLRSGCPITL  481



>ref|XP_008241894.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Prunus mume]
Length=491

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/482 (72%), Positives = 397/482 (82%), Gaps = 13/482 (3%)
 Frame = -2

Query  1740  YYDVFLGLLVGIGIAVYL-------LRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNST  1582
             YYDVF+ ++  IG+   +       L   T   +   IPG+LG+PF+GET SLLSAT+S 
Sbjct  16    YYDVFIVVVFSIGVTFLVSKIAWRSLDMTTTSYRGGGIPGRLGLPFVGETLSLLSATSSI  75

Query  1581  KGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVG  1402
             KGCY+FVR RR WHG+WFKTRIFG+IHVFVPS +GA+ IF++DFA FNKGYVKSMAD VG
Sbjct  76    KGCYEFVRLRRTWHGKWFKTRIFGQIHVFVPSTEGARAIFSDDFAKFNKGYVKSMADCVG  135

Query  1401  KKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNM  1222
             +KSLLCVPHE HKRIRRLLS+PFSMNSLS FVQKFD+MLC+ L++    GKSF VLDF+M
Sbjct  136   EKSLLCVPHEDHKRIRRLLSEPFSMNSLSTFVQKFDKMLCRELKKLEGGGKSFAVLDFSM  195

Query  1221  KITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETF  1042
             KITFDAMCNML+S+TD SLLR+I++DC+ VSDAML+FP MIPGTRYYKGIKAR RLMETF
Sbjct  196   KITFDAMCNMLLSVTDDSLLRKIDKDCTAVSDAMLTFPYMIPGTRYYKGIKARRRLMETF  255

Query  1041  KTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTA  862
             K II   RRR G+ +  D    FLQ MLERDS+P +EKL+D EIMDNLLTLIIAGQTTT+
Sbjct  256   KDIIG--RRRSGKESAGD----FLQSMLERDSYPPNEKLQDSEIMDNLLTLIIAGQTTTS  309

Query  861   AAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSN  682
             AA+MWSVK LDEN E Q RLREEQLSI R +P GA  TLED   M Y  KVVKETLR+SN
Sbjct  310   AAVMWSVKFLDENREAQERLREEQLSIARARPDGASATLEDFKNMPYCLKVVKETLRISN  369

Query  681   VLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSY  502
             VLLWFPRVAL +C IEGF+IKKGWHVNIDATCIH DP +Y +P  FNPSRFDEMQ+PYS+
Sbjct  370   VLLWFPRVALSDCTIEGFEIKKGWHVNIDATCIHNDPDLYAEPMQFNPSRFDEMQKPYSF  429

Query  501   IPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             IPFGSGPRTCLG+NMAK+TMLV+LHRLTSRY+W+VDD D SL + AHIPRLRSGCPITL 
Sbjct  430   IPFGSGPRTCLGMNMAKLTMLVFLHRLTSRYRWTVDDLDTSLAKNAHIPRLRSGCPITLR  489

Query  321   AF  316
             A 
Sbjct  490   AL  491



>ref|XP_004509304.1| PREDICTED: cytochrome P450 716B1-like [Cicer arietinum]
Length=492

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/483 (71%), Positives = 400/483 (83%), Gaps = 7/483 (1%)
 Frame = -2

Query  1752  VSHYYYDVFLGLLVGIGIAVYLLRG-QTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKG  1576
             V H YYD+ + L   IG+     R  +   SK   IPG+LG+P +GETFS LSATNST+G
Sbjct  12    VVHNYYDITMVLFFSIGLTYLASRAWKKTTSKRENIPGRLGLPLIGETFSFLSATNSTRG  71

Query  1575  CYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKK  1396
             CYDFVR RRLWHGRWFKTR+FGK+H+F+P+ +GA+TIF+NDF LFNKGYVKSMADAVGKK
Sbjct  72    CYDFVRLRRLWHGRWFKTRLFGKVHIFIPNPEGARTIFSNDFDLFNKGYVKSMADAVGKK  131

Query  1395  SLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKI  1216
             SLLCVP ESHKRIRRLLS+PFSM SLS F+ KFD+MLC RL++    GKSF  LDF M +
Sbjct  132   SLLCVPVESHKRIRRLLSEPFSMISLSAFITKFDKMLCGRLQKIEESGKSFKALDFCMMM  191

Query  1215  TFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKT  1036
             TFDAMC+MLMSIT+ SLLR+IE+DC+ VS+AMLSFPVMIPGTRYYKGI AR RLMETFK 
Sbjct  192   TFDAMCDMLMSITEDSLLRQIEKDCTAVSNAMLSFPVMIPGTRYYKGITARKRLMETFKE  251

Query  1035  IIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAA  856
             II  RRR    G ES ED  FLQ ML+R+SFP SEKL+D EIMDNLLTLIIAGQTTTAAA
Sbjct  252   IIARRRR----GEESPED--FLQSMLQRNSFPASEKLDDSEIMDNLLTLIIAGQTTTAAA  305

Query  855   MMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVL  676
             MMWSVK L +N + Q+ LREEQLS+++ KP+GA +  ED+N M Y  KVVKETLRMSNVL
Sbjct  306   MMWSVKFLHDNRDEQDILREEQLSLIKMKPEGASLNHEDINNMRYGLKVVKETLRMSNVL  365

Query  675   LWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIP  496
             LWFPRVAL++C IEG++IKKGWHVNIDATCIHY+  ++KDP  FNP RFDEMQ+PYS+IP
Sbjct  366   LWFPRVALNDCTIEGYEIKKGWHVNIDATCIHYNSDLFKDPLKFNPQRFDEMQKPYSFIP  425

Query  495   FGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAF  316
             FGSGPRTCLG+NMAKVTMLV+LHRLTS Y W++DD D  LE+KAHIPRLRSGCPITLT  
Sbjct  426   FGSGPRTCLGMNMAKVTMLVFLHRLTSGYTWTLDDLDTCLEKKAHIPRLRSGCPITLTPI  485

Query  315   NQG  307
             N+ 
Sbjct  486   NKN  488



>ref|XP_010649113.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like isoform X1 [Vitis 
vinifera]
Length=492

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/498 (69%), Positives = 408/498 (82%), Gaps = 11/498 (2%)
 Frame = -2

Query  1791  VELGKLRMVFGSMVSHYYYDVFLGLLVGIGIAVYLLRG-QTVRSKSCIIPGKLGIPFLGE  1615
             + L + ++VF   +   + ++ +  +  +G+ + + +  + + S+  +IPG+LG+P LGE
Sbjct  2     INLPRNKLVF---LVQNHIEIMMVAVFSLGVMLIVQKALRRLTSEKSVIPGRLGLPLLGE  58

Query  1614  TFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNK  1435
             TFS LSAT STKGCYDFVR RRLWHG+WFKTRIFGK+HVFVP+ DGAKTIFAND  LFNK
Sbjct  59    TFSFLSATGSTKGCYDFVRLRRLWHGKWFKTRIFGKVHVFVPTTDGAKTIFANDLVLFNK  118

Query  1434  GYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRI  1255
             GYVKSMAD VGKKSLLCVP ESHKRIRRLLSDPFSMNSLS FV +FD ML QRL +    
Sbjct  119   GYVKSMADVVGKKSLLCVPQESHKRIRRLLSDPFSMNSLSKFVMEFDNMLYQRLNKLEEG  178

Query  1254  GKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKG  1075
             GKSF V DF MKI FDA+CN L+S+T+  LL+ IERDC+ VS+AMLSFP+MIPGTRYYKG
Sbjct  179   GKSFVVFDFCMKIAFDAICNRLISVTEAPLLQEIERDCTYVSNAMLSFPLMIPGTRYYKG  238

Query  1074  IKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLL  895
             IKAR RLMETF  +I SRR     G E  +  DFLQ ML+RDS+P SEKLED EIMDNLL
Sbjct  239   IKARKRLMETFGEMISSRR----SGKEYSD--DFLQSMLQRDSYPPSEKLEDSEIMDNLL  292

Query  894   TLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYAS  715
             TLIIAGQTTTAAAMMWSVK LDEN E+Q+RLREEQLSI+RNK +GAL+TLEDLN+M Y  
Sbjct  293   TLIIAGQTTTAAAMMWSVKFLDENEEVQDRLREEQLSIIRNKAEGALLTLEDLNSMCYGL  352

Query  714   KVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPS  535
             +VVKETLRMSNVLLWFPRVAL++C+IEGF+IKKGWH+NIDAT IH+D ++YKDP  FNPS
Sbjct  353   QVVKETLRMSNVLLWFPRVALNDCRIEGFEIKKGWHLNIDATYIHFDHSLYKDPIQFNPS  412

Query  534   RFD-EMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHI  358
             RFD E+ +PYS++PFGSGPRTCLGINMAK+TMLV+L RLTS +KW VDD DP LE+KAHI
Sbjct  413   RFDVEVPKPYSFMPFGSGPRTCLGINMAKMTMLVFLSRLTSGFKWRVDDRDPCLEKKAHI  472

Query  357   PRLRSGCPITLTAFNQGD  304
             PRLRSGCPITL    + D
Sbjct  473   PRLRSGCPITLRTLKKRD  490



>ref|XP_010029755.1| PREDICTED: cytochrome P450 90A1-like isoform X1 [Eucalyptus grandis]
Length=560

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/549 (64%), Positives = 405/549 (74%), Gaps = 80/549 (15%)
 Frame = -2

Query  1740  YYDVFLGLLVGIGIAVYL-LRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDF  1564
             YYDV   +LV +G   Y   + + +  +   IPG+LG+PF+GETFS LSATNSTKGCY+F
Sbjct  16    YYDVLFAVLVSVGFMFYFSAKAKKISGERDHIPGRLGVPFVGETFSFLSATNSTKGCYEF  75

Query  1563  VRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLC  1384
             VR RRLW+G+WFKTRIFGK+HVF+P+  GAKT+FA+DFA FNKGYVKSMADAVGKKSLLC
Sbjct  76    VRLRRLWYGKWFKTRIFGKVHVFIPTTGGAKTVFASDFAQFNKGYVKSMADAVGKKSLLC  135

Query  1383  VPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDA  1204
             VPHESHKRIR LLSDPFSM SLS FV KFD+MLCQRL++    GK F VLDFNMKI FDA
Sbjct  136   VPHESHKRIRHLLSDPFSMPSLSKFVTKFDKMLCQRLKKLEEHGKRFVVLDFNMKIAFDA  195

Query  1203  MCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDS  1024
             MC MLMS+T+ S+L++IE+DC+ VS+AMLSFPVMIPGTRYY+GIKAR RLMETF+ +I+ 
Sbjct  196   MCEMLMSVTEESMLQQIEKDCTDVSNAMLSFPVMIPGTRYYRGIKARNRLMETFREMIEE  255

Query  1023  RRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWS  844
             RR   GRG  + E  DFLQ ML+RDS P  EKL+D EIMDNLLTLIIAGQTTTAAAMMWS
Sbjct  256   RR---GRGKGAPE--DFLQSMLDRDSLPPEEKLDDSEIMDNLLTLIIAGQTTTAAAMMWS  310

Query  843   VKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASK----------------  712
             VK LDEN E Q+RLREEQL+ILR KP+GA +TLEDLN+M+Y  K                
Sbjct  311   VKFLDENPEAQDRLREEQLAILRKKPQGAALTLEDLNSMSYGLKVTISLSHAWVQILTSF  370

Query  711   -------------------VVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDAT  589
                                V KETLRMSNVLLW+PRVA+ +C IEG  IKKGWHVN+DAT
Sbjct  371   HGQCGMCDQSNADILMKFQVAKETLRMSNVLLWYPRVAITDCTIEGHSIKKGWHVNVDAT  430

Query  588   CIHYDPAIYKDPTHFNPSRFD---------------------------------------  526
             CIHYDP+IYKDP  FNPSRFD                                       
Sbjct  431   CIHYDPSIYKDPVQFNPSRFDVNMPSSPPFVSLSCNFLDQHVTDEHFKALTIALPATNLQ  490

Query  525   EMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLR  346
             EMQ+PYS+IPFGSGPRTCLG+NMAKVTML +LHRLTS Y+W+VDDPD SLE+KAHIPRLR
Sbjct  491   EMQKPYSFIPFGSGPRTCLGMNMAKVTMLAFLHRLTSGYRWTVDDPDTSLEKKAHIPRLR  550

Query  345   SGCPITLTA  319
             SGCPITL A
Sbjct  551   SGCPITLKA  559



>gb|AET03877.2| cytochrome P450 family protein [Medicago truncatula]
Length=492

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/494 (69%), Positives = 402/494 (81%), Gaps = 10/494 (2%)
 Frame = -2

Query  1785  LGKLRMVFGSMVSHYYYDVFLGLLVGIGIAVYLLRG-QTVRSKSCIIPGKLGIPFLGETF  1609
             L +  +VF   V   YYD+ L L + IG+     R  +   +    IPG+LG+PF+GETF
Sbjct  4     LSREELVF---VVQNYYDIILVLFLSIGLTYLASRAWKRATNNREDIPGRLGLPFIGETF  60

Query  1608  SLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGY  1429
             SLLSATNST+GCYDFVR RRLWHGRWFKTR+FGK+H+++P+ +GA+TIFANDF LFNKGY
Sbjct  61    SLLSATNSTRGCYDFVRLRRLWHGRWFKTRLFGKVHIYIPTPEGARTIFANDFDLFNKGY  120

Query  1428  VKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGK  1249
             VKSMADAVGKKSLLCVP ESHKRIRRLLS+PFSM SL  F+ KFD++LC RL++    GK
Sbjct  121   VKSMADAVGKKSLLCVPVESHKRIRRLLSEPFSMTSLYAFITKFDKLLCGRLQKLEESGK  180

Query  1248  SFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIK  1069
             SF  LDF M++TFDAMC MLMSIT+ SLLR+IE+DC+ VS+AMLSFPVMIPGTRYYKGI 
Sbjct  181   SFKTLDFCMEMTFDAMCGMLMSITEDSLLRQIEKDCTAVSNAMLSFPVMIPGTRYYKGIT  240

Query  1068  ARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTL  889
             AR RLMETF+ II  RRR    G ES  D  FLQ ML+RDSFP SEKL+D EIMDNLLTL
Sbjct  241   ARNRLMETFREIIARRRR----GEESPGD--FLQSMLQRDSFPASEKLDDSEIMDNLLTL  294

Query  888   IIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKV  709
             IIAGQTTTAAAMMWSVK L++N + Q+ LREEQLS+ + KP+GA +  ED+N M Y  KV
Sbjct  295   IIAGQTTTAAAMMWSVKFLNDNRDAQDILREEQLSLTKMKPEGASLNHEDINNMRYGLKV  354

Query  708   VKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRF  529
             VKETLRMSNVLLWFPRVAL +C IEG++IKKGWHVNIDATCIHYD  ++ DP  FNP RF
Sbjct  355   VKETLRMSNVLLWFPRVALKDCTIEGYEIKKGWHVNIDATCIHYDSDLFMDPLKFNPQRF  414

Query  528   DEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRL  349
             DEMQ+PYS++PFGSGPRTCLG+NMAKVTMLV+LHRLTS Y W++DD D  LE+KAHIPRL
Sbjct  415   DEMQKPYSFLPFGSGPRTCLGMNMAKVTMLVFLHRLTSGYTWTLDDLDACLEKKAHIPRL  474

Query  348   RSGCPITLTAFNQG  307
             RSGCPITL + ++ 
Sbjct  475   RSGCPITLKSISKS  488



>ref|XP_007204348.1| hypothetical protein PRUPE_ppa005680mg [Prunus persica]
 gb|EMJ05547.1| hypothetical protein PRUPE_ppa005680mg [Prunus persica]
Length=448

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/445 (76%), Positives = 379/445 (85%), Gaps = 7/445 (2%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG+LG+PF+GET SLLSAT+S KGCY+FVR RR+WHG+WFKTRIFG+IHVFVPS +GA+
Sbjct  11    IPGRLGLPFVGETLSLLSATSSIKGCYEFVRLRRIWHGKWFKTRIFGQIHVFVPSTEGAR  70

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              IF++DFA FNKGYVKSMAD VG+KSLLCVPHE HKRIR LLS+PFSMNSLS FVQKFD+
Sbjct  71    AIFSDDFAKFNKGYVKSMADCVGEKSLLCVPHEDHKRIRHLLSEPFSMNSLSTFVQKFDK  130

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSF  1111
             +LCQ L++    GKSF VLDF+MKITFDAMCNML+S+TD SLLR+I +DC+ VSDAML+F
Sbjct  131   VLCQELKKLEGGGKSFVVLDFSMKITFDAMCNMLLSVTDDSLLRKINKDCTAVSDAMLTF  190

Query  1110  PVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESE  931
             P MIPGTRYYKGIKAR RLMETFK II  RR     G ES E  DFLQ MLERDS P +E
Sbjct  191   PYMIPGTRYYKGIKARRRLMETFKDIIGRRR----SGKESAE--DFLQSMLERDSHPPNE  244

Query  930   KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALI  751
             KL+D EIMDNLLTLIIAGQTTT+AAMMWSVK LDEN E Q RLR EQLSI R +P GA  
Sbjct  245   KLQDSEIMDNLLTLIIAGQTTTSAAMMWSVKFLDENREAQERLR-EQLSIARARPDGASA  303

Query  750   TLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDP  571
             TLED   M Y  KVVKETLR+SNVLLWFPRVAL +C IEGF+IKKGWHVNIDATCIH DP
Sbjct  304   TLEDFKNMPYCLKVVKETLRISNVLLWFPRVALSDCTIEGFEIKKGWHVNIDATCIHNDP  363

Query  570   AIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDD  391
             A+Y +P  FNPSRFDEMQ+PYS+IPFGSGPRTCLG+NMAKVTMLV+LHRLTS Y+W+VDD
Sbjct  364   ALYAEPMQFNPSRFDEMQKPYSFIPFGSGPRTCLGMNMAKVTMLVFLHRLTSGYRWTVDD  423

Query  390   PDPSLERKAHIPRLRSGCPITLTAF  316
              D SL R AHIPRLRSGCPITL A 
Sbjct  424   LDTSLARNAHIPRLRSGCPITLRAL  448



>ref|XP_006425626.1| hypothetical protein CICLE_v10027167mg [Citrus clementina]
 gb|ESR38866.1| hypothetical protein CICLE_v10027167mg [Citrus clementina]
Length=485

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/481 (70%), Positives = 401/481 (83%), Gaps = 11/481 (2%)
 Frame = -2

Query  1752  VSHYYYDVFLGLLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGC  1573
             V +YY  V +  +  +G+A +L +    +++   IPG+LG+PF+GET S  SATNSTKGC
Sbjct  14    VQNYY--VIIVTVFSLGVAFFLSKSWGRKAE---IPGRLGLPFIGETLSFFSATNSTKGC  68

Query  1572  YDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKS  1393
             Y+FV+ RRL +G+WFKTRI GKIH+FVPS +GAK IF +DFA FNKGYVKSMADAVGK S
Sbjct  69    YNFVKVRRLRYGKWFKTRILGKIHMFVPSTEGAKMIFTSDFANFNKGYVKSMADAVGKNS  128

Query  1392  LLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKIT  1213
             LLCVPHESHKRIRRLLSDPFSMNSLS FV+ FD+ML +RL +    GKSF++LDF+MK+T
Sbjct  129   LLCVPHESHKRIRRLLSDPFSMNSLSKFVKTFDKMLSERLNKLQESGKSFSILDFSMKLT  188

Query  1212  FDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTI  1033
             FDAMCNMLMS+TD SLL +IE+DC+ VSDAMLSFP MIPGTRYY+GIKAR RLMETF+ +
Sbjct  189   FDAMCNMLMSVTDDSLLGQIEKDCTAVSDAMLSFPFMIPGTRYYRGIKARRRLMETFRGM  248

Query  1032  IDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAM  853
             I  RR     G ES ED  FLQ MLE+DS P +EKL D EIMDNLLTLIIAGQTTTAAAM
Sbjct  249   IAKRRS----GEESFED--FLQSMLEKDSCPTNEKLSDSEIMDNLLTLIIAGQTTTAAAM  302

Query  852   MWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLL  673
             MWSVK L +N E Q +LREEQL+++++K  GA +TLED+++M+Y  KVVKETLRMSNVLL
Sbjct  303   MWSVKFLHDNREAQQKLREEQLAMIKDKADGAALTLEDVSSMSYGLKVVKETLRMSNVLL  362

Query  672   WFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPF  493
             W+PRVAL++C I+GF+IKKGWHVNIDA  IHYDPA+YKDP  FNPSRF+EMQ+ YS+IPF
Sbjct  363   WYPRVALNDCTIDGFEIKKGWHVNIDAAYIHYDPALYKDPEQFNPSRFEEMQKSYSFIPF  422

Query  492   GSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFN  313
             GSGPRTCLG+NMAKVTML++LHRLTS Y W+VDDPD SLE+K+HIPRLRSGCPITL   N
Sbjct  423   GSGPRTCLGMNMAKVTMLIFLHRLTSGYLWTVDDPDLSLEKKSHIPRLRSGCPITLKPLN  482

Query  312   Q  310
             +
Sbjct  483   K  483



>ref|XP_003548874.1| PREDICTED: cytochrome P450 716B1-like isoform X1 [Glycine max]
 gb|KHN22762.1| Cytochrome P450 716B1 [Glycine soja]
Length=494

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/485 (71%), Positives = 396/485 (82%), Gaps = 10/485 (2%)
 Frame = -2

Query  1755  MVSHYYYDVFLGLLVGIGIAVYLLRGQTVRSKSC---IIPGKLGIPFLGETFSLLSATNS  1585
             +V  YYYD+ +  L  IG+  YL      R+ +     IPG+LG+PF+GETFS LSATNS
Sbjct  12    VVQKYYYDLIMVALFTIGVT-YLASKAWKRATTNNREEIPGRLGLPFIGETFSFLSATNS  70

Query  1584  TKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAV  1405
             T+GCYDFVR RRLW+GRWFKTR+FGKIH+F+PS +GA+TIFANDF LFNKGYVKSMADAV
Sbjct  71    TRGCYDFVRLRRLWNGRWFKTRLFGKIHIFIPSPEGARTIFANDFVLFNKGYVKSMADAV  130

Query  1404  GKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFN  1225
             G+KSLLCVP ESHKRIR LLS+PFSM SLS FV KFD+MLC RL++    GKSF VLD  
Sbjct  131   GQKSLLCVPVESHKRIRGLLSEPFSMTSLSAFVTKFDKMLCGRLQKLEESGKSFKVLDLC  190

Query  1224  MKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMET  1045
             MK+TFDAMC+MLMSIT+ SLLR+IE DC+ VSDAMLS P+MIP TRYYKGI AR R+MET
Sbjct  191   MKMTFDAMCDMLMSITEDSLLRQIEEDCTAVSDAMLSIPIMIPRTRYYKGITARKRVMET  250

Query  1044  FKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTT  865
             F  II  RRR    G E+ ED  FLQ ML+RDS P SEKL+D EIMDNLLTLIIAGQTTT
Sbjct  251   FGEIIARRRR----GEETPED--FLQSMLQRDSLPASEKLDDSEIMDNLLTLIIAGQTTT  304

Query  864   AAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMS  685
             AAAMMWSVK L +N E Q+ LREEQLSI + KP+GA I  EDLN+M Y  KVVKETLRMS
Sbjct  305   AAAMMWSVKFLHDNRETQDILREEQLSITKMKPEGASINHEDLNSMRYGLKVVKETLRMS  364

Query  684   NVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYS  505
             NVLLWFPRVAL++C IEG+DIKKGWHVNIDAT IH+D  +YKDP  FNP RFDEMQ+PYS
Sbjct  365   NVLLWFPRVALEDCTIEGYDIKKGWHVNIDATHIHHDSDLYKDPLKFNPQRFDEMQKPYS  424

Query  504   YIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITL  325
             +IPFGSGPRTCLGINMAKVTMLV+LHRLT  Y W++DD D  LE+KAHIPRLR+GCPITL
Sbjct  425   FIPFGSGPRTCLGINMAKVTMLVFLHRLTGGYTWTLDDLDTCLEKKAHIPRLRNGCPITL  484

Query  324   TAFNQ  310
              + ++
Sbjct  485   KSLSK  489



>ref|XP_010649114.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like isoform X3 [Vitis 
vinifera]
Length=489

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/498 (69%), Positives = 406/498 (82%), Gaps = 14/498 (3%)
 Frame = -2

Query  1791  VELGKLRMVFGSMVSHYYYDVFLGLLVGIGIAVYLLRG-QTVRSKSCIIPGKLGIPFLGE  1615
             + L + ++VF   +   + ++ +  +  +G+ + + +  + + S+  +IPG+LG+P LGE
Sbjct  2     INLPRNKLVF---LVQNHIEIMMVAVFSLGVMLIVQKALRRLTSEKSVIPGRLGLPLLGE  58

Query  1614  TFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNK  1435
             TFS LSAT STKGCYDFVR RRLWHG+WFKTRIFGK+HVFVP+ DGAKTIFAND  LFNK
Sbjct  59    TFSFLSATGSTKGCYDFVRLRRLWHGKWFKTRIFGKVHVFVPTTDGAKTIFANDLVLFNK  118

Query  1434  GYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRI  1255
             GYVKSMAD VGKKSLLCVP ESHKRIRRLLSDPFSMNSLS FV +FD ML QRL +    
Sbjct  119   GYVKSMADVVGKKSLLCVPQESHKRIRRLLSDPFSMNSLSKFVMEFDNMLYQRLNKLEEG  178

Query  1254  GKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKG  1075
             GKSF V DF MKI FDA+CN L+S+T+  LL+ IERDC+ VS+AMLSFP+MIPGTRYYKG
Sbjct  179   GKSFVVFDFCMKIAFDAICNRLISVTEAPLLQEIERDCTYVSNAMLSFPLMIPGTRYYKG  238

Query  1074  IKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLL  895
             IKAR RLMETF  +I SRR     G E  +  DFLQ ML+RDS+P SEKLED EIMDNLL
Sbjct  239   IKARKRLMETFGEMISSRR----SGKEYSD--DFLQSMLQRDSYPPSEKLEDSEIMDNLL  292

Query  894   TLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYAS  715
             TLIIAGQTTTAAAMMWSVK LDEN E+Q+RLREEQLSI+RNK +GAL+TLEDLN+M Y  
Sbjct  293   TLIIAGQTTTAAAMMWSVKFLDENEEVQDRLREEQLSIIRNKAEGALLTLEDLNSMCYG-  351

Query  714   KVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPS  535
               ++ETLRMSNVLLWFPRVAL++C+IEGF+IKKGWH+NIDAT IH+D ++YKDP  FNPS
Sbjct  352   --LQETLRMSNVLLWFPRVALNDCRIEGFEIKKGWHLNIDATYIHFDHSLYKDPIQFNPS  409

Query  534   RFD-EMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHI  358
             RFD E+ +PYS++PFGSGPRTCLGINMAK+TMLV+L RLTS +KW VDD DP LE+KAHI
Sbjct  410   RFDVEVPKPYSFMPFGSGPRTCLGINMAKMTMLVFLSRLTSGFKWRVDDRDPCLEKKAHI  469

Query  357   PRLRSGCPITLTAFNQGD  304
             PRLRSGCPITL    + D
Sbjct  470   PRLRSGCPITLRTLKKRD  487



>ref|XP_006467149.1| PREDICTED: abscisic acid 8'-hydroxylase 2-like [Citrus sinensis]
Length=485

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/481 (70%), Positives = 401/481 (83%), Gaps = 11/481 (2%)
 Frame = -2

Query  1752  VSHYYYDVFLGLLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGC  1573
             V +YY  V +  +  +G+A ++ +    +++   IPG+LG+PF+GET S  SATNSTKGC
Sbjct  14    VQNYY--VIIVTVFSLGVAFFISKSWGRKAE---IPGRLGLPFIGETLSFFSATNSTKGC  68

Query  1572  YDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKS  1393
             Y+FV+ RRL +G+WFKTRI GKIH+FVPS +GAK IF +DFA FNKGYVKSMADAVGK S
Sbjct  69    YNFVKVRRLRYGKWFKTRILGKIHMFVPSTEGAKMIFTSDFANFNKGYVKSMADAVGKNS  128

Query  1392  LLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKIT  1213
             LLCVPHESHKRIRRLLSDPFSMNSLS FV+ FD+ML +RL +    GKSF++LDF+MK+T
Sbjct  129   LLCVPHESHKRIRRLLSDPFSMNSLSKFVKTFDKMLSERLNKLQESGKSFSILDFSMKLT  188

Query  1212  FDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTI  1033
             FDAMCNMLMS+TD SLL +IE+DC+ VSDAMLSFP MIPGTRYY+GIKAR RLMETF+ +
Sbjct  189   FDAMCNMLMSVTDDSLLGQIEKDCTAVSDAMLSFPFMIPGTRYYRGIKARRRLMETFRGM  248

Query  1032  IDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAM  853
             I  RR     G ES ED  FLQ MLE+DS P +EKL D EIMDNLLTLIIAGQTTTAAAM
Sbjct  249   IAKRRS----GEESFED--FLQSMLEKDSCPTNEKLSDSEIMDNLLTLIIAGQTTTAAAM  302

Query  852   MWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLL  673
             MWSVK L +N E Q +LREEQL+++++K  GA +TLED+++M+Y  KVVKETLRMSNVLL
Sbjct  303   MWSVKFLHDNREAQQKLREEQLAMIKDKADGAALTLEDVSSMSYGLKVVKETLRMSNVLL  362

Query  672   WFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPF  493
             W+PRVAL++C I+GF+IKKGWHVNIDA  IHYDPA+YKDP  FNPSRF+EMQ+ YS+IPF
Sbjct  363   WYPRVALNDCTIDGFEIKKGWHVNIDAAYIHYDPALYKDPEQFNPSRFEEMQKSYSFIPF  422

Query  492   GSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFN  313
             GSGPRTCLG+NMAKVTML++LHRLTS Y W+VDDPD SLE+K+HIPRLRSGCPITL   N
Sbjct  423   GSGPRTCLGMNMAKVTMLIFLHRLTSGYLWTVDDPDLSLEKKSHIPRLRSGCPITLKPLN  482

Query  312   Q  310
             +
Sbjct  483   K  483



>ref|XP_003629401.1| Abscisic acid 8'-hydroxylase [Medicago truncatula]
Length=519

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/520 (66%), Positives = 402/520 (77%), Gaps = 37/520 (7%)
 Frame = -2

Query  1785  LGKLRMVFGSMVSHYYYDVFLGLLVGIGIAVYLLRG-QTVRSKSCIIPGKLGIPFLGETF  1609
             L +  +VF   V   YYD+ L L + IG+     R  +   +    IPG+LG+PF+GETF
Sbjct  4     LSREELVF---VVQNYYDIILVLFLSIGLTYLASRAWKRATNNREDIPGRLGLPFIGETF  60

Query  1608  SLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGY  1429
             SLLSATNST+GCYDFVR RRLWHGRWFKTR+FGK+H+++P+ +GA+TIFANDF LFNKGY
Sbjct  61    SLLSATNSTRGCYDFVRLRRLWHGRWFKTRLFGKVHIYIPTPEGARTIFANDFDLFNKGY  120

Query  1428  VKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGK  1249
             VKSMADAVGKKSLLCVP ESHKRIRRLLS+PFSM SL  F+ KFD++LC RL++    GK
Sbjct  121   VKSMADAVGKKSLLCVPVESHKRIRRLLSEPFSMTSLYAFITKFDKLLCGRLQKLEESGK  180

Query  1248  SFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIK  1069
             SF  LDF M++TFDAMC MLMSIT+ SLLR+IE+DC+ VS+AMLSFPVMIPGTRYYKGI 
Sbjct  181   SFKTLDFCMEMTFDAMCGMLMSITEDSLLRQIEKDCTAVSNAMLSFPVMIPGTRYYKGIT  240

Query  1068  ARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTL  889
             AR RLMETF+ II  RR    RG ES    DFLQ ML+RDSFP SEKL+D EIMDNLLTL
Sbjct  241   ARNRLMETFREIIARRR----RGEESPG--DFLQSMLQRDSFPASEKLDDSEIMDNLLTL  294

Query  888   IIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKV  709
             IIAGQTTTAAAMMWSVK L++N + Q+ LREEQLS+ + KP+GA +  ED+N M Y  KV
Sbjct  295   IIAGQTTTAAAMMWSVKFLNDNRDAQDILREEQLSLTKMKPEGASLNHEDINNMRYGLKV  354

Query  708   VKETLRMSNVLLWFPRVALDNCKIE---------------------------GFDIKKGW  610
             VKETLRMSNVLLWFPRVAL +C IE                           G++IKKGW
Sbjct  355   VKETLRMSNVLLWFPRVALKDCTIEDSTIGGLLSSVFLVFMIMLLTIQVATTGYEIKKGW  414

Query  609   HVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYL  430
             HVNIDATCIHYD  ++ DP  FNP RFDEMQ+PYS++PFGSGPRTCLG+NMAKVTMLV+L
Sbjct  415   HVNIDATCIHYDSDLFMDPLKFNPQRFDEMQKPYSFLPFGSGPRTCLGMNMAKVTMLVFL  474

Query  429   HRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFNQ  310
             HRLTS Y W++DD D  LE+KAHIPRLRSGCPITL + ++
Sbjct  475   HRLTSGYTWTLDDLDACLEKKAHIPRLRSGCPITLKSISK  514



>ref|XP_006599361.1| PREDICTED: cytochrome P450 716B1-like isoform X2 [Glycine max]
Length=540

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/531 (65%), Positives = 396/531 (75%), Gaps = 56/531 (11%)
 Frame = -2

Query  1755  MVSHYYYDVFLGLLVGIGIAVYLLRGQTVRSKSC---IIPGKLGIPFLGETFSLLSATNS  1585
             +V  YYYD+ +  L  IG+  YL      R+ +     IPG+LG+PF+GETFS LSATNS
Sbjct  12    VVQKYYYDLIMVALFTIGVT-YLASKAWKRATTNNREEIPGRLGLPFIGETFSFLSATNS  70

Query  1584  TKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAV  1405
             T+GCYDFVR RRLW+GRWFKTR+FGKIH+F+PS +GA+TIFANDF LFNKGYVKSMADAV
Sbjct  71    TRGCYDFVRLRRLWNGRWFKTRLFGKIHIFIPSPEGARTIFANDFVLFNKGYVKSMADAV  130

Query  1404  GKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFN  1225
             G+KSLLCVP ESHKRIR LLS+PFSM SLS FV KFD+MLC RL++    GKSF VLD  
Sbjct  131   GQKSLLCVPVESHKRIRGLLSEPFSMTSLSAFVTKFDKMLCGRLQKLEESGKSFKVLDLC  190

Query  1224  MKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMET  1045
             MK+TFDAMC+MLMSIT+ SLLR+IE DC+ VSDAMLS P+MIP TRYYKGI AR R+MET
Sbjct  191   MKMTFDAMCDMLMSITEDSLLRQIEEDCTAVSDAMLSIPIMIPRTRYYKGITARKRVMET  250

Query  1044  FKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTT  865
             F  II  RR    RG E+ E  DFLQ ML+RDS P SEKL+D EIMDNLLTLIIAGQTTT
Sbjct  251   FGEIIARRR----RGEETPE--DFLQSMLQRDSLPASEKLDDSEIMDNLLTLIIAGQTTT  304

Query  864   AAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMS  685
             AAAMMWSVK L +N E Q+ LREEQLSI + KP+GA I  EDLN+M Y  KVVKETLRMS
Sbjct  305   AAAMMWSVKFLHDNRETQDILREEQLSITKMKPEGASINHEDLNSMRYGLKVVKETLRMS  364

Query  684   NVLLWFPRVALDNCKIE-------------------------------------------  634
             NVLLWFPRVAL++C IE                                           
Sbjct  365   NVLLWFPRVALEDCTIEGEELNSSEDINSIMFIKYFRLIIGGLLSLVFLVVMTVLLTIQV  424

Query  633   ---GFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGI  463
                G+DIKKGWHVNIDAT IH+D  +YKDP  FNP RFDEMQ+PYS+IPFGSGPRTCLGI
Sbjct  425   AITGYDIKKGWHVNIDATHIHHDSDLYKDPLKFNPQRFDEMQKPYSFIPFGSGPRTCLGI  484

Query  462   NMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFNQ  310
             NMAKVTMLV+LHRLT  Y W++DD D  LE+KAHIPRLR+GCPITL + ++
Sbjct  485   NMAKVTMLVFLHRLTGGYTWTLDDLDTCLEKKAHIPRLRNGCPITLKSLSK  535



>ref|XP_010909382.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Elaeis guineensis]
Length=564

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/447 (71%), Positives = 373/447 (83%), Gaps = 6/447 (1%)
 Frame = -2

Query  1665  SKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPS  1486
             SK   +PGKL +P+LGET + LSATNSTKGCY+FVR RR W+G+WFKTR+FGKIH+++PS
Sbjct  115   SKKGEVPGKLRLPYLGETLAFLSATNSTKGCYEFVRKRRQWYGKWFKTRLFGKIHIYIPS  174

Query  1485  VDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFV  1306
              +GAKT+  NDF  FNKGYVKSM DAVGKKSLL VPHESH+RIRRLLSDPFS++SLS FV
Sbjct  175   PEGAKTVLTNDFIKFNKGYVKSMGDAVGKKSLLTVPHESHRRIRRLLSDPFSISSLSKFV  234

Query  1305  QKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSD  1126
             QK D+ML +RL+     G SF VLDF MK+TFDAMC+ML+S+TD  LL+ IE+ C+ VS+
Sbjct  235   QKLDKMLLERLKSVEEKGGSFVVLDFCMKVTFDAMCDMLISVTDTKLLQDIEQKCNDVSN  294

Query  1125  AMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDS  946
              MLSFP MIPG+RYYKG+KAR +LM+ F  +I  RR  M  G+      DFLQ ML+RDS
Sbjct  295   MMLSFPAMIPGSRYYKGMKARKQLMQIFSKMITRRRSGMEYGD------DFLQAMLQRDS  348

Query  945   FPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKP  766
              PE EKL DEEIMDNLLTLIIAGQ+TTAAAMMWSVK LD N   Q RLREEQLS+ R+KP
Sbjct  349   LPEDEKLSDEEIMDNLLTLIIAGQSTTAAAMMWSVKFLDGNGHAQERLREEQLSLTRSKP  408

Query  765   KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATC  586
             +GAL+T+EDLN+MTY  KVVKETLRMSNVLLWFPRV ++NC IEGF++KKGWHVN+DAT 
Sbjct  409   EGALLTMEDLNSMTYGLKVVKETLRMSNVLLWFPRVVIENCVIEGFELKKGWHVNVDATQ  468

Query  585   IHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYK  406
             IHYDP  YKDP  F+PSRFDEMQ+PY++IPFGSG RTCLGINMAKVTMLV+LHRLT  Y+
Sbjct  469   IHYDPLFYKDPLEFDPSRFDEMQKPYTFIPFGSGVRTCLGINMAKVTMLVFLHRLTCSYR  528

Query  405   WSVDDPDPSLERKAHIPRLRSGCPITL  325
             W VDD DPSLE++AHIPRLRSGCPITL
Sbjct  529   WKVDDMDPSLEKRAHIPRLRSGCPITL  555



>ref|XP_007156078.1| hypothetical protein PHAVU_003G256500g [Phaseolus vulgaris]
 gb|ESW28072.1| hypothetical protein PHAVU_003G256500g [Phaseolus vulgaris]
Length=494

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/484 (69%), Positives = 386/484 (80%), Gaps = 8/484 (2%)
 Frame = -2

Query  1755  MVSHYYYDVFLGLLVGIGIAVYLLRG--QTVRSKSCIIPGKLGIPFLGETFSLLSATNST  1582
             +V    Y + L  L  IG+  +  +   +   +    IPG+LG+PF+GETFS LSATNST
Sbjct  12    LVVQNCYHIILVALFTIGVTYFASKAWKRATTNNREEIPGRLGLPFVGETFSFLSATNST  71

Query  1581  KGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVG  1402
             +GCYDFVR RRLW+G+WFKTR+FGKIH+FVP+ +GA+TIFANDF LFNKGYVKSMADAVG
Sbjct  72    RGCYDFVRLRRLWNGKWFKTRLFGKIHIFVPNPEGARTIFANDFVLFNKGYVKSMADAVG  131

Query  1401  KKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNM  1222
             +KSLLCVP ESHKRIRRLLS+PFSM SL  FV KFD++LC RL++    GKSF VLDF M
Sbjct  132   EKSLLCVPVESHKRIRRLLSEPFSMTSLFAFVTKFDKLLCGRLQKLEENGKSFKVLDFCM  191

Query  1221  KITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETF  1042
             K+TFDAMC+MLMS+T+ SLLR+IE DC+ VSDAMLS P+MIPGTRYYKGI AR RLMETF
Sbjct  192   KMTFDAMCDMLMSVTEDSLLRQIEEDCNAVSDAMLSIPIMIPGTRYYKGISARKRLMETF  251

Query  1041  KTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTA  862
             + II  RR         +   DFLQ ML+RDS P SEKL+D EIMDNLLTLIIAGQTTTA
Sbjct  252   RGIIGRRR------RGEETPEDFLQSMLQRDSLPASEKLDDSEIMDNLLTLIIAGQTTTA  305

Query  861   AAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSN  682
             AAMMWSVK L +N E Q+ LREEQLSI + KP GA I  EDLN + Y SKVVKETLRMSN
Sbjct  306   AAMMWSVKFLHDNREAQDILREEQLSITKMKPDGASINHEDLNNIRYGSKVVKETLRMSN  365

Query  681   VLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSY  502
             VLLWFPRVAL +C IEG +IKKGWHVNIDAT IH+D  +YK+P  FNP RFDE +RPYS+
Sbjct  366   VLLWFPRVALQDCTIEGHEIKKGWHVNIDATYIHHDSDLYKEPLKFNPQRFDEQKRPYSF  425

Query  501   IPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             IPFGSGPRTCLGINMAKVTMLV+LHRL   Y W++DD D  LE+KAHIPRLRSGCPITL 
Sbjct  426   IPFGSGPRTCLGINMAKVTMLVFLHRLAGGYTWTLDDLDTCLEKKAHIPRLRSGCPITLK  485

Query  321   AFNQ  310
             + ++
Sbjct  486   SLSK  489



>ref|XP_008785080.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Phoenix dactylifera]
Length=506

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/469 (68%), Positives = 380/469 (81%), Gaps = 9/469 (2%)
 Frame = -2

Query  1722  GLLVGIGIAVYLLRGQTVRSKSCI---IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTR  1552
              L+    +A+ L+  +  RS +C    +PGKL +P LGET + LSATNSTKGCY+FVR R
Sbjct  17    ALVTLFSLALSLMVYKAWRSSTCKKGEVPGKLWLPCLGETLAFLSATNSTKGCYEFVRKR  76

Query  1551  RLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHE  1372
             R W+GRWFKTR+FGKIH+++PS +GAKT+  NDF  FNKGYVKSM DAVGK+SLL VPHE
Sbjct  77    RAWYGRWFKTRLFGKIHIYIPSPEGAKTVLTNDFIKFNKGYVKSMGDAVGKRSLLTVPHE  136

Query  1371  SHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNM  1192
             SH+RIRRLLSDPFS+ SLS FVQK D ML +RL+     G SF VLDF MK+TFD+MC+M
Sbjct  137   SHRRIRRLLSDPFSLCSLSKFVQKLDMMLLERLKSLEEKGGSFLVLDFCMKVTFDSMCDM  196

Query  1191  LMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRR  1012
             L+S+TD  +L+ IE+ C+ VS+ MLSFP MIPG+RYYKG+KAR +LM+ F+ +I  RR  
Sbjct  197   LISVTDTKVLQDIEQKCNDVSNMMLSFPAMIPGSRYYKGMKARKQLMQIFREMIARRRSG  256

Query  1011  MGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLL  832
             M R +      DFLQ ML+RDS PE EKL DEEIMDNLLTL+IAGQ+TTAAAMMWSVK L
Sbjct  257   MERRD------DFLQAMLQRDSLPEDEKLSDEEIMDNLLTLVIAGQSTTAAAMMWSVKFL  310

Query  831   DENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVAL  652
             D N   Q RLREEQLSI  +KP+GAL+ +EDLN+MTY  KVVKETLRMSNVLLWFPRV  
Sbjct  311   DGNRHAQERLREEQLSITGSKPEGALLAMEDLNSMTYGLKVVKETLRMSNVLLWFPRVVT  370

Query  651   DNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTC  472
             +NC IEGF++KKGWHVN+DAT IHYDP+ YKDP+ FNPSRFDEMQ+PY++IPFGSG RTC
Sbjct  371   ENCVIEGFELKKGWHVNVDATQIHYDPSFYKDPSEFNPSRFDEMQKPYTFIPFGSGVRTC  430

Query  471   LGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITL  325
             LGINMAKVTMLV+LHRL S Y+W VDD DPSLE++AHIPRLRSGCPITL
Sbjct  431   LGINMAKVTMLVFLHRLMSSYRWKVDDMDPSLEKRAHIPRLRSGCPITL  479



>emb|CBI17462.3| unnamed protein product [Vitis vinifera]
Length=426

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/420 (76%), Positives = 361/420 (86%), Gaps = 6/420 (1%)
 Frame = -2

Query  1665  SKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPS  1486
             S+  +IPG+LG+P LGETFS LSAT STKGCYDFVR RRLWHG+WFKTRIFGK+HVFVP+
Sbjct  13    SEKSVIPGRLGLPLLGETFSFLSATGSTKGCYDFVRLRRLWHGKWFKTRIFGKVHVFVPT  72

Query  1485  VDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFV  1306
              DGAKTIFAND  LFNKGYVKSMAD VGKKSLLCVP ESHKRIRRLLSDPFSMNSLS FV
Sbjct  73    TDGAKTIFANDLVLFNKGYVKSMADVVGKKSLLCVPQESHKRIRRLLSDPFSMNSLSKFV  132

Query  1305  QKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSD  1126
              +FD ML QRL +    GKSF V DF MKI FDA+CN L+S+T+  LL+ IERDC+ VS+
Sbjct  133   MEFDNMLYQRLNKLEEGGKSFVVFDFCMKIAFDAICNRLISVTEAPLLQEIERDCTYVSN  192

Query  1125  AMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDS  946
             AMLSFP+MIPGTRYYKGIKAR RLMETF  +I SRR     G E  +  DFLQ ML+RDS
Sbjct  193   AMLSFPLMIPGTRYYKGIKARKRLMETFGEMISSRR----SGKEYSD--DFLQSMLQRDS  246

Query  945   FPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKP  766
             +P SEKLED EIMDNLLTLIIAGQTTTAAAMMWSVK LDEN E+Q+RLREEQLSI+RNK 
Sbjct  247   YPPSEKLEDSEIMDNLLTLIIAGQTTTAAAMMWSVKFLDENEEVQDRLREEQLSIIRNKA  306

Query  765   KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATC  586
             +GAL+TLEDLN+M Y  +VVKETLRMSNVLLWFPRVAL++C+IEGF+IKKGWH+NIDAT 
Sbjct  307   EGALLTLEDLNSMCYGLQVVKETLRMSNVLLWFPRVALNDCRIEGFEIKKGWHLNIDATY  366

Query  585   IHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYK  406
             IH+D ++YKDP  FNPSRFDE+ +PYS++PFGSGPRTCLGINMAK+TMLV+L RLTS +K
Sbjct  367   IHFDHSLYKDPIQFNPSRFDEVPKPYSFMPFGSGPRTCLGINMAKMTMLVFLSRLTSGFK  426



>ref|XP_011083191.1| PREDICTED: cytochrome P450 85A1 [Sesamum indicum]
Length=532

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/513 (63%), Positives = 381/513 (74%), Gaps = 45/513 (9%)
 Frame = -2

Query  1719  LLVGIGIA---VYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRR  1549
             +++ +G+A   V + +      K   IPGKLG+PFLGETF+ L+A NST+GCYDFVR RR
Sbjct  24    VVIAVGLAAVLVMIFQWYPKGRKGSEIPGKLGLPFLGETFAFLAAVNSTRGCYDFVRLRR  83

Query  1548  LWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHES  1369
             L +G+WFKTRI GK HV+VPSV+GAKT+FANDF +FNK Y+KSM D VGK SLLCVP E 
Sbjct  84    LRYGKWFKTRILGKTHVYVPSVEGAKTVFANDFVMFNKRYLKSMGDMVGKNSLLCVPKEI  143

Query  1368  HKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNML  1189
             H R+R LL+DPFSMNS+S FV KFDR L +RL+     GKSF VL+F+MK  FD +C+ML
Sbjct  144   HGRMRHLLADPFSMNSVSKFVPKFDRELSERLKRLENSGKSFRVLEFSMKAAFDGICDML  203

Query  1188  MSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRM  1009
             +SITD S L ++E D + V+DAMLSFP+MIPGT YY+G+KAR RL++TFK  I  RR   
Sbjct  204   ISITDASTLDQLEHDITCVTDAMLSFPLMIPGTGYYRGMKARERLIDTFKAKITKRR---  260

Query  1008  GRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLD  829
                N  +   DFLQ ML+RDS+P +EKL+DEEI+DNLLTLIIAGQ+TTAAA+MW VK LD
Sbjct  261   ---NGEEVSDDFLQSMLQRDSYPPNEKLDDEEIVDNLLTLIIAGQSTTAAAIMWCVKFLD  317

Query  828   ENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALD  649
             EN + Q++LREEQL ILRNKP GAL+  +DL +M+Y SKVVKETLRMSNVLLW+PRVALD
Sbjct  318   ENKQAQDKLREEQLQILRNKPAGALLKYDDLMSMSYGSKVVKETLRMSNVLLWYPRVALD  377

Query  648   NCKIE------------------------------------GFDIKKGWHVNIDATCIHY  577
             NC IE                                    G++IKKGW+VNIDAT IHY
Sbjct  378   NCTIEGKFRLLNQPKNVALFLLSDCSLLWITCLALDMFVPAGYEIKKGWNVNIDATQIHY  437

Query  576   DPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSV  397
             DP  YKDP  FNPSRFDEMQ+PYSYIPFG GPRTCLGINMAK TMLV+LHRLTS Y W+V
Sbjct  438   DPNTYKDPMRFNPSRFDEMQKPYSYIPFGLGPRTCLGINMAKATMLVFLHRLTSGYTWTV  497

Query  396   DDPDPSLERKAHIPRLRSGCPITLTAFNQGDYT  298
             DD D SLERKAHIPRLRSGCPITLT  +    T
Sbjct  498   DDEDLSLERKAHIPRLRSGCPITLTRLDDTSIT  530



>ref|XP_002524333.1| Ent-kaurenoic acid oxidase, putative [Ricinus communis]
 gb|EEF38073.1| Ent-kaurenoic acid oxidase, putative [Ricinus communis]
Length=491

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/491 (62%), Positives = 378/491 (77%), Gaps = 12/491 (2%)
 Frame = -2

Query  1791  VELGKLRMVFGSMVSHYYYDVFLGLLVGIGIAVYL--LRGQTVRSKSCIIPGKLGIPFLG  1618
             ++L K  ++F   ++   YD+ +  L  I +   L   R +   S    IPG LG+PF+G
Sbjct  2     LKLSKEELLF---LAQNKYDIVMVALFSIAVFAVLKAWRKKITTSNKEDIPGGLGLPFVG  58

Query  1617  ETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFN  1438
             ET S LSATNST+GCYDFVR RR W+G+WFKTRIFGKIHVF PS + A+ +F NDF  FN
Sbjct  59    ETLSFLSATNSTRGCYDFVRLRRKWYGKWFKTRIFGKIHVFAPSTEAARKVFTNDFGEFN  118

Query  1437  KGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHR  1258
             KGY+KSMA  VG+KS+  VP ESHKRIR +LS  FS+ SLSIFVQ FD+ML QRL+    
Sbjct  119   KGYIKSMATVVGEKSVFAVPLESHKRIRHILSALFSIPSLSIFVQNFDQMLSQRLKNLQE  178

Query  1257  IGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYK  1078
              G +F VLDF MK+T D+MCNMLMSIT+ SLL++I RDC+ VSDA+LS P+MIPGT YYK
Sbjct  179   RGITFAVLDFTMKLTLDSMCNMLMSITEESLLKQILRDCAAVSDALLSVPLMIPGTTYYK  238

Query  1077  GIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNL  898
             G+KAR RLME FK  I  RR     G E  +  DFLQ +LERDS+P SE+L+D EIMDNL
Sbjct  239   GMKARERLMEIFKEKIARRR----SGEEYKD--DFLQSLLERDSYPSSERLQDSEIMDNL  292

Query  897   LTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYA  718
             LTL+++GQ ++AA MMWSVK LDEN E+ ++LREEQ +I +N  +GA +++ DLN M+Y 
Sbjct  293   LTLLVSGQVSSAATMMWSVKFLDENKEVLDKLREEQSNIAKNM-QGASLSMVDLNKMSYC  351

Query  717   SKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNP  538
              KVVKE+LRMSN +LW PRVA  +C ++GF+IKKGW+VN+DAT IHYDPA+YKDP  FNP
Sbjct  352   YKVVKESLRMSNAVLWLPRVAQKDCTVDGFEIKKGWNVNVDATHIHYDPALYKDPLRFNP  411

Query  537   SRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHI  358
             SRFDEMQ+PYS+IPFG+GPRTCLGI MAK++MLV++HRLTS Y+W ++DPDPSLER  H+
Sbjct  412   SRFDEMQKPYSFIPFGAGPRTCLGIEMAKLSMLVFIHRLTSEYEWRIEDPDPSLERTTHV  471

Query  357   PRLRSGCPITL  325
             PRLR+G PITL
Sbjct  472   PRLRTGLPITL  482



>gb|EYU24120.1| hypothetical protein MIMGU_mgv1a019906mg [Erythranthe guttata]
Length=483

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/497 (64%), Positives = 374/497 (75%), Gaps = 31/497 (6%)
 Frame = -2

Query  1776  LRMVFGSMVSHYYYDV-FLG--------LLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPF  1624
             L+  +  ++++ Y DV F G        +LVG     +  +G   R K   IPGKLG+ F
Sbjct  5     LKEAYYKILTNNYSDVIFRGVVVAVVVAILVG-----WFRKGCERRIKKGEIPGKLGVSF  59

Query  1623  LGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFAL  1444
             LGETFS L+A NST+GCYDFV+ RR+ HG WFKTRI G +HVFVPS +GAK + A+D A 
Sbjct  60    LGETFSFLAAANSTRGCYDFVKQRRIRHGNWFKTRILGHVHVFVPSTEGAKRVLASDHAA  119

Query  1443  FNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQ  1264
             FNK ++KSMADAVGKKSLL VP E H+RIRRLLSDPFSMNS+S FV KFD  LC+RL+  
Sbjct  120   FNKRFLKSMADAVGKKSLLGVPQEIHQRIRRLLSDPFSMNSMSKFVPKFDLELCERLKRL  179

Query  1263  HRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRY  1084
                GKSF VLDF  K+ FD +C MLMS+ D S LR++E D   V++AMLSFPVM PGTRY
Sbjct  180   ENEGKSFRVLDFTTKVAFDGICEMLMSVRDYSTLRKLESDVDAVNEAMLSFPVMFPGTRY  239

Query  1083  YKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMD  904
             Y+G+KAR RLMETF  +I  RR     G E+  D DFLQ +LERDS+P  EKL+D+EI+D
Sbjct  240   YRGMKARRRLMETFTKMISKRR----SGEEAPAD-DFLQSLLERDSYPPEEKLDDQEILD  294

Query  903   NLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMT  724
             NLLTLIIAGQ+TTAAA+MW VK LDEN  +Q+ LREEQLSILR KP GAL+  EDL +M+
Sbjct  295   NLLTLIIAGQSTTAAAIMWCVKFLDENKHVQHTLREEQLSILRKKPDGALLKYEDLASMS  354

Query  723   YASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHF  544
             YASKVVKETLRM+NVLLW+PR            IKKGW+VNIDAT IHYD   Y++P  F
Sbjct  355   YASKVVKETLRMANVLLWYPR------------IKKGWNVNIDATQIHYDSTTYEEPYRF  402

Query  543   NPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKA  364
             NPSRFDEMQ+PYSYIPFG+GPR CLGINMAKVTMLV+LHRLTS Y W+VDD D SLERKA
Sbjct  403   NPSRFDEMQKPYSYIPFGTGPRACLGINMAKVTMLVFLHRLTSGYTWTVDDEDLSLERKA  462

Query  363   HIPRLRSGCPITLTAFN  313
             HIPRL+SGCPITL   +
Sbjct  463   HIPRLQSGCPITLNRLD  479



>ref|XP_004303111.1| PREDICTED: cytochrome P450 716B1-like [Fragaria vesca subsp. 
vesca]
Length=491

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/485 (61%), Positives = 378/485 (78%), Gaps = 9/485 (2%)
 Frame = -2

Query  1764  FGSMVSHYYYDVFLGLLVGIGIAVYL----LRGQTVRSKSCIIPGKLGIPFLGETFSLLS  1597
             F  +V  +Y  + + LL  IG+A ++     R  T  S+   IPG+LG+PF+GET   LS
Sbjct  10    FLFLVKKHYDVLIVALLFSIGVAFFVSKLAWRKATASSRG-YIPGRLGLPFIGETVPFLS  68

Query  1596  ATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSM  1417
             A  ST GCY+F+R RR+ +G+WFKTR+FGKIHVFVPS DGA+ I +NDF  FNKGY+K++
Sbjct  69    AVKSTGGCYEFIRLRRIRYGKWFKTRVFGKIHVFVPSTDGARMILSNDFVKFNKGYMKAL  128

Query  1416  ADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTV  1237
              D +G KSL  V HE+HKRIR LLSD FSMNSLS F++KFD+MLCQRL++  + GKSF+V
Sbjct  129   LDCIGDKSLFTVSHENHKRIRDLLSDLFSMNSLSSFIEKFDKMLCQRLKKLEQGGKSFSV  188

Query  1236  LDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGR  1057
              DF+MK+ FD+MC MLMSITD +LLR++E+D + VS+A+ S P+MIPGT+YYKGIKAR R
Sbjct  189   FDFSMKMAFDSMCCMLMSITDEALLRQLEKDITAVSNAIFSAPIMIPGTKYYKGIKARRR  248

Query  1056  LMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAG  877
             +ME FK +I  RR     G E  E  DFLQ +L RDS+   EKL+D EIMDNL+TL+I+G
Sbjct  249   IMEIFKDMIARRRS----GEEWPEPEDFLQSLLRRDSYHPDEKLQDPEIMDNLMTLLISG  304

Query  876   QTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKET  697
             Q TT+A  MWSVK LDEN ++Q+ LR+E LSI R+KP+GA +TLED+N M Y  KV+KET
Sbjct  305   QATTSATQMWSVKFLDENQQVQDILRKEVLSIARSKPEGASVTLEDINRMPYCWKVLKET  364

Query  696   LRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQ  517
             +R+S+V++W+PRVAL +C IEGF+IKKGWHVN+DA CIH DP +Y DP+ FNPSRFDE+ 
Sbjct  365   MRISSVVMWYPRVALADCTIEGFEIKKGWHVNVDAKCIHNDPELYPDPSKFNPSRFDELL  424

Query  516   RPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGC  337
             +PYS+IPF SGPRTCLGINMAK+TM+V+L+RLTS Y W+VDD D SL+  AH PRLRSGC
Sbjct  425   KPYSFIPFASGPRTCLGINMAKMTMMVFLYRLTSAYSWTVDDLDTSLQENAHFPRLRSGC  484

Query  336   PITLT  322
             PITL 
Sbjct  485   PITLN  489



>gb|KDP36557.1| hypothetical protein JCGZ_08324 [Jatropha curcas]
Length=498

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/488 (59%), Positives = 374/488 (77%), Gaps = 11/488 (2%)
 Frame = -2

Query  1755  MVSHYYYDVFLGLLVGIGIAVYL-----LRGQTVRSKSCIIPGKLGIPFLGETFSLLSAT  1591
             ++ + Y D+ +     + I  +L     +   T +S    IPG +G+PF GETFS LSAT
Sbjct  14    LLQNKYNDIIIITFFSVAIIAFLEAWRRITASTSKSNEEEIPGGVGVPFFGETFSFLSAT  73

Query  1590  NSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMAD  1411
             NST+GCYDFV+ RR W+G+WFKT++FGKIHVF P+ + A+ +F+NDF  FNKGY+KSMA 
Sbjct  74    NSTRGCYDFVKLRRKWYGKWFKTKMFGKIHVFAPTTEAARQVFSNDFGEFNKGYIKSMAT  133

Query  1410  AVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLD  1231
              VG KS+   P ESH RIR +LS  FSM SLS FV  FD++L QRL +  + GKSF VL+
Sbjct  134   VVGAKSVFAAPLESHTRIRHVLSALFSMPSLSKFVGNFDQILSQRLNKLEQSGKSFPVLE  193

Query  1230  FNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLM  1051
             F MK+T D+MCNMLMSIT+ SLL +I RDC  VSDA+LS P+MIPGT YYKG+KAR RLM
Sbjct  194   FTMKLTLDSMCNMLMSITEESLLEQILRDCGLVSDALLSVPLMIPGTTYYKGMKARERLM  253

Query  1050  ETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQT  871
             + F  +I   RRR G+ N+ D    FLQ +LERDS P +E+L+D EIMDNLLTL+++GQ 
Sbjct  254   QMFTEMI--ARRRSGKENKDD----FLQYLLERDSHPSNERLDDSEIMDNLLTLLVSGQV  307

Query  870   TTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLR  691
             ++AAAMMWSVK LDEN E+ NRLREEQL+I ++K +G+++++ED+N MTY  +VVKETLR
Sbjct  308   SSAAAMMWSVKFLDENKEVLNRLREEQLNIAKDKQEGSVLSMEDVNKMTYGIQVVKETLR  367

Query  690   MSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRP  511
             MSNV+LW PR   ++ +++GF+IKKGW+VN+DAT IH+DPA+YKDP  FNPSRFDEMQ+P
Sbjct  368   MSNVVLWLPRTVQNDFRLDGFEIKKGWNVNVDATFIHFDPALYKDPLLFNPSRFDEMQKP  427

Query  510   YSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPI  331
             YS+IPFG+GPRTCLGI M K++MLV+LHRLT  Y+W ++D DPS+E+  H+PRL++G PI
Sbjct  428   YSFIPFGAGPRTCLGIEMGKLSMLVFLHRLTREYEWRIEDGDPSMEKTTHVPRLKTGLPI  487

Query  330   TLTAFNQG  307
             TL A N  
Sbjct  488   TLKALNNA  495



>ref|XP_008354232.1| PREDICTED: abscisic acid 8'-hydroxylase 4-like [Malus domestica]
Length=495

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/479 (61%), Positives = 365/479 (76%), Gaps = 12/479 (3%)
 Frame = -2

Query  1740  YYDVFLGLLVGIGIAVYLL----RGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGC  1573
             Y D+ +  L+ I + V L+    RG+   SK  I PG LG+P  GET S LS +NS KGC
Sbjct  25    YSDILIAALLSI-VTVLLVPKIARGRVTSSKGSI-PGGLGLPIFGETLSFLSTSNSAKGC  82

Query  1572  YDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKS  1393
             YDFVR RR+ +G WFKTR+FGKIHV+VPS +GA+TIFA+DFA F+K Y+K M+DAVG  S
Sbjct  83    YDFVRRRRMLYGDWFKTRLFGKIHVYVPSSEGARTIFASDFATFDKAYLKPMSDAVGVDS  142

Query  1392  LLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKIT  1213
             LL V  E+H+RIRRLLSDPFSM+SL  F+QK D++LCQ L+ +   G+ F+VL  +MK+T
Sbjct  143   LLVVAQETHRRIRRLLSDPFSMSSLPTFIQKLDKILCQELKTREESGEKFSVLALSMKLT  202

Query  1212  FDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTI  1033
              DAMC +LMS+TD  +LR  E DC+ VSDAM+SFPVMIPGTRYY G+KAR R+M+ FK +
Sbjct  203   SDAMCTLLMSVTDDKILRMFEHDCALVSDAMISFPVMIPGTRYYNGMKARARVMKVFKDM  262

Query  1032  IDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAM  853
             I  RR     G E  +D  FLQ M+ERD+ P++EKL D EIMDNLLTLIIAGQTTT+AAM
Sbjct  263   IAERRS----GKEYSDD--FLQSMIERDTCPDNEKLTDAEIMDNLLTLIIAGQTTTSAAM  316

Query  852   MWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLL  673
             MWS+K LDEN E+ +RLREEQL+I R +P+GA    ED+  M Y  KV+KETLR++NVL+
Sbjct  317   MWSLKFLDENREVLDRLREEQLTIARARPEGASAKHEDIKNMPYCVKVMKETLRLANVLV  376

Query  672   WFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPF  493
             WFPRVA  +C +EGF+IKKGW VNID T IH +P ++ +PT F+PSRFDEM +PYSYIPF
Sbjct  377   WFPRVATSDCTLEGFEIKKGWRVNIDVTRIHMNPDLFPNPTQFDPSRFDEMPKPYSYIPF  436

Query  492   GSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAF  316
             GSGPR+C G NMAK T++++LHR+ S Y W++ D DPSLE+ +HIPRL SG PITL A 
Sbjct  437   GSGPRSCJGTNMAKATIMIFLHRVVSGYSWTIHDWDPSLEKMSHIPRLSSGLPITLKAL  495



>gb|KEH20410.1| cytochrome P450 family protein [Medicago truncatula]
Length=427

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/421 (68%), Positives = 337/421 (80%), Gaps = 10/421 (2%)
 Frame = -2

Query  1785  LGKLRMVFGSMVSHYYYDVFLGLLVGIGIAVYLLRG-QTVRSKSCIIPGKLGIPFLGETF  1609
             L +  +VF   V   YYD+ L L + IG+     R  +   +    IPG+LG+PF+GETF
Sbjct  4     LSREELVF---VVQNYYDIILVLFLSIGLTYLASRAWKRATNNREDIPGRLGLPFIGETF  60

Query  1608  SLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGY  1429
             SLLSATNST+GCYDFVR RRLWHGRWFKTR+FGK+H+++P+ +GA+TIFANDF LFNKGY
Sbjct  61    SLLSATNSTRGCYDFVRLRRLWHGRWFKTRLFGKVHIYIPTPEGARTIFANDFDLFNKGY  120

Query  1428  VKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGK  1249
             VKSMADAVGKKSLLCVP ESHKRIRRLLS+PFSM SL  F+ KFD++LC RL++    GK
Sbjct  121   VKSMADAVGKKSLLCVPVESHKRIRRLLSEPFSMTSLYAFITKFDKLLCGRLQKLEESGK  180

Query  1248  SFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIK  1069
             SF  LDF M++TFDAMC MLMSIT+ SLLR+IE+DC+ VS+AMLSFPVMIPGTRYYKGI 
Sbjct  181   SFKTLDFCMEMTFDAMCGMLMSITEDSLLRQIEKDCTAVSNAMLSFPVMIPGTRYYKGIT  240

Query  1068  ARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTL  889
             AR RLMETF+ II  RR    RG ES    DFLQ ML+RDSFP SEKL+D EIMDNLLTL
Sbjct  241   ARNRLMETFREIIARRR----RGEESPG--DFLQSMLQRDSFPASEKLDDSEIMDNLLTL  294

Query  888   IIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKV  709
             IIAGQTTTAAAMMWSVK L++N + Q+ LREEQLS+ + KP+GA +  ED+N M Y  KV
Sbjct  295   IIAGQTTTAAAMMWSVKFLNDNRDAQDILREEQLSLTKMKPEGASLNHEDINNMRYGLKV  354

Query  708   VKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRF  529
             VKETLRMSNVLLWFPRVAL +C IEG++IKKGWHVNIDATCIHYD  ++ DP  FNP RF
Sbjct  355   VKETLRMSNVLLWFPRVALKDCTIEGYEIKKGWHVNIDATCIHYDSDLFMDPLKFNPQRF  414

Query  528   D  526
             D
Sbjct  415   D  415



>ref|XP_010649115.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like isoform X4 [Vitis 
vinifera]
Length=369

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/373 (74%), Positives = 314/373 (84%), Gaps = 7/373 (2%)
 Frame = -2

Query  1419  MADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFT  1240
             MAD VGKKSLLCVP ESHKRIRRLLSDPFSMNSLS FV +FD ML QRL +    GKSF 
Sbjct  1     MADVVGKKSLLCVPQESHKRIRRLLSDPFSMNSLSKFVMEFDNMLYQRLNKLEEGGKSFV  60

Query  1239  VLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARG  1060
             V DF MKI FDA+CN L+S+T+  LL+ IERDC+ VS+AMLSFP+MIPGTRYYKGIKAR 
Sbjct  61    VFDFCMKIAFDAICNRLISVTEAPLLQEIERDCTYVSNAMLSFPLMIPGTRYYKGIKARK  120

Query  1059  RLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIA  880
             RLMETF  +I SRR     G E  +D  FLQ ML+RDS+P SEKLED EIMDNLLTLIIA
Sbjct  121   RLMETFGEMISSRRS----GKEYSDD--FLQSMLQRDSYPPSEKLEDSEIMDNLLTLIIA  174

Query  879   GQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKE  700
             GQTTTAAAMMWSVK LDEN E+Q+RLREEQLSI+RNK +GAL+TLEDLN+M Y  +VVKE
Sbjct  175   GQTTTAAAMMWSVKFLDENEEVQDRLREEQLSIIRNKAEGALLTLEDLNSMCYGLQVVKE  234

Query  699   TLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFD-E  523
             TLRMSNVLLWFPRVAL++C+IEGF+IKKGWH+NIDAT IH+D ++YKDP  FNPSRFD E
Sbjct  235   TLRMSNVLLWFPRVALNDCRIEGFEIKKGWHLNIDATYIHFDHSLYKDPIQFNPSRFDVE  294

Query  522   MQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRS  343
             + +PYS++PFGSGPRTCLGINMAK+TMLV+L RLTS +KW VDD DP LE+KAHIPRLRS
Sbjct  295   VPKPYSFMPFGSGPRTCLGINMAKMTMLVFLSRLTSGFKWRVDDRDPCLEKKAHIPRLRS  354

Query  342   GCPITLTAFNQGD  304
             GCPITL    + D
Sbjct  355   GCPITLRTLKKRD  367



>gb|KDP44569.1| hypothetical protein JCGZ_22151 [Jatropha curcas]
Length=415

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/455 (62%), Positives = 336/455 (74%), Gaps = 45/455 (10%)
 Frame = -2

Query  1755  MVSHYYYDVFLGLLVGIGIAVYLLRGQTVRSKSCI-----IPGKLGIPFLGETFSLLSAT  1591
             M  HY+  + +  L  +   V     + V   +C+     IPG+LG+PF+GETFS LSA+
Sbjct  1     MEDHYFLVLIVVALFSLAYVVSKKAWKRVPGDACLGESAQIPGRLGLPFIGETFSFLSAS  60

Query  1590  NSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMAD  1411
             NS KGCY+FVR RRL +G+ FKTRIFGKIHVF+PS  GA+ IF NDF  FNKGYVKSMAD
Sbjct  61    NSNKGCYEFVRLRRLLYGKCFKTRIFGKIHVFIPSTKGARHIFTNDFLEFNKGYVKSMAD  120

Query  1410  AVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLD  1231
             AVG+KSLLCVPH+SHKRIRRLLSDPFS+ SL  FV KFD+ML Q+L++  + GKSF VL 
Sbjct  121   AVGQKSLLCVPHDSHKRIRRLLSDPFSLPSLCKFVHKFDQMLTQKLKKLEQTGKSFKVLH  180

Query  1230  FNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLM  1051
             F+M++TFDAMCNMLMS+TD  LLR IE+DC+ VSDAMLSFP+MIPGTRYYKGIKAR RLM
Sbjct  181   FSMQMTFDAMCNMLMSVTDDFLLRHIEKDCNAVSDAMLSFPLMIPGTRYYKGIKARQRLM  240

Query  1050  ETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQT  871
             +T + II  RR     G E+ +  DFLQ ML RDS+P SEKL+DEEIMDN+LTLIIAGQT
Sbjct  241   KTMRGIIADRR----SGRETCD--DFLQSMLGRDSYPSSEKLDDEEIMDNILTLIIAGQT  294

Query  870   TTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLR  691
             TTAAAMMWSVK LDEN E Q++LREEQL I +NK    L++LEDL+ M+Y SKVVKETLR
Sbjct  295   TTAAAMMWSVKFLDENREAQDKLREEQLLIAKNKQFAGLLSLEDLHKMSYGSKVVKETLR  354

Query  690   MSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRP  511
             +SNVLLWFPRVA  +C I+G                                   EMQ+P
Sbjct  355   LSNVLLWFPRVAEHDCIIDG----------------------------------KEMQKP  380

Query  510   YSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYK  406
             YSYIPFGSGPR CLG+NMAKVTMLV+LHRLTS Y+
Sbjct  381   YSYIPFGSGPRACLGMNMAKVTMLVFLHRLTSGYE  415



>gb|KCW56713.1| hypothetical protein EUGRSUZ_I02403 [Eucalyptus grandis]
Length=393

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/371 (71%), Positives = 309/371 (83%), Gaps = 6/371 (2%)
 Frame = -2

Query  1740  YYDVFLGLLVGIGIAVYL-LRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDF  1564
             YYDV   +LV +G   Y   + + +  +   IPG+LG+PF+GETFS LSATNSTKGCY+F
Sbjct  16    YYDVLFAVLVSVGFMFYFSAKAKKISGERDHIPGRLGVPFVGETFSFLSATNSTKGCYEF  75

Query  1563  VRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLC  1384
             VR RRLW+G+WFKTRIFGK+HVF+P+  GAKT+FA+DFA FNKGYVKSMADAVGKKSLLC
Sbjct  76    VRLRRLWYGKWFKTRIFGKVHVFIPTTGGAKTVFASDFAQFNKGYVKSMADAVGKKSLLC  135

Query  1383  VPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDA  1204
             VPHESHKRIR LLSDPFSM SLS FV KFD+MLCQRL++    GK F VLDFNMKI FDA
Sbjct  136   VPHESHKRIRHLLSDPFSMPSLSKFVTKFDKMLCQRLKKLEEHGKRFVVLDFNMKIAFDA  195

Query  1203  MCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDS  1024
             MC MLMS+T+ S+L++IE+DC+ VS+AMLSFPVMIPGTRYY+GIKAR RLMETF+ +I+ 
Sbjct  196   MCEMLMSVTEESMLQQIEKDCTDVSNAMLSFPVMIPGTRYYRGIKARNRLMETFREMIEE  255

Query  1023  RRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWS  844
             RR   GRG  + E  DFLQ ML+RDS P  EKL+D EIMDNLLTLIIAGQTTTAAAMMWS
Sbjct  256   RR---GRGKGAPE--DFLQSMLDRDSLPPEEKLDDSEIMDNLLTLIIAGQTTTAAAMMWS  310

Query  843   VKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFP  664
             VK LDEN E Q+RLREEQL+ILR KP+GA +TLEDLN+M+Y  KV KETLRMSNVLLW+P
Sbjct  311   VKFLDENPEAQDRLREEQLAILRKKPQGAALTLEDLNSMSYGLKVAKETLRMSNVLLWYP  370

Query  663   RVALDNCKIEG  631
             RVA+ +C IEG
Sbjct  371   RVAITDCTIEG  381



>gb|KEH20409.1| cytochrome P450 family protein [Medicago truncatula]
Length=386

 Score =   528 bits (1360),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 263/386 (68%), Positives = 308/386 (80%), Gaps = 10/386 (3%)
 Frame = -2

Query  1785  LGKLRMVFGSMVSHYYYDVFLGLLVGIGIAVYLLRG-QTVRSKSCIIPGKLGIPFLGETF  1609
             L +  +VF   V   YYD+ L L + IG+     R  +   +    IPG+LG+PF+GETF
Sbjct  4     LSREELVF---VVQNYYDIILVLFLSIGLTYLASRAWKRATNNREDIPGRLGLPFIGETF  60

Query  1608  SLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGY  1429
             SLLSATNST+GCYDFVR RRLWHGRWFKTR+FGK+H+++P+ +GA+TIFANDF LFNKGY
Sbjct  61    SLLSATNSTRGCYDFVRLRRLWHGRWFKTRLFGKVHIYIPTPEGARTIFANDFDLFNKGY  120

Query  1428  VKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGK  1249
             VKSMADAVGKKSLLCVP ESHKRIRRLLS+PFSM SL  F+ KFD++LC RL++    GK
Sbjct  121   VKSMADAVGKKSLLCVPVESHKRIRRLLSEPFSMTSLYAFITKFDKLLCGRLQKLEESGK  180

Query  1248  SFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIK  1069
             SF  LDF M++TFDAMC MLMSIT+ SLLR+IE+DC+ VS+AMLSFPVMIPGTRYYKGI 
Sbjct  181   SFKTLDFCMEMTFDAMCGMLMSITEDSLLRQIEKDCTAVSNAMLSFPVMIPGTRYYKGIT  240

Query  1068  ARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTL  889
             AR RLMETF+ II  RR    RG ES    DFLQ ML+RDSFP SEKL+D EIMDNLLTL
Sbjct  241   ARNRLMETFREIIARRR----RGEESPG--DFLQSMLQRDSFPASEKLDDSEIMDNLLTL  294

Query  888   IIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKV  709
             IIAGQTTTAAAMMWSVK L++N + Q+ LREEQLS+ + KP+GA +  ED+N M Y  KV
Sbjct  295   IIAGQTTTAAAMMWSVKFLNDNRDAQDILREEQLSLTKMKPEGASLNHEDINNMRYGLKV  354

Query  708   VKETLRMSNVLLWFPRVALDNCKIEG  631
             VKETLRMSNVLLWFPRVAL +C IEG
Sbjct  355   VKETLRMSNVLLWFPRVALKDCTIEG  380



>gb|KEH20408.1| cytochrome P450 family protein [Medicago truncatula]
Length=394

 Score =   528 bits (1361),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 263/386 (68%), Positives = 308/386 (80%), Gaps = 10/386 (3%)
 Frame = -2

Query  1785  LGKLRMVFGSMVSHYYYDVFLGLLVGIGIAVYLLRG-QTVRSKSCIIPGKLGIPFLGETF  1609
             L +  +VF   V   YYD+ L L + IG+     R  +   +    IPG+LG+PF+GETF
Sbjct  4     LSREELVF---VVQNYYDIILVLFLSIGLTYLASRAWKRATNNREDIPGRLGLPFIGETF  60

Query  1608  SLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGY  1429
             SLLSATNST+GCYDFVR RRLWHGRWFKTR+FGK+H+++P+ +GA+TIFANDF LFNKGY
Sbjct  61    SLLSATNSTRGCYDFVRLRRLWHGRWFKTRLFGKVHIYIPTPEGARTIFANDFDLFNKGY  120

Query  1428  VKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGK  1249
             VKSMADAVGKKSLLCVP ESHKRIRRLLS+PFSM SL  F+ KFD++LC RL++    GK
Sbjct  121   VKSMADAVGKKSLLCVPVESHKRIRRLLSEPFSMTSLYAFITKFDKLLCGRLQKLEESGK  180

Query  1248  SFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIK  1069
             SF  LDF M++TFDAMC MLMSIT+ SLLR+IE+DC+ VS+AMLSFPVMIPGTRYYKGI 
Sbjct  181   SFKTLDFCMEMTFDAMCGMLMSITEDSLLRQIEKDCTAVSNAMLSFPVMIPGTRYYKGIT  240

Query  1068  ARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTL  889
             AR RLMETF+ II  RR    RG ES    DFLQ ML+RDSFP SEKL+D EIMDNLLTL
Sbjct  241   ARNRLMETFREIIARRR----RGEESPG--DFLQSMLQRDSFPASEKLDDSEIMDNLLTL  294

Query  888   IIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKV  709
             IIAGQTTTAAAMMWSVK L++N + Q+ LREEQLS+ + KP+GA +  ED+N M Y  KV
Sbjct  295   IIAGQTTTAAAMMWSVKFLNDNRDAQDILREEQLSLTKMKPEGASLNHEDINNMRYGLKV  354

Query  708   VKETLRMSNVLLWFPRVALDNCKIEG  631
             VKETLRMSNVLLWFPRVAL +C IEG
Sbjct  355   VKETLRMSNVLLWFPRVALKDCTIEG  380



>ref|XP_010110046.1| Abscisic acid 8'-hydroxylase 4 [Morus notabilis]
 gb|EXC25064.1| Abscisic acid 8'-hydroxylase 4 [Morus notabilis]
Length=505

 Score =   473 bits (1218),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 238/484 (49%), Positives = 325/484 (67%), Gaps = 25/484 (5%)
 Frame = -2

Query  1719  LLVGIGIAVYLLRGQTVR-----------SKSCIIPGKLGIPFLGETFSLLSATNSTKGC  1573
             +LV +G  ++L+  Q V+           S + I PG  G+PF+GET   ++A NS KG 
Sbjct  18    MLVVLGALLFLILYQIVKMLLLLKYRNQESTANIPPGSTGLPFVGETLQFMAAINSHKGF  77

Query  1572  YDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKS  1393
             YDFVR RRL +G  F+T IFG+ HVFV S + AK I  ND   F K Y+KS+A+ VG +S
Sbjct  78    YDFVRIRRLRYGNCFRTNIFGETHVFVSSTESAKAILNNDSGKFTKRYIKSIAELVGHQS  137

Query  1392  LLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEE-QHRIGKSFTVLDFNMKI  1216
             LLC  H+ HK IR  LS+ FSM SLS+F+++FD+++   L   +H+   +  VLD  +KI
Sbjct  138   LLCASHQHHKLIRGRLSNLFSMTSLSLFIKQFDQLIVDNLSSWEHK--ATVVVLDEALKI  195

Query  1215  TFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKT  1036
             T  AMC MLM+I  G  L  ++++ + V +A+L+FP+ IPGTR+YKG++AR R+M   + 
Sbjct  196   TCKAMCKMLMNIESGYKLEILQKEVARVCEALLAFPLRIPGTRFYKGLQARKRIMSIIEE  255

Query  1035  IIDSRRRRMGRGNESDEDRDFLQEMLERD------SFPESEKLEDEEIMDNLLTLIIAGQ  874
              I  RRR +G    +++  DFL  +L  D      + P  +KL D EI DN+LT+IIAGQ
Sbjct  256   EISDRRRGLG----TNQHEDFLGSLLAGDDKACYEAGPNRQKLLDSEIQDNILTMIIAGQ  311

Query  873   TTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETL  694
              TTA+A+ W VK LD+N E+ + LR+EQL + R  P+   +TLEDLN M YASKVVKE+L
Sbjct  312   DTTASAVTWMVKYLDDNQEVLHTLRDEQLQLARKSPEKTFLTLEDLNDMPYASKVVKESL  371

Query  693   RMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRF-DEMQ  517
             RM++++ WFPR+AL +C+IE F IKKGW+VNIDA  +H +P +Y DP  FNPSRF D   
Sbjct  372   RMASIVPWFPRLALHDCEIERFKIKKGWNVNIDARAVHLNPTMYNDPKKFNPSRFGDAES  431

Query  516   RPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGC  337
             RPYS++ FG G RTCLGINMAK  MLV+LHRL + Y+W V D D S+E+ A   RL+SGC
Sbjct  432   RPYSFLAFGMGGRTCLGINMAKAMMLVFLHRLVTTYRWKVIDQDSSIEKWAMFSRLKSGC  491

Query  336   PITL  325
             P+ +
Sbjct  492   PVIV  495



>ref|XP_010263599.1| PREDICTED: abscisic acid 8'-hydroxylase 3 [Nelumbo nucifera]
Length=481

 Score =   457 bits (1177),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 238/483 (49%), Positives = 323/483 (67%), Gaps = 16/483 (3%)
 Frame = -2

Query  1746  HYYYDVFLGLLVGIGIAVYLLRGQT----VRSKSC--IIPGKLGIPFLGETFSLLSATNS  1585
             H +  + L L   + IA +L R        R+KS   I PG  G+P +GE+   LSA +S
Sbjct  5     HAFLPLGLHLCSVLVIAFWLFRTTQKILLCRNKSTDNIPPGTGGLPLIGESLQFLSANSS  64

Query  1584  TKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAV  1405
              KG Y FV  RRL +G  FKT IFGK HVFV SV+ AK I +NDF  F K YVKS+++ V
Sbjct  65    AKGLYHFVHIRRLRYGNCFKTNIFGKTHVFVSSVESAKAILSNDFVNFTKRYVKSISELV  124

Query  1404  GKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEE-QHRIGKSFTVLDF  1228
             G +S+LC   E H+ IR  LS+ F+M+S S F++ FD ++   L   +H+  ++  VLD 
Sbjct  125   GDQSILCATQEYHRLIRGRLSNLFTMDSTSSFIKHFDHLIVTTLRSWEHK--QTVVVLDD  182

Query  1227  NMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLME  1048
              +K+TF A+C M +S+ + + L  +++D   V +AML+FP+ +P TR+  G+KAR R+ME
Sbjct  183   ALKVTFQAICKMAISLENPNELEMLQKDVGQVCEAMLAFPLNLPYTRFRAGMKARKRIME  242

Query  1047  TFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTT  868
               K IID RR+  G  +E     DF+Q ++  D      KL D ++ DN+LT+IIAGQ T
Sbjct  243   MLKKIIDERRQGCGECHE-----DFIQSLVSEDE-KLGCKLTDSQVQDNILTMIIAGQIT  296

Query  867   TAAAMMWSVKLLDENTEIQNRLREEQLSILRNK-PKGALITLEDLNTMTYASKVVKETLR  691
             TA+AM W VK LDEN EIQ+ LR EQ  +L +K P G+ +T+EDLN M YASKVV+E+LR
Sbjct  297   TASAMTWMVKYLDENQEIQHTLRAEQQLMLADKNPCGSPLTIEDLNAMPYASKVVRESLR  356

Query  690   MSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRP  511
             M++V+ WFPRVAL +C+IEGF IKKGW VNIDA  IH DP +Y DP+ F PSRFD+  +P
Sbjct  357   MASVVPWFPRVALKDCEIEGFKIKKGWIVNIDARYIHLDPTVYHDPSEFYPSRFDDESKP  416

Query  510   YSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPI  331
             YS++ FG+G RTCLG+N+AK  MLV+L+RL + Y+W V DPD SLE+     R R+GCPI
Sbjct  417   YSFLAFGTGGRTCLGMNLAKAMMLVFLNRLVTTYRWKVMDPDSSLEKWVLFARPRTGCPI  476

Query  330   TLT  322
              +T
Sbjct  477   RVT  479



>ref|XP_009365520.1| PREDICTED: abscisic acid 8'-hydroxylase 1 [Pyrus x bretschneideri]
 ref|XP_009365521.1| PREDICTED: abscisic acid 8'-hydroxylase 1 [Pyrus x bretschneideri]
Length=495

 Score =   452 bits (1162),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 229/492 (47%), Positives = 318/492 (65%), Gaps = 24/492 (5%)
 Frame = -2

Query  1740  YYDVFLGLLVGIGIAVYLLRGQTVRSKSC---------IIPGKLGIPFLGETFSLLSATN  1588
             YY      +V +  A+  L  Q ++S +C         I PG  G+PF+GET   +++ N
Sbjct  10    YYSFGCYAVVVVLGALSCLLYQIIKSMNCSNHDISTADIPPGSRGLPFIGETLKFMASLN  69

Query  1587  STKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADA  1408
             S KG Y+FVR RRL HG  F+T IFG+ HVFV S + A+ +  ND   F+K Y+KS+A  
Sbjct  70    SGKGLYEFVRLRRLRHGNCFRTNIFGETHVFVSSTESARAVLNNDLGRFSKRYMKSIAAL  129

Query  1407  VGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEE-QHRIGKSFTVLD  1231
             VG +SLLC  H+ HK IR  LS+ FS NSLS+F+++FD ++   L   +HR      + D
Sbjct  130   VGNQSLLCASHQHHKLIRGQLSNLFSTNSLSVFIKQFDELIVDALRGWEHR--SCVVIQD  187

Query  1230  FNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLM  1051
               +KIT  AMC ML+S+  G  L  ++++ + V +AMLSFP+ +P TR+YKG++AR ++M
Sbjct  188   EALKITCKAMCKMLISVESGYELEVLQKEVAHVCEAMLSFPLRLPRTRFYKGLQARKKIM  247

Query  1050  ETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESE------KLEDEEIMDNLLTL  889
                   I  RR+ +    E     D LQ +L  D     E      +L DEEI DN+LT+
Sbjct  248   GIIGDAISERRKGLEVKCE-----DLLQRLLTEDEKACGETGTTARQLTDEEIKDNILTM  302

Query  888   IIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKV  709
             IIAGQ TTA+AM W VK LDEN E+ + L +EQL + R     + +TLE +N M YASKV
Sbjct  303   IIAGQDTTASAMTWMVKFLDENPEVLHTLMKEQLDLARKTSSKSFLTLESINDMPYASKV  362

Query  708   VKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRF  529
             VKE+LR+++V+ WFPR+AL++C++EGF IK+GW+VN+DA  +H DP +Y DP  FNPSRF
Sbjct  363   VKESLRLASVVPWFPRLALEDCEMEGFKIKRGWNVNVDAKSVHLDPTVYTDPNKFNPSRF  422

Query  528   -DEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPR  352
              DE + PYS++ FG G RTCLG+NMAK  MLV+LHRLT+ Y+W V D D S+E+     +
Sbjct  423   DDESKVPYSFLAFGMGGRTCLGMNMAKAMMLVFLHRLTTTYRWKVIDADSSIEKWGLFSK  482

Query  351   LRSGCPITLTAF  316
             L+SGCP+T+T  
Sbjct  483   LKSGCPVTVTCI  494



>ref|XP_008220838.1| PREDICTED: abscisic acid 8'-hydroxylase 3 isoform X2 [Prunus 
mume]
Length=496

 Score =   451 bits (1159),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 218/469 (46%), Positives = 312/469 (67%), Gaps = 15/469 (3%)
 Frame = -2

Query  1692  YLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIF  1513
             ++++     S + I PG  G+P +GET   ++A NS KG Y+FVR RRL HG  F+T IF
Sbjct  31    HIIKSNNQESTADIPPGSQGLPLIGETLQFMAAINSGKGFYEFVRLRRLRHGNCFRTNIF  90

Query  1512  GKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPF  1333
             G+  VFV S + AK I  ND   F+K Y++S+ + VG +SLLC  H+ HK IR  LS+ F
Sbjct  91    GETDVFVSSTESAKAILNNDSGKFSKRYIRSIGELVGNQSLLCASHQHHKLIRSQLSNLF  150

Query  1332  SMNSLSIFVQKFDRMLCQRLEE-QHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRR  1156
             S +SLS+F+++FD+++   L   +HR   +  + D  +KIT  AMC ML+S+  G  L  
Sbjct  151   STSSLSVFIKQFDQLIVDALRGWEHR--STVVIQDEALKITCKAMCKMLISVESGYELEV  208

Query  1155  IERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRD  976
             +E++ + V +AML+ P+ +PGTR+YKG++AR ++M      ++ RRR +    E     D
Sbjct  209   LEKEVAHVCEAMLALPLRLPGTRFYKGLQARKKIMAIVGKAMNERRRGLHANGE-----D  263

Query  975   FLQEMLERD------SFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEI  814
             FLQ +++ D      +      L DEEI DN+LT+IIAGQ TTA+AM W VK LDEN E+
Sbjct  264   FLQRLVDEDDKACNGATTNGGGLTDEEIQDNILTMIIAGQDTTASAMTWMVKFLDENPEV  323

Query  813   QNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIE  634
              + L  EQL + R     + +TLE +N M YASKVVKE+LR+++++ WFPR+AL++C++E
Sbjct  324   LDTLLREQLDLARKVSSKSFLTLESINDMPYASKVVKESLRLASIVPWFPRLALEDCEME  383

Query  633   GFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRF-DEMQRPYSYIPFGSGPRTCLGINM  457
             GF IK+GW+VN+DA  +H DP +Y DP  FNPSRF DE + PYS++ FG G RTCLG+NM
Sbjct  384   GFKIKRGWNVNVDAKSVHLDPTVYNDPNKFNPSRFDDESKVPYSFLAFGMGGRTCLGMNM  443

Query  456   AKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFNQ  310
             AK  MLV+LHRL + Y+W V +PD S+E+     +LRSGCP+T+T   +
Sbjct  444   AKAMMLVFLHRLITTYRWKVINPDVSIEKWGLFSKLRSGCPVTVTCITE  492



>ref|XP_008364981.1| PREDICTED: abscisic acid 8'-hydroxylase 1-like [Malus domestica]
 ref|XP_008364982.1| PREDICTED: abscisic acid 8'-hydroxylase 1-like [Malus domestica]
 ref|XP_008364983.1| PREDICTED: abscisic acid 8'-hydroxylase 1-like [Malus domestica]
Length=504

 Score =   447 bits (1151),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 226/498 (45%), Positives = 321/498 (64%), Gaps = 25/498 (5%)
 Frame = -2

Query  1740  YYDVFLGLLVGIGIAVYLLRGQTVRSKSC---------IIPGKLGIPFLGETFSLLSATN  1588
             YY      +V +  A+  L  Q ++S +C         I PG  G+PF+GET   +++ N
Sbjct  10    YYSFGCYXVVXVLGALSCLLYQIIKSXNCSNHDISTAEIPPGSRGLPFIGETLKFMASIN  69

Query  1587  STKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADA  1408
             S KG Y+FVR RRL HG  F+T IFG+ HVFV S D AK +  ND   F+K Y+K++A  
Sbjct  70    SGKGFYEFVRLRRLRHGNCFRTNIFGETHVFVSSTDSAKAVLNNDLGRFSKRYMKTIAAL  129

Query  1407  VGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEE-QHRIGKSFTVLD  1231
             VG +SLLC  H+ HK IR  LS+ FS NSLS+F+++FD ++   +   +HR      + D
Sbjct  130   VGNQSLLCASHQHHKLIRGQLSNLFSTNSLSVFIKQFDELIVDAMRGWEHR--SCVVIQD  187

Query  1230  FNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLM  1051
               +KIT  AMC ML+S+  G  L  ++++ + V +AML+FP+ +P TR+YKG++AR ++M
Sbjct  188   EAVKITCKAMCKMLISVESGYELEVLQKEVAHVCEAMLAFPLRLPRTRFYKGLQARKKIM  247

Query  1050  ETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESE------KLEDEEIMDNLLTL  889
                   +  RR+ +   +E     D LQ +L  D     E      +L DEEI DN+LT+
Sbjct  248   GIIGDAMSERRKGLEVKSE-----DLLQRLLTEDEKACGETGTTARQLTDEEIKDNILTM  302

Query  888   IIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKV  709
             IIAGQ TTA+AM W +K LDEN E+   L +EQL + R     + +TLE +N M YA+KV
Sbjct  303   IIAGQDTTASAMTWMIKFLDENPEVLPTLMKEQLDLARKTSSKSFLTLESINDMPYAAKV  362

Query  708   VKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRF  529
              KE+LR+++V+ WFPR+AL++C++EGF IK+GW+VN+DA  +H DP +Y DP  FNPSRF
Sbjct  363   XKESLRLASVVPWFPRLALEDCEMEGFKIKRGWNVNVDAKSVHLDPTVYTDPNKFNPSRF  422

Query  528   -DEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPR  352
              DE + PYS++ FG G RTCLG+NMAK  MLV+LHRLT+ Y+W V D D S+E+     +
Sbjct  423   DDESKVPYSFLAFGMGGRTCLGMNMAKAMMLVFLHRLTTTYRWKVIDADSSIEKWGLFSK  482

Query  351   LRSGCPITLTAFNQGDYT  298
             L+SGCP+T+T   + +YT
Sbjct  483   LKSGCPVTVTCIAE-NYT  499



>ref|XP_002300756.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE80029.1| cytochrome P450 family protein [Populus trichocarpa]
Length=519

 Score =   447 bits (1151),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 220/447 (49%), Positives = 302/447 (68%), Gaps = 9/447 (2%)
 Frame = -2

Query  1653  IIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGA  1474
             I PG  G+P +GET   ++A N+ +G YDFVR RRL +G  FKT I G   VFV S + A
Sbjct  64    IPPGSCGLPLIGETIQFMAAMNNGRGFYDFVRARRLRYGNCFKTNILGLAQVFVSSTESA  123

Query  1473  KTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFD  1294
             K I  N+   F K Y+KS+A+ VG +SLLC  H  HK IR  L+  FS +S+S+F+++FD
Sbjct  124   KIILNNESGKFTKRYIKSIAELVGDQSLLCASHGHHKLIRSCLTHLFSTSSISVFIKQFD  183

Query  1293  RMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLS  1114
              ++ + L    ++G +  VLD   +ITF AMC MLMS+ D   L+ ++ D + V +AML+
Sbjct  184   ELVVKSLG-TWQVGDTIVVLDQATEITFKAMCRMLMSLEDEPKLQMLQEDITHVCEAMLA  242

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPES  934
             FPV  P TR+YKG+KAR R+M T   I+ + RRR  +GN+    +DF+Q +L  D  P S
Sbjct  243   FPVRFPWTRFYKGLKARKRIMSTLDLIM-TERRRCSQGNQ----KDFMQCLLVEDEKPGS  297

Query  933   EK---LEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPK  763
             ++   + D EI DN+LT+IIAGQ TTA+A+ W VK L EN ++ + LR EQL +      
Sbjct  298   DEAYTMTDTEIKDNILTMIIAGQDTTASAITWMVKYLGENQDVLDTLRAEQLHLAEKISP  357

Query  762   GALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCI  583
             G  +TLEDL  M YASKVVKE+LRM++++ WFPR+AL +C+IEGF IKKGW++N+D   I
Sbjct  358   GPFLTLEDLAEMPYASKVVKESLRMASIVPWFPRLALQDCEIEGFKIKKGWNINVDVKSI  417

Query  582   HYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKW  403
             H DP +Y  P  FNP+RF++  +PYS++ FG G RTCLG+NMAK  MLV+LHRL + YKW
Sbjct  418   HLDPNLYNGPNKFNPTRFNDDSKPYSFLAFGMGARTCLGMNMAKAMMLVFLHRLITTYKW  477

Query  402   SVDDPDPSLERKAHIPRLRSGCPITLT  322
              V D D S+E+ A   RL+SGCP+ +T
Sbjct  478   KVIDSDSSIEKWALFSRLKSGCPVQVT  504



>ref|XP_008220837.1| PREDICTED: abscisic acid 8'-hydroxylase 3 isoform X1 [Prunus 
mume]
Length=502

 Score =   446 bits (1146),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 219/475 (46%), Positives = 312/475 (66%), Gaps = 21/475 (4%)
 Frame = -2

Query  1692  YLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIF  1513
             ++++     S + I PG  G+P +GET   ++A NS KG Y+FVR RRL HG  F+T IF
Sbjct  31    HIIKSNNQESTADIPPGSQGLPLIGETLQFMAAINSGKGFYEFVRLRRLRHGNCFRTNIF  90

Query  1512  GKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPF  1333
             G+  VFV S + AK I  ND   F+K Y++S+ + VG +SLLC  H+ HK IR  LS+ F
Sbjct  91    GETDVFVSSTESAKAILNNDSGKFSKRYIRSIGELVGNQSLLCASHQHHKLIRSQLSNLF  150

Query  1332  SMNSLSIFVQKFDRMLCQRLEE-QHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRR  1156
             S +SLS+F+++FD+++   L   +HR   +  + D  +KIT  AMC ML+S+  G  L  
Sbjct  151   STSSLSVFIKQFDQLIVDALRGWEHR--STVVIQDEALKITCKAMCKMLISVESGYELEV  208

Query  1155  IERDCSTVSDAMLSFPVMIPGTRYYKG------IKARGRLMETFKTIIDSRRRRMGRGNE  994
             +E++ + V +AML+ P+ +PGTR+YKG      I+AR ++M      ++ RRR +    E
Sbjct  209   LEKEVAHVCEAMLALPLRLPGTRFYKGLQYDHFIQARKKIMAIVGKAMNERRRGLHANGE  268

Query  993   SDEDRDFLQEMLERD------SFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLL  832
                  DFLQ +++ D      +      L DEEI DN+LT+IIAGQ TTA+AM W VK L
Sbjct  269   -----DFLQRLVDEDDKACNGATTNGGGLTDEEIQDNILTMIIAGQDTTASAMTWMVKFL  323

Query  831   DENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVAL  652
             DEN E+ + L  EQL + R     + +TLE +N M YASKVVKE+LR+++++ WFPR+AL
Sbjct  324   DENPEVLDTLLREQLDLARKVSSKSFLTLESINDMPYASKVVKESLRLASIVPWFPRLAL  383

Query  651   DNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRF-DEMQRPYSYIPFGSGPRT  475
             ++C++EGF IK+GW+VN+DA  +H DP +Y DP  FNPSRF DE + PYS++ FG G RT
Sbjct  384   EDCEMEGFKIKRGWNVNVDAKSVHLDPTVYNDPNKFNPSRFDDESKVPYSFLAFGMGGRT  443

Query  474   CLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFNQ  310
             CLG+NMAK  MLV+LHRL + Y+W V +PD S+E+     +LRSGCP+T+T   +
Sbjct  444   CLGMNMAKAMMLVFLHRLITTYRWKVINPDVSIEKWGLFSKLRSGCPVTVTCITE  498



>ref|XP_011028878.1| PREDICTED: abscisic acid 8'-hydroxylase 1 [Populus euphratica]
Length=500

 Score =   445 bits (1144),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 223/448 (50%), Positives = 300/448 (67%), Gaps = 11/448 (2%)
 Frame = -2

Query  1653  IIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGA  1474
             I PG  G+P +GET   ++A N+ +G YDFVR RRL +G+ FKT I G   VFV S + A
Sbjct  45    IPPGSCGLPLIGETIQFMAAMNNGRGYYDFVRARRLRYGKCFKTNILGLAQVFVSSTESA  104

Query  1473  KTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFD  1294
             K I  N+   F K Y+KS+A+ VG +SLLC  H  HK IR  L+  FS +S+S+F+++FD
Sbjct  105   KIILKNESGKFTKRYIKSIAELVGDQSLLCASHGQHKLIRSCLTHLFSTSSISVFIRQFD  164

Query  1293  RMLCQRLEE-QHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAML  1117
              ++ + L   Q R   +  VLD   +ITF AMC MLMS  D   L  ++ D + V +AML
Sbjct  165   ELVVKSLSTWQDR--DTIVVLDHATEITFKAMCRMLMSSEDDPKLEMLQEDITLVCEAML  222

Query  1116  SFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFP-  940
             +FP+  P TR+YKG+KAR R+M T   I+ + RRR  +GN+    +DF+Q +L  D  P 
Sbjct  223   AFPIRFPWTRFYKGLKARKRIMSTLDLIM-TERRRCSQGNQ----KDFMQCLLVEDEKPG  277

Query  939   --ESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKP  766
               E+ ++ D EI DN+LT+IIAGQ TTA+A+ W VK L EN ++ + LR EQL +     
Sbjct  278   SDEAYRMTDTEIKDNILTMIIAGQDTTASAIAWMVKYLGENQDVLDTLRAEQLHLAEKIS  337

Query  765   KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATC  586
              G  +TLEDL  M YASKVVKE+LRM++++ WFPR AL +C+IEGF IKKGW++N+DA  
Sbjct  338   PGPFLTLEDLAEMPYASKVVKESLRMASIVPWFPRSALQDCEIEGFKIKKGWNINVDAKS  397

Query  585   IHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYK  406
             IH DP  Y  P +FNPSRF++  +PYS++ FG G RTCLG+NMAK  MLV+LHRL + YK
Sbjct  398   IHLDPNHYNCPNNFNPSRFNDDSKPYSFLAFGMGARTCLGMNMAKAMMLVFLHRLITTYK  457

Query  405   WSVDDPDPSLERKAHIPRLRSGCPITLT  322
             W V D D S+E+ A   RL+SGCPI +T
Sbjct  458   WLVIDSDSSIEKWALFSRLKSGCPIQVT  485



>ref|XP_007226877.1| hypothetical protein PRUPE_ppa016822mg [Prunus persica]
 gb|EMJ28076.1| hypothetical protein PRUPE_ppa016822mg [Prunus persica]
Length=496

 Score =   442 bits (1137),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 217/469 (46%), Positives = 309/469 (66%), Gaps = 15/469 (3%)
 Frame = -2

Query  1692  YLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIF  1513
             ++++     S++ I PG  G+P +GET   ++A NS KG Y+FVR RRL HG  F+T IF
Sbjct  31    HIIKSNNQESRADIPPGSQGLPLIGETLQFMAAINSGKGFYEFVRLRRLRHGNCFRTNIF  90

Query  1512  GKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPF  1333
             G   VFV S + AK I  ND   F+K Y++S+ + VG +SLLC   + HK IR  L++ F
Sbjct  91    GATDVFVSSRESAKAILNNDSGKFSKRYIRSIGELVGNQSLLCASPQHHKLIRGQLTNLF  150

Query  1332  SMNSLSIFVQKFDRMLCQRLEE-QHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRR  1156
             S +SLSIF+++FD+++   L   +HR   +  + D  +KIT  AMC ML+S+  G  L  
Sbjct  151   STSSLSIFIKQFDKLIVDALGGWEHR--STVVIQDEALKITCKAMCKMLISVESGYELEV  208

Query  1155  IERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRD  976
             +E++ + V +AML+ P+ +PGTR+YKG++AR ++M      +  RRR +    E     D
Sbjct  209   LEKEVAHVCEAMLALPLRLPGTRFYKGLQARKKIMAIIGKAMSERRRGLQANGE-----D  263

Query  975   FLQEMLERD------SFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEI  814
             FLQ +L+ D      +      L DEEI DN+LT+IIAGQ TTA+AM W VK LDEN E+
Sbjct  264   FLQRLLDEDGKACNGATTNGGGLTDEEIQDNILTMIIAGQDTTASAMTWMVKFLDENPEV  323

Query  813   QNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIE  634
              + L  EQL + R     + +TLE +N M YASKVVKE+LR+++++ WFPR+ L++C++E
Sbjct  324   LDILLREQLGLARKVSSKSFLTLESINDMPYASKVVKESLRLASIVPWFPRLVLEDCEME  383

Query  633   GFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRF-DEMQRPYSYIPFGSGPRTCLGINM  457
             GF IK+GW+VN+DA  +H DP +Y DP  FNPSRF DE + PYS++ FG G RTCLG+NM
Sbjct  384   GFKIKRGWNVNVDAKSVHLDPTVYNDPNKFNPSRFDDESKIPYSFLAFGMGGRTCLGMNM  443

Query  456   AKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFNQ  310
             AK  MLV+LHRLT+ Y+W V + D S+E+     +LRSGCP+T+T   +
Sbjct  444   AKAMMLVFLHRLTTTYRWKVINSDVSIEKWGLFSKLRSGCPVTITCITE  492



>ref|XP_009785222.1| PREDICTED: abscisic acid 8'-hydroxylase 2 [Nicotiana sylvestris]
Length=497

 Score =   442 bits (1137),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 218/479 (46%), Positives = 313/479 (65%), Gaps = 8/479 (2%)
 Frame = -2

Query  1743  YYYDVFLGLLVGIGIAVYLLRGQTVRSKSCIIP-GKLGIPFLGETFSLLSATNSTKGCYD  1567
             +Y  ++LGLL     ++ +LR  T       +P G  G+PF+GET   ++A NS KG YD
Sbjct  16    WYIVLYLGLLYLFVRSLKMLRHNTTAKTPAKVPQGNRGLPFIGETIHFMAAINSNKGFYD  75

Query  1566  FVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLL  1387
             FV+ RRL +G  FKT IFG+ HVF+ S   AK I +N+   F K Y+KS+A  VG +SLL
Sbjct  76    FVKVRRLKYGNCFKTNIFGQTHVFISSTKAAKKILSNETENFTKRYIKSIAKLVGDQSLL  135

Query  1386  CVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFD  1207
             C  HE HK IR  L+  F+  SLS  V++FD +    L   H+   + T+L   +KIT  
Sbjct  136   CASHEQHKLIRSHLTTLFTTASLSSMVKQFDELTVNNLSTWHQ-RSNVTILHEALKITLK  194

Query  1206  AMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIID  1027
             A+C MLM++     L  + +D   + +AML+FP ++P TR+YKG++AR R+M     II+
Sbjct  195   AICKMLMNLEGEEELETLHKDVGLIYEAMLAFPSILPWTRFYKGLQARKRIMRLLDKIIE  254

Query  1026  SRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMW  847
              RR+        ++  DFL  +L +DS  E+ +L +++I DN+LT+IIAGQ TTA+A+ W
Sbjct  255   KRRK------SKEKFDDFLAHLLSKDSGEEAIQLSNQQIKDNILTMIIAGQDTTASAITW  308

Query  846   SVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWF  667
              +K LDEN +  N+LR EQ ++ +     A +TLEDLN M YASKV+KE+LRM++++ WF
Sbjct  309   MIKYLDENPDALNQLRAEQQALQQKVSGKAHLTLEDLNCMPYASKVIKESLRMASIVPWF  368

Query  666   PRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGS  487
             PR+AL +C+IEGF IKKGW +N+DA  IH+D  I+ DP  F PSRFD+  +PYS++ FG 
Sbjct  369   PRMALHDCEIEGFTIKKGWTINVDAKSIHFDSMIFHDPNKFIPSRFDDDSKPYSFLAFGM  428

Query  486   GPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFNQ  310
             G RTCLG+++A+  MLV++HRLT+ Y+W V D D S+E+     RL+SGCPI +T   +
Sbjct  429   GGRTCLGLHLARAMMLVFVHRLTTSYRWMVIDSDESIEKWTLFSRLKSGCPIRVTCLEE  487



>ref|XP_004293199.1| PREDICTED: abscisic acid 8'-hydroxylase 1-like [Fragaria vesca 
subsp. vesca]
Length=464

 Score =   439 bits (1129),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 212/453 (47%), Positives = 304/453 (67%), Gaps = 11/453 (2%)
 Frame = -2

Query  1653  IIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGA  1474
             I PG  G+P +GET   +++ NS KG Y+FVR RRL +G+ F+T IFG  HVF+ S +  
Sbjct  21    IPPGTQGLPLIGETLHFMASINSGKGFYEFVRLRRLRYGKCFRTNIFGGTHVFISSTESG  80

Query  1473  KTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFD  1294
             K I  ND   F K Y+KS+A+ VG +SLLC   + HK +R  L   FS NSLS+F+++FD
Sbjct  81    KAILNNDLGKFGKRYIKSIAELVGNQSLLCASQQHHKLLRGHLGSLFSTNSLSVFIKQFD  140

Query  1293  RMLCQRLE-EQHRIGKSFTVLDFN-MKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAM  1120
             +++ + L+  +H   +S  V+    +KIT  AMC ML+S+  G  L  ++++ + V +AM
Sbjct  141   QLIVEALKCWEH---QSTVVIQVEALKITGKAMCKMLLSMESGYELEVLQKEVAHVCEAM  197

Query  1119  LSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFP  940
             L+FP+ +PGTR+YKG++ R ++M      +  RRRR  + NE D     LQ++L  ++  
Sbjct  198   LAFPLRLPGTRFYKGLQGRKKIMSIIDQAMRERRRRGLKANEDDH----LQQILRDEA--  251

Query  939   ESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKG  760
             +   L DEE+ DN+LT++IAGQ TTA AM W VK L EN E+ + L +EQL + R     
Sbjct  252   DGHGLTDEEVRDNILTMVIAGQDTTATAMTWMVKFLGENPEVLHTLMKEQLDLGRKTSSK  311

Query  759   ALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIH  580
             + +TLE +N M YASKVVKE+LR+++++ WFPR+AL++C++EGF IKKGW+VN+DA  IH
Sbjct  312   SFLTLESINEMPYASKVVKESLRLASIVPWFPRLALEDCEMEGFRIKKGWNVNVDAKSIH  371

Query  579   YDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWS  400
              DP +Y DP  FNPSRFD   R ++++ FG G RTCLG+NMAK  MLV+LHRL + Y+W 
Sbjct  372   LDPTVYIDPDKFNPSRFDVRNRSFTFLAFGMGGRTCLGMNMAKAMMLVFLHRLVTTYRWK  431

Query  399   VDDPDPSLERKAHIPRLRSGCPITLTAFNQGDY  301
             V D D S+E+     +LRSGCP+T+T  N+  Y
Sbjct  432   VIDQDSSIEKWGLFSKLRSGCPVTVTRINEDIY  464



>ref|XP_007017598.1| Cytochrome P450, family 722, subfamily A, polypeptide 1 isoform 
1 [Theobroma cacao]
 gb|EOY14823.1| Cytochrome P450, family 722, subfamily A, polypeptide 1 isoform 
1 [Theobroma cacao]
Length=488

 Score =   440 bits (1131),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 234/480 (49%), Positives = 315/480 (66%), Gaps = 11/480 (2%)
 Frame = -2

Query  1746  HYYYDVF-LGLLVGIGIAVY-LLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGC  1573
             H  Y V  L  LV +   ++ +L+     S++ I PG LG+PF+GET   ++A NS KG 
Sbjct  13    HCLYAVLVLAALVFLASQLWKMLQELNQESRADIPPGSLGLPFIGETIQFMAAINSGKGF  72

Query  1572  YDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKS  1393
             YDFVR R L +G  FKT IFG+ HVFV S   AK I  ND+  F KGY+KS+A+ VG +S
Sbjct  73    YDFVRVRSLRYGNCFKTSIFGETHVFVSSTSSAKAILNNDWGRFTKGYIKSIAELVGNQS  132

Query  1392  LLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKIT  1213
             LLC   + HK +R  L + FS NS+S  V++FD ++   L      G +  VLD  ++IT
Sbjct  133   LLCASQQHHKLLRGRLVNLFSTNSISRLVKQFDELIVHTLSGWED-GGTVIVLDEALQIT  191

Query  1212  FDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTI  1033
               AMC ML+S+  G  L  ++ D   V  AML+FP+ +P TR+YKG++AR R+M T + I
Sbjct  192   LKAMCKMLLSLESGLELELLQEDVGHVCKAMLAFPLRLPWTRFYKGLQARKRIMGTLEKI  251

Query  1032  IDSRRRRMGRGNESDEDRDFLQEMLERDSFPESE---KLEDEEIMDNLLTLIIAGQTTTA  862
             I SRRRR   G ++  D DFLQ +L  D    S+   +L D EI DN+LT+IIAGQ TTA
Sbjct  252   I-SRRRR---GLDAAAD-DFLQRLLLEDDNSCSDGLHRLSDAEIQDNILTMIIAGQDTTA  306

Query  861   AAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSN  682
             +A+ W VK L EN ++ + ++ EQL +L    K   +TL DLN M YASKVVKE+LRM++
Sbjct  307   SAITWMVKYLGENEDVLDAIKAEQLHLLDKTSKKLFLTLGDLNEMPYASKVVKESLRMAS  366

Query  681   VLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSY  502
             V+ WFPR+ L +C+IEG+ +KKGW VNID   IH DP +Y +P +FNPSRFD+  +PYS+
Sbjct  367   VVPWFPRLVLQDCEIEGYKMKKGWTVNIDVRSIHLDPMVYSEPNNFNPSRFDDESKPYSF  426

Query  501   IPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             + FG G RTCLG+NMAK  MLV+LHRL + YKW V D D S+++ A   RL SGCP+ +T
Sbjct  427   LAFGMGARTCLGMNMAKAMMLVFLHRLLTTYKWKVLDSDSSIDKWALFSRLSSGCPVHVT  486



>ref|XP_002510423.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52610.1| cytochrome P450, putative [Ricinus communis]
Length=458

 Score =   435 bits (1118),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 221/461 (48%), Positives = 308/461 (67%), Gaps = 10/461 (2%)
 Frame = -2

Query  1689  LLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFG  1510
             +L G    S + I PG  G+P +GET   ++A NS KG YDFVR RRL +G  FKT IFG
Sbjct  1     MLWGPFQESLANIPPGSRGLPLIGETLQFMAAINSDKGFYDFVRVRRLRYGNCFKTSIFG  60

Query  1509  KIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFS  1330
             + HVF+ S + AKTI  N+   F K Y+KS+A+ VG +SLLC  H  HK IR  L + FS
Sbjct  61    QTHVFISSTESAKTILNNESGKFTKKYIKSIAELVGDQSLLCASHLHHKLIRSRLINLFS  120

Query  1329  MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIE  1150
               SLS+F+++FD+++   L     +G +  VLD  +KITF AMC MLMSI +   L+ ++
Sbjct  121   TTSLSLFIEQFDQLVITSLHSWKNMG-TVIVLDQALKITFKAMCKMLMSIENEQELQMLQ  179

Query  1149  RDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFL  970
              D + V +AML+FP+ +P TR++KG+KAR R+M   + ++ +RRR           RDFL
Sbjct  180   DDITHVCEAMLAFPLRLPCTRFHKGLKARKRIMNRLEMMMVNRRR-----CSDTNQRDFL  234

Query  969   QEML---ERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLR  799
             Q++L   E+     + KL D EI DN+LT+IIAGQ TTA+A+ W VK + EN  + + L 
Sbjct  235   QQLLIGDEKSCSDGAFKLTDPEIKDNILTMIIAGQDTTASAITWMVKYVGENQNVLDTLC  294

Query  798   EEQLSILRN-KPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDI  622
              EQ  I      +G  ++LEDL+ M YASKVVKE+LRM++V+ WFPR+AL++C+IEGF I
Sbjct  295   AEQFHIAEKIASEGQFLSLEDLSEMPYASKVVKESLRMASVVPWFPRLALEDCEIEGFKI  354

Query  621   KKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTM  442
              KGW+VNIDA  IH DP +Y++  +F+P RF++  +PYS++ FG G RTCLG+NMAK  M
Sbjct  355   MKGWNVNIDARSIHRDPILYEESNNFHPPRFEDDSKPYSFLAFGMGRRTCLGMNMAKAMM  414

Query  441   LVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTA  319
             LV+LHRL + Y+W +   D S+E+ A   RL+SGCPI +T+
Sbjct  415   LVFLHRLITTYEWKLLASDSSIEKWALFSRLKSGCPIHVTS  455



>ref|XP_007017596.1| Cytochrome P450, family 722, subfamily A, polypeptide 1 [Theobroma 
cacao]
 gb|EOY14821.1| Cytochrome P450, family 722, subfamily A, polypeptide 1 [Theobroma 
cacao]
Length=488

 Score =   435 bits (1119),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 227/490 (46%), Positives = 316/490 (64%), Gaps = 10/490 (2%)
 Frame = -2

Query  1779  KLRMVFGSMVSHYYYDVFLGLLVGIGIAVY-LLRGQTVRSKSCIIPGKLGIPFLGETFSL  1603
             +L +  G     +Y  + L  LV +   ++ +L+      ++ I PG LG+PF+GET   
Sbjct  3     QLLLDVGPYCVCFYAVLVLAALVFLASQLWKMLQQLNQECRADIPPGCLGLPFIGETIQF  62

Query  1602  LSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVK  1423
             ++A NS KG YDFVR R L +G  FKT IFG+  VF+ S + AK I  ND   F K Y+K
Sbjct  63    MAAINSGKGFYDFVRVRSLRYGNCFKTNIFGQTQVFLSSTESAKIILNNDLGRFTKRYIK  122

Query  1422  SMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSF  1243
             S+A+ VG +SLLC   + HK +R  L + FS NS+S+ V++FD ++   L      G + 
Sbjct  123   SIAELVGNQSLLCASQQHHKLLRGRLVNLFSTNSISLLVKQFDELIVHTLNGWGD-GGTV  181

Query  1242  TVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKAR  1063
              VLD  ++ITF AMC ML+S+  G  L  ++ D   V  AML+FP+ +P TR+YKG++AR
Sbjct  182   IVLDEALQITFKAMCKMLLSLERGLELELLQEDVGHVCKAMLAFPLRLPWTRFYKGLQAR  241

Query  1062  GRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEML-ERDSFPES--EKLEDEEIMDNLLT  892
              R+M T + II  RRR +    +     DFLQ +L E D++      +L D EI DN+LT
Sbjct  242   KRIMSTLEKIISRRRRGLDAATD-----DFLQRLLVEEDNYCSDGLHRLTDAEIQDNILT  296

Query  891   LIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASK  712
             +IIAGQ TTA+A+ W VK L EN ++ + ++ EQL +L    K   +TL+DLN M YASK
Sbjct  297   MIIAGQDTTASAITWMVKYLGENEDVLDAIKAEQLHLLEKTSKKLFLTLDDLNEMPYASK  356

Query  711   VVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSR  532
             VVKE+LRM++V+ WFPR+ L +C+IEG+ +KKGW VNID   IH DP +Y +P +FNPSR
Sbjct  357   VVKESLRMASVVPWFPRLVLQDCEIEGYKMKKGWTVNIDVRSIHLDPMVYSEPNNFNPSR  416

Query  531   FDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPR  352
             FD+  +PYS++ FG G RTCLG+NMAK  MLV+LHRL + YKW V D D S+++ A   R
Sbjct  417   FDDESKPYSFLAFGMGARTCLGMNMAKAMMLVFLHRLLTTYKWKVLDSDSSIDKWALFSR  476

Query  351   LRSGCPITLT  322
             L SGCP+ +T
Sbjct  477   LSSGCPVHVT  486



>ref|XP_004238286.1| PREDICTED: abscisic acid 8'-hydroxylase 2 isoform X1 [Solanum 
lycopersicum]
Length=481

 Score =   429 bits (1103),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 222/484 (46%), Positives = 315/484 (65%), Gaps = 15/484 (3%)
 Frame = -2

Query  1755  MVSHYYYDVF--LGLLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNST  1582
             M S ++Y +F  LGLL+ + I  Y   G+T   K  I  G  GIP +GET   ++  NS 
Sbjct  1     MFSWFWY-IFPCLGLLL-LQIIWYNNTGKTPAKK--IPAGNRGIPVIGETIQFMATINSN  56

Query  1581  KGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVG  1402
             KG YDF++ RRL +G  FKT IFG+ HVF+ S +  K I +N+   F K Y+KS+A  VG
Sbjct  57    KGFYDFIKIRRLKYGNCFKTNIFGQTHVFISSTEATKKILSNEKGNFTKRYIKSIAKLVG  116

Query  1401  KKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNM  1222
              +SLLC  H+ HK IR  LS+ FS  SLS  V++FD +    L   H+   S  +L   +
Sbjct  117   DQSLLCASHQYHKSIRSQLSNLFSTTSLSTMVRQFDELTINNLSTWHK-KSSIIILHEAL  175

Query  1221  KITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETF  1042
             KIT +A+C MLMS+ +   L  + +D   + +AMLSFP+ +P TR+YKG++AR R+M   
Sbjct  176   KITLEAICKMLMSLENKEELEMLHKDIGLIYEAMLSFPLRLPWTRFYKGLQARKRIMNLL  235

Query  1041  KTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTA  862
               II++RR        + +  DFL  +L +D+  +  +L +E+I DN+LT+IIAGQ TTA
Sbjct  236   DRIIEARR------TSNKKYDDFLDYLLIKDN--QIIQLTNEQIKDNILTMIIAGQDTTA  287

Query  861   AAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSN  682
             +A+ W VK LDEN +  N LR EQ ++ +     A +T EDLN M YASKVVKE+LRM++
Sbjct  288   SAITWMVKYLDENPKALNNLRAEQQALQQKVSCKAYLTFEDLNCMPYASKVVKESLRMAS  347

Query  681   VLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSY  502
             ++ WFPR+AL +C+IEGF IKKGW +N+DA  IH+DP I+ DP  F PSRFD+  +PY +
Sbjct  348   IVPWFPRMALQDCEIEGFTIKKGWIINVDAKSIHFDPMIFHDPHKFIPSRFDDDSKPYRF  407

Query  501   IPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             + FG G RTCLG+++A+  MLV+++RLT+ Y+W V D D S++R     RL+SGCPI +T
Sbjct  408   LAFGMGGRTCLGLHLARAMMLVFVYRLTTSYRWKVLDSDESIQRWTLFSRLKSGCPIHVT  467

Query  321   AFNQ  310
             +  +
Sbjct  468   SIEE  471



>ref|XP_002281158.1| PREDICTED: abscisic acid 8'-hydroxylase 4 [Vitis vinifera]
 emb|CBI19732.3| unnamed protein product [Vitis vinifera]
Length=502

 Score =   430 bits (1105),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 217/465 (47%), Positives = 309/465 (66%), Gaps = 13/465 (3%)
 Frame = -2

Query  1704  GIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFK  1525
             GIA  +LR     S + I PG  G+P +GET   ++AT+S+KG YDFV  R+L +G  F+
Sbjct  38    GIA-RVLRDSHWESTAKIPPGSRGLPLIGETLHFMAATSSSKGFYDFVHIRQLRYGNCFR  96

Query  1524  TRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLL  1345
             T IFG+ HVFV S + AK +  N+   F K Y+KS+A+ VG +SLLC  H+ HK IR  L
Sbjct  97    TSIFGQTHVFVSSTESAKVVLNNEVGKFTKRYIKSIAELVGNESLLCASHQHHKLIRGRL  156

Query  1344  SDPFSMNSLSIFVQKFDRMLCQRLEE-QHRIGKSFTVLDFNMKITFDAMCNMLMSITDGS  1168
              + FS  S+S F+++FD+++   L   +H+   +  VL   +++   AMC MLMS+  G 
Sbjct  157   INLFSTASISSFIKQFDQLIVTTLSGWEHK--PTVVVLHEALELICKAMCKMLMSLESGD  214

Query  1167  LLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESD  988
              +  +++D + V +AM++FP+ +P TR+YKG++AR R+M+  +  I+ RRR    G    
Sbjct  215   EVEMLQKDVAHVCEAMIAFPLRLPCTRFYKGLEARKRVMKMLEKKIEERRR----GEAYH  270

Query  987   EDRDFLQEMLERDSFP---ESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTE  817
             ED  FLQ +L+ +      E   L D EI DN+LT+IIAGQ TTA+A+ W VK LDEN +
Sbjct  271   ED--FLQHLLKDNGSACCDEVPPLTDAEIQDNILTMIIAGQDTTASAITWMVKYLDENQQ  328

Query  816   IQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKI  637
             + + LR EQ  I       + +TL+DLN M YASKVVKE+LRM++++ W PRVAL +C++
Sbjct  329   VLHTLRAEQGRIAEKTSHTSSLTLDDLNEMPYASKVVKESLRMASIVAWLPRVALQDCEV  388

Query  636   EGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINM  457
             +GF IKKGW++NIDA  IH DP +Y +PT F PSRFD   +P S++ FG+G RTCLG+NM
Sbjct  389   QGFKIKKGWNINIDARSIHLDPTLYNNPTMFIPSRFDGEPKPNSFLAFGTGGRTCLGMNM  448

Query  456   AKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             AK  MLV+LHRL + Y W+V +PD S+E+ A   RL+SGCPI ++
Sbjct  449   AKAMMLVFLHRLITTYNWTVVNPDSSIEKWALFSRLKSGCPIHVS  493



>ref|XP_009621239.1| PREDICTED: abscisic acid 8'-hydroxylase 2 [Nicotiana tomentosiformis]
Length=501

 Score =   429 bits (1103),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 215/466 (46%), Positives = 304/466 (65%), Gaps = 15/466 (3%)
 Frame = -2

Query  1689  LLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFG  1510
             L    T ++ + + PG  G+PF+GET + ++A  S KG YDFV+ RRL +G  FKT IFG
Sbjct  35    LWHNTTAKTPAKVPPGNRGLPFIGETINFMAAIKSNKGFYDFVKVRRLKYGNCFKTNIFG  94

Query  1509  KIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFS  1330
             + HVF+ S   AK I + + A F K Y+KS+A  VG +SLLC  HE HK IR  LS  F+
Sbjct  95    QTHVFISSTKAAKKILSKETANFTKRYIKSIAKLVGDQSLLCASHEQHKLIRSHLSTLFT  154

Query  1329  MNSLSIFVQKFDRMLCQRLEE-QHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRI  1153
               SLS  V++FD +    L   QHR      +L   +KIT +A+C MLM++     L  +
Sbjct  155   TASLSSMVRQFDELTVNNLSTWQHR--SDVIILHEALKITLEAICKMLMNLEGEEELETL  212

Query  1152  ERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDF  973
              +D   + +AML+FP+ +P TR+YKG++AR R+M     II+ RR      N  ++  DF
Sbjct  213   HKDVGLIYEAMLAFPIKLPWTRFYKGLQARKRIMRLLDKIIEKRR------NSKEKFDDF  266

Query  972   LQEMLERDSFPESEK-----LEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQN  808
             L  +L +D   ESE+     L ++EI DN+LT+IIAGQ TTA+A+ W +K LDEN +  N
Sbjct  267   LAHLLSKDG-EESEQENATQLTNQEIKDNILTMIIAGQDTTASAITWMIKYLDENPDALN  325

Query  807   RLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGF  628
             +L+ EQ ++ +     A +TLEDLN M YASKV+KE+LRM++++ WFPR+AL +C+IEGF
Sbjct  326   QLQAEQKALQQKVSSKAHLTLEDLNCMPYASKVIKESLRMASIVPWFPRMALHDCEIEGF  385

Query  627   DIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKV  448
              IKKGW++N+DA  IH+D  I+ DP  F PSRFD   +PYS++ FG G RTCLG+++A+ 
Sbjct  386   TIKKGWNINVDAKSIHFDAMIFHDPNKFIPSRFDVDSKPYSFLAFGMGGRTCLGLHLARA  445

Query  447   TMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFNQ  310
              MLV++HRLT+ Y+W V D D S+E+     RL+SGCPI +T   +
Sbjct  446   MMLVFVHRLTTSYRWMVIDSDESIEKWTLFSRLKSGCPIRVTCLEE  491



>ref|XP_007136626.1| hypothetical protein PHAVU_009G060000g [Phaseolus vulgaris]
 gb|ESW08620.1| hypothetical protein PHAVU_009G060000g [Phaseolus vulgaris]
Length=485

 Score =   426 bits (1094),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 214/453 (47%), Positives = 297/453 (66%), Gaps = 14/453 (3%)
 Frame = -2

Query  1665  SKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPS  1486
             S S I PG  G+PFLGET   ++A N+TKG Y+FVR RRL +G+ FKT++FG+ HVF+ S
Sbjct  37    SVSNIPPGNQGLPFLGETLQFMAAINNTKGVYEFVRARRLQYGKCFKTKLFGETHVFISS  96

Query  1485  VDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFV  1306
              D AK I  N    F+K Y+KS+A+ VG+ SLLC  H+ HK IR  L   FS +SLS FV
Sbjct  97    TDSAKVIL-NKEGKFSKKYMKSIAELVGRDSLLCAAHQHHKLIRASLFSLFSTHSLSSFV  155

Query  1305  QKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSD  1126
             Q FD +L Q +    + G    + D  +K+   AMC ML+SI +G  L  ++ + + + +
Sbjct  156   QLFDSLLLQAITTW-KSGSVLVIQDETLKVACKAMCKMLISIENGYELETMQNEVARLGE  214

Query  1125  AMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLE---  955
             AML+ PV +P TR+YKG++AR R+M+  +  I+ RR  +   +      DFLQ++L+   
Sbjct  215   AMLAIPVRLPWTRFYKGLQARKRIMDILEKTINERRSGIATSH-----VDFLQQLLDNKL  269

Query  954   -RDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSIL  778
               D  P   +L D EI DN+LT+IIAGQ T A AM W +K +DEN  + N L +EQL I 
Sbjct  270   HEDGVP---RLTDTEIKDNILTMIIAGQDTIANAMTWMIKFVDENPLVFNTLMKEQLEIE  326

Query  777   RNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNI  598
             +N  + + +T+E LN M YASKVVKE LR ++V+ W PRVAL++C IEG+ IKKGW++NI
Sbjct  327   KNGSRNSYLTVEALNEMPYASKVVKEALRKASVVQWLPRVALEDCVIEGYKIKKGWNINI  386

Query  597   DATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLT  418
             DA  IH+DP ++ DP+ FNPSRF    +PYS++ FG G R CLG NMAK  MLV+LHR  
Sbjct  387   DARSIHHDPTLHNDPSVFNPSRFPAESKPYSFLAFGMGGRACLGKNMAKAMMLVFLHRFI  446

Query  417   SRYKWSVDDPDPSLERKAHIPRLRSGCPITLTA  319
             +  KW V D D S++++A   +L+SG P+ L +
Sbjct  447   TNCKWKVIDSDSSIQKRALFTKLKSGYPVHLIS  479



>ref|XP_004501123.1| PREDICTED: abscisic acid 8'-hydroxylase 4-like [Cicer arietinum]
Length=488

 Score =   425 bits (1093),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 224/492 (46%), Positives = 310/492 (63%), Gaps = 15/492 (3%)
 Frame = -2

Query  1755  MVSH--YYYDVFLGLLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNST  1582
             M+S   YY  VFL +L  +    +  R     S   I PG  G+PF+GET   ++A NS+
Sbjct  1     MISQLCYYVGVFLVVLSCLKFQTFW-RKNNKSSSVGIPPGNRGLPFIGETLHFMAAINSS  59

Query  1581  KGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVG  1402
             KG Y+FVR RRL +G  FKT++FG+ HVF+ S + AK I  N+   F+K Y+KS+++ VG
Sbjct  60    KGVYEFVRIRRLRYGNCFKTKLFGETHVFISSKESAKLILRNEGGKFSKKYIKSISELVG  119

Query  1401  KKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNM  1222
               SLLC   + HK IR  L   FS +SLS FV  FD+++ +      + G    + D  +
Sbjct  120   PDSLLCAAQQHHKLIRARLFSLFSTHSLSSFVILFDQLVIEA-TTSWKCGSLLIIQDEAL  178

Query  1221  KITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETF  1042
             K+   AMC ML+SI  G  L  +++D + VS+AML+FP+ +P TR+YKG++AR R+M+  
Sbjct  179   KLACKAMCKMLVSIESGHELLMMQKDVAQVSEAMLAFPLRLPWTRFYKGLQARKRIMDIL  238

Query  1041  KTIIDSRRRRMGRGNESDEDRDFLQEML--ERDSFPESE--KLEDEEIMDNLLTLIIAGQ  874
             +  I  RRR +          DFLQ++L  E D   + E  +L D+EI DN+LT+IIAGQ
Sbjct  239   EKEISDRRRGIATSRV-----DFLQQLLANEDDKLEKGEITRLTDKEIKDNILTMIIAGQ  293

Query  873   TTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETL  694
              T A AM W +K +DEN E+ N LR+EQL I +       +TLE L+ M Y S VVKE L
Sbjct  294   DTIAIAMTWMIKFVDENQEVLNELRKEQLQIEKKGGGSVYLTLEALSEMQYGSMVVKEAL  353

Query  693   RMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQR  514
             RM++V+ W PRVAL++C+IEGF +KKGW++NIDA  IH+DP I+ DP  FNPSRF    +
Sbjct  354   RMASVVQWLPRVALEDCEIEGFKMKKGWNINIDARSIHHDPTIHSDPDVFNPSRFPSESK  413

Query  513   PYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCP  334
             P S++ FG G R CLG NMAK  MLV+L+R+ S +KW V D D S+++ A   +L+SG P
Sbjct  414   PNSFLAFGIGGRMCLGKNMAKAMMLVFLYRVISSFKWKVIDSDSSIQKLALFTKLKSGYP  473

Query  333   ITLTAFNQGDYT  298
             I L +    DYT
Sbjct  474   IRLISVK--DYT  483



>ref|XP_010060975.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase [Eucalyptus 
grandis]
 gb|KCW67877.1| hypothetical protein EUGRSUZ_F01592 [Eucalyptus grandis]
Length=500

 Score =   426 bits (1094),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 212/447 (47%), Positives = 298/447 (67%), Gaps = 13/447 (3%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKT  1468
             PG LG+P +GET   ++A  S +G YDFV +RRL  GR FKT IFG+ HVFV +   AK 
Sbjct  50    PGSLGLPVIGETLQFMAAIKSGRGFYDFVESRRLRCGRCFKTNIFGETHVFVSTATSAKM  109

Query  1467  IFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRM  1288
             I  ND   F K Y++S+A  VG +SLLC  H+ H+ +R  L++ FS  SLS F+Q+FD +
Sbjct  110   ILNNDSGKFTKRYIRSIAQLVGNQSLLCASHQQHRHVRGHLNNFFSTCSLSAFIQQFDVL  169

Query  1287  LCQRLEE-QHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSF  1111
             + + L++ +HR   +  VLD  +KITF  MC ML+S+  G  L  ++ D S V  AML+F
Sbjct  170   IVKSLDDWEHR--GTVVVLDEALKITFKIMCRMLLSLESGRQLEMLQEDVSIVCKAMLAF  227

Query  1110  PVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESE  931
             P+ +P TR+ +GI+AR R+M   +T+I   +RR+ R +  D     L  +L  D   E +
Sbjct  228   PLRLPRTRFQRGIEARERIMSALETLIT--QRRLARTSHED----CLNYLLSNDDETECK  281

Query  930   K---LEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKG  760
             K   L   EI DN+LT+IIAG  TTA+A+ W VK L EN  + ++LR EQ+   +     
Sbjct  282   KDPKLTTGEIKDNILTMIIAGHDTTASAITWMVKFLGENETVLDKLRAEQVCFAKKMSGR  341

Query  759   ALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIH  580
               + LED+  M+YASKVVKE+LRM++V+ WFPR+ L +C IEG+ IK+GW+VN++A  +H
Sbjct  342   PFLKLEDIGEMSYASKVVKESLRMASVVPWFPRLVLQDCDIEGYKIKRGWNVNVNAKSVH  401

Query  579   YDPAIYKDPTHFNPSRF-DEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKW  403
             +DPA++ +P  FNPSRF DE + PYS++ FG+G RTCLG+NMAK  MLV+LHRL + YKW
Sbjct  402   FDPAVHDNPFEFNPSRFDDESKLPYSFLGFGAGGRTCLGMNMAKAMMLVFLHRLVTTYKW  461

Query  402   SVDDPDPSLERKAHIPRLRSGCPITLT  322
              V DPD +LE+ A   RL++GCP+ +T
Sbjct  462   RVLDPDSTLEKWALFSRLKNGCPVLVT  488



>ref|XP_009390176.1| PREDICTED: abscisic acid 8'-hydroxylase 4 [Musa acuminata subsp. 
malaccensis]
Length=491

 Score =   425 bits (1093),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 213/442 (48%), Positives = 295/442 (67%), Gaps = 9/442 (2%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKT  1468
             PG  G+P +GET + L+A +S +G YDFVR R L +G  FKT I G+ HVFV S+   +T
Sbjct  50    PGTTGLPLIGETPAFLAANHSGRGVYDFVRARHLRYGECFKTNILGRTHVFVSSIVAVRT  109

Query  1467  IFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRM  1288
             +  ++   F+K Y++S+ + VG +SLLC  HE HK IRR +S  F ++S+   V+KFD +
Sbjct  110   LLGHESPDFSKRYIRSITELVGDQSLLCASHEQHKFIRRHISCLFKLDSMDSTVRKFDEL  169

Query  1287  LCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFP  1108
             +   L    +   +  VL   MKITF+A+C ML+S  D   L  +  D S VS+AML+ P
Sbjct  170   VIHTLRGWEQ-KDTVLVLSDAMKITFNAICKMLISTEDEHELEILRNDVSEVSEAMLALP  228

Query  1107  VMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEK  928
             +  PGTR+Y+G+KAR R+M T + +ID R+R    G+E  ED  FLQ ++ RD    +E 
Sbjct  229   LKFPGTRFYRGLKARRRIMNTLRKMIDLRKR----GSECHED--FLQGLV-RDESHGNEP  281

Query  927   LEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALIT  748
             L D++I+DN+LTLIIAGQ TTA+++ W VK LDEN E+Q +LR   L +        L +
Sbjct  282   LTDDQILDNILTLIIAGQVTTASSIAWMVKYLDENQEVQEKLRALHLELAFTNSLSPLGS  341

Query  747   LEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPA  568
              E LN M YA K+VKETLRM+ ++ WFPRVAL + +I G  I+KGW VN++A  IHYDP 
Sbjct  342   -EVLNVMPYALKIVKETLRMATIVSWFPRVALKDSEIGGLRIQKGWIVNVNARSIHYDPV  400

Query  567   IYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDP  388
             +Y DP  FNPSRFD+  +PYS++ FG+G R C+G+N+AK  MLV+LHRL + Y+W V D 
Sbjct  401   VYDDPVKFNPSRFDDDSKPYSFLAFGTGGRICVGMNLAKAMMLVFLHRLVTTYRWRVTDS  460

Query  387   DPSLERKAHIPRLRSGCPITLT  322
             D SL++ A  P LRSGCPIT++
Sbjct  461   DSSLQKGAMFPMLRSGCPITVS  482



>gb|KEH36179.1| cytochrome P450 family protein [Medicago truncatula]
Length=493

 Score =   424 bits (1091),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 218/489 (45%), Positives = 302/489 (62%), Gaps = 12/489 (2%)
 Frame = -2

Query  1743  YYYDVFLGLLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDF  1564
             Y+    L  L  + +     +         I PG  G+PF+GET   ++A NSTKG Y+F
Sbjct  11    YFVGFLLVFLSSLKVCALWCKNNKCSRSVGIPPGNRGLPFIGETLHFMAAINSTKGVYEF  70

Query  1563  VRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLC  1384
             VR RRL +G  FKT++FG+ HVF+ S + AK I  N+   F+K Y+KS++  +G  SLLC
Sbjct  71    VRLRRLRYGNCFKTKLFGETHVFISSKESAKVILRNEGGKFSKKYIKSISKLLGPDSLLC  130

Query  1383  VPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDA  1204
                  HK IR  L   FS +SL  FVQ FD ++ +        G    + D  +K+   A
Sbjct  131   AAEHHHKLIRSRLLSLFSPHSLPSFVQLFDELVTEA-TGTWTCGSLVIIQDEALKLACKA  189

Query  1203  MCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDS  1024
             MC ML+SI     L  + +D + VS+AML+FP+ +P TR+YKG++AR R+M+  + +I  
Sbjct  190   MCKMLISIESSHELAMMHKDVARVSEAMLAFPLRLPWTRFYKGLQARKRVMDILENVISK  249

Query  1023  RRRRMGRGNESDEDRDFLQEMLERDSFPESEK-----LEDEEIMDNLLTLIIAGQTTTAA  859
             RR  +     +D   DFLQ++L  D    SEK     L D+EI DN+LT+IIAGQ T A 
Sbjct  250   RRHEI-----ADRRVDFLQQLLADDE-NNSEKDEVTTLTDKEIKDNILTMIIAGQDTIAI  303

Query  858   AMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNV  679
             AM W +K +DEN E+ N L++EQL I +    G  +TL+DL+ M YASKVVKE LRM++V
Sbjct  304   AMTWMIKFVDENQEVLNELKKEQLQIEKKGRGGVYLTLKDLSEMQYASKVVKEALRMASV  363

Query  678   LLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYI  499
             + WFPRVAL +C+IEGF+IKKGW++NIDA  IH+DP I+ DP  FNPSRF    +P S++
Sbjct  364   VQWFPRVALQDCEIEGFNIKKGWNINIDARSIHHDPTIHNDPEIFNPSRFPSESKPNSFL  423

Query  498   PFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTA  319
              FG G R CLG NMA+  MLV+L+RL + +KW V D D S+++ A   +L+SG P+ L  
Sbjct  424   AFGIGGRMCLGKNMAEAMMLVFLNRLVTNFKWKVIDSDSSIQKSALFTKLKSGYPVRLIY  483

Query  318   FNQGDYT*N  292
               + D   N
Sbjct  484   VKEEDLNKN  492



>ref|XP_006467169.1| PREDICTED: abscisic acid 8'-hydroxylase 2-like [Citrus sinensis]
Length=475

 Score =   421 bits (1082),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 212/475 (45%), Positives = 306/475 (64%), Gaps = 23/475 (5%)
 Frame = -2

Query  1689  LLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFG  1510
             +LRG   RS   I PG  G+P +GET   ++A NS++G Y F++ R L +G  F+T IF 
Sbjct  6     MLRG---RSTVSIPPGSEGLPLIGETLQFMAAINSSQGFYQFIQVRHLKYGDCFRTNIFA  62

Query  1509  KIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFS  1330
               +VF  S   AK I  N+   F K Y+KS+ + VG  S+LC   + HK IR  L++ FS
Sbjct  63    TTNVFFSSTGAAKIILNNEGENFTKRYIKSVGEIVGDNSVLCASTQRHKLIRSRLANLFS  122

Query  1329  MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIE  1150
             ++SLSIF ++FD+++ + L +      +  VL   +K+TF AMC +L+S+  G  L  +E
Sbjct  123   LSSLSIFTKQFDQLVLENLSDWEHKAATVVVLREALKVTFKAMCKILLSLESGKELEMLE  182

Query  1149  RDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFL  970
              D + V DAML+FP+ +P T++Y+G+KAR R+M T + +I+ RR    +G E+ E  DFL
Sbjct  183   NDVTRVYDAMLAFPLKLPWTKFYRGVKARKRIMRTLEKMINIRR----KGLETHE--DFL  236

Query  969   QEMLERDSFPES------------EKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDE  826
             Q +L  D+  +             +KL DEEI DN+LT+IIAGQ TTA+A+ W VK L E
Sbjct  237   QCLLAEDAVDKDRASLSSSSSETPKKLTDEEIQDNILTMIIAGQDTTASAITWMVKYLSE  296

Query  825   NTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDN  646
             N E+ ++L+ E   ++  + K +L+TLEDLN M YASKVVKE+LRM++++ W+PR+ + +
Sbjct  297   NEEVLDKLKAEHFPLME-RTKKSLLTLEDLNRMPYASKVVKESLRMASIVAWYPRLVIHD  355

Query  645   CKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFD-EMQRPYSYIPFGSGPRTCL  469
             C+IEG+ IK GW VNIDA  IH D  ++ +P  FNPSRFD +  +PY  IPF  G R CL
Sbjct  356   CEIEGYVIKAGWSVNIDAKSIHLDSTVHSNPYKFNPSRFDGDESKPYGSIPFSMGGRACL  415

Query  468   GINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFNQGD  304
             G++MAK  MLV+LHRL + YKW + D D S+++ A   RL+SGCPI + + N  D
Sbjct  416   GMHMAKAMMLVFLHRLITTYKWEMIDSDSSIDKWAMFARLKSGCPIHVKSTNIQD  470



>gb|KDO71226.1| hypothetical protein CISIN_1g010899mg [Citrus sinensis]
Length=498

 Score =   422 bits (1084),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 212/475 (45%), Positives = 306/475 (64%), Gaps = 23/475 (5%)
 Frame = -2

Query  1689  LLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFG  1510
             +LRG   RS   I PG  G+P +GET   ++A NS++G Y F++ R L +G  F+T IF 
Sbjct  29    MLRG---RSTVSIPPGSEGLPLIGETLQFMAAINSSQGFYQFIQVRHLKYGDCFRTNIFA  85

Query  1509  KIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFS  1330
               +VF  S   AK I  N+   F K Y+KS+ + VG  S+LC   + HK IR  L++ FS
Sbjct  86    TTNVFFSSTGAAKIILNNEGENFTKRYIKSVGEIVGDNSVLCASTQRHKLIRSRLANLFS  145

Query  1329  MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIE  1150
             ++SLSIF ++FD+++ + L +      +  VL   +K+TF AMC +L+S+  G  L  +E
Sbjct  146   LSSLSIFTKQFDQLVLENLSDWEHKAATVVVLREALKVTFKAMCKILLSLESGKELEMLE  205

Query  1149  RDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFL  970
              D + V DAML+FP+ +P T++Y+G+KAR R+M T + +I+ RR    +G E+ E  DFL
Sbjct  206   NDVTRVYDAMLAFPLKLPWTKFYRGVKARKRIMRTLEKMINIRR----KGLETHE--DFL  259

Query  969   QEMLERDSFPES------------EKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDE  826
             Q +L  D+  +             +KL DEEI DN+LT+IIAGQ TTA+A+ W VK L E
Sbjct  260   QCLLAEDAVDKDRASLSSSSSETPKKLTDEEIQDNILTMIIAGQDTTASAITWMVKYLSE  319

Query  825   NTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDN  646
             N E+ ++L+ E   ++  + K +L+TLEDLN M YASKVVKE+LRM++++ W+PR+ + +
Sbjct  320   NEEVLDKLKAEHFPLME-RTKKSLLTLEDLNRMPYASKVVKESLRMASIVAWYPRLVIHD  378

Query  645   CKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFD-EMQRPYSYIPFGSGPRTCL  469
             C+IEG+ IK GW VNIDA  IH D  ++ +P  FNPSRFD +  +PY  IPF  G R CL
Sbjct  379   CEIEGYVIKAGWSVNIDAKSIHLDSTVHSNPYKFNPSRFDGDESKPYGSIPFSMGGRACL  438

Query  468   GINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFNQGD  304
             G++MAK  MLV+LHRL + YKW + D D S+++ A   RL+SGCPI + + N  D
Sbjct  439   GMHMAKAMMLVFLHRLITTYKWEMIDSDSSIDKWAMFARLKSGCPIHVKSTNMKD  493



>emb|CAN64558.1| hypothetical protein VITISV_040162 [Vitis vinifera]
Length=496

 Score =   420 bits (1080),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 215/465 (46%), Positives = 305/465 (66%), Gaps = 19/465 (4%)
 Frame = -2

Query  1704  GIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFK  1525
             GIA  +LR     S + I PG  G+P +GET   ++AT+S+KG YDFV  R+L      +
Sbjct  38    GIA-RVLRDSHWESTAKIPPGSRGLPLIGETLHFMAATSSSKGFYDFVHIRQL------R  90

Query  1524  TRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLL  1345
             T IFG+ HVFV S + AK +  N+   F K Y+KS+A+ VG +SLLC  H+ HK IR  L
Sbjct  91    TSIFGQTHVFVSSTESAKVVLNNEVGKFTKRYIKSIAELVGNESLLCASHQHHKLIRGRL  150

Query  1344  SDPFSMNSLSIFVQKFDRMLCQRLEE-QHRIGKSFTVLDFNMKITFDAMCNMLMSITDGS  1168
              + FS  S+S F+++FD+++   L   +H+   +  VL   +++   AMC MLMS+  G 
Sbjct  151   INLFSTASISSFIKQFDQLIVTTLSGWEHK--PTVVVLHEALELICKAMCKMLMSLESGD  208

Query  1167  LLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESD  988
              +  +++D + V +AM++FP+ +P TR+YKG++AR R+M+  +  I+ RRR    G    
Sbjct  209   EVEMLQKDVAHVCEAMIAFPLRLPCTRFYKGLEARKRVMKMLEKKIEERRR----GEAYH  264

Query  987   EDRDFLQEMLERDSFP---ESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTE  817
             ED  FLQ +L+ +      E   L D EI DN+LT+IIAGQ TTA+A+ W VK LDEN  
Sbjct  265   ED--FLQHLLKDNGSACCDEVPPLTDAEIQDNILTMIIAGQDTTASAITWMVKYLDENQH  322

Query  816   IQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKI  637
             + + LR EQ  I       + +TL+DLN M YASKVVKE+LRM++++ W PRVAL +C++
Sbjct  323   VLHTLRAEQGRIAEKTSHTSSLTLDDLNEMPYASKVVKESLRMASIVAWLPRVALQDCEV  382

Query  636   EGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINM  457
             +GF IKKGW++NIDA  IH DP +Y +PT F PSRFD   +P S++ FG+G RTCLG+NM
Sbjct  383   QGFKIKKGWNINIDARSIHLDPTLYNNPTMFIPSRFDGEXKPNSFLAFGTGGRTCLGMNM  442

Query  456   AKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             AK  MLV+LHRL + Y W+V +PD S+E+ A   RL+SGCPI ++
Sbjct  443   AKAMMLVFLHRLITTYNWTVVNPDSSIEKWALFSRLKSGCPIHVS  487



>ref|XP_010906351.1| PREDICTED: LOW QUALITY PROTEIN: abscisic acid 8'-hydroxylase 
2-like [Elaeis guineensis]
Length=485

 Score =   415 bits (1067),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 213/452 (47%), Positives = 297/452 (66%), Gaps = 17/452 (4%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKT  1468
             PG  GIP++GET + ++A NS+KG YDFV TR + +G  FKT I G+ HVFV S++ AK 
Sbjct  45    PGNRGIPWIGETLAFMAANNSSKGFYDFVATRHIRYGNCFKTSILGETHVFVSSIEAAKA  104

Query  1467  IFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRM  1288
             I   +   F+K Y++S+A+ +G +SLLC  HE HK  RR +S  F++NS++  +  FD +
Sbjct  105   ILNCESIDFSKRYIRSIAELLGNQSLLCASHEQHKLTRRRISKLFTLNSMASSITMFDEL  164

Query  1287  LCQRLEEQHRIGKSFTVLDFN--MKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLS  1114
               + L    + G    V+ FN  +K+TF+A+C ML+S+ +   L  + +D   VS+AML+
Sbjct  165   TMKTLCSWKQKGN---VMVFNEALKVTFNAICKMLISLEEEDELEMLRKDVFEVSEAMLA  221

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPES  934
             FP+ + GTRYY+G+KAR R+  T + II SRR+ + R        DFLQ +L RD     
Sbjct  222   FPLKLLGTRYYRGVKARKRIDNTLRKIIASRRKSLER------HEDFLQWLLVRDESLHD  275

Query  933   EKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGAL  754
             +   D +I+DN+LTLIIAGQ TTA+A+ W VK LDEN E+Q+ LR     +L       L
Sbjct  276   DPWTDTQILDNILTLIIAGQITTASAIAWMVKYLDENQEVQDGLR-----LLMCIYDFTL  330

Query  753   ITLEDLNTM-TYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHY  577
             + L     +   A  +VKE+LRM+ ++ WFPRVAL +C+I GF IKK W VN+DA  IHY
Sbjct  331   LHLAWFMLVKIIAVXIVKESLRMATIVSWFPRVALKDCQIGGFQIKKDWIVNVDARSIHY  390

Query  576   DPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSV  397
             DPA+Y DP  F+PSRFDE  +PYS++ FG+G RTCLG+N+AK  MLV+LHRL + ++W V
Sbjct  391   DPAVYDDPVKFDPSRFDEDPKPYSFLAFGTGGRTCLGMNLAKAMMLVFLHRLVTTFRWKV  450

Query  396   DDPDPSLERKAHIPRLRSGCPITLTAFNQGDY  301
              DPD SLE+ A  PRLRSGCPI +    + +Y
Sbjct  451   TDPDSSLEKWAMFPRLRSGCPIHVIGGVKTEY  482



>gb|KFK44099.1| hypothetical protein AALP_AA1G215700 [Arabis alpina]
Length=459

 Score =   411 bits (1056),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 203/452 (45%), Positives = 291/452 (64%), Gaps = 5/452 (1%)
 Frame = -2

Query  1668  RSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVP  1489
             +S + I+PG  G P +GET   + + NS KG Y+FVRTRR+ +G  F+TR+FG+ HVF+ 
Sbjct  7     KSTADILPGSHGFPVIGETLHFMLSINSGKGFYEFVRTRRIRYGSCFRTRLFGETHVFLS  66

Query  1488  SVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIF  1309
             + + A+ +  N+  +F K Y+KS+A+ VG +SLLC     HK +R  L + FS  S ++ 
Sbjct  67    TTESARAVLNNESGMFTKRYIKSIAELVGDRSLLCASQHHHKTLRSRLINLFSKKSTALM  126

Query  1308  VQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVS  1129
             V+ FD ++   L      G    + D  ++ITF AMC ML+S+ D   +  +++D   V 
Sbjct  127   VRHFDELVVDALSGWEHRGTVVLLTDL-LQITFKAMCKMLISLEDEEEVGSLQKDVGFVC  185

Query  1128  DAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERD  949
             +AML+FP+ +P TR+ KGI ARGR+ME  +  I  RR  +   N ++   DFL ++L  D
Sbjct  186   EAMLAFPLNLPWTRFRKGIMARGRVMEMLEKTIRERRNEISCHNHNNHHEDFLHQLLAAD  245

Query  948   SFPESE---KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSIL  778
             +   S+   KL D EI DN+LT+IIAGQ TTA+A+ W VK L EN ++ + L EEQ  I 
Sbjct  246   NDSSSDHFTKLTDAEIKDNILTMIIAGQDTTASALTWMVKYLGENQKVLDILIEEQTKIA  305

Query  777   RNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNI  598
             + K     + LEDL+ M YASK+VKE+LRM++V+ WFPRV L +C++EG+ I+KGW++NI
Sbjct  306   K-KASPTFLELEDLSEMPYASKMVKESLRMASVVPWFPRVVLQDCEMEGYKIRKGWNINI  364

Query  597   DATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLT  418
             DA  IH DP +Y +P  FNPSRFDE     S++ FG G R CLG+ MAK  MLV+LHR  
Sbjct  365   DARSIHLDPNVYNNPLKFNPSRFDEEATANSFLAFGMGGRACLGLVMAKAMMLVFLHRFI  424

Query  417   SRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             + Y+W V D DPS+E+     RL+SG PI ++
Sbjct  425   TTYRWEVVDGDPSIEKWTLFARLKSGYPIRVS  456



>gb|AFK39117.1| unknown [Lotus japonicus]
Length=499

 Score =   412 bits (1059),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 203/453 (45%), Positives = 289/453 (64%), Gaps = 11/453 (2%)
 Frame = -2

Query  1653  IIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGA  1474
             I PG  G+PF+GET    +A NS+KG Y+FVR RRL +G  FKT++FG+ HVF+ + + A
Sbjct  43    IPPGSGGLPFVGETLQFTAAINSSKGVYEFVRVRRLRYGNCFKTKLFGETHVFISNTESA  102

Query  1473  KTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFD  1294
             K I  N+   F+K Y+KS+A+ VG  SLLC   + HK IR  L   FS +SLS FV+ FD
Sbjct  103   KAILNNEGGKFSKRYIKSIAELVGPDSLLCASQQYHKHIRGCLFSLFSTDSLSSFVKLFD  162

Query  1293  RMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLS  1114
              ++ + +    + G +  + D  +K+   AMC ML+S+  GS L  ++++   V +AML+
Sbjct  163   ELVLEAMSSW-KCGSTVIIQDEALKLACKAMCKMLISMESGSELEMMQKEVGHVCEAMLA  221

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERD-----  949
              P  +P TR+YKG++AR ++M+  +  I  RR  +     S    DFLQ++L  D     
Sbjct  222   LPFRLPWTRFYKGLQARKKIMDMLEKNISERRSGI-----SSSHVDFLQQLLAEDHDNKL  276

Query  948   SFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNK  769
             +  E  +L D EI DN+LT+IIAGQ TTA AM W +K +DEN E+ N L +EQ+ I +  
Sbjct  277   NKDEVPRLTDTEIKDNILTMIIAGQDTTATAMAWMIKFVDENEEVLNMLMKEQIQIEKKG  336

Query  768   PKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDAT  589
             P+   +TLE LN M YASKV+KE LRM++++ W PRV+L++C+I+G  IKKGW++NIDA 
Sbjct  337   PRSTYLTLEALNEMPYASKVIKEALRMASIVQWLPRVSLEDCEIKGLKIKKGWNINIDAR  396

Query  588   CIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRY  409
              IH+DP  Y  P  FNP RF    +  S++ FG G R C+G NMAK  MLV+LHRL + Y
Sbjct  397   SIHHDPTTYNYPDVFNPLRFHAETKQNSFLAFGVGGRMCMGKNMAKTMMLVFLHRLITNY  456

Query  408   KWSVDDPDPSLERKAHIPRLRSGCPITLTAFNQ  310
             KW V D D S+++ A   +L++GCPI L    +
Sbjct  457   KWKVIDSDASIKKWAIFSKLQNGCPIRLICMKE  489



>ref|XP_006342223.1| PREDICTED: abscisic acid 8'-hydroxylase 2-like [Solanum tuberosum]
Length=481

 Score =   411 bits (1057),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 208/448 (46%), Positives = 298/448 (67%), Gaps = 9/448 (2%)
 Frame = -2

Query  1653  IIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGA  1474
             I  G   IP +GET   ++A NS +G YDF++ RRL +G  FKT IFG+ HVF+ S + A
Sbjct  33    IPAGNREIPVIGETIQFMAAINSNRGFYDFIKIRRLKYGNCFKTNIFGQTHVFISSTEAA  92

Query  1473  KTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFD  1294
             K I +N+   F K Y+KS+A  VG +SLLC  H+ HK IR  LS  FS  SLS  V++FD
Sbjct  93    KKILSNEGGNFTKRYIKSIAKLVGDQSLLCASHQQHKIIRSHLSSLFSTTSLSTMVRQFD  152

Query  1293  RMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLS  1114
              +    L   H+   S  +L   +KIT +A+C MLMS+ D   L  + +D   + +AMLS
Sbjct  153   ELTVNNLSNWHK-KSSIIILHEALKITLEAICKMLMSLEDKKELEMLHKDIGLIYEAMLS  211

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPES  934
             FP+ +P TR+YKG++AR R+M     +I++RR+   + +      DFL  +L +D   + 
Sbjct  212   FPLRLPWTRFYKGLQARKRIMNLLDKMIEARRKSKEKYD------DFLDYLLIKDD--QI  263

Query  933   EKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGAL  754
              +L +E+I DN+LT+IIAGQ TTA+A+ W VK LD+N +  N LR EQ ++ +     A 
Sbjct  264   IQLTNEQIKDNILTMIIAGQDTTASAITWMVKYLDDNPKALNNLRAEQQALQQKVSCKAY  323

Query  753   ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYD  574
             +T EDLN M YASKVVKE+LRM++++ WFPR+AL +C+IEGF IKKGW++N+DA  IH+D
Sbjct  324   LTYEDLNCMPYASKVVKESLRMASIVPWFPRMALQDCEIEGFTIKKGWNINVDAKSIHFD  383

Query  573   PAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVD  394
             P I+ DP  F PSRFD+  +PYS++ FG G RTCLG+++A+  MLV+++RLT+ Y+W + 
Sbjct  384   PMIFNDPHKFIPSRFDDDSKPYSFLAFGMGGRTCLGLHLARAMMLVFVYRLTTSYRWKIL  443

Query  393   DPDPSLERKAHIPRLRSGCPITLTAFNQ  310
             D D S+E+     RL+SGCPI +T+  +
Sbjct  444   DSDESIEKWTLFSRLKSGCPIHVTSIEE  471



>ref|XP_010230530.1| PREDICTED: abscisic acid 8'-hydroxylase 4-like [Brachypodium 
distachyon]
Length=510

 Score =   410 bits (1055),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 213/490 (43%), Positives = 315/490 (64%), Gaps = 24/490 (5%)
 Frame = -2

Query  1713  VGIGIAVYLLR-----GQTVRSKSCIIPGKLGI-----PFLG-ETFSLLSATNSTKGCYD  1567
             +G+G+  +L R     G +   KS  +P   G+       LG ET S L+A +S +G YD
Sbjct  19    IGMGMGYHLRRRRIQDGNSHDDKSAPLPPPGGMRSWCRAALGFETLSFLAANSSGRGFYD  78

Query  1566  FVRTRRLWHGRWFKTRIFGKIHVFVPSV---DGAKTIFANDFALFNKGYVKSMADAVGKK  1396
             FVR+R L HG  F+T +FG+ HVF+ S      A T+  +      K Y++++AD +G+ 
Sbjct  79    FVRSRGLRHGACFRTALFGRTHVFLLSPLSRAAAPTLLLDTHPHMAKRYLRTVADLLGEH  138

Query  1395  SLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRI-----GKSFTVLD  1231
             SLLC  H++H+ +RR ++  F+    + FVQ FDR++  ++++   +     G+   VLD
Sbjct  139   SLLCASHDAHRFMRRAVAGLFASAPTADFVQSFDRLVTHQMQQLLLLRGKDEGRVVVVLD  198

Query  1230  FNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLM  1051
               +++TF A+C ML+   D   L R++RD   V+ AML+ P+ +PGTR+YKG++AR R+M
Sbjct  199   AALEVTFRAICEMLIGAQDEGKLARLQRDVMDVTRAMLALPLRLPGTRFYKGLQARKRIM  258

Query  1050  ETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERD-SFPESEKLEDEEIMDNLLTLIIAGQ  874
             +  +  I  RR+    G E D   DFLQ +L +  +    E L D++I+DN+LTLIIAGQ
Sbjct  259   DALRQEISMRRQ--NDGLEMDRRNDFLQTLLMKSHTHSAEEALTDQQILDNILTLIIAGQ  316

Query  873   TTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETL  694
              TTA A+ W VK L +NTE+Q+ LR  Q+ I       + +TL+DLNTM YA K VKE+L
Sbjct  317   VTTATAITWMVKYLADNTELQDTLRSVQVDIASKHHLDSPLTLQDLNTMEYAYKAVKESL  376

Query  693   RMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRF--DEM  520
             RM+ ++ WFPRVAL +C++ GF IKK W VN+DA  IHYDP IY +PT F+PSRF  +++
Sbjct  377   RMATIVSWFPRVALKDCQVAGFQIKKDWIVNVDARSIHYDPTIYPNPTVFDPSRFTNEDL  436

Query  519   QRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSG  340
             + PYS++ FG+G RTCLG+N+AK+ ML++LHRL +  +W + D D SLE+ A  PRL++G
Sbjct  437   KPPYSFLVFGAGGRTCLGMNLAKIMMLIFLHRLVTNLRWEMADQDTSLEKWAMFPRLKNG  496

Query  339   CPITLTAFNQ  310
             CPI LT  ++
Sbjct  497   CPIRLTPIHK  506



>ref|XP_010673149.1| PREDICTED: abscisic acid 8'-hydroxylase 4 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=492

 Score =   409 bits (1052),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 215/493 (44%), Positives = 305/493 (62%), Gaps = 12/493 (2%)
 Frame = -2

Query  1755  MVSHYYYDVFLGLLVGIGIAVYLLRGQTV----RSKSCIIPGKLGI-PFLGETFSLLSAT  1591
             M   Y+  V L L++G  +    L         +S+  I PG  G+ P++GET   ++A 
Sbjct  1     MALRYFLFVPLSLVIGYLMKKLWLISHNYNNYGKSQINIPPGSRGLFPYIGETLQFIAAI  60

Query  1590  NSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMAD  1411
              S +G Y FV+ R L +G  FKT IFG+ HVFV S   AK I +ND   F K Y++S+ +
Sbjct  61    YSKQGFYSFVQARHLRYGNCFKTHIFGETHVFVSSTKAAKEIMSNDLGKFTKKYIRSIGE  120

Query  1410  AVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLD  1231
              VG +SLLC  H+SHK +RR L D F+  S++ F ++FD ++   L      G    +LD
Sbjct  121   VVGSESLLCASHQSHKLLRRHLLDLFTSKSITDFTKQFDELVIHTLLTWEYKGH-VVILD  179

Query  1230  FNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLM  1051
               +K+TF AMC ML+S+  G+ L  +++D   V  AML+ P+  P T + KG+KAR R+M
Sbjct  180   EALKMTFKAMCKMLLSLEAGNELYMLQKDVDCVCHAMLALPLKFPWTTFSKGLKARKRIM  239

Query  1050  ETFKTIIDSRR-RRMGRGNESDEDRDFLQEML---ERDSFPESEK--LEDEEIMDNLLTL  889
             +    II  RR +   +       +DFLQ +L   +R+S    ++  L D  I DN+LT+
Sbjct  240   DMLGKIIQERRIKHSAQVPVVHHHQDFLQYLLLALDRESCSSDQEPTLTDAHIKDNILTM  299

Query  888   IIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKV  709
             IIAGQ TTA+AM W VK LDEN  +   L +E  +  +     + +TLE+LN MTY +KV
Sbjct  300   IIAGQDTTASAMTWMVKYLDENQGVLEVLLDEVHNQQKIAAHKSFLTLEELNEMTYGAKV  359

Query  708   VKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRF  529
             VKE LRM++++ WFPRVAL +C I G+ I+KGW++N+DA  IH+DP ++KDP  FNPSRF
Sbjct  360   VKECLRMASIVPWFPRVALHDCNILGYTIEKGWNINVDARSIHFDPTLHKDPHQFNPSRF  419

Query  528   DEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRL  349
             D   + YSY+ FG+G RTCLG+N+A+  MLV+L+RL + YKW V D D SLE  A   RL
Sbjct  420   DIEPKAYSYLAFGAGGRTCLGMNLARTMMLVFLYRLLTTYKWEVTDRDSSLENWALFSRL  479

Query  348   RSGCPITLTAFNQ  310
             +SGCPI +T  ++
Sbjct  480   KSGCPIQVTRLHK  492



>ref|XP_007017599.1| Abscisic acid 8'-hydroxylase 1 isoform 2 [Theobroma cacao]
 gb|EOY14824.1| Abscisic acid 8'-hydroxylase 1 isoform 2 [Theobroma cacao]
Length=463

 Score =   407 bits (1047),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 221/453 (49%), Positives = 297/453 (66%), Gaps = 12/453 (3%)
 Frame = -2

Query  1746  HYYYDVF-LGLLVGIGIAVY-LLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGC  1573
             H  Y V  L  LV +   ++ +L+     S++ I PG LG+PF+GET   ++A NS KG 
Sbjct  13    HCLYAVLVLAALVFLASQLWKMLQELNQESRADIPPGSLGLPFIGETIQFMAAINSGKGF  72

Query  1572  YDFVRTRRLW-HGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKK  1396
             YDFVR R L  +G  FKT IFG+ HVFV S   AK I  ND+  F KGY+KS+A+ VG +
Sbjct  73    YDFVRVRSLSRYGNCFKTSIFGETHVFVSSTSSAKAILNNDWGRFTKGYIKSIAELVGNQ  132

Query  1395  SLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKI  1216
             SLLC   + HK +R  L + FS NS+S  V++FD ++   L      G +  VLD  ++I
Sbjct  133   SLLCASQQHHKLLRGRLVNLFSTNSISRLVKQFDELIVHTLSGWED-GGTVIVLDEALQI  191

Query  1215  TFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKT  1036
             T  AMC ML+S+  G  L  ++ D   V  AML+FP+ +P TR+YKG++AR R+M T + 
Sbjct  192   TLKAMCKMLLSLESGLELELLQEDVGHVCKAMLAFPLRLPWTRFYKGLQARKRIMGTLEK  251

Query  1035  IIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESE---KLEDEEIMDNLLTLIIAGQTTT  865
             II SRRRR   G ++  D DFLQ +L  D    S+   +L D EI DN+LT+IIAGQ TT
Sbjct  252   II-SRRRR---GLDAAAD-DFLQRLLLEDDNSCSDGLHRLSDAEIQDNILTMIIAGQDTT  306

Query  864   AAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMS  685
             A+A+ W VK L EN ++ + ++ EQL +L    K   +TL DLN M YASKVVKE+LRM+
Sbjct  307   ASAITWMVKYLGENEDVLDAIKAEQLHLLDKTSKKLFLTLGDLNEMPYASKVVKESLRMA  366

Query  684   NVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYS  505
             +V+ WFPR+ L +C+IEG+ +KKGW VNID   IH DP +Y +P +FNPSRFD+  +PYS
Sbjct  367   SVVPWFPRLVLQDCEIEGYKMKKGWTVNIDVRSIHLDPMVYSEPNNFNPSRFDDESKPYS  426

Query  504   YIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYK  406
             ++ FG G RTCLG+NMAK  MLV+LHRL + YK
Sbjct  427   FLAFGMGARTCLGMNMAKAMMLVFLHRLLTTYK  459



>ref|NP_173393.5| cytochrome P450, family 722, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
 gb|AEE29875.1| cytochrome P450, family 722, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
Length=476

 Score =   408 bits (1048),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 200/449 (45%), Positives = 290/449 (65%), Gaps = 5/449 (1%)
 Frame = -2

Query  1668  RSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVP  1489
             +S + + PG  G P +GET   + + NS KG Y+FVR+RR+ +G  F+T +FG+ HVF+ 
Sbjct  30    KSTAGVPPGSDGFPVIGETLQFMLSVNSGKGFYEFVRSRRIRYGSCFRTSLFGETHVFLS  89

Query  1488  SVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIF  1309
             + + A+ +  ND  +F K Y+KS+ + VG +SLLC P   HK +R  L + FS  S ++ 
Sbjct  90    TTESARLVLNNDSGMFTKRYIKSIGELVGDRSLLCAPQHHHKILRSRLINLFSKRSTALM  149

Query  1308  VQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVS  1129
             V+ FD ++   L      G    + D  ++ITF AMC ML+S+     L  ++RD   V 
Sbjct  150   VRHFDELVVDALGGWEHRGTVVLLTDL-LQITFKAMCKMLVSLEKEEELGSMQRDVGFVC  208

Query  1128  DAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERD  949
             +AML+FP+ +P TR++KGI ARGR+ME  + II  RR  +   N   ED  FLQ++L  D
Sbjct  209   EAMLAFPLNLPWTRFHKGIMARGRVMEMLEKIIRERRNEINSHNNHHED--FLQQLLAVD  266

Query  948   SFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNK  769
             +  ++ +L D EI DN+LT+IIAGQ TTA+A+ W VK L EN ++ + L EEQ  I +  
Sbjct  267   N--DTPQLTDAEIKDNILTMIIAGQDTTASALTWMVKYLGENQKVLDILIEEQSQITKKA  324

Query  768   PKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDAT  589
                  + LEDL+ M YASK+VKE+LRM++V+ WFPR+ L +C++EG+ IKKGW++NIDA 
Sbjct  325   SNKPFLELEDLSEMPYASKMVKESLRMASVVPWFPRLVLQDCEMEGYKIKKGWNINIDAR  384

Query  588   CIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRY  409
              IH DP +Y +P  FNP RF+E  +  S++ FG G RTCLG+ +AK  MLV+LHR  + Y
Sbjct  385   SIHLDPTVYSEPHKFNPLRFEEEAKANSFLAFGMGGRTCLGLALAKAMMLVFLHRFITTY  444

Query  408   KWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             +W V D DPS+E+     RL+SG PI ++
Sbjct  445   RWEVVDEDPSIEKWTLFARLKSGYPIRVS  473



>ref|XP_010459635.1| PREDICTED: cytochrome P450 90A1-like [Camelina sativa]
Length=480

 Score =   407 bits (1046),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 199/444 (45%), Positives = 289/444 (65%), Gaps = 5/444 (1%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKT  1468
             PG  G P +GET   + + NS KG Y+FVR+RR+ +G  F+T +FG+ HVF+ + + A+ 
Sbjct  37    PGSHGFPVIGETLQFMLSVNSGKGFYEFVRSRRIRYGSCFRTSLFGETHVFLSTTESARA  96

Query  1467  IFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRM  1288
             +  N+  +F K Y+KS+ + VG++SLLC P   HK +R  L + FS  S ++ V+ FD +
Sbjct  97    VLNNESGMFTKRYIKSIGELVGERSLLCAPQHHHKILRSRLINLFSKRSTALMVRHFDEL  156

Query  1287  LCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFP  1108
             +   L      G    + D  ++ITF AMC ML+S+ D   L  +++D   V +AML+FP
Sbjct  157   VVDALSGWEHRGTVILLTDL-LQITFKAMCKMLISLEDEEELGSMQKDVGFVCEAMLAFP  215

Query  1107  VMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEML--ERDSFPES  934
             + +P TR++KGI ARGR+ME  + II  R+RR+   N++    DFLQ++L  + D+   S
Sbjct  216   LNLPWTRFHKGIMARGRVMELLENII--RKRRIETNNQNIHHEDFLQQLLAVDNDTSSSS  273

Query  933   EKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGAL  754
              KL D EI DN+LT+IIAGQ TTA+A+ W VK L EN ++ + L EEQ  I ++      
Sbjct  274   PKLTDAEIKDNILTMIIAGQDTTASALTWMVKYLGENQKVLDILIEEQSQIGKSASDKPF  333

Query  753   ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYD  574
             + LEDL+ M YASK++KE+LRM++V+ WFPR+ L +C++EG+ IKKGW++NIDA  IH D
Sbjct  334   LELEDLSEMPYASKLMKESLRMASVVPWFPRLVLQDCEMEGYKIKKGWNINIDARSIHLD  393

Query  573   PAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVD  394
             P +Y  P  FNP RF+   +  S++ FG G RTCLG+ MAK  MLV+LHR  + Y W V 
Sbjct  394   PDVYNKPHKFNPLRFEAEAKANSFLAFGMGGRTCLGLVMAKAMMLVFLHRFVTTYSWEVV  453

Query  393   DPDPSLERKAHIPRLRSGCPITLT  322
             D DPS+E+     RL+SG PI ++
Sbjct  454   DEDPSIEKWTLFARLKSGYPIRVS  477



>ref|XP_006416485.1| hypothetical protein EUTSA_v10007476mg [Eutrema salsugineum]
 gb|ESQ34838.1| hypothetical protein EUTSA_v10007476mg [Eutrema salsugineum]
Length=489

 Score =   406 bits (1044),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 208/456 (46%), Positives = 293/456 (64%), Gaps = 11/456 (2%)
 Frame = -2

Query  1668  RSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVP  1489
             +S + I PG  G P +GET   + + NS KG Y+FVRTRR+ +G  F+T +FG+ HVF+ 
Sbjct  35    KSTADIPPGSHGFPVIGETLQFMLSVNSGKGFYEFVRTRRIRYGSCFRTSLFGETHVFLS  94

Query  1488  SVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIF  1309
             + + A+ +  N+  +F K Y+KS+A+ VG +SLLC  H  HK +R  L + FS  S ++ 
Sbjct  95    TTESARAVLNNESGMFTKRYIKSIAELVGDRSLLCASHHHHKILRSRLINLFSKKSTAMM  154

Query  1308  VQKFDRMLCQRLEE-QHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTV  1132
             V+ FD ++   L   QHR G    + D  ++ITF AMC ML+S+     L  +++D   V
Sbjct  155   VRHFDELIVDALSGWQHR-GTVVLLTDL-LQITFKAMCKMLISLEAEEELGSLQKDVGFV  212

Query  1131  SDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLE-  955
              +AML+FP+ +P TR++KGI ARGR+M+  + II  RR      N   ED  FLQ++L  
Sbjct  213   CEAMLAFPLNLPWTRFHKGIMARGRVMKMLEKIIRERRNETNSHNNYHED--FLQQLLAV  270

Query  954   -----RDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQ  790
                    S   S KL D +I DNLLT+IIAGQ TTA+A+ W VK L EN ++ + L EEQ
Sbjct  271   DNDNSSSSSDHSTKLTDADIKDNLLTMIIAGQDTTASALTWMVKYLGENQKVLDILIEEQ  330

Query  789   LSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGW  610
               I +   +   + LEDL+ M YASK+VKE+LRM++V+ WFPR+ L +C++EG+ IKKGW
Sbjct  331   SQIAKKASEKPFLELEDLSEMPYASKMVKESLRMASVVPWFPRLVLQDCEMEGYKIKKGW  390

Query  609   HVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYL  430
             ++NIDA  IH DP +Y +P  FNPSRFDE  +  S++ FG G RTCLG+ MAK  MLV+L
Sbjct  391   NINIDARSIHLDPTVYIEPHKFNPSRFDEEAKANSFLAFGMGGRTCLGLGMAKAMMLVFL  450

Query  429   HRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             HR  + Y+W V D DPS+E+     RL+SG PI ++
Sbjct  451   HRFITTYRWEVVDGDPSIEKWTLFARLKSGYPIRVS  486



>ref|XP_009110265.1| PREDICTED: abscisic acid 8'-hydroxylase 1 isoform X1 [Brassica 
rapa]
 emb|CDX96655.1| BnaA08g21980D [Brassica napus]
Length=489

 Score =   405 bits (1042),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 202/455 (44%), Positives = 288/455 (63%), Gaps = 8/455 (2%)
 Frame = -2

Query  1668  RSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVP  1489
             +S + I PG  G P +GET   + + NS KG Y+FVR+RR+ +G  F+T +FG+ HVF+ 
Sbjct  34    KSTADIPPGSHGFPVVGETLQFMLSVNSGKGFYEFVRSRRIRYGSCFRTSLFGETHVFLS  93

Query  1488  SVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIF  1309
             + + A+ +  N+  +F K Y+KS+A  VG +SLLC     HK +R    + FS  S ++ 
Sbjct  94    TTESARAVLNNESGMFTKRYIKSIAALVGDRSLLCASQHHHKILRSRFINLFSKKSTALM  153

Query  1308  VQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVS  1129
             V+ FD ++   L      G    + D  ++ITF AMC ML+S+ +   L  ++RD   V 
Sbjct  154   VRHFDELVVDALSGWEHRGTVVLLTDL-LQITFKAMCKMLISLENEEELGSLQRDVGFVC  212

Query  1128  DAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLE--  955
             +AML+FP+ +P TR++KGI ARGR+ME  + II  RR      N +  + DFLQ++L   
Sbjct  213   EAMLAFPLNLPWTRFHKGIMARGRVMEVLEKIIRERRNETNSHNNNYRE-DFLQQLLAVD  271

Query  954   ----RDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQL  787
                   S   S KL D EI DN+LT+IIAGQ TTA+A+ W VK L EN ++ N L EEQ 
Sbjct  272   SDGSASSSDHSTKLTDAEIKDNILTMIIAGQDTTASALTWMVKYLGENQKVLNILIEEQT  331

Query  786   SILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWH  607
              + +       + L+DL  MTYASK+VKE+LRM++V+ WFPR+ L +C++EG+ I KGW+
Sbjct  332   QLAKQASHKPFLELDDLTEMTYASKMVKESLRMASVVPWFPRLVLQDCEMEGYKINKGWN  391

Query  606   VNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLH  427
             +NIDA  IH DP +Y +P  FNPSRFDE  +  S++ FG G RTCLG+NMAK  M+V+LH
Sbjct  392   INIDARSIHLDPNVYSEPHKFNPSRFDEEAKANSFLAFGMGGRTCLGLNMAKAMMVVFLH  451

Query  426   RLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             R  + Y+W V D DPS+E+     RL+SG PI ++
Sbjct  452   RFITTYRWEVVDGDPSIEKWTLFARLKSGYPIRVS  486



>ref|XP_006307378.1| hypothetical protein CARUB_v10009004mg [Capsella rubella]
 gb|EOA40276.1| hypothetical protein CARUB_v10009004mg [Capsella rubella]
Length=481

 Score =   405 bits (1041),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 200/451 (44%), Positives = 291/451 (65%), Gaps = 5/451 (1%)
 Frame = -2

Query  1668  RSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVP  1489
             +S + + PG  G P +GET   + + NS KG Y+FV +RR+ +G  FKT +FG+ HVF+ 
Sbjct  31    KSTADVPPGSHGFPVIGETLQFMLSVNSGKGFYEFVHSRRIRYGSCFKTSLFGETHVFLS  90

Query  1488  SVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIF  1309
             +++ A+ +  N+  +F K Y+KS+ + VG++SLLC P   HK +R  L + FS  S ++ 
Sbjct  91    TMESARAVLNNESGMFTKRYIKSIGELVGERSLLCAPQHHHKILRSRLINLFSKRSTALM  150

Query  1308  VQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVS  1129
             V  FD ++   L      G    + D  ++ITF AMC ML+S+ D   L  ++RD   V 
Sbjct  151   VSHFDELVVDALSGWEHRGTVILLTDL-LQITFKAMCKMLISLEDAEELGSMQRDVGFVC  209

Query  1128  DAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEML--E  955
             +AML+FP+ +P TR++KGI ARGR+ME  + II  R RR    ++++   DFLQ++L  +
Sbjct  210   EAMLAFPLNLPWTRFHKGIMARGRVMEVLENII--RERRNETNSQNNHHEDFLQQLLAVD  267

Query  954   RDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILR  775
              D+   S KL D EI DN+LT+IIAGQ TTA+A+ W VK L EN ++ + L +EQ  I +
Sbjct  268   DDTSSSSPKLTDAEIKDNILTMIIAGQDTTASALTWMVKYLGENQKVLDILIDEQSKIGK  327

Query  774   NKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNID  595
                    + LEDL+ M YASK+VKE+LRM++V+ WFPRV L +C++EG+ IKKGW++NID
Sbjct  328   KASDKPFLELEDLSEMPYASKLVKESLRMASVVPWFPRVVLQDCEMEGYKIKKGWNINID  387

Query  594   ATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTS  415
             A  IH DP +Y  P  FNP RF+E  +  S++ FG G RTCLG+ MAK  MLV+LHR  +
Sbjct  388   ARSIHLDPNVYDKPHKFNPLRFEEEAKGNSFLAFGMGGRTCLGLVMAKAMMLVFLHRFIT  447

Query  414   RYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
              Y+W V D D S+++     RL+SG PI ++
Sbjct  448   TYRWEVVDEDSSIDKWTLFARLKSGYPIRVS  478



>ref|XP_010477182.1| PREDICTED: cytochrome P450 90A1-like [Camelina sativa]
Length=480

 Score =   405 bits (1040),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 200/444 (45%), Positives = 287/444 (65%), Gaps = 5/444 (1%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKT  1468
             PG  G P +GET   + + NS KG Y+FVR+RR+ +G  F+T +FG+ HVF+ + + A+ 
Sbjct  37    PGSHGFPVIGETLQFMLSVNSGKGFYEFVRSRRIRYGSCFRTSLFGETHVFLSTTESARA  96

Query  1467  IFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRM  1288
             +  ND  +F K Y+KS+ + VG++SLLC P   HK +R  L + FS  S ++ V+ FD +
Sbjct  97    VLNNDSGMFTKRYIKSIGELVGERSLLCAPQHHHKILRSRLINLFSKRSTALIVRHFDEL  156

Query  1287  LCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFP  1108
             +   L      G    + D  ++ITF AMC ML+S+ D   L  +++D   V +AML+FP
Sbjct  157   VVDALSGWEHRGTVILLTDL-LQITFKAMCKMLISLEDEEELGSMQKDVGFVCEAMLAFP  215

Query  1107  VMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEML--ERDSFPES  934
             + +P TR++KGI ARGR+ME  + II  R+RR    N+++   DFLQ++L  + D+   S
Sbjct  216   LNLPWTRFHKGIMARGRVMELLEDII--RKRRNEINNQNNHHEDFLQQLLAVDNDTSSSS  273

Query  933   EKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGAL  754
              KL D EI DN+LT+IIAG  TTA+A+ W VK L EN ++ + L EEQ  I R       
Sbjct  274   PKLTDAEIKDNILTMIIAGPDTTASALTWMVKYLGENQKVLDILIEEQSQIGRKTLDKPF  333

Query  753   ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYD  574
             + LEDL+ M YASK++KE+LRM++V+ WFPR+ L +C++EG+ IKKGW++NIDA  IH D
Sbjct  334   LELEDLSEMPYASKLMKESLRMASVVPWFPRLVLQDCEMEGYKIKKGWNINIDARSIHLD  393

Query  573   PAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVD  394
             P +Y  P  FNP RF+   +  S++ FG G RTCLG+ MAK  MLV+LHR  + Y W V 
Sbjct  394   PDVYNKPHKFNPLRFEAEAKANSFLAFGMGGRTCLGLVMAKAMMLVFLHRFVTTYSWEVV  453

Query  393   DPDPSLERKAHIPRLRSGCPITLT  322
             D DPS+E+     RL+SG PI ++
Sbjct  454   DEDPSIEKWTLFARLKSGYPIRVS  477



>ref|XP_010501526.1| PREDICTED: abscisic acid 8'-hydroxylase 1-like, partial [Camelina 
sativa]
Length=474

 Score =   404 bits (1039),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 198/445 (44%), Positives = 289/445 (65%), Gaps = 5/445 (1%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKT  1468
             PG  G P +GET   + + NS KG Y+FVR+RR+ +G  F+T +FG+ HVF+ + + A+ 
Sbjct  26    PGSHGFPVIGETLQFMLSVNSGKGFYEFVRSRRIRYGSCFRTSLFGETHVFLSTTESARA  85

Query  1467  IFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRM  1288
             +  ND  +F K Y+KS+ + VG++SLLC     HK +R  L + FS  S ++ V+ FD +
Sbjct  86    VLNNDSGMFTKRYIKSIGELVGERSLLCSLQHHHKILRSRLINLFSKRSTALMVRHFDEL  145

Query  1287  LCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFP  1108
             +   L      G    + D  ++ITF AMC ML+S+ D   L  +++D   V +AML+FP
Sbjct  146   VVDALSGWEHRGTVILLTDL-LQITFKAMCKMLISLEDEEELGSMQKDVGFVCEAMLAFP  204

Query  1107  VMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEML--ERDSFPES  934
             + +P +R++KGI ARGR+M+  + II  R+RR    N++    DFLQ++L  + D+   S
Sbjct  205   LNLPWSRFHKGIMARGRVMQLLENII--RKRRNETNNQNIHHEDFLQQLLAVDNDTSSSS  262

Query  933   EKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGAL  754
              KL D EI DN+LT+IIAGQ TTA+A+ W VK L EN ++ + L EEQ  I ++      
Sbjct  263   PKLTDAEIKDNILTMIIAGQDTTASALTWMVKYLGENQKVLDILIEEQSQIGKSASDKPF  322

Query  753   ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYD  574
             + LEDL+ MTYASK++KE+LRM++V+ WFPR+ L +C++EG+ IKKGW++NIDA  IH D
Sbjct  323   LELEDLSEMTYASKLMKESLRMASVVPWFPRLVLQDCEMEGYKIKKGWNINIDARSIHLD  382

Query  573   PAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVD  394
             P +Y  P  FNP RF+   +  S++ FG G RTCLG+ MAK  MLV+LHR  + Y W V 
Sbjct  383   PDVYNKPHKFNPLRFEAEAKANSFLAFGMGGRTCLGLVMAKAMMLVFLHRFVTTYSWEVV  442

Query  393   DPDPSLERKAHIPRLRSGCPITLTA  319
             D DPS+E+     RL+SG PI +++
Sbjct  443   DEDPSIEKWTLFARLKSGYPIRVSS  467



>gb|KGN62620.1| hypothetical protein Csa_2G361840 [Cucumis sativus]
Length=483

 Score =   398 bits (1023),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 208/447 (47%), Positives = 288/447 (64%), Gaps = 17/447 (4%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKT  1468
             PG  G+PF+GET   ++A N + G YDFVR R L +G  FKTRIFG+ HVFV + + AK 
Sbjct  44    PGSRGLPFIGETLQFMAAVNCSSGVYDFVRIRCLRYGGCFKTRIFGETHVFVSNTEWAKL  103

Query  1467  IFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRM  1288
             I  +    F K Y+KS+ + VG +SLLC PH  HK +R  L + FS   L+ FV +FDR 
Sbjct  104   ILNDGGGRFTKKYIKSIVELVGHQSLLCAPHLHHKFLRSRLINLFSSCFLASFVPQFDR-  162

Query  1287  LCQRLEEQHRIGKSFTV--LDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLS  1114
               Q +E   R    FTV  L   +KIT  AMC ML+S+ + + +  I++D   V +AML+
Sbjct  163   --QIVETFQRWESGFTVFVLTEALKITCKAMCKMLISLEEENEVEMIQKDVGYVCEAMLA  220

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEML-ERDSFPE  937
             FP   PGTR+  G+KAR R+++  K II  RR          +  DFLQ +L E D+   
Sbjct  221   FPWRFPGTRFDAGLKARRRIIKKLKNIIQKRREL------ESQYEDFLQRLLMEEDN---  271

Query  936   SEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKG-  760
              E L D EI DN+LT++IAGQ TTA+A+ W VK LDEN ++   L+EEQ  IL  + +  
Sbjct  272   GEPLSDMEIGDNILTMLIAGQDTTASAITWMVKFLDENQDVLQNLKEEQFKILEEQREDN  331

Query  759   -ALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCI  583
              + +TLED+  M+YA+KVVKE+LR+++++ W PR+ L +  I+ + IKKGW+VNID   +
Sbjct  332   RSFLTLEDVANMSYATKVVKESLRLASIVPWLPRLILHDTDIQDYKIKKGWNVNIDVRSL  391

Query  582   HYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKW  403
             H DP+IYKDP  F PSRFDE  + +S++ FG G R CLG+N+AK  MLV+LHRL + ++W
Sbjct  392   HSDPSIYKDPIKFIPSRFDEETKAFSFLAFGMGGRQCLGMNLAKAMMLVFLHRLLTSFRW  451

Query  402   SVDDPDPSLERKAHIPRLRSGCPITLT  322
              V D D S+E+ A   +L+SGCPI +T
Sbjct  452   KVMDCDSSIEKWALFTKLKSGCPILIT  478



>gb|KHN45870.1| Abscisic acid 8'-hydroxylase 3 [Glycine soja]
Length=434

 Score =   396 bits (1017),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 201/434 (46%), Positives = 278/434 (64%), Gaps = 15/434 (3%)
 Frame = -2

Query  1602  LSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIF--ANDFALFNKGY  1429
             ++A NS+KG Y+FV  RRL +G+ FK ++FG+ HVF+ S + AK I    N+   F+K Y
Sbjct  1     MAAINSSKGVYEFVHARRLRYGKCFKAKLFGETHVFISSRESAKVIVNKENEGGKFSKSY  60

Query  1428  VKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGK  1249
             +KS+A+ +G+ SLLC   + HK IR  L   FS +SLS FVQ FD ++ Q        G 
Sbjct  61    IKSIAELLGRDSLLCAAQQHHKLIRARLFSLFSTDSLSSFVQLFDSLVLQ-ATRTWTCGS  119

Query  1248  SFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIK  1069
                + D  +K+   AMC ML+SI  G  L  +  + + + +AML+ PV +P TR+YKG++
Sbjct  120   VVVIQDETLKLACKAMCKMLISIESGQELVTMHNEVARLCEAMLALPVRLPWTRFYKGLQ  179

Query  1068  ARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLE----RDSFPESEKLEDEEIMDN  901
             AR R+M   +  I  RR  +     +    DFLQ++L+     D  P    L D EI DN
Sbjct  180   ARKRIMNILEKNISERRSGI-----ATHHVDFLQQLLDNKLNEDGVP---GLTDREIKDN  231

Query  900   LLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTY  721
             +LT+IIAGQ T A AM W +K +DEN ++ N L +EQL I +N  + + +TLE LN M Y
Sbjct  232   ILTMIIAGQDTIANAMTWMIKFVDENRQVFNTLMKEQLKIEKNGSRNSYLTLEALNEMPY  291

Query  720   ASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFN  541
             ASKVVKE LR ++V+ W PRVAL++C IEGF IKKGW++NIDA  IH+DP ++KDP  FN
Sbjct  292   ASKVVKEALRKASVVQWLPRVALEDCVIEGFKIKKGWNINIDARSIHHDPTVHKDPDVFN  351

Query  540   PSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAH  361
             PSRF    +PYS++ FG G RTCLG NMAK  MLV+LHR  + YKW V D D S++++A 
Sbjct  352   PSRFPAESKPYSFLAFGMGGRTCLGKNMAKAMMLVFLHRFITNYKWKVIDSDSSIQKRAL  411

Query  360   IPRLRSGCPITLTA  319
               +L+SG P+ L +
Sbjct  412   FTKLKSGYPVRLIS  425



>ref|XP_004168682.1| PREDICTED: abscisic acid 8'-hydroxylase 4-like [Cucumis sativus]
Length=504

 Score =   397 bits (1020),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 204/445 (46%), Positives = 287/445 (64%), Gaps = 13/445 (3%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKT  1468
             PG  G+PF+GET   ++A N + G YDFVR R L +G  FKTRIFG+ HVFV + + AK 
Sbjct  65    PGSRGLPFIGETLQFMAAVNCSSGVYDFVRIRCLRYGGCFKTRIFGETHVFVSNTEWAKL  124

Query  1467  IFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRM  1288
             I  +    F K Y+KS+ + VG +SLLC PH  HK +R  L + FS   L+ FV +FDR 
Sbjct  125   ILNDGGGRFTKKYIKSIVELVGHQSLLCAPHLHHKFLRSRLINLFSSCFLASFVPQFDRQ  184

Query  1287  LCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFP  1108
             + +  +     G +  VL   +KIT  AMC ML+S+ + + +  I++D   V +AML+FP
Sbjct  185   IVETFQRWES-GSTVFVLTEALKITCKAMCKMLISLEEENEVEMIQKDVGYVCEAMLAFP  243

Query  1107  VMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEML-ERDSFPESE  931
                PGTR+  G+KAR R+++  K II  RR          +  DFLQ +L E D+    E
Sbjct  244   WRFPGTRFDAGLKARRRIIKKLKNIIQKRREL------ESQYEDFLQRLLMEEDN---GE  294

Query  930   KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKG--A  757
              L D EI DN+LT++IAGQ TTA+A+ W VK LDEN ++   L+EEQ  IL  + +   +
Sbjct  295   PLSDMEIGDNILTMLIAGQDTTASAITWMVKFLDENQDVLQNLKEEQFKILEEQREDNRS  354

Query  756   LITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHY  577
              +TLED+  M+YA+KVVKE+LR+++++ W PR+ L +  I+ + IKKGW+VNID   +H 
Sbjct  355   FLTLEDVANMSYATKVVKESLRLASIVPWLPRLILHDTDIQDYKIKKGWNVNIDVRSLHS  414

Query  576   DPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSV  397
             DP+IYKDP  F PSRFDE  + +S++ FG G R CLG+N+AK  MLV+LHRL + ++W V
Sbjct  415   DPSIYKDPIKFIPSRFDEETKAFSFLAFGMGGRQCLGMNLAKAMMLVFLHRLLTSFRWKV  474

Query  396   DDPDPSLERKAHIPRLRSGCPITLT  322
              D D S+E+ A   +L+SGCPI +T
Sbjct  475   MDCDSSIEKWALFTKLKSGCPILIT  499



>ref|XP_004152773.1| PREDICTED: abscisic acid 8'-hydroxylase 4-like [Cucumis sativus]
Length=504

 Score =   396 bits (1017),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 204/445 (46%), Positives = 287/445 (64%), Gaps = 13/445 (3%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKT  1468
             PG  G+PF+GET   ++A N + G YDFVR R L +G  FKTRIFG+ HVFV + + AK 
Sbjct  65    PGSRGLPFIGETLQFMAAVNCSSGVYDFVRIRCLRYGGCFKTRIFGETHVFVSNTEWAKL  124

Query  1467  IFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRM  1288
             I  +    F K Y+KS+ + VG +SLLC PH  HK +R  L + FS   L+ FV +FDR 
Sbjct  125   ILNDGGGRFTKKYIKSIVELVGHQSLLCAPHLHHKFLRSRLINLFSSCFLASFVPQFDRQ  184

Query  1287  LCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFP  1108
             + +  +     G +  VL   +KIT  AMC ML+S+ + + +  I++D   V +AML+FP
Sbjct  185   IVETFQRWES-GFTVFVLTEALKITCKAMCKMLISLEEENEVEMIQKDVGYVCEAMLAFP  243

Query  1107  VMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEML-ERDSFPESE  931
                PGTR+  G+KAR R+++  K II  RR          +  DFLQ +L E D+    E
Sbjct  244   WRFPGTRFDAGLKARRRIIKKLKNIIQKRREL------ESQYEDFLQRLLMEEDN---GE  294

Query  930   KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKG--A  757
              L D EI DN+LT++IAGQ TTA+A+ W VK LDEN ++   L+EEQ  IL  + +   +
Sbjct  295   PLSDMEIGDNILTMLIAGQDTTASAITWMVKFLDENQDVLQNLKEEQFKILEEQREDNRS  354

Query  756   LITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHY  577
              +TLED+  M+YA+KVVKE+LR+++++ W PR+ L +  I+ + IKKGW+VNID   +H 
Sbjct  355   FLTLEDVANMSYATKVVKESLRLASIVPWLPRLILHDTDIQDYKIKKGWNVNIDVRSLHS  414

Query  576   DPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSV  397
             DP+IYKDP  F PSRFDE  + +S++ FG G R CLG+N+AK  MLV+LHRL + ++W V
Sbjct  415   DPSIYKDPIKFIPSRFDEETKAFSFLAFGMGGRQCLGMNLAKAMMLVFLHRLLTSFRWKV  474

Query  396   DDPDPSLERKAHIPRLRSGCPITLT  322
              D D S+E+ A   +L+SGCPI +T
Sbjct  475   MDCDSSIEKWALFTKLKSGCPILIT  499



>ref|XP_010539102.1| PREDICTED: abscisic acid 8'-hydroxylase 4 [Tarenaya hassleriana]
Length=499

 Score =   395 bits (1016),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 201/437 (46%), Positives = 288/437 (66%), Gaps = 13/437 (3%)
 Frame = -2

Query  1668  RSKSC--IIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVF  1495
             RSKS   I PG  G P +GET   + + NS KG Y+FVRTR L +G  F+T +FG+ HVF
Sbjct  38    RSKSTAEIPPGSDGFPVIGETLQFMFSANSGKGFYEFVRTRHLKYGYCFRTNLFGETHVF  97

Query  1494  VPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLS  1315
             V + + A+ +  N+   F K Y+KS+A+ VG +SLLC PH  HK +R  L + FS  S +
Sbjct  98    VSTTESARAVLNNESNRFTKRYIKSIAELVGDQSLLCAPHHHHKILRSRLINLFSTKSTA  157

Query  1314  IFVQKFDRMLCQRLEE-QHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCS  1138
             + ++ FD ++   L   +HR  ++  +L   +K+TF AMC ML+S+ D   +  ++ D +
Sbjct  158   LMIRSFDEIVIDSLRGWEHR--RTVVLLTELLKLTFKAMCKMLVSLEDEEHMSLLQHDVA  215

Query  1137  TVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEML  958
              V +AML+FP+ +P TR+ +GIKARGR+M+  + II  R RR G    S    DFLQ +L
Sbjct  216   LVCEAMLAFPLKLPWTRFNRGIKARGRVMKVLERII--RERRSG----SHHHEDFLQHLL  269

Query  957   ERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSIL  778
               +S  ++ +L + EI DN+LT+IIAGQ TTA+A+ W VK L EN ++ + L EEQL I 
Sbjct  270   TNNS-GQATRLSEAEIKDNILTMIIAGQDTTASALTWMVKYLGENQKVLDILTEEQLQIS  328

Query  777   RNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNI  598
             +       +++EDL+ M+YASK+ KE+LRM++V+ WFPR+AL +C+IEG+ IKKGW++NI
Sbjct  329   KKSSDKPFLSVEDLSKMSYASKMAKESLRMASVVPWFPRLALQDCEIEGYMIKKGWNINI  388

Query  597   DATCIHYDPAIYKDPTHFNPSRFDEM-QRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRL  421
             DA  IH DP +Y DP  FNPSRFDE   +  S++ FG G RTCLG  MAK  + V+LHR 
Sbjct  389   DARSIHLDPNVYNDPHIFNPSRFDEEDAKSNSFLAFGMGGRTCLGHTMAKAMIFVFLHRF  448

Query  420   TSRYKWSVDDPDPSLER  370
              + Y+W V D DP++E+
Sbjct  449   VTTYRWEVVDKDPTIEK  465



>ref|XP_008444740.1| PREDICTED: abscisic acid 8'-hydroxylase 2 [Cucumis melo]
Length=484

 Score =   394 bits (1012),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 201/445 (45%), Positives = 287/445 (64%), Gaps = 13/445 (3%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKT  1468
             PG  G+PF+GET   ++A N + G YDFVR R L +G  FKTRIFG+ HVFV S + AK 
Sbjct  46    PGSRGLPFIGETLQFMAAVNCSSGVYDFVRIRCLRYGGCFKTRIFGETHVFVSSTEWAKL  105

Query  1467  IFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRM  1288
             I  +    F K Y+KS+A+ VG +SLLC PH  HK +R  L + FS   L+ FV +FDR 
Sbjct  106   ILNDGGGRFTKKYIKSIAELVGHQSLLCAPHLHHKFLRSRLINLFSSCFLASFVPQFDRQ  165

Query  1287  LCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFP  1108
             + +  +     G +  VL   +KIT  AMC ML+S+ + + +  I++D + +  AML+FP
Sbjct  166   IVETFQRWES-GSTIFVLTEALKITCKAMCKMLISLEEENEVETIQKDVAYICAAMLAFP  224

Query  1107  VMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEML-ERDSFPESE  931
                P TR+  G+KAR R+++  K+II  RR          +  DFLQ++L E D+     
Sbjct  225   WRFPWTRFDTGLKARRRIIKKLKSIIQERREL------ELQYEDFLQQLLMEEDN---ER  275

Query  930   KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGA--  757
              L D EI DN+LT++IAGQ TTA+A+ W VK LDEN ++   L+EEQ  IL  + +    
Sbjct  276   PLSDMEIGDNILTMLIAGQDTTASAITWIVKFLDENQDVLQNLKEEQFKILEKQREENRN  335

Query  756   LITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHY  577
              +T EDL  M+YA+K+VKE+LR+++++ W PR+ L + +I+ + IKKGW+VNID   +H 
Sbjct  336   FLTSEDLANMSYAAKIVKESLRLASIVPWLPRLILHDTEIQDYKIKKGWNVNIDVRSLHS  395

Query  576   DPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSV  397
             DP+IYKDP  F+PSRFDE  + + ++ FG G R CLG+N+AK  MLV+LHRL + ++W V
Sbjct  396   DPSIYKDPIKFDPSRFDEETKAFGFLAFGMGGRQCLGMNLAKAMMLVFLHRLVTSFRWKV  455

Query  396   DDPDPSLERKAHIPRLRSGCPITLT  322
              D D S+E+ A   +L+SGCPI +T
Sbjct  456   MDCDSSIEKWALFTKLKSGCPILIT  480



>ref|XP_010320398.1| PREDICTED: abscisic acid 8'-hydroxylase 2 isoform X2 [Solanum 
lycopersicum]
Length=452

 Score =   392 bits (1007),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 209/484 (43%), Positives = 298/484 (62%), Gaps = 44/484 (9%)
 Frame = -2

Query  1755  MVSHYYYDVF--LGLLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNST  1582
             M S ++Y +F  LGLL+ + I  Y   G+T   K  I  G  GIP +GET   ++  NS 
Sbjct  1     MFSWFWY-IFPCLGLLL-LQIIWYNNTGKTPAKK--IPAGNRGIPVIGETIQFMATINSN  56

Query  1581  KGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVG  1402
             KG YDF++ RRL +G  FKT IFG+ HVF+ S +  K I +N+   F K Y+KS+A  VG
Sbjct  57    KGFYDFIKIRRLKYGNCFKTNIFGQTHVFISSTEATKKILSNEKGNFTKRYIKSIAKLVG  116

Query  1401  KKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNM  1222
              +SLLC  H+ HK IR  LS+ FS  SLS  V++FD +    L   H+   S  +L   +
Sbjct  117   DQSLLCASHQYHKSIRSQLSNLFSTTSLSTMVRQFDELTINNLSTWHK-KSSIIILHEAL  175

Query  1221  KITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETF  1042
             KIT +A+C MLMS+ +   L  + +D   + +AMLSFP+ +P TR+YKG++AR R+M   
Sbjct  176   KITLEAICKMLMSLENKEELEMLHKDIGLIYEAMLSFPLRLPWTRFYKGLQARKRIMNLL  235

Query  1041  KTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTA  862
               II++RR        + +  DFL  +L +D+  +  +L +E+I DN+LT+IIAGQ TTA
Sbjct  236   DRIIEARR------TSNKKYDDFLDYLLIKDN--QIIQLTNEQIKDNILTMIIAGQDTTA  287

Query  861   AAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSN  682
             +A+ W VK LDEN +  N LR                             VVKE+LRM++
Sbjct  288   SAITWMVKYLDENPKALNNLR-----------------------------VVKESLRMAS  318

Query  681   VLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSY  502
             ++ WFPR+AL +C+IEGF IKKGW +N+DA  IH+DP I+ DP  F PSRFD+  +PY +
Sbjct  319   IVPWFPRMALQDCEIEGFTIKKGWIINVDAKSIHFDPMIFHDPHKFIPSRFDDDSKPYRF  378

Query  501   IPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             + FG G RTCLG+++A+  MLV+++RLT+ Y+W V D D S++R     RL+SGCPI +T
Sbjct  379   LAFGMGGRTCLGLHLARAMMLVFVYRLTTSYRWKVLDSDESIQRWTLFSRLKSGCPIHVT  438

Query  321   AFNQ  310
             +  +
Sbjct  439   SIEE  442



>ref|XP_006579030.1| PREDICTED: abscisic acid 8'-hydroxylase 1 [Glycine max]
Length=478

 Score =   392 bits (1007),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 201/452 (44%), Positives = 279/452 (62%), Gaps = 20/452 (4%)
 Frame = -2

Query  1668  RSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVP  1489
             +S   I PG  G+PF+GET   ++A NS+KG Y+FV  RRL +G+ FK ++FG+ HVF+ 
Sbjct  36    KSSIGIPPGNRGLPFVGETLQFMAAINSSKGVYEFVHARRLRYGKCFKAKLFGETHVFIS  95

Query  1488  SVDGAKTIF--ANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLS  1315
             S + AK I    N+   F+K Y+KS+A+ +G+ SLLC   + HK IR  L   FS +SLS
Sbjct  96    SRESAKVIVNKENEGGKFSKSYIKSIAELLGRDSLLCAAQQHHKLIRARLFSLFSTDSLS  155

Query  1314  IFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCST  1135
              FVQ FD ++ Q        G    + D  +K+   AMC ML+SI  G  L  +  + + 
Sbjct  156   SFVQLFDSLVLQ-ATRTWTCGSVVVIQDETLKLACKAMCKMLISIESGQELVTMHNEVAR  214

Query  1134  VSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLE  955
             + +AML+ PV +P TR+YKG++AR R+M   +  I  RR  +     +    DFLQ+   
Sbjct  215   LCEAMLALPVRLPWTRFYKGLQARKRIMNILEKNISERRSGI-----ATHHVDFLQQ---  266

Query  954   RDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILR  775
                      L D ++        IAGQ T A AM W +K +DEN ++ N L +EQL I +
Sbjct  267   ---------LWDNKLNRGWSNFEIAGQDTIANAMTWMIKFVDENRQVFNTLMKEQLKIEK  317

Query  774   NKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNID  595
             N  + + +TLE LN M YASKVVKE LR ++V+ W PRVAL++C IEGF IKKGW++NID
Sbjct  318   NGSRNSYLTLEALNEMPYASKVVKEALRKASVVQWLPRVALEDCVIEGFKIKKGWNINID  377

Query  594   ATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTS  415
             A  IH+DP ++KDP  FNPSRF    +PYS++ FG G RTCLG NMAK  MLV+LHR  +
Sbjct  378   ARSIHHDPTVHKDPDVFNPSRFPAESKPYSFLAFGMGGRTCLGKNMAKAMMLVFLHRFIT  437

Query  414   RYKWSVDDPDPSLERKAHIPRLRSGCPITLTA  319
              YKW V D D S++++A   +L+SG P+ L +
Sbjct  438   NYKWKVIDSDSSIQKRALFTKLKSGYPVRLIS  469



>ref|XP_004960948.1| PREDICTED: abscisic acid 8'-hydroxylase 2-like [Setaria italica]
Length=542

 Score =   382 bits (980),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 197/447 (44%), Positives = 291/447 (65%), Gaps = 16/447 (4%)
 Frame = -2

Query  1617  ETFSLLSATNSTKGCYDFVRTRRLWHGR-WFKTRIFGKIHVFVPSVDGAKTIFANDFALF  1441
             ET + ++A  S +G Y FV  R   HG   F+T +FG  HVFV S   A+++ A + A F
Sbjct  95    ETLAFVAANGSGRGFYHFVGERHRRHGPPCFRTALFGATHVFVSSPAAARSLLAAEPAGF  154

Query  1440  NKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQH  1261
             +K YV+++AD +G+ SLLC  H +H+ +RR ++  F+  + + F   FD +    + +  
Sbjct  155   SKRYVRTVADLLGEHSLLCADHAAHRSLRRAVAPLFNARATASFTAAFDALTRGLMRDWL  214

Query  1260  RIGK-------SFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVM  1102
              +         S  VLD  + ITF+A+C+ML++       RR++RD   V+ AML+FP+ 
Sbjct  215   ALATCRSPSSSSVVVLDAALGITFEAICDMLVATLPRDAKRRLQRDVLAVTRAMLAFPLR  274

Query  1101  IPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEK--  928
             +PGTR++ G++AR R+ME  +  I SRR+R   G   D D DFLQ +L R    +SE   
Sbjct  275   LPGTRFHAGLRARERIMEVLRREIASRRQRGHGGGGGD-DMDFLQSLLLRSQQQQSENDD  333

Query  927   ---LEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGA  757
                L DE+I+DN+LTLIIAGQ TTA A+ W VK L ++ + Q  LR  QL +   + +  
Sbjct  334   EALLTDEQILDNILTLIIAGQVTTATAITWMVKYLADSRDFQETLRSVQLELAPKQHQDC  393

Query  756   LITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHY  577
              +TL+ L++M  A K VKE+LRM++++ WFPRVAL++C++ GF I KGW VNIDA  +HY
Sbjct  394   PLTLQHLSSMELAYKTVKESLRMASIVSWFPRVALEDCEVAGFQINKGWIVNIDARSLHY  453

Query  576   DPAIYKDPTHFNPSRF--DEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKW  403
             DP IY +PT F+PSRF  +++++PYS++ FG+G RTCLG+N+AK+ ML++LHRL + ++W
Sbjct  454   DPTIYDNPTTFDPSRFNGEDVKQPYSFLVFGAGGRTCLGMNLAKIMMLIFLHRLVTTFRW  513

Query  402   SVDDPDPSLERKAHIPRLRSGCPITLT  322
              + D D SLE+ A  PRLR+GCPI LT
Sbjct  514   EMADDDTSLEKWAMFPRLRNGCPIHLT  540



>emb|CDX83746.1| BnaC08g18990D [Brassica napus]
Length=489

 Score =   380 bits (975),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 200/463 (43%), Positives = 285/463 (62%), Gaps = 24/463 (5%)
 Frame = -2

Query  1668  RSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVP  1489
             +S + I PG  G P +GET   + + NS KG Y+FVR+RR+ +G  F+T +FG+ HVF+ 
Sbjct  34    KSTADIPPGSHGFPVVGETLQFMLSVNSGKGFYEFVRSRRIRYGSCFRTSLFGETHVFLS  93

Query  1488  SVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSL---  1318
             + + A+ +  N+  +F K Y+KS+A  VG +SLLC     HK +R    +  S+  L   
Sbjct  94    TTESARAVLNNESGMFTKRYIKSIAALVGDRSLLCASQHHHKILRSRFIN-LSLTRLVDG  152

Query  1317  SIFVQKFDRMLCQRLEEQHRIGKSFTVL-----DFNMKITFDAMCNMLMSITDGSLLRRI  1153
             S  VQ     +C R        K F+++     +    ITF AMC ML+S+ +   L  +
Sbjct  153   STVVQWSCSQICSR--------KPFSLMRKVWPNLAHFITFKAMCKMLISLENEEELGSL  204

Query  1152  ERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDF  973
             +RD   V +AML+FP+ +P TR+++GI ARGR+ME  + II  RR      + ++   DF
Sbjct  205   QRDVGFVCEAMLAFPLNLPWTRFHEGIMARGRVMEVLEKIIRDRRNETNS-HNNNNHEDF  263

Query  972   LQEMLE------RDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQ  811
             LQ++L         S     KL D EI DN+LT+IIAGQ TTA+A+ W VK L EN ++ 
Sbjct  264   LQQLLAVDSDDSASSSDHYTKLTDAEIKDNILTMIIAGQDTTASALTWMVKYLGENQKVL  323

Query  810   NRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEG  631
             N L EEQ  + +       + L+DL  MTYASK+VKE+LRM++V+ WFPR+ L +C+ EG
Sbjct  324   NILIEEQTQVAKQASDKPFLELDDLTEMTYASKMVKESLRMASVVPWFPRLVLQDCEREG  383

Query  630   FDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAK  451
             + I KGW++NIDA  IH DP +Y +P  FNPSRFDE  +  S++PFG G RTCLG+NMAK
Sbjct  384   YKINKGWNINIDARSIHLDPNVYSEPHKFNPSRFDEEAKANSFLPFGMGGRTCLGLNMAK  443

Query  450   VTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
               M+V+LHR  + Y+W V D DPS+E+     RL+SG PI ++
Sbjct  444   AMMVVFLHRFITTYRWEVVDGDPSIEKWTLFARLKSGYPIRVS  486



>ref|XP_007046851.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOX91008.1| Cytochrome P450, putative [Theobroma cacao]
Length=309

 Score =   372 bits (956),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 199/371 (54%), Positives = 246/371 (66%), Gaps = 68/371 (18%)
 Frame = -2

Query  1419  MADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFT  1240
             MADAVGKKS+L    ESHKRIRRLLS PFSM+SLS FV+K D+M  +RL +    GKSF+
Sbjct  1     MADAVGKKSVLYAKQESHKRIRRLLSVPFSMDSLSTFVKKIDKMPIERLNKLEESGKSFS  60

Query  1239  VLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARG  1060
             VLDF MK+ FDAMCNMLMS+TD SLLR+IE+DC  V  ++L+FPV+IPGT YY+G+KAR 
Sbjct  61    VLDFGMKMNFDAMCNMLMSVTDDSLLRQIEKDCIDVDRSVLAFPVLIPGTTYYRGMKARK  120

Query  1059  RLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIA  880
             RLME+F+ +I  RR     G E+ E  DFL  +L+RDS   +E+L+D EI+DNL+TL+IA
Sbjct  121   RLMESFREMIARRR----SGMETSE--DFLHSILQRDSCAPNEELDDSEIIDNLITLLIA  174

Query  879   GQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKE  700
             G+TTTA+A+MW VK LDEN E+Q RLREEQ +I RNKP+G  +TLEDL +M+Y    +KE
Sbjct  175   GKTTTASAIMWCVKFLDENREVQYRLREEQHAIARNKPEGTSLTLEDLKSMSYG---LKE  231

Query  699   TLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEM  520
             T                                             + P  F P      
Sbjct  232   T---------------------------------------------QKPYSFIP------  240

Query  519   QRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSG  340
                     FGSGPRTCLG+NMAKV MLV+LHRL + Y W+VDD DPSLE+K+HIPRLRSG
Sbjct  241   --------FGSGPRTCLGMNMAKVIMLVFLHRLITAYNWTVDDLDPSLEKKSHIPRLRSG  292

Query  339   CPITLTAFNQG  307
             CPITL A N+ 
Sbjct  293   CPITLKALNKA  303



>ref|XP_002893056.1| CYP722A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69315.1| CYP722A1 [Arabidopsis lyrata subsp. lyrata]
Length=450

 Score =   374 bits (959),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 186/442 (42%), Positives = 278/442 (63%), Gaps = 5/442 (1%)
 Frame = -2

Query  1731  VFLGLLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTR  1552
             V    ++ +G  + ++     +S + + PG  G P +GET   + + NS KG Y+FVR+R
Sbjct  9     VLCAAMLALGKFLKIMFQDRKKSTADVPPGSDGFPVIGETLQFMLSVNSGKGFYEFVRSR  68

Query  1551  RLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHE  1372
             R+ +G  F+T +FG+ HVF+ + D A+ +  N+  +F K Y+KS+ + VG +SLLC    
Sbjct  69    RIRYGGCFRTSLFGETHVFLSTTDSARAVLNNESGMFTKRYIKSIGELVGDRSLLCASQH  128

Query  1371  SHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNM  1192
              HK +R  L + FS  S ++ V++FD ++   L      G    + D  ++ITF AMC M
Sbjct  129   HHKILRSRLINLFSKRSTALMVRQFDELVVDALGGWEDRGTVVLLTDL-LQITFKAMCKM  187

Query  1191  LMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRR  1012
             L+S+ D   L  +++D   V +AML+FP+ +P TR++KGI ARGR+ME  + II  RR  
Sbjct  188   LISLEDEEELGSMQKDVGFVCEAMLAFPLNLPWTRFHKGIMARGRVMEMLEKIIRERRNE  247

Query  1011  MGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLL  832
             +   N   ED  FLQ++L  D++  + KL D EI DN+LT+IIAGQ TTA+A+ W +K L
Sbjct  248   INSQNNHHED--FLQQLLAVDNY--TPKLTDAEIKDNILTMIIAGQDTTASALTWMIKYL  303

Query  831   DENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVAL  652
              EN ++ + L E+             + LEDL+ M YASK+VKE+LRM++V+ WFPR+ L
Sbjct  304   GENQKVLDILIEQSQLTNNKASNKPFLELEDLSEMPYASKMVKESLRMASVVPWFPRLVL  363

Query  651   DNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTC  472
              +C++EG+ IKKGW++NIDA  IH DP +Y +P  FNP RF+E  +  S++ FG G RTC
Sbjct  364   QDCEMEGYKIKKGWNINIDARSIHLDPTVYNEPHKFNPLRFEEEAKANSFLAFGMGGRTC  423

Query  471   LGINMAKVTMLVYLHRLTSRYK  406
             LG+ MAK  MLV+LHR  + Y+
Sbjct  424   LGLVMAKAMMLVFLHRFITTYR  445



>dbj|BAJ91618.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=456

 Score =   356 bits (914),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 185/394 (47%), Positives = 266/394 (68%), Gaps = 11/394 (3%)
 Frame = -2

Query  1479  GAKTI--FANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFV  1306
             GA+T+   A D   F K YV+++AD +G+ SLLC  H +H+R+RR ++  F+    + F 
Sbjct  61    GAETLSFLAADPPHFAKRYVRTVADLLGEHSLLCTSHGAHRRMRRAVAGLFASAPTAAFA  120

Query  1305  QKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSIT-DGSLLRRIERDCSTVS  1129
               FDR++  RL      G++  VLD  + +TF A+C ML+    D   L +++ D   V+
Sbjct  121   AAFDRLITARLLADGCQGRA-VVLDAALDVTFGAICEMLIGPQEDAHKLEQLQSDVMDVT  179

Query  1128  DAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERD  949
              AML+ P+ +PGTR+Y+G++AR R+M+  +  I  RR +   G + D   DFLQ +L + 
Sbjct  180   QAMLALPIRLPGTRFYRGLQARKRIMDVLRQEISMRREK---GLKLDHRDDFLQSLLLKS  236

Query  948   SF--PESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILR  775
                 PE E L DE+I+DN+LTLIIAGQ TTA A+ W VK L +NT++Q +LR  QL  L 
Sbjct  237   HMDSPE-EALTDEQILDNILTLIIAGQVTTATAITWMVKYLGDNTDLQEKLRSVQLD-LA  294

Query  774   NKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNID  595
             +K   A +TL+ LNTM YA K+VKE+LRM+ ++ WFPRVAL +C++ GF IKK W VN+D
Sbjct  295   SKHHDAPLTLQHLNTMDYAYKIVKESLRMATIVSWFPRVALKDCQVAGFHIKKDWIVNVD  354

Query  594   ATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTS  415
             A  IHYDPAIY +PT F+PSRF++  +PYS++ FG+G RTCLG+N+AK+ ML++LHRL +
Sbjct  355   ARSIHYDPAIYDNPTVFDPSRFNDDMKPYSFLVFGAGSRTCLGMNLAKIMMLIFLHRLVT  414

Query  414   RYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFN  313
              ++W + D D SLE+ A  PRL++GCPI LT  +
Sbjct  415   NFRWEMADHDSSLEKWAMFPRLKNGCPIRLTPIH  448



>ref|XP_006425454.1| hypothetical protein CICLE_v10027097mg [Citrus clementina]
 gb|ESR38694.1| hypothetical protein CICLE_v10027097mg [Citrus clementina]
Length=523

 Score =   358 bits (920),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 192/475 (40%), Positives = 277/475 (58%), Gaps = 70/475 (15%)
 Frame = -2

Query  1689  LLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFG  1510
             +LRG   RS   I PG  G+P +GET   ++A NS++G Y F++ R L  G         
Sbjct  101   MLRG---RSTVSIPPGSEGLPLIGETLQFMAAINSSQGFYQFIQVRHLNTG---------  148

Query  1509  KIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFS  1330
                        AK I  N+   F K Y+KS+ + VG  S+LC   + HK IR  L++ FS
Sbjct  149   ----------AAKIILNNEGENFTKRYIKSVGEIVGDNSVLCASTQRHKLIRSRLANLFS  198

Query  1329  MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIE  1150
             ++SLSIF ++FD+++ + L +      +  VL   +K+TF AMC +L+S+  G  L  +E
Sbjct  199   LSSLSIFTKQFDQLVLENLSDWEHKAATVVVLREALKVTFKAMCKILLSLESGKELEMLE  258

Query  1149  RDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFL  970
              D + V DAML+FP+ +P T++Y+G+KAR R+M T + +I+ RR+    G E+ ED  FL
Sbjct  259   NDVARVYDAMLAFPLKLPWTKFYRGVKARKRIMRTLEKMINIRRK----GLETHED--FL  312

Query  969   QEMLERDSFPES------------EKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDE  826
             Q +L  D+  +             +KL DEEI DN+LT+IIAGQ TTA+A+ W VK L E
Sbjct  313   QCLLAEDAVDKDRASLSSSSSETPKKLTDEEIQDNILTMIIAGQDTTASAITWMVKYLSE  372

Query  825   NTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDN  646
             N E+ ++L                             KVVKE+LRM++++ W+PR+ + +
Sbjct  373   NEEVLDKL-----------------------------KVVKESLRMASIVAWYPRLVIHD  403

Query  645   CKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFD-EMQRPYSYIPFGSGPRTCL  469
             C+IEG+ IK GW VNIDA  IH D  ++ +P  FNPSRFD +  +PY  IPF  G R CL
Sbjct  404   CEIEGYVIKAGWSVNIDAKSIHLDSTVHSNPYKFNPSRFDGDESKPYGSIPFSMGGRACL  463

Query  468   GINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFNQGD  304
             G++MAK  MLV+LHRL + YKW + D D S+++ A   RL+SGCPI + + N  D
Sbjct  464   GMHMAKAMMLVFLHRLITTYKWEMIDSDSSIDKWAMFARLKSGCPIHVKSTNIQD  518



>ref|XP_010673152.1| PREDICTED: abscisic acid 8'-hydroxylase 4 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=442

 Score =   355 bits (912),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 182/408 (45%), Positives = 255/408 (63%), Gaps = 8/408 (2%)
 Frame = -2

Query  1668  RSKSCIIPGKLGI-PFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFV  1492
             +S+  I PG  G+ P++GET   ++A  S +G Y FV+ R L +G  FKT IFG+ HVFV
Sbjct  34    KSQINIPPGSRGLFPYIGETLQFIAAIYSKQGFYSFVQARHLRYGNCFKTHIFGETHVFV  93

Query  1491  PSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSI  1312
              S   AK I +ND   F K Y++S+ + VG +SLLC  H+SHK +RR L D F+  S++ 
Sbjct  94    SSTKAAKEIMSNDLGKFTKKYIRSIGEVVGSESLLCASHQSHKLLRRHLLDLFTSKSITD  153

Query  1311  FVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTV  1132
             F ++FD ++   L      G    +LD  +K+TF AMC ML+S+  G+ L  +++D   V
Sbjct  154   FTKQFDELVIHTLLTWEYKGH-VVILDEALKMTFKAMCKMLLSLEAGNELYMLQKDVDCV  212

Query  1131  SDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRR-RRMGRGNESDEDRDFLQEML-  958
               AML+ P+  P T + KG+KAR R+M+    II  RR +   +       +DFLQ +L 
Sbjct  213   CHAMLALPLKFPWTTFSKGLKARKRIMDMLGKIIQERRIKHSAQVPVVHHHQDFLQYLLL  272

Query  957   ----ERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQ  790
                 E  S  +   L D  I DN+LT+IIAGQ TTA+AM W VK LDEN  +   L +E 
Sbjct  273   ALDRESCSSDQEPTLTDAHIKDNILTMIIAGQDTTASAMTWMVKYLDENQGVLEVLLDEV  332

Query  789   LSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGW  610
              +  +     + +TLE+LN MTY +KVVKE LRM++++ WFPRVAL +C I G+ I+KGW
Sbjct  333   HNQQKIAAHKSFLTLEELNEMTYGAKVVKECLRMASIVPWFPRVALHDCNILGYTIEKGW  392

Query  609   HVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLG  466
             ++N+DA  IH+DP ++KDP  FNPSRFD   + YSY+ FG+G RTCLG
Sbjct  393   NINVDARSIHFDPTLHKDPHQFNPSRFDIEPKAYSYLAFGAGGRTCLG  440



>gb|KDO71004.1| hypothetical protein CISIN_1g0156961mg, partial [Citrus sinensis]
Length=228

 Score =   345 bits (885),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 172/234 (74%), Positives = 194/234 (83%), Gaps = 6/234 (3%)
 Frame = -2

Query  1500  VFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNS  1321
             +FVPS +GAK IF +DFA FNKGYVKSMADAVGK SLLCVPHESHKRIRRLLSDPFSMNS
Sbjct  1     MFVPSTEGAKMIFTSDFANFNKGYVKSMADAVGKNSLLCVPHESHKRIRRLLSDPFSMNS  60

Query  1320  LSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDC  1141
             LS FV+ FD+ML +RL +    GKSF++LDF+MK+TFDAMCNMLMS+TD SLL +IE+DC
Sbjct  61    LSKFVKTFDKMLSERLNKLQESGKSFSILDFSMKLTFDAMCNMLMSVTDDSLLGQIEKDC  120

Query  1140  STVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEM  961
             + VSDAMLSFP MIPGTRYY+GIKAR RLMETF+ +I  RR     G ES E  DFLQ M
Sbjct  121   TAVSDAMLSFPFMIPGTRYYRGIKARRRLMETFRGMIAKRR----SGEESFE--DFLQSM  174

Query  960   LERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLR  799
             LE+DS P +EKL D EIMDNLLTLIIAGQTTTAAAMMWSVK L +N E Q +LR
Sbjct  175   LEKDSCPTNEKLSDSEIMDNLLTLIIAGQTTTAAAMMWSVKFLHDNREAQQKLR  228



>ref|XP_009110266.1| PREDICTED: abscisic acid 8'-hydroxylase 1 isoform X2 [Brassica 
rapa]
Length=439

 Score =   337 bits (863),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 178/455 (39%), Positives = 253/455 (56%), Gaps = 58/455 (13%)
 Frame = -2

Query  1668  RSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVP  1489
             +S + I PG  G P +GET   + + NS KG Y+FVR+RR+ +G  F+T +FG+ HVF+ 
Sbjct  34    KSTADIPPGSHGFPVVGETLQFMLSVNSGKGFYEFVRSRRIRYGSCFRTSLFGETHVFLS  93

Query  1488  SVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIF  1309
             + + A+ +  N+  +F K Y+KS+A  VG +SLLC     HK +R    + FS  S ++ 
Sbjct  94    TTESARAVLNNESGMFTKRYIKSIAALVGDRSLLCASQHHHKILRSRFINLFSKKSTALM  153

Query  1308  VQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVS  1129
             V+ FD ++   L      G    + D                                  
Sbjct  154   VRHFDELVVDALSGWEHRGTVVLLTDL---------------------------------  180

Query  1128  DAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLE--  955
                               ++ARGR+ME  + II  RR      N +  + DFLQ++L   
Sbjct  181   ------------------LQARGRVMEVLEKIIRERRNETNSHNNNYRE-DFLQQLLAVD  221

Query  954   ----RDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQL  787
                   S   S KL D EI DN+LT+IIAGQ TTA+A+ W VK L EN ++ N L EEQ 
Sbjct  222   SDGSASSSDHSTKLTDAEIKDNILTMIIAGQDTTASALTWMVKYLGENQKVLNILIEEQT  281

Query  786   SILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWH  607
              + +       + L+DL  MTYASK+VKE+LRM++V+ WFPR+ L +C++EG+ I KGW+
Sbjct  282   QLAKQASHKPFLELDDLTEMTYASKMVKESLRMASVVPWFPRLVLQDCEMEGYKINKGWN  341

Query  606   VNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLH  427
             +NIDA  IH DP +Y +P  FNPSRFDE  +  S++ FG G RTCLG+NMAK  M+V+LH
Sbjct  342   INIDARSIHLDPNVYSEPHKFNPSRFDEEAKANSFLAFGMGGRTCLGLNMAKAMMVVFLH  401

Query  426   RLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             R  + Y+W V D DPS+E+     RL+SG PI ++
Sbjct  402   RFITTYRWEVVDGDPSIEKWTLFARLKSGYPIRVS  436



>ref|XP_006654892.1| PREDICTED: abscisic acid 8'-hydroxylase 2-like [Oryza brachyantha]
Length=502

 Score =   333 bits (853),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 178/465 (38%), Positives = 272/465 (58%), Gaps = 34/465 (7%)
 Frame = -2

Query  1617  ETFSLLSATNSTKGCYDFVRTRR---LWHGRWFKTRIFGKIHVFVP-SVDGAKTIFANDF  1450
             ET + L+A  S +G Y FV  R    L HG  F+T + G++HVF+P S   A  + A + 
Sbjct  33    ETAAFLAAHGSGRGFYHFVHARYARYLRHGPCFRTALLGRVHVFLPASAPAAYQLLAAEP  92

Query  1449  ALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLE  1270
             + F K Y ++ A+ +G  S+LC  H  H+  RR ++  FSM S + F   FDR+    + 
Sbjct  93    SHFAKRYARTAAELLGAHSILCCSHVEHRLARRAVATLFSMPSTAAFTATFDRLASDVIV  152

Query  1269  EQHR-------IGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSF  1111
              Q R              LD  ++I++ A+C ML  +   + L R+  +   V+ AML+ 
Sbjct  153   GQWRPRNGDDTATVQVVALDAALEISYGAICEML--VGKKNRLERVRGEVFAVTQAMLAL  210

Query  1110  PV-MIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPES  934
             P+  +PG+R+ +G++AR R+M   +  + +R+    + +  D     +Q   +R   P++
Sbjct  211   PLRWVPGSRFRRGLEARKRIMAALREEMAARQHEHDQ-HGGDLLSVLMQRRRQRHHHPDA  269

Query  933   EKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGAL  754
                E E+I+DN+LTLIIAGQ TTA A+ W +K L +N  IQ++LR E + +     +  L
Sbjct  270   LTTE-EQILDNILTLIIAGQVTTATAITWMLKYLSDNRHIQDKLRAEAVGVELKNNQAGL  328

Query  753   ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYD  574
             +T++DLN M YA K VKE+LRM+ ++ WFPR+ALD+C + GF I+K W VNIDA  +HYD
Sbjct  329   VTMQDLNGMEYAYKAVKESLRMATIVSWFPRLALDDCHLAGFQIRKDWIVNIDARSLHYD  388

Query  573   PAIYKDPTHFNPSRFDE------------------MQRPYSYIPFGSGPRTCLGINMAKV  448
             PA++ +PT F+PSRF+E                    +    + FG+G RTCLG+N+AK+
Sbjct  389   PAVFDNPTVFDPSRFNEEGSDDETVKKKKKKKGPSAAQQRRLLVFGAGSRTCLGMNLAKI  448

Query  447   TMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFN  313
              MLV+L+RL + ++W + D D SLE+ A  PRL++GCPI LT  N
Sbjct  449   MMLVFLYRLLTNFRWEMADDDTSLEKWAMFPRLKNGCPIRLTPIN  493



>ref|XP_009110267.1| PREDICTED: cytochrome P450 90A1 isoform X3 [Brassica rapa]
Length=424

 Score =   329 bits (843),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 168/390 (43%), Positives = 242/390 (62%), Gaps = 8/390 (2%)
 Frame = -2

Query  1668  RSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVP  1489
             +S + I PG  G P +GET   + + NS KG Y+FVR+RR+ +G  F+T +FG+ HVF+ 
Sbjct  34    KSTADIPPGSHGFPVVGETLQFMLSVNSGKGFYEFVRSRRIRYGSCFRTSLFGETHVFLS  93

Query  1488  SVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIF  1309
             + + A+ +  N+  +F K Y+KS+A  VG +SLLC     HK +R    + FS  S ++ 
Sbjct  94    TTESARAVLNNESGMFTKRYIKSIAALVGDRSLLCASQHHHKILRSRFINLFSKKSTALM  153

Query  1308  VQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVS  1129
             V+ FD ++   L      G    + D  ++ITF AMC ML+S+ +   L  ++RD   V 
Sbjct  154   VRHFDELVVDALSGWEHRGTVVLLTDL-LQITFKAMCKMLISLENEEELGSLQRDVGFVC  212

Query  1128  DAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLE--  955
             +AML+FP+ +P TR++KGI ARGR+ME  + II  RR      N +  + DFLQ++L   
Sbjct  213   EAMLAFPLNLPWTRFHKGIMARGRVMEVLEKIIRERRNETNSHNNNYRE-DFLQQLLAVD  271

Query  954   ----RDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQL  787
                   S   S KL D EI DN+LT+IIAGQ TTA+A+ W VK L EN ++ N L EEQ 
Sbjct  272   SDGSASSSDHSTKLTDAEIKDNILTMIIAGQDTTASALTWMVKYLGENQKVLNILIEEQT  331

Query  786   SILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWH  607
              + +       + L+DL  MTYASK+VKE+LRM++V+ WFPR+ L +C++EG+ I KGW+
Sbjct  332   QLAKQASHKPFLELDDLTEMTYASKMVKESLRMASVVPWFPRLVLQDCEMEGYKINKGWN  391

Query  606   VNIDATCIHYDPAIYKDPTHFNPSRFDEMQ  517
             +NIDA  IH DP +Y +P  FNPSR  + Q
Sbjct  392   INIDARSIHLDPNVYSEPHKFNPSRRKQKQ  421



>ref|NP_001183271.1| putative cytochrome P450 superfamily protein [Zea mays]
 gb|ACR36255.1| unknown [Zea mays]
 gb|AFW82946.1| LOW QUALITY PROTEIN: putative cytochrome P450 superfamily protein 
[Zea mays]
Length=550

 Score =   328 bits (840),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 187/469 (40%), Positives = 281/469 (60%), Gaps = 38/469 (8%)
 Frame = -2

Query  1617  ETFSLLSATNSTKGCYDFV--RTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFAL  1444
             ET + LSA +S +G Y FV  R RR   G  F+T + G  HVFV S D A+++   + A 
Sbjct  81    ETLAFLSANSSGRGFYHFVEARHRRYGPGPCFRTSLLGATHVFVSSADAARSLLGAEPAG  140

Query  1443  FNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQ  1264
             F+K YV+++A+ +G+ SLLC  H +H+ +RR ++  F+  + +     FD  L +RL ++
Sbjct  141   FSKRYVRTVAELLGEHSLLCASHATHRALRRAVAPLFNAQATASLAATFDG-LTRRLMKR  199

Query  1263  HRIGK--SFTVLDFNMKITFDAMCNMLMSIT-DGSLLRRIERDCSTVSDAMLSFPVMIPG  1093
                    +  VLD  + +TF+A+C+ML+  T      RR++ D   V+ AML+FP+ +PG
Sbjct  200   DWSSSTGAVVVLDAALDLTFEAICDMLIGRTLRPDARRRLQSDVLAVTRAMLAFPLRLPG  259

Query  1092  TRYYKGIKARGRLMETFKTIIDSRRRRM----GRGNESDEDRDFLQEMLERDS-------  946
             TR++ G++AR R+M+  +  I SR+R++        E     DFLQ +L   S       
Sbjct  260   TRFHAGLRARKRIMDVLRQEIGSRQRQIMDMEEEEEEQQHGDDFLQSLLLLRSRRRRRSQ  319

Query  945   -----FPESEKLEDE---------EIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQN  808
                   P S    ++         +I+DN+LTLIIAGQ TTA+A+ W VK L +N   Q 
Sbjct  320   QQQHLLPSSSAHHNDDDDLFLTDDQILDNILTLIIAGQVTTASAITWMVKYLADNKVFQE  379

Query  807   RLRE--EQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIE  634
              LR    +L   + + +     L+ LN+M  A   VKE+LRM++++ WFPRVAL++C++ 
Sbjct  380   TLRSVQLELKQQQQQEEADHDLLQHLNSMELAYMTVKESLRMASIVSWFPRVALEDCQVA  439

Query  633   GFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFD-----EMQRPYSYIPFGSGPRTCL  469
             GF I KGW VNIDA  +HYD  +Y +PT F+PSRF        ++PYS++ FG+G RTCL
Sbjct  440   GFHIHKGWIVNIDARALHYDATLYHNPTMFDPSRFKGGHSMHTKQPYSFLVFGAGGRTCL  499

Query  468   GINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             G+N+AK+ ML++LH L + ++W + D DPSLE+ A  PRLR+GCPI L 
Sbjct  500   GMNLAKIMMLIFLHHLVTTWRWEMADDDPSLEKWAMFPRLRNGCPIHLA  548



>gb|AAF79438.1|AC025808_20 F18O14.38 [Arabidopsis thaliana]
Length=375

 Score =   308 bits (790),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 158/355 (45%), Positives = 226/355 (64%), Gaps = 12/355 (3%)
 Frame = -2

Query  1446  LFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEE  1267
             +F K Y+KS+ + VG +SLLC P   HK +R  L + FS  S ++ V+ FD ++   L  
Sbjct  1     MFTKRYIKSIGELVGDRSLLCAPQHHHKILRSRLINLFSKRSTALMVRHFDELVVDALGG  60

Query  1266  QHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTR  1087
                 G    + D  ++ITF AMC ML+S+     L  ++RD   V +AML+FP+ +P TR
Sbjct  61    WEHRGTVVLLTDL-LQITFKAMCKMLVSLEKEEELGSMQRDVGFVCEAMLAFPLNLPWTR  119

Query  1086  YYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIM  907
             ++KGI ARGR+ME  + II  RR  +   N   ED  FLQ++L  D+  ++ +L D EI 
Sbjct  120   FHKGIMARGRVMEMLEKIIRERRNEINSHNNHHED--FLQQLLAVDN--DTPQLTDAEIK  175

Query  906   DNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTM  727
             DN+LT+IIAGQ TTA+A+ W VK L EN ++ + L EEQ  I +       + LEDL+ M
Sbjct  176   DNILTMIIAGQDTTASALTWMVKYLGENQKVLDILIEEQSQITKKASNKPFLELEDLSEM  235

Query  726   TYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTH  547
              YASK+VKE+LRM++V+ WFPR+ L +C++EG+ IKKGW++NIDA  IH DP +Y +P  
Sbjct  236   PYASKMVKESLRMASVVPWFPRLVLQDCEMEGYKIKKGWNINIDARSIHLDPTVYSEPHK  295

Query  546   FNPSRFD-------EMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKW  403
             FNP RF+       E  +  S++ FG G RTCLG+ +AK  MLV+LHR  + Y++
Sbjct  296   FNPLRFEVNKPQFKEEAKANSFLAFGMGGRTCLGLALAKAMMLVFLHRFITTYRF  350



>ref|XP_010927381.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Elaeis guineensis]
Length=478

 Score =   311 bits (797),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 159/421 (38%), Positives = 245/421 (58%), Gaps = 13/421 (3%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG PF+GETFS +S  +S  G Y FV  R+  +G+ FKTR+ G++ VF+   + +K
Sbjct  35    IPGCLGWPFIGETFSFISEFSSASGIYSFVHKRQQMYGKVFKTRVLGRLTVFMTGREASK  94

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              + +    + +     +    +G  SLL    E HKR+RRL+++P S+++L  ++Q  D 
Sbjct  95    ILLSGKDGMVSLNLFYTGQQVLGPTSLLTTSGEEHKRLRRLIAEPLSIDALKKYLQFIDD  154

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITD-GSLLRRIERDCSTVSDAMLS  1114
             +  + L+     G+   VL+     T   + +M+MS+   G    +   +   +S +  S
Sbjct  155   LAIKTLDGW--AGRRVFVLEEASIFTLKVIAHMIMSLEPYGEEQEKFRANFKLISSSFAS  212

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPE-  937
              P  IPG  +++G++AR R+     +II  RR      +  D   DFLQ +L + S  E 
Sbjct  213   LPFKIPGCAFHRGLEARNRMYAMLDSIISKRR------DGKDVHHDFLQTLLRKHSKEET  266

Query  936   ---SEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKP  766
                S+KL D ++ DN+LTL++AG  TT AA+ W +K L EN ++   LREE + I   + 
Sbjct  267   DDDSDKLTDAQLKDNILTLLVAGHDTTTAALTWLIKFLGENPDVLQNLREEHIGIQERRH  326

Query  765   KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATC  586
               + +T  ++N M Y  KV+ ETLR + +L WF R A  +  I+G DIKKGW VN+D   
Sbjct  327   GSSHLTWSEVNNMPYTIKVISETLRKATILPWFSRKAAQDFSIDGCDIKKGWSVNLDVVS  386

Query  585   IHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYK  406
             IH+DP ++ +P  F+PSRFD   +P+S++ FGSGPR C GIN+AK+ + V+LH LT R+K
Sbjct  387   IHHDPDVFPNPEKFDPSRFDNPLKPFSFLGFGSGPRMCPGINLAKLEICVFLHHLTCRFK  446

Query  405   W  403
             W
Sbjct  447   W  447



>ref|XP_002466145.1| hypothetical protein SORBIDRAFT_01g002160 [Sorghum bicolor]
 gb|EER93143.1| hypothetical protein SORBIDRAFT_01g002160 [Sorghum bicolor]
Length=475

 Score =   310 bits (794),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 164/455 (36%), Positives = 264/455 (58%), Gaps = 11/455 (2%)
 Frame = -2

Query  1719  LLVGIGIA---VYLLRGQTVRSKSC-IIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTR  1552
             +LV + +A   +  LR +   SK    IPG +G P +GETFS +S  +S  G   F+R R
Sbjct  8     VLVAVALACAGLLWLRSRISSSKEMRDIPGTMGWPVIGETFSFISDFSSPAGILSFMRDR  67

Query  1551  RLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHE  1372
             +   G+ FKT + G+I VF+   D AK + +    + +     +    +G  SLL    +
Sbjct  68    QRRFGKVFKTYVLGRITVFMTGRDAAKILLSGKDGVVSLNLFYTGKQVLGPTSLLTTNGD  127

Query  1371  SHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKS-FTVLDFNMKITFDAMCN  1195
              HK++RRL+ +P S+++L  ++   + +  Q L+  H  G+S   VL+     T   + N
Sbjct  128   EHKKLRRLIGEPLSIDALKKYLGFINDLAVQTLDTWH--GRSRVLVLEEASSFTLKVIAN  185

Query  1194  MLMSI-TDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRR  1018
             ML+S+  +G    +   +   +S +  S P+ +PGT +++G+KAR R+     ++I  RR
Sbjct  186   MLVSLEPEGEEQEKFRANFKVISSSFASLPLKLPGTAFHRGLKARNRMYAMLDSVIARRR  245

Query  1017  RRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVK  838
              R G G   +   DFLQ +L + +  E++KL D ++ DN+LTL++AG  TT A + W VK
Sbjct  246   IRDGGG---EAPSDFLQTLLRKHAGDEADKLTDAQLKDNILTLLVAGHDTTTAGLTWLVK  302

Query  837   LLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRV  658
              L EN ++  +LREE L I       + ++  D+N M Y +KV+ ETLR + +L WF R 
Sbjct  303   FLGENPDVLAKLREEHLEIKERLNGSSRLSWSDVNNMPYTNKVMNETLRRATILPWFSRK  362

Query  657   ALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPR  478
             A  +  I+G++IKKG  VN+D   IH+DP+++ DP  FNP+RFDE  +PYS++ FGSGPR
Sbjct  363   AAQDFSIDGYEIKKGTSVNLDVVSIHHDPSVFADPERFNPNRFDETLKPYSFLGFGSGPR  422

Query  477   TCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLE  373
              C G+++AK+ + V++H L  RY W   + D +++
Sbjct  423   MCPGMSLAKLEICVFVHHLVCRYSWKPLENDDTVQ  457



>gb|KDO83690.1| hypothetical protein CISIN_1g012199mg [Citrus sinensis]
Length=468

 Score =   309 bits (792),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 159/446 (36%), Positives = 255/446 (57%), Gaps = 14/446 (3%)
 Frame = -2

Query  1692  YLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIF  1513
             +L+R      +   IPG LG+P +GE+F+ LSA +   G Y FV+ R+  +G+ FKT   
Sbjct  13    FLMRSMASPKEMEGIPGSLGLPIVGESFAFLSAFSKPSGIYSFVKERQQRYGKVFKTYTL  72

Query  1512  GKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPF  1333
             G+  V +   + +K +      + +     +    +G  SLL    E+HKR+RRL+++P 
Sbjct  73    GRFSVIMTGREASKILLTGKDGMVSLNLFYTGQQVLGPTSLLQTNGEAHKRLRRLIAEPL  132

Query  1332  SMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSIT-DGSLLRR  1156
             S++ L  + Q  + +  + L++    GK   VL+     T   + NM+MS+   G    +
Sbjct  133   SVDGLKKYFQFINTLAIETLDQWS--GKKVLVLEEASTFTLKVIGNMIMSLEPTGEEQEK  190

Query  1155  IERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRD  976
                +   +S +  S P+ IPGT +Y+GIKAR R+     +II  RR       ES + +D
Sbjct  191   FRANFKLISSSFASLPLKIPGTAFYRGIKARDRMYAMLDSIISKRR-----SGESIQ-QD  244

Query  975   FLQEMLERDSFPESE-----KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQ  811
             FL+ ++ + S    E     KL D+++ DN+LTL++AG  TT AA+ W +K ++EN  + 
Sbjct  245   FLESLIIKHSQAADEEANEDKLTDKQLKDNILTLLVAGHDTTTAALTWLIKFIEENPAVL  304

Query  810   NRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEG  631
              +LREE   I  N+  G+ +T  ++N M Y +KV+ ETLR + +L WF R A  + +IEG
Sbjct  305   QKLREEHREIQANRNGGSNLTWSEVNNMPYTTKVISETLRRATILPWFSRKAAQDFEIEG  364

Query  630   FDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAK  451
             + I KGW +N+D   IH+DP I+ +P  F+PSRFD   + +S++ FGSGPR C GIN+AK
Sbjct  365   YKIVKGWSINLDVVSIHHDPGIFANPEKFDPSRFDAPIKTFSFLGFGSGPRMCPGINLAK  424

Query  450   VTMLVYLHRLTSRYKWSVDDPDPSLE  373
             + + +++H L  RYKW   + D S++
Sbjct  425   LEICIFIHHLVCRYKWRALEKDDSVQ  450



>gb|KEH25831.1| cytochrome P450 family protein [Medicago truncatula]
Length=481

 Score =   309 bits (792),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 165/478 (35%), Positives = 268/478 (56%), Gaps = 22/478 (5%)
 Frame = -2

Query  1785  LGKLRMVFGSMVSHYYYDVFLGLLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFS  1606
             +G + M+   ++S  ++ V L +L    + +YL R          IPG LG P +GE+  
Sbjct  1     MGLINMLLCWILSLIFFLVVLSIL----LLMYLTRSPKEMEG---IPGNLGWPIIGESLK  53

Query  1605  LLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYV  1426
              +S  +S  G + F+  R+  +G+ FK+ + G+  VF+   + +K +      L +    
Sbjct  54    FISDFSSPSGIFSFMNNRQKRYGKVFKSFVLGRFTVFMTGREASKILLTGKDGLVSLNLF  113

Query  1425  KSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKS  1246
              +    +G  SLL    E+HKR+RRL+++P S++ L  +    +      L++    GK 
Sbjct  114   YTGQQVLGPTSLLQTTGEAHKRLRRLIAEPLSLDGLKKYFHFINTQAIVTLDQWE--GKK  171

Query  1245  FTVLDFNMKITFDAMCNMLMSIT-DGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIK  1069
               VL+     T   + +M+MS+   G    +   +   +S +  S P  +PGT +++GIK
Sbjct  172   VHVLEEASTFTLKVIGHMIMSLEPTGEDQEKFRSNFKIISSSFASLPFKLPGTAFHRGIK  231

Query  1068  ARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEML-----ERDSFPESE-KLEDEEIM  907
             AR R+ +   ++I  RR      N  D  +DFL+ ++     + D   E E KL D+++ 
Sbjct  232   ARDRMYDMLDSVISRRR------NGQDFQQDFLESLIMKHSRKSDGQEEDENKLTDKQLK  285

Query  906   DNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTM  727
             DN+LTL++AG  TT AA+ W +K L+EN  +  +LREE   I+ N+  G  +T  ++N M
Sbjct  286   DNVLTLLVAGHDTTTAALTWLIKFLEENQNVLEQLREEHNEIIANRKSGTELTWSEVNNM  345

Query  726   TYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTH  547
              Y +KV+ ETLR + +L W+ R A  + +I+G+ IKKGW VN+D   IH+DP ++ DP  
Sbjct  346   PYTAKVISETLRRATILPWYSRKAAQDFEIDGYQIKKGWSVNLDVVSIHHDPNVFPDPEK  405

Query  546   FNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLE  373
             FNPSRFDE  RP+S++ FGSGPR C G+N+AKV + V++H L +RYKW   + D S++
Sbjct  406   FNPSRFDEHLRPFSFLGFGSGPRMCPGMNLAKVEICVFIHHLVTRYKWRALEKDDSVQ  463



>ref|XP_006472966.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Citrus sinensis]
Length=476

 Score =   309 bits (791),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 159/446 (36%), Positives = 255/446 (57%), Gaps = 14/446 (3%)
 Frame = -2

Query  1692  YLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIF  1513
             +L+R      +   IPG LG+P +GE+F+ LSA +   G Y FV+ R+  +G+ FKT   
Sbjct  21    FLMRSMASPKEMEGIPGSLGLPIVGESFAFLSAFSKPSGIYSFVKERQQRYGKVFKTYTL  80

Query  1512  GKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPF  1333
             G+  V +   + +K +      + +     +    +G  SLL    E+HKR+RRL+++P 
Sbjct  81    GRFSVIMTGREASKILLTGKDGMVSLNLFYTGQQVLGPTSLLQTNGEAHKRLRRLIAEPL  140

Query  1332  SMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSIT-DGSLLRR  1156
             S++ L  + Q  + +  + L++    GK   VL+     T   + NM+MS+   G    +
Sbjct  141   SVDGLKKYFQFINTLAIETLDQWS--GKKVLVLEEASTFTLKVIGNMIMSLEPTGEEQEK  198

Query  1155  IERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRD  976
                +   +S +  S P+ IPGT +Y+GIKAR R+     +II  RR       ES + +D
Sbjct  199   FRANFKLISSSFASLPLKIPGTAFYRGIKARDRMYAMLDSIISKRR-----SGESIQ-QD  252

Query  975   FLQEMLERDSFPESE-----KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQ  811
             FL+ ++ + S    E     KL D+++ DN+LTL++AG  TT AA+ W +K ++EN  + 
Sbjct  253   FLESLIIKHSQAADEEANEDKLTDKQLKDNILTLLVAGHDTTTAALTWLIKFIEENPAVL  312

Query  810   NRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEG  631
              +LREE   I  N+  G+ +T  ++N M Y +KV+ ETLR + +L WF R A  + +IEG
Sbjct  313   QKLREEHREIQANRNGGSNLTWSEVNNMPYTTKVISETLRRATILPWFSRKAAQDFEIEG  372

Query  630   FDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAK  451
             + I KGW +N+D   IH+DP I+ +P  F+PSRFD   + +S++ FGSGPR C GIN+AK
Sbjct  373   YKIVKGWSINLDVVSIHHDPGIFANPEKFDPSRFDAPIKTFSFLGFGSGPRMCPGINLAK  432

Query  450   VTMLVYLHRLTSRYKWSVDDPDPSLE  373
             + + +++H L  RYKW   + D S++
Sbjct  433   LEICIFIHHLVCRYKWRALEKDDSVQ  458



>ref|XP_004237776.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Solanum lycopersicum]
Length=477

 Score =   307 bits (786),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 159/432 (37%), Positives = 249/432 (58%), Gaps = 14/432 (3%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG P +GE+ S +S  +S  G Y F+  R+  +G+ FK+ + G+  VF+   + +K
Sbjct  36    IPGTLGWPIIGESLSFISEFSSPAGIYSFINKRQKLYGKVFKSYVLGRYTVFMTGREASK  95

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              +      + +     +    +G  SLL    E+HKR+RRL+++P S++ L  + Q  + 
Sbjct  96    ILLTGKDGIVSLNLFYTGQQVLGPTSLLQQTGEAHKRLRRLIAEPLSVDGLKKYFQFINS  155

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSI-TDGSLLRRIERDCSTVSDAMLS  1114
             +  + L++    G+   VL+     T   + NM+MS+   G    +   +   +S +  S
Sbjct  156   LAIETLDQWS--GRKILVLEETSTFTLKVIGNMIMSLEPTGEEQEKFRTNFKIISGSFAS  213

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDS--FP  940
              P  +PGT +Y+GI+AR R+     +IID RR      +  +  +DFLQ ++++     P
Sbjct  214   LPFKVPGTAFYRGIQARDRMYAMLDSIIDQRR------SGENIKQDFLQSLVKKHGKDAP  267

Query  939   ESE---KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNK  769
             E +   KL D+++ DN+LTL++AG  TT AA+ W +K L EN  +  RLREE   I   K
Sbjct  268   EGDDDDKLTDKQLKDNILTLLVAGHDTTTAALTWLLKFLQENPAVLERLREEHREIQAQK  327

Query  768   PKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDAT  589
                  +T  ++N M Y +KV+ ETLRM+ +L WF R A  + +IEG  IKKGW +N+D  
Sbjct  328   QGTLDLTWSEVNNMPYTAKVISETLRMATILPWFSRKAAQDFEIEGCKIKKGWSLNLDVV  387

Query  588   CIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRY  409
              IH DP I+ +P  F+PSRFD+  +P+S++ FGSGPR C GIN+AK+ + V+LH L  RY
Sbjct  388   SIHRDPKIFPNPEKFDPSRFDDPLKPFSFLGFGSGPRMCPGINLAKLEISVFLHHLVCRY  447

Query  408   KWSVDDPDPSLE  373
             KW+  D D S++
Sbjct  448   KWTPLDTDDSVQ  459



>ref|XP_008665727.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like isoform X2 [Zea 
mays]
 tpg|DAA52375.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=479

 Score =   306 bits (785),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 172/473 (36%), Positives = 272/473 (58%), Gaps = 28/473 (6%)
 Frame = -2

Query  1731  VFLG--LLVGIGIA----VYLLRGQTVRSKSCI-IPGKLGIPFLGETFSLLSATNSTKGC  1573
             VF G  +LV + +A    V  LR ++  SK    IPG +G P +GETFS +S  +S  G 
Sbjct  3     VFGGGPVLVAVALACAGLVVWLRSRSSSSKEMGDIPGTMGWPVVGETFSFISDFSSPAGI  62

Query  1572  YDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFAN------DFALFNKGYVKSMAD  1411
               F+R R+   G+ FKT + G++ VF+   D AK + ++         LF  G       
Sbjct  63    LSFMRDRQRRFGKVFKTYVLGRVTVFMTGRDAAKILLSSGKDGVVSLNLFYTG-----KQ  117

Query  1410  AVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKS-FTVL  1234
              +G  SLL    + H+++RRL+ +P S+++L  ++   + +  Q L+  H  G+S   VL
Sbjct  118   VLGPTSLLTTNGDEHRKLRRLIGEPLSVDALKKYLGFINDLAVQTLDTWH--GRSRVLVL  175

Query  1233  DFNMKITFDAMCNMLMSI-TDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGR  1057
             +     T   + NML+S+  +G    +   +   +S +  S P+ +PGT +++G+KAR R
Sbjct  176   EEASSFTLKVIANMLVSLEPEGEEQEKFRANFKVISSSFASLPLKVPGTAFHRGLKARNR  235

Query  1056  LMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAG  877
             +     ++I   RRR G   E+    DFLQ +L + +  E++KL D ++ DN+LTL++AG
Sbjct  236   MYAMLDSVI--ARRRSGSEGEAAAPSDFLQTLLRKHAGDEADKLTDAQLKDNILTLLVAG  293

Query  876   QTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKET  697
               TT A + W VK L EN ++ ++LREE L I  +    + +   D+N M Y +KV+ ET
Sbjct  294   HDTTTAGLTWLVKFLGENPDVLDKLREEHLEIKESLNGSSRLRWSDVNNMPYTNKVMNET  353

Query  696   LRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQ  517
             LR + +L W+ R A  +  I+G+ IKKG  VN+D   IH+DPA++ DP  F+P+RFDE  
Sbjct  354   LRRATILPWYSRKAAQDFSIDGYAIKKGTSVNLDVVSIHHDPAVFADPNRFDPNRFDETL  413

Query  516   RPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWS-VDDPD---PSLER  370
             +PYS++ FGSGPR C G+++AK+ + V++H L  RY W  ++D D   P+L R
Sbjct  414   KPYSFLGFGSGPRMCPGMSLAKLEICVFVHHLVCRYTWKPLEDDDTVQPTLVR  466



>emb|CDP11373.1| unnamed protein product [Coffea canephora]
Length=473

 Score =   304 bits (778),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 157/455 (35%), Positives = 258/455 (57%), Gaps = 17/455 (4%)
 Frame = -2

Query  1722  GLLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLW  1543
               L+ I +   LL+      +   IPG+LG P +GETFS ++  +S  G + F+R R+  
Sbjct  11    AFLILIVLVSALLQRWASPWEMAAIPGRLGWPIVGETFSFITEFSSAAGIHSFIRKRQQR  70

Query  1542  HGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHK  1363
             +G+ FKT + G++ VF+   + +K +      + +     +    +G  SLL    E+HK
Sbjct  71    YGKVFKTSVLGRLTVFMTGSEASKILLTGKDGMVSLNLSYAGRQVLGPTSLLHQNGEAHK  130

Query  1362  RIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMS  1183
             R+RRL+++P S+N L  + Q  D +    L++ H  G+   VL+     +   + NM+MS
Sbjct  131   RLRRLIAEPLSINGLKKYFQFIDNLAIDTLDKWH--GREILVLEEASTFSLKVISNMIMS  188

Query  1182  ITD-GSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMG  1006
             +   G    +   +   +S +  + P+ IPGT +Y+GI+AR R+     +II  RR    
Sbjct  189   LEPAGEEQEKFRANFKVMSSSFSALPLKIPGTAFYRGIQARNRMYAMLDSIIAQRR----  244

Query  1005  RGNESDEDRDFLQEMLERDS-----FPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSV  841
                  +  +DFL+ ++ + +       + +KL D ++ DN+LTL++AG  TT AA+ W V
Sbjct  245   --TGDNFQQDFLESLVNKYNEHGYGGEDDDKLTDAQLKDNILTLLVAGHDTTTAALTWLV  302

Query  840   KLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPR  661
             K L++N     RLREE   I  ++   + +T  D+N M Y +KV+ ETLR++ +L WF R
Sbjct  303   KFLEQNPAALERLREEHREIQASR---SGLTWSDINNMPYTNKVISETLRIATILPWFSR  359

Query  660   VALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGP  481
              A ++  ++G  I KGW VN+D   IH+DP ++ DP  F+PSRFDE  +P+S++ FGSGP
Sbjct  360   TAAEDFTVDGCKISKGWSVNLDVVSIHHDPKLFPDPQKFDPSRFDEPLKPFSFLGFGSGP  419

Query  480   RTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSL  376
             R C GIN+AK+ + +++H L  R+KW   + D S+
Sbjct  420   RMCPGINLAKIEICIFIHHLVCRFKWKPLEKDDSV  454



>gb|EEE61996.1| hypothetical protein OsJ_16777 [Oryza sativa Japonica Group]
Length=516

 Score =   305 bits (781),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 178/464 (38%), Positives = 266/464 (57%), Gaps = 35/464 (8%)
 Frame = -2

Query  1617  ETFSLLSATNSTKGCYDFVRTR-RLWHGRW-------FKTRIFGKIHVFV-PSVDGAKTI  1465
             ET + L++  S +G Y FV+ R +L+ G         F+T + G++HVFV  S   A  +
Sbjct  59    ETAAFLASHGSGRGFYHFVQERYKLYKGEGEGEATCCFRTALMGRVHVFVSASHPAASQL  118

Query  1464  FANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRR--LLSDPFSMNSLSIFVQKFDR  1291
                +     K Y ++ AD +G  S+LC    +H R  R  L +  F+  S + F   FDR
Sbjct  119   LTAEPPHLPKRYARTAADLLGPHSILCSTSHAHHRHARRALATTLFATPSTAAFAAAFDR  178

Query  1290  MLCQR---LEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAM  1120
             ++ +    L   H   +   VLD  + I++ A+C ML+    G L R ++ D   V+ AM
Sbjct  179   LVIRHWTTLLPPHNQNQVVVVLDAALHISYRAICEMLLGAGGGKL-RPLQSDVFAVTQAM  237

Query  1119  LSFPV-MIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSF  943
             L+ P+  +PGTR+ +G+ AR R+M   +  + +R       +      D L  +++R   
Sbjct  238   LALPLRWLPGTRFRRGLHARKRIMAALREEMAARNHHH---HHHHHHHDLLSVLMQRRQL  294

Query  942   PESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPK  763
                + L +++I+DN+LTLIIAGQ TTA A+ W VK L +N  IQ++LR E     R + K
Sbjct  295   GHPDALTEDQILDNMLTLIIAGQVTTATAITWMVKYLSDNRLIQDKLRAEAF---RLELK  351

Query  762   GAL-ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATC  586
             G   +T++ LN M YA K VKE+LRM+ ++ WFPRVAL +C++ GF IKK W VNIDA  
Sbjct  352   GDYSLTMQHLNAMDYAYKAVKESLRMATIVSWFPRVALKDCQVAGFHIKKDWIVNIDARS  411

Query  585   IHYDPAIYKDPTHFNPSRFDE------------MQRPYSYIPFGSGPRTCLGINMAKVTM  442
             +HYDP ++ +PT F+PSRFDE              +    + FG+G RTCLG+N AK+ M
Sbjct  412   LHYDPDVFDNPTVFDPSRFDEEGEGDDAKLGRAQPQKRRLLVFGAGGRTCLGMNHAKIMM  471

Query  441   LVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFNQ  310
             L++LHRL + ++W + D DPSLE+ A  PRL++GCPI LT  + 
Sbjct  472   LIFLHRLLTNFRWEMADDDPSLEKWAMFPRLKNGCPILLTPIHN  515



>ref|NP_001054381.1| Os05g0101600 [Oryza sativa Japonica Group]
 gb|AAG03095.2|AC073405_11 unknown protein [Oryza sativa Japonica Group]
 gb|AAW56889.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16295.1| Os05g0101600 [Oryza sativa Japonica Group]
 dbj|BAG94886.1| unnamed protein product [Oryza sativa Japonica Group]
Length=518

 Score =   305 bits (781),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 178/464 (38%), Positives = 266/464 (57%), Gaps = 35/464 (8%)
 Frame = -2

Query  1617  ETFSLLSATNSTKGCYDFVRTR-RLWHGRW-------FKTRIFGKIHVFV-PSVDGAKTI  1465
             ET + L++  S +G Y FV+ R +L+ G         F+T + G++HVFV  S   A  +
Sbjct  61    ETAAFLASHGSGRGFYHFVQERYKLYKGEGEGEATCCFRTALMGRVHVFVSASHPAASQL  120

Query  1464  FANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRR--LLSDPFSMNSLSIFVQKFDR  1291
                +     K Y ++ AD +G  S+LC    +H R  R  L +  F+  S + F   FDR
Sbjct  121   LTAEPPHLPKRYARTAADLLGPHSILCSTSHAHHRHARRALATTLFATPSTAAFAAAFDR  180

Query  1290  MLCQR---LEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAM  1120
             ++ +    L   H   +   VLD  + I++ A+C ML+    G L R ++ D   V+ AM
Sbjct  181   LVIRHWTTLLPPHNQNQVVVVLDAALHISYRAICEMLLGAGGGKL-RPLQSDVFAVTQAM  239

Query  1119  LSFPV-MIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSF  943
             L+ P+  +PGTR+ +G+ AR R+M   +  + +R       +      D L  +++R   
Sbjct  240   LALPLRWLPGTRFRRGLHARKRIMAALREEMAARNHHH---HHHHHHHDLLSVLMQRRQL  296

Query  942   PESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPK  763
                + L +++I+DN+LTLIIAGQ TTA A+ W VK L +N  IQ++LR E     R + K
Sbjct  297   GHPDALTEDQILDNMLTLIIAGQVTTATAITWMVKYLSDNRLIQDKLRAEAF---RLELK  353

Query  762   GAL-ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATC  586
             G   +T++ LN M YA K VKE+LRM+ ++ WFPRVAL +C++ GF IKK W VNIDA  
Sbjct  354   GDYSLTMQHLNAMDYAYKAVKESLRMATIVSWFPRVALKDCQVAGFHIKKDWIVNIDARS  413

Query  585   IHYDPAIYKDPTHFNPSRFDE------------MQRPYSYIPFGSGPRTCLGINMAKVTM  442
             +HYDP ++ +PT F+PSRFDE              +    + FG+G RTCLG+N AK+ M
Sbjct  414   LHYDPDVFDNPTVFDPSRFDEEGEGDDAKLGRAQPQKRRLLVFGAGGRTCLGMNHAKIMM  473

Query  441   LVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFNQ  310
             L++LHRL + ++W + D DPSLE+ A  PRL++GCPI LT  + 
Sbjct  474   LIFLHRLLTNFRWEMADDDPSLEKWAMFPRLKNGCPILLTPIHN  517



>ref|XP_009616515.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Nicotiana tomentosiformis]
Length=473

 Score =   302 bits (773),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 157/430 (37%), Positives = 250/430 (58%), Gaps = 12/430 (3%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG P +GE+ S +S  +S  G Y F+  R+  +G+ FK+ + G+  VF+   + +K
Sbjct  34    IPGTLGWPIIGESLSFISEFSSPAGIYSFINKRQKLYGKVFKSYVLGRYTVFMTGREASK  93

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              +      + +     +    +G  SLL    +SHKR+R+L+++P S++ L  + Q  + 
Sbjct  94    ILLTGKDGMVSLNLFYTGQQVLGPTSLLQQTGDSHKRLRKLIAEPLSVDGLKKYFQFINS  153

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSI-TDGSLLRRIERDCSTVSDAMLS  1114
             +  + L++    GK   VL+     T   + NM+MS+   G    +   +   +S +  S
Sbjct  154   LAIETLDQWS--GKEVLVLEEASTFTLKVIGNMIMSLDPTGEEQDKFRTNFKIISASFSS  211

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPES  934
              P  +PGT +Y+GI+AR R+     +IID  +RR G+  +    +DFLQ ++++ +   +
Sbjct  212   LPFKVPGTAFYRGIQARDRMYAMLDSIID--QRRSGKSLK----QDFLQSLVKKHASEGN  265

Query  933   E---KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPK  763
             +   KL D+++ DN+LTL++AG  TT AA+ W +K + EN  +  RLREE   I   K  
Sbjct  266   DDDGKLSDKQLKDNILTLLVAGHDTTTAALTWLLKFIQENPAVLERLREEHREIQARKQG  325

Query  762   GALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCI  583
                +   ++N M Y +KV+ ETLRM+ +L WF R A  + +I+GF IKKGW +N+D   I
Sbjct  326   TPDLAWSEVNNMPYTAKVISETLRMATILPWFSRKAAMDFEIDGFKIKKGWSLNLDVLSI  385

Query  582   HYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKW  403
             H DP I+ +P  FNP RFDE  +P+S++ FGSGPR C GIN+AK+ + V+LH L  RYKW
Sbjct  386   HRDPKIFPNPEKFNPFRFDEPLKPFSFLGFGSGPRMCPGINLAKLEISVFLHHLVCRYKW  445

Query  402   SVDDPDPSLE  373
             +  D D S++
Sbjct  446   TPLDTDDSVQ  455



>ref|XP_009784233.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Nicotiana sylvestris]
Length=479

 Score =   300 bits (768),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 157/436 (36%), Positives = 246/436 (56%), Gaps = 18/436 (4%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG P +GE+ S +S  +S  G Y F+  R+  +G+ FK+ + G+  VF+   + +K
Sbjct  34    IPGTLGWPIIGESLSFISEFSSRAGIYSFINKRQKLYGKVFKSYVLGRYTVFMAGREASK  93

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              +      + +     +    +G  SLL    ESHKR+R+++++P S++ L  + Q  + 
Sbjct  94    ILLTGKDGMVSLNLFYTGQQVLGPTSLLQQTGESHKRLRKVIAEPLSLDGLKKYFQFINS  153

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSI-TDGSLLRRIERDCSTVSDAMLS  1114
             +  + L++    G+   VL+     T   + NM+MS+   G    +   +   +S +  S
Sbjct  154   LAIETLDQWS--GRKVLVLEEASTFTLKVIGNMIMSLDPTGQEQEKFRTNFKIISASFSS  211

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPES  934
              P  +PGT +Y+GI+AR R+     +IID RR      +     +DFLQ ++++     S
Sbjct  212   LPFKVPGTAFYRGIQARDRMYAMLDSIIDQRR------SGKSLKQDFLQSLVKKHGKDAS  265

Query  933   E---------KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSI  781
             E         KL D+++ DN+LTL++AG  TT AA+ W VK + EN  +  RLREE   I
Sbjct  266   EGDDDDDDDDKLTDKQLKDNILTLLVAGHDTTTAALTWLVKYIQENPVVLERLREEHREI  325

Query  780   LRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVN  601
                K     +   ++N M Y +KV+ ETLRM+ +L WF R A  + +I+GF IKKGW +N
Sbjct  326   QARKQGTLDLAWSEVNNMPYTAKVISETLRMATILPWFSRKAAMDFEIDGFKIKKGWSLN  385

Query  600   IDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRL  421
             +D   IH DP I+ +P  F+PSRFD   +P+S++ FGSGPR C GIN+AK+ + V+LH L
Sbjct  386   LDVVSIHRDPKIFVNPEKFDPSRFDGPLKPFSFLGFGSGPRMCPGINLAKLEISVFLHHL  445

Query  420   TSRYKWSVDDPDPSLE  373
               RYKW+  D D S++
Sbjct  446   VCRYKWTPLDTDDSVQ  461



>gb|EMS55131.1| Abscisic acid 8'-hydroxylase 4 [Triticum urartu]
Length=300

 Score =   294 bits (753),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/290 (51%), Positives = 203/290 (70%), Gaps = 10/290 (3%)
 Frame = -2

Query  1176  DGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGN  997
             D   L +++ D   V+ AML+ P+ +PGTR+Y+G++AR R+M+  +  I  RR     G 
Sbjct  8     DAHKLGQLQADVMDVTQAMLALPIRLPGTRFYRGLQARKRIMDVLRQEIFVRREN---GL  64

Query  996   ESDEDRDFLQEMLERDSF--PESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDEN  823
             + D   DFLQ +L +     PE E L DE+I+DN+LTLIIAGQ TTA A+ W VK L +N
Sbjct  65    KLDRRDDFLQTLLLKSHMDSPE-EALTDEQILDNILTLIIAGQVTTATAITWMVKYLGDN  123

Query  822   TEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNC  643
             T++Q +LR  QL  L +K   A +TL+ LNTM YA K VKE+LRM+ ++ WFPRVAL +C
Sbjct  124   TDLQEKLRSVQLD-LASKHNDAPLTLQHLNTMDYAYKTVKESLRMATIVSWFPRVALKDC  182

Query  642   KIE---GFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTC  472
             + +   GF IKK W VN+DA  IHYDPAIY +PT F+PSRF++  +PYS++ FG+G RTC
Sbjct  183   QRQVTTGFHIKKDWIVNVDARSIHYDPAIYDNPTVFDPSRFNDDMKPYSFLVFGAGSRTC  242

Query  471   LGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             LG+N+AK+ ML++LHRL + ++W + D D SLE+ A  PRL++GCPI LT
Sbjct  243   LGMNLAKIMMLIFLHRLVTNFRWEMADHDTSLEKWAMFPRLKNGCPIQLT  292



>ref|XP_008793990.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Phoenix dactylifera]
Length=477

 Score =   300 bits (767),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 157/436 (36%), Positives = 245/436 (56%), Gaps = 17/436 (4%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG P +GETFS +S  +S  G + FVR RR  +G+ FKT + G++ +F+   +  +
Sbjct  35    IPGCLGWPLIGETFSFISEFSSASGIHSFVRKRRQLYGKVFKTSVLGRLTIFMTGREAGR  94

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              + +    + +     +    +G  SLL    E HKR+RRL+ +P SM++L  + Q  D 
Sbjct  95    ILLSGKDGIVSLNLFYTGKQVLGPTSLLTTSGEEHKRLRRLIGEPLSMDALKKYFQFIDD  154

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITD-GSLLRRIERDCSTVSDAMLS  1114
             +  + LE     G++  VL+     T   + +M+MS    G    +I  +   +S    S
Sbjct  155   LAIKTLEGWR--GRTVFVLEEASTFTLKVIAHMIMSAEPYGEEQEKIRANFKVISSCFAS  212

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPES  934
              P+ IPG  +++G+KAR R+     +II  RR      +  D   DFLQ +L + S   +
Sbjct  213   LPLKIPGCAFHRGLKARNRMYAMLDSIISKRR------DGKDVRHDFLQTLLRKHSKEAA  266

Query  933   E----KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKP  766
             +    KL D ++ DN+LTL++AG  TT A++ W +K L EN ++   LREE + I   + 
Sbjct  267   DDDLDKLTDAQLKDNILTLLVAGHDTTTASLTWLIKFLAENPDVLQNLREEHMRIQERRH  326

Query  765   KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATC  586
                 +T  +++ M Y  KV+ ETLR + +L WF R A  +  I+G DIKKGW VN+D   
Sbjct  327   GSLHLTWSEVSNMPYTIKVINETLRKATILPWFSRKATQDFSIDGCDIKKGWAVNLDVVS  386

Query  585   IHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYK  406
             +H+DP ++ +P  F+PSRFD   +P+S++ FGSGPR C G+N+AK+ + V++H L  R+K
Sbjct  387   MHHDPDVFPNPEKFDPSRFDNPLKPFSFLGFGSGPRMCPGMNLAKLEICVFVHHLLCRFK  446

Query  405   WSVDDPD----PSLER  370
             W   D D    P+L R
Sbjct  447   WRPLDEDNCVQPTLVR  462



>ref|XP_011042838.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Populus euphratica]
Length=476

 Score =   298 bits (763),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 160/448 (36%), Positives = 260/448 (58%), Gaps = 14/448 (3%)
 Frame = -2

Query  1698  AVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTR  1519
             A + L+ +    +  +IPG LG P +GE+FS LSA +S  G + F++ R+  +G+ FKT 
Sbjct  19    AFFWLQSRISPKEMEVIPGSLGWPVVGESFSFLSAFSSAAGIFSFMKNRQQSYGKVFKTF  78

Query  1518  IFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSD  1339
             + G+  VF+   + +K +      + +     +    +G  SLL    E+HKR+RRL+ +
Sbjct  79    VLGRFTVFMTGREASKILLTGKDGMVSLNLFYTGKQVLGPTSLLQTTGEAHKRLRRLIGE  138

Query  1338  PFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITD-GSLL  1162
             P S++ L  +    + +  + L++    G++  VL+     T   + NM+MS+   G   
Sbjct  139   PLSVDGLKTYFHFINTVAMETLDQWS--GRTVLVLEEASTFTLKVIGNMIMSLEPAGEEQ  196

Query  1161  RRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDED  982
              +   +   +S +  S P  IPGT Y+ GIKAR R+ +   +II  RR   G+  +    
Sbjct  197   EKFRSNFKIISSSFASLPFKIPGTAYHNGIKARDRMYDMLDSIIAGRRS--GKSIQ----  250

Query  981   RDFLQEMLERDSFPES-----EKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTE  817
             +DFL+ ++ + S  E      +KL D+++ DN+LTL++AG  TT AA+ W +K L+EN  
Sbjct  251   QDFLESLIMKHSKAEGGEHQEDKLTDKQLKDNILTLLVAGHDTTTAALTWLMKFLEENPA  310

Query  816   IQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKI  637
             +  +LREE ++I   +  GA +T  ++N M Y +KV+ ETLR + +L WF R A  + +I
Sbjct  311   VLEKLREEHINIQSKRTDGASLTWSEVNNMPYTNKVINETLRRATILPWFSRKAAQDFEI  370

Query  636   EGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINM  457
             +G+ IKKGW VN+D   IH+DP ++ DP  F+PSRFD   R +S++ FGSGPR C GIN+
Sbjct  371   DGYKIKKGWSVNLDVVSIHHDPEVFPDPEKFDPSRFDAPVRSFSFLGFGSGPRMCPGINL  430

Query  456   AKVTMLVYLHRLTSRYKWSVDDPDPSLE  373
             A++ + V++H L  RYKW   + D S++
Sbjct  431   ARLEICVFIHHLVIRYKWKPLEKDDSVQ  458



>gb|KDP43007.1| hypothetical protein JCGZ_25193 [Jatropha curcas]
Length=476

 Score =   298 bits (762),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 162/459 (35%), Positives = 262/459 (57%), Gaps = 14/459 (3%)
 Frame = -2

Query  1731  VFLGLLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTR  1552
             + + L+  + +A YLL           IPG LG P +GE+FS LS  +S  G + F++ R
Sbjct  7     LIIALVSLLVLAFYLLHLWISPKAMEYIPGSLGWPIVGESFSFLSEFSSPSGIFSFMKKR  66

Query  1551  RLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHE  1372
             +  +G+ FK+ + G+  VF+   + +K +      + +     +    +G  SLL    E
Sbjct  67    QQKYGKVFKSFVLGRFTVFMTGREASKILLTGKDGMVSLNLFYTGQQVLGPTSLLQTTGE  126

Query  1371  SHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNM  1192
             +HKR+RRL+++P S++ L  +    + +  + L++    G+   VL+     T   + NM
Sbjct  127   AHKRLRRLIAEPLSVDGLKKYFHFINTLAIETLDQWP--GRKVFVLEEASTFTLKVIGNM  184

Query  1191  LMSITD-GSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRR  1015
             +MS+   G    +   +   +S +  S P  IPGT ++ GIKAR R+ E   + I  RR 
Sbjct  185   IMSLEPAGEEQEKFRSNFKIISSSFASLPFKIPGTAFHNGIKARDRMYEMLDSTIAMRRS  244

Query  1014  RMGRGNESDEDRDFLQEMLER-----DSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMM  850
               G+  +    +DFL+ ++ +     D      KL D+++ DN+LTL++AG  TT AA+ 
Sbjct  245   --GKSFQ----QDFLESLIMKHTKAGDGEDNENKLTDQQLKDNILTLLVAGHDTTTAALT  298

Query  849   WSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLW  670
             W VK LDEN ++  RLREE   I   + +G  +T  ++N+M Y +KV+ ETLR + +L W
Sbjct  299   WLVKFLDENPQVLERLREEHREIQSKRREGENLTWSEVNSMPYTNKVISETLRRATILPW  358

Query  669   FPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFG  490
             F R A  + +I+G+ IKKGW +N+D   IH+DP ++ DP  FNPSRFDE  RP+S++ FG
Sbjct  359   FSRKAAQDFEIDGYTIKKGWSINLDVVSIHHDPEVFPDPYKFNPSRFDETLRPFSFLGFG  418

Query  489   SGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLE  373
             SGPR C G+N+AK+ + V++H L ++YKW   + D S++
Sbjct  419   SGPRMCPGLNLAKLEICVFIHHLVTKYKWKPLEKDDSVQ  457



>ref|XP_006434438.1| hypothetical protein CICLE_v10003821mg [Citrus clementina]
 gb|ESR47678.1| hypothetical protein CICLE_v10003821mg [Citrus clementina]
Length=470

 Score =   298 bits (762),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 157/446 (35%), Positives = 251/446 (56%), Gaps = 20/446 (4%)
 Frame = -2

Query  1692  YLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIF  1513
             +L+R      +   IPG LG+P +GE+F+ LSA +   G Y FV+ R+  +G+ FKT   
Sbjct  21    FLMRSMASPKEMEGIPGSLGLPIVGESFAFLSAFSKPSGIYSFVKERQQRYGKVFKTYTL  80

Query  1512  GKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPF  1333
             G+  V +   + +K +      + +     +    +G  SLL    E+HKR+RRL+++P 
Sbjct  81    GRFSVIMTGREASKILLTGKDGMVSLNLFYTGQQVLGPTSLLQTNGEAHKRLRRLIAEPL  140

Query  1332  SMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSIT-DGSLLRR  1156
             S++ L  + Q  + +  + L++    GK   VL+     T   + NM+MS+   G    +
Sbjct  141   SVDGLKKYFQFINTLAIETLDQWS--GKKVLVLEEASTFTLKVIGNMIMSLEPTGEEQEK  198

Query  1155  IERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRD  976
                +   +S +  S P+ IPGT +Y+GIKAR R+     +II  RR       ES + +D
Sbjct  199   FRANFKLISSSFASLPLKIPGTAFYRGIKARDRMYAMLDSIISKRR-----SGESIQ-QD  252

Query  975   FLQEMLERDSFPESE-----KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQ  811
             FL+ ++ + S    E     KL D+++ DN+LTL++AG  TT AA+ W +K ++EN    
Sbjct  253   FLESLIIKHSQAADEEANEDKLTDKQLKDNILTLLVAGHDTTTAALTWLIKFIEENPA--  310

Query  810   NRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEG  631
                 EE   I  N+  G+ +T  ++N M Y +KV+ ETLR + +L WF R A  + +IEG
Sbjct  311   ----EEHREIQANRNGGSNLTWSEVNNMPYTTKVISETLRRATILPWFSRKAAQDFEIEG  366

Query  630   FDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAK  451
             + I KGW +N+D   IH+DP I+ +P  F+PSRFD   + +S++ FGSGPR C GIN+AK
Sbjct  367   YKIVKGWSINLDVVSIHHDPGIFANPEKFDPSRFDAPIKTFSFLGFGSGPRMCPGINLAK  426

Query  450   VTMLVYLHRLTSRYKWSVDDPDPSLE  373
             + + +++H L  RYKW   + D S++
Sbjct  427   LEICIFIHHLVCRYKWRALEKDDSVQ  452



>ref|XP_002533019.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF29373.1| cytochrome P450, putative [Ricinus communis]
Length=476

 Score =   297 bits (761),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 156/432 (36%), Positives = 252/432 (58%), Gaps = 14/432 (3%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             +PG LG P +GE+FS LS  +S  G Y F++ R+  +G+ FK+ + G+  +F+   + +K
Sbjct  35    LPGSLGWPIVGESFSFLSEFSSPSGIYSFMKNRQQRYGKVFKSFVLGRFTIFMTGREASK  94

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              +      L +     +    +G  SLL    E+HKRIRRL+++P S++ L  + Q  + 
Sbjct  95    ILLTGKDGLVSLNLFYTGQQVLGPTSLLQTTGEAHKRIRRLIAEPLSVDGLKKYFQFINT  154

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSI-TDGSLLRRIERDCSTVSDAMLS  1114
             +  + L++    G+   VL+     T   + NM+MS+   G    +   +   +S +  S
Sbjct  155   LAIETLDQWS--GRKILVLEEASTFTLKVIGNMIMSLEPTGEEQEKFRANFKIISSSFAS  212

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDS----  946
              P  IPGT ++ GIKAR R+     +II SRR      +     +DFL+ ++ + S    
Sbjct  213   LPFKIPGTAFHNGIKARDRMYALLDSIIASRR------SGKSVQQDFLESLIIKHSKGGE  266

Query  945   -FPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNK  769
                + +KL D+++ DN+LTL++AG  TT AA+ W +K LDEN  +  +LREE + I   +
Sbjct  267   GEDDEDKLTDKQLKDNILTLLVAGHDTTTAALTWLIKFLDENPRVLEQLREEHIQIQAKR  326

Query  768   PKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDAT  589
               GA +T  ++N+M Y +KV+ ETLR + +L WF R A  + +I+G+ IKKGW +N+D  
Sbjct  327   TDGATLTWSEVNSMPYTNKVISETLRRATILPWFSRKAAQDFEIDGYKIKKGWSINLDVV  386

Query  588   CIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRY  409
              IH+DP ++ DP  F+P+RF    RP+S++ FGSGPR C GIN+AK+ + V++H L +RY
Sbjct  387   SIHHDPEVFPDPQKFDPTRFGAPLRPFSFLGFGSGPRMCPGINLAKLEICVFIHHLVTRY  446

Query  408   KWSVDDPDPSLE  373
             KW   + D S++
Sbjct  447   KWRPLEKDDSVQ  458



>gb|AFK38360.1| unknown [Lotus japonicus]
Length=239

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 173/225 (77%), Gaps = 9/225 (4%)
 Frame = -2

Query  1752  VSHYYYDVFLGLLVGIG---IAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNST  1582
             V   YY+V L  L+ +    +A    +G     K   IPG+LG+PF+GETFSLLSATNST
Sbjct  13    VVQNYYEVILVALISVWFTYLASKAWKGAKNERKD--IPGRLGLPFIGETFSLLSATNST  70

Query  1581  KGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVG  1402
             +GCYDFVR RRLWHGRWFKTR+FGKIHVFVP+ +GA+TIFANDF +FN+GYVKS+ADAVG
Sbjct  71    RGCYDFVRLRRLWHGRWFKTRVFGKIHVFVPNPEGARTIFANDFVVFNQGYVKSIADAVG  130

Query  1401  KKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNM  1222
             +KSLLCVP ESHKRIRRLLS+PFSM SLS F+ KFD+MLC RL++    GKSF VLDF M
Sbjct  131   EKSLLCVPVESHKRIRRLLSEPFSMTSLSSFITKFDKMLCGRLQKLQESGKSFKVLDFCM  190

Query  1221  KITFDAMCNMLMSITDGSLLRRIERD----CSTVSDAMLSFPVMI  1099
             K+TFD MC MLMSIT+ SLL++IE+D     S +S A L    M+
Sbjct  191   KMTFDGMCEMLMSITEDSLLQKIEKDLLKGLSAISKAQLKLLWML  235



>ref|XP_004981142.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Setaria italica]
Length=470

 Score =   296 bits (757),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 161/459 (35%), Positives = 255/459 (56%), Gaps = 12/459 (3%)
 Frame = -2

Query  1686  LRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGK  1507
             LR ++   +   IPG +G P +GET S +S  +S  G   F+R R+   G+ FKT + G+
Sbjct  22    LRSRSSSKEMRDIPGTMGWPVIGETVSFISDFSSPAGILSFMRDRQKRFGKVFKTYVLGR  81

Query  1506  IHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSM  1327
             I VF+   + AK + +    + +     +    +G  SLL    E HK++RRL+ +P S+
Sbjct  82    ITVFMTGREAAKILLSGKDGVVSLNLFYTGKQVLGPTSLLTTNGEEHKKLRRLIGEPLSI  141

Query  1326  NSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSIT-DGSLLRRIE  1150
             ++L       + +  Q L+    +G+   VL+     T   + NML+S+  +G    +  
Sbjct  142   DALKKHFDFINELAVQTLDTW--LGRRVLVLEEASSFTLKVIANMLVSLEPEGEEQEKFR  199

Query  1149  RDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFL  970
              +   +S +  S P+  PGT +++G+KAR R+     ++I SRRR  G     +   DFL
Sbjct  200   ANFKVISSSFASLPLKAPGTAFHRGLKARNRMYAMLDSVI-SRRREGG-----EVRSDFL  253

Query  969   QEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQ  790
             Q +L + +  +++KL D ++ DN+LTL++AG  TT A + W VK L EN E+  +LREE 
Sbjct  254   QTLLRKHAGDDADKLTDSQLKDNILTLLVAGHDTTTAGLTWLVKFLGENPEVLEKLREEH  313

Query  789   LSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGW  610
             L I       + +   D++ M Y +KV+ ETLR + +L WF R A  +  I+G+DIKKG 
Sbjct  314   LEIRERLNGTSHLRWSDVSNMPYTNKVMNETLRRATILPWFSRKAAQDFSIDGYDIKKGT  373

Query  609   HVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYL  430
              VN+D   IH+DPA++ DP  F+P RFD   +PYS++ FGSGPR C G+N+A++ + V++
Sbjct  374   SVNLDVVSIHHDPAVFADPERFHPDRFDVTVKPYSFLGFGSGPRMCPGMNLARLEICVFV  433

Query  429   HRLTSRYKWS-VDDPDPSLERKAHIPRLRSGCPITLTAF  316
             H L  RY W  + D D        +P  ++  PI  TA 
Sbjct  434   HHLVCRYTWKPLADDDAVQPTLVRMP--KNKYPIIATAL  470



>ref|XP_009368539.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Pyrus x bretschneideri]
Length=478

 Score =   295 bits (755),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 160/449 (36%), Positives = 262/449 (58%), Gaps = 14/449 (3%)
 Frame = -2

Query  1698  AVYLLRGQTVRSKSCI-IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKT  1522
             A ++L+  T+  KS   IPG LG P +GE+FS +S  +S  G Y F+  R+  +G+ FK+
Sbjct  19    AFFVLQSWTLSPKSMKDIPGSLGWPIVGESFSFISEFSSPSGIYSFMNKRQQRYGKVFKS  78

Query  1521  RIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLS  1342
              + G+  VF+   + +K + A    + +     +    +G  SLL    E HKR+RRL++
Sbjct  79    FVLGRFTVFMTGREASKILLAGRDGMVSLNLFYTGQQVLGPTSLLQTTGEEHKRLRRLIA  138

Query  1341  DPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITD-GSL  1165
             +P S++ L  + Q  + +  + LE+    G++  VL+     T   + NM+MS+   G  
Sbjct  139   EPLSVDGLKKYFQFINTLAIETLEQWP--GRTVLVLEEASTFTLKVIGNMIMSLEPAGEE  196

Query  1164  LRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDE  985
               +   +   +S +  S P  IPGT ++ GI+AR R+     + I   +RR GRG     
Sbjct  197   QEQFRSNFKLISSSFASLPFKIPGTAFHSGIQARDRMYAMLDSTIS--KRRSGRGGF---  251

Query  984   DRDFLQEMLERDSFPESE-----KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENT  820
              +DFL+ ++ + S  E +     KL D+++ DN+LTL++AG  TT A + W +K L EN 
Sbjct  252   QQDFLESLIMKHSKGEGDEDNKDKLTDQQLKDNILTLLVAGHDTTTAGLTWLIKFLGENP  311

Query  819   EIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCK  640
              +  +LR+E   I  N+  GA +T +++N M Y +KV+ ETLR + +L W+ R A  N +
Sbjct  312   TVLEQLRDEHKKIEANRDSGANLTWDEVNNMPYTAKVISETLRRATILPWYSRKAAQNFE  371

Query  639   IEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGIN  460
             I+G+ I+KGW VN+D   IH+DP ++ +P +F+PSRFD+  +P+S++ FGSG R C G+N
Sbjct  372   IDGYKIEKGWSVNLDVVSIHHDPEVFPNPQNFDPSRFDQPLKPFSFLGFGSGQRMCPGLN  431

Query  459   MAKVTMLVYLHRLTSRYKWSVDDPDPSLE  373
             +AK+ + V++H L  RYKWS  + D S++
Sbjct  432   LAKLEISVFIHHLVCRYKWSPLEKDDSVQ  460



>gb|KHN15438.1| Abscisic acid 8'-hydroxylase 3 [Glycine soja]
Length=475

 Score =   295 bits (754),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 153/427 (36%), Positives = 247/427 (58%), Gaps = 5/427 (1%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG P +GE+FS LS  +S  G + F+  R+  +G+ FK+ + G+  VF+   + +K
Sbjct  35    IPGSLGWPIVGESFSFLSDFSSPSGIFSFMNKRQKRYGKVFKSFVLGRFTVFMTGREASK  94

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              +      + +     +    +G  SLL    E+HKR+RRL+ +P S++ L  +    + 
Sbjct  95    ILLTGKDGIVSLNLFYTGQQVLGPTSLLQTTGEAHKRLRRLIGEPLSIDGLKKYFHFINT  154

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSIT-DGSLLRRIERDCSTVSDAMLS  1114
                + L++    G+   VL+     T   + +M+MS+   G    +   +   +S +  S
Sbjct  155   QAMETLDQWQ--GRKVLVLEEASTFTLKVIGHMIMSLEPSGEEQEKFRSNFKIISSSFAS  212

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPES  934
              P  +PGT +++GIKAR R+ E   + I   RRR G+  + D     + +  + D   + 
Sbjct  213   LPFKLPGTAFHRGIKARDRMYEMLDSTIS--RRRSGQEFQQDFLGSLVMKHSKEDGEEDE  270

Query  933   EKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGAL  754
              KL D+++ DN+LTL++AG  TT AA+ W +K L EN  +  +LREE   I+ N+  G  
Sbjct  271   NKLTDKQLKDNILTLLVAGHDTTTAALTWLIKFLGENPLVLEQLREEHRQIVANRKSGTD  330

Query  753   ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYD  574
             +T  ++N M Y +KV+ ETLR + +L WF R A  + +I+G+ IKKGW VN+D   IH+D
Sbjct  331   LTWAEVNNMPYTAKVISETLRRATILPWFSRKASQDFEIDGYKIKKGWSVNLDVVSIHHD  390

Query  573   PAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVD  394
             P +++DP  F+PSRFDE  RP+S++ FGSGPR C G+N+AK+ + V++H L +RYKW   
Sbjct  391   PEVFQDPEKFDPSRFDETLRPFSFLGFGSGPRMCPGMNLAKLEICVFIHHLVNRYKWRHL  450

Query  393   DPDPSLE  373
             + D S++
Sbjct  451   EKDNSVQ  457



>ref|XP_004516648.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Cicer arietinum]
Length=477

 Score =   295 bits (754),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 152/433 (35%), Positives = 250/433 (58%), Gaps = 15/433 (3%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG P +GE+FS LS  +S  G + F+  R+  +G+ FK+ + G+  VF+   + +K
Sbjct  35    IPGNLGWPIVGESFSFLSDFSSPSGIFSFMSKRQKRYGKVFKSFVLGRFSVFMTGREASK  94

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              +      + +     +    +G  SLL    E+HKR+RRL+++P S++ L  +    + 
Sbjct  95    ILLTGKDGIVSLNLFYTGQQVLGPTSLLQTTGEAHKRLRRLIAEPLSLDGLKKYFHFINT  154

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSIT-DGSLLRRIERDCSTVSDAMLS  1114
                  L++    G    VL+     T   + +M+MS+   G    +   +   +S +  S
Sbjct  155   QAIVTLDQWQ--GNKVLVLEEASTFTLKVIGHMIMSLEPTGEDQEKFRSNFKIISSSFAS  212

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPES  934
              P  +PGT +++GIKAR R+ +   ++I  RR      N  D  +DFL+ ++ + S   +
Sbjct  213   LPFKLPGTAFHRGIKARDRMYDMLDSVISRRR------NGQDFQQDFLESLIMKHSRKSN  266

Query  933   EKLEDE------EIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRN  772
             E+ EDE      ++ DN+LTL++AG  TT AA+ W +K L+EN  +  +LREE   I+ N
Sbjct  267   EQEEDENKLTDKQLKDNVLTLLVAGHDTTTAALTWLIKFLEENPNVLQQLREEHNQIIEN  326

Query  771   KPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDA  592
             +  G  +T  ++N M Y +KV+ ETLR + +L WF R A  + +I+G+ +KKGW +N+D 
Sbjct  327   RKNGTDLTWSEVNNMPYTAKVISETLRRATILPWFSRKASQDFEIDGYKVKKGWSLNLDV  386

Query  591   TCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSR  412
               IH+DP ++ +P  F+PSRFDE  RP+S++ FGSGPR C G+N+AK+ + V++H L +R
Sbjct  387   VSIHHDPKVFPNPERFDPSRFDEHLRPFSFLGFGSGPRMCPGMNLAKLEICVFIHHLVTR  446

Query  411   YKWSVDDPDPSLE  373
             YKW   + D S++
Sbjct  447   YKWRALEKDDSVQ  459



>ref|XP_008243633.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Prunus mume]
Length=477

 Score =   294 bits (752),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 162/456 (36%), Positives = 263/456 (58%), Gaps = 15/456 (3%)
 Frame = -2

Query  1719  LLVGIGIAVYLLRGQTVRSKSCI-IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLW  1543
             +L+ +  A ++L   T   KS + IPG LG P +GE+FS +S  +S  G Y FV  R+  
Sbjct  12    VLIFVFSAFFVLHSWTSSPKSLVDIPGSLGWPIVGESFSFISEFSSPSGIYSFVNKRQQR  71

Query  1542  HGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHK  1363
             +G+ FKT + G+  VF+   + +K + A    + +     +    +G  SLL    E HK
Sbjct  72    YGKVFKTSVLGRFTVFMTGREASKMLLAGKDGMVSLNLFYTGQQVLGPTSLLQTTGEEHK  131

Query  1362  RIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMS  1183
             R+RRL+++P S++ L  + Q  + +  + LE+    G++  VL+     T   + NM+MS
Sbjct  132   RLRRLIAEPLSVDGLKKYFQFINTLAIETLEQWP--GRTVLVLEEASTFTLKVIGNMIMS  189

Query  1182  ITD-GSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMG  1006
             +   G    +   +   +S +  S P  IPGT ++ GI+AR R+     ++I   +RR G
Sbjct  190   LEPAGEEQEKFRSNFKLISSSFASLPFKIPGTAFHCGIQARDRMYAMLDSVIS--KRRSG  247

Query  1005  RGNESDEDRDFLQEMLERDSFP-----ESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSV  841
              G +    +DFL+ ++ + S       + +KL D+++ DN+LTL++AG  TT AA+ W +
Sbjct  248   GGFQ----KDFLESLIMKHSKAAGDEDDKDKLTDKQLKDNILTLLVAGHDTTTAALTWLI  303

Query  840   KLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPR  661
             K L EN  +  +LR+E   I  N+  GA +T +++N M Y +KV+ ETLR + +L W  R
Sbjct  304   KFLGENPSVLEQLRDEHRQIQSNRENGANLTWDEVNNMPYTAKVINETLRRATILPWNSR  363

Query  660   VALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGP  481
              A  N +I+G+ I+KGW VN+D   IH+DP ++ +P  F+PSRFD   +P+S++ FGSG 
Sbjct  364   KAAQNFEIDGYKIEKGWSVNLDVVSIHHDPEVFPNPQKFDPSRFDAPLKPFSFLGFGSGQ  423

Query  480   RTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLE  373
             R C GIN+AK+ + V++H L  RYKW   + D S++
Sbjct  424   RMCPGINLAKLEISVFIHHLVCRYKWIPLEKDDSVQ  459



>ref|XP_008339194.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Malus domestica]
Length=478

 Score =   293 bits (751),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 160/449 (36%), Positives = 260/449 (58%), Gaps = 14/449 (3%)
 Frame = -2

Query  1698  AVYLLRGQTVRSKSCI-IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKT  1522
             A ++L+  T   KS   IPG LG P +GE+FS +S  +S  G Y F+  R+  +G+ FK+
Sbjct  19    AFFVLQSWTSSPKSMEDIPGSLGWPIVGESFSFISEFSSPSGIYSFMNKRQQRYGKVFKS  78

Query  1521  RIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLS  1342
              + G+  VF+   + +K + A    + +     +    +G  SLL    E HKR+RRL++
Sbjct  79    FVLGRFTVFMTGREASKILLAGRDGMVSLNLFYTGQQVLGPTSLLQTTGEEHKRLRRLIA  138

Query  1341  DPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITD-GSL  1165
             +P S++ L  + Q  + +  + LE+    G++  VL+     T   + NM+MS+   G  
Sbjct  139   EPLSVDGLKKYFQFINTLAIETLEQWP--GRTVLVLEEASTFTLKVIGNMIMSLEPAGEE  196

Query  1164  LRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDE  985
               +   +   +S +  S P  IPGT ++ GI+AR R+     + I   +RR GRG     
Sbjct  197   QEQFRSNFKLISSSFASLPFKIPGTAFHSGIQARDRMYAMLDSTIS--KRRSGRGGF---  251

Query  984   DRDFLQEMLERDSFPESE-----KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENT  820
              +DFL+ ++ + S  E +     KL D+++ DN+LTL++AG  TT A + W +K L EN 
Sbjct  252   QQDFLESLIMKHSKGEGDEDNKDKLTDQQLKDNILTLLVAGHDTTTAGLTWLIKFLGENP  311

Query  819   EIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCK  640
              +  +LR+E   I  N+  GA +T +++N M Y +KV+ ETLR + +L W+ R A  N +
Sbjct  312   TVLEQLRDEHKKIEANRDSGANLTWDEVNNMPYTAKVISETLRRATILPWYSRKAAQNFE  371

Query  639   IEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGIN  460
             I+G+ I+KGW VN+D   IH+DP ++ +P  F+PSRFD+  +P+S++ FGSG R C G+N
Sbjct  372   IDGYKIEKGWSVNLDVVSIHHDPEVFPNPQKFDPSRFDQPLKPFSFLGFGSGQRMCPGLN  431

Query  459   MAKVTMLVYLHRLTSRYKWSVDDPDPSLE  373
             +AK+ + V++H L  RYKWS  + D S++
Sbjct  432   LAKLEISVFIHHLVCRYKWSPLEKDDSVQ  460



>gb|EYU17448.1| hypothetical protein MIMGU_mgv1a024410mg [Erythranthe guttata]
Length=446

 Score =   292 bits (748),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 159/433 (37%), Positives = 246/433 (57%), Gaps = 15/433 (3%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG P +GE+FS LS+ ++  G + F+  R+  +G+ FK+ + G+  VF+   +  K
Sbjct  4     IPGNLGWPIVGESFSFLSSFSNPAGIFSFMHNRQQRYGKVFKSYVLGRFTVFMTGREAGK  63

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              +      L +     +    +G  SLL    E+HKR+RRL+ +P SM+ L  +    + 
Sbjct  64    ILLTGKDGLVSLNLFYTGKQVLGPTSLLQQTGEAHKRLRRLIGEPLSMDGLKKYFPFINS  123

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSI-TDGSLLRRIERDCSTVSDAMLS  1114
             +  + L++    G+   VL+     T   + +M+MS+   G    +   +   +S    S
Sbjct  124   LAVEILDQW--CGRRVLVLEEASTFTLKVIGHMIMSLEPSGEDQEKFRGNFKIISSCFAS  181

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPES  934
              P  IPGT +Y+GIKAR R+   F + I  RR      N     +DFL  +L++ S   S
Sbjct  182   LPFKIPGTAFYRGIKARDRMYAMFDSTIAQRR------NGEGLQQDFLGSLLKKHSKENS  235

Query  933   E------KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRN  772
             E      KL D+++ DN+LTL++AG  TT AA+ W +K L EN     RLREE   I  +
Sbjct  236   EGADDDNKLTDKQLKDNILTLLVAGHDTTTAALTWLIKFLGENPAALERLREEHQKIQSS  295

Query  771   KPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDA  592
             +  G+ +T  ++N M Y  KV+ ETLR + +L WF R A  +  I+G+ I+KGW VN+D 
Sbjct  296   REYGSSLTWSEVNNMPYTLKVINETLRRATILPWFSRKAAQDFDIDGYKIEKGWSVNLDV  355

Query  591   TCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSR  412
               IH+DP ++ +P  F+PSRFDE  +P+S++ FGSGPR C GIN+AK+ + V++H+L  R
Sbjct  356   VSIHHDPEMFPNPEKFDPSRFDEPIKPFSFLGFGSGPRMCPGINLAKLEICVFIHQLVCR  415

Query  411   YKWSVDDPDPSLE  373
             YKWS  + D S++
Sbjct  416   YKWSPLEKDDSVQ  428



>gb|AAF98400.1|AC024609_1 Hypothetical protein [Arabidopsis thaliana]
Length=349

 Score =   289 bits (739),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 148/347 (43%), Positives = 219/347 (63%), Gaps = 5/347 (1%)
 Frame = -2

Query  1668  RSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVP  1489
             +S + + PG  G P +GET   + + NS KG Y+FVR+RR+ +G  F+T +FG+ HVF+ 
Sbjct  7     KSTAGVPPGSDGFPVIGETLQFMLSVNSGKGFYEFVRSRRIRYGSCFRTSLFGETHVFLS  66

Query  1488  SVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIF  1309
             + + A+ +  ND  +F K Y+KS+ + VG +SLLC P   HK +R  L + FS  S ++ 
Sbjct  67    TTESARLVLNNDSGMFTKRYIKSIGELVGDRSLLCAPQHHHKILRSRLINLFSKRSTALM  126

Query  1308  VQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVS  1129
             V+ FD ++   L      G    + D  ++ITF AMC ML+S+     L  ++RD   V 
Sbjct  127   VRHFDELVVDALGGWEHRGTVVLLTDL-LQITFKAMCKMLVSLEKEEELGSMQRDVGFVC  185

Query  1128  DAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERD  949
             +AML+FP+ +P TR++KGI ARGR+ME  + II  RR  +   N   E  DFLQ++L  D
Sbjct  186   EAMLAFPLNLPWTRFHKGIMARGRVMEMLEKIIRERRNEINSHNNHHE--DFLQQLLAVD  243

Query  948   SFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNK  769
             +  ++ +L D EI DN+LT+IIAGQ TTA+A+ W VK L EN ++ + L EEQ  I +  
Sbjct  244   N--DTPQLTDAEIKDNILTMIIAGQDTTASALTWMVKYLGENQKVLDILIEEQSQITKKA  301

Query  768   PKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGF  628
                  + LEDL+ M YASK+VKE+LRM++V+ WFPR+ L +C++EG 
Sbjct  302   SNKPFLELEDLSEMPYASKMVKESLRMASVVPWFPRLVLQDCEMEGL  348



>ref|XP_007199302.1| hypothetical protein PRUPE_ppa023168mg, partial [Prunus persica]
 gb|EMJ00501.1| hypothetical protein PRUPE_ppa023168mg, partial [Prunus persica]
Length=458

 Score =   292 bits (747),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 160/447 (36%), Positives = 258/447 (58%), Gaps = 15/447 (3%)
 Frame = -2

Query  1692  YLLRGQTVRSKSCI-IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRI  1516
             ++L   T   KS + IPG LG P +GE+FS +S  +S  G Y FV  R+  +G+ FKT +
Sbjct  2     FVLHSWTSSPKSLVDIPGSLGWPIVGESFSFISEFSSPSGIYSFVNKRQQRYGKVFKTSV  61

Query  1515  FGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDP  1336
              G+  VF+   + +K + A    + +     +    +G  SLL    E HKR+RRL+++P
Sbjct  62    LGRFTVFMTGREASKMLLAGKDGMVSLNLFYTGQQVLGPTSLLQTTGEEHKRLRRLIAEP  121

Query  1335  FSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITD-GSLLR  1159
              S++ L  + +  + +  + LE+    G++  VL+     T   + NM+MS+   G    
Sbjct  122   LSVDGLKKYFKFINTLAIETLEQWP--GRTVLVLEEASTFTLKVIGNMIMSLEPAGEEQE  179

Query  1158  RIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDR  979
             +   +   +S +  S P  IPGT ++ GI+AR R+     ++I   +RR G G +    +
Sbjct  180   KFRSNFKLISSSFASLPFKIPGTAFHLGIQARDRMYAMLDSVIS--KRRSGGGFQ----K  233

Query  978   DFLQEMLERDSFP-----ESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEI  814
             DFL+ ++ + S       + +KL D+++ DN+LTL++AG  TT AA+ W +K L EN  +
Sbjct  234   DFLESLIMKHSKAAGDEDDKDKLTDKQLKDNILTLLVAGHDTTTAALTWLIKFLGENPSV  293

Query  813   QNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIE  634
               +LR+E   I  N+  GA +T +++N M Y +KV+ ETLR + +L W  R A  N +I+
Sbjct  294   LEQLRDEHQQIQSNRENGANLTWDEVNNMPYTAKVINETLRRATILPWNSRKAAQNFEID  353

Query  633   GFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMA  454
             G+ I+KGW VN+D   IH+DP I+ +P  F+PSRFD   +P+S++ FGSG R C GIN+A
Sbjct  354   GYKIEKGWSVNLDVVSIHHDPEIFPNPQKFDPSRFDAPLKPFSFLGFGSGQRMCPGINLA  413

Query  453   KVTMLVYLHRLTSRYKWSVDDPDPSLE  373
             K+ + V++H L  RYKW   + D S++
Sbjct  414   KLEISVFIHHLVCRYKWIPLEKDDSVQ  440



>ref|XP_010108653.1| Abscisic acid 8'-hydroxylase 3 [Morus notabilis]
 gb|EXC19909.1| Abscisic acid 8'-hydroxylase 3 [Morus notabilis]
Length=446

 Score =   291 bits (745),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 160/450 (36%), Positives = 258/450 (57%), Gaps = 16/450 (4%)
 Frame = -2

Query  1653  IIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGA  1474
             +IPG LG P +GE+FS LS  +S  G   F+  R+  +G+ FKT + G+  VF+   +  
Sbjct  3     VIPGSLGWPIVGESFSFLSEFSSPSGICSFMHKRQERYGKVFKTLVLGRFTVFMTGREAG  62

Query  1473  KTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFD  1294
             K +      + +     +    +G  SLL    ++HKR+RRL+++P S++ L  + Q  +
Sbjct  63    KILLTGKDGMVSLNLFYTGKQVLGPTSLLQATGDAHKRLRRLIAEPLSVDGLKKYFQFIN  122

Query  1293  RMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSIT-DGSLLRRIERDCSTVSDAML  1117
              +  + +E+    G++  VL+     T   + +M+MS+   G    +   +   +S +  
Sbjct  123   TLAIETMEQWP--GRTVLVLEEASTFTLKVIGHMIMSLEPTGEEQEKFRANFKLISSSFA  180

Query  1116  SFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDS---  946
             S P  IPGT +++GIKAR R+     +II   RRR G G +    +DFL+ ++ + S   
Sbjct  181   SLPFKIPGTAFHRGIKARDRMYAMLDSIIS--RRRNGEGFQ----QDFLESLIMKHSKLA  234

Query  945   ---FPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILR  775
                    +KL D ++ DN+LTL++AG  TT AA+ W +K L EN  +  +LR+E L I  
Sbjct  235   AGKEDNEDKLTDAQLKDNILTLLVAGHDTTTAALTWLIKFLGENPSVLEQLRDEHLEIQA  294

Query  774   NKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNID  595
             N+  G  +T  ++N+M Y +KV+ ETLR + +L WF R A  + +I+G+ IK+GW VN+D
Sbjct  295   NRKDGTNLTWAEVNSMPYTAKVINETLRRATILPWFSRKAAQDFEIDGYKIKRGWSVNLD  354

Query  594   ATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTS  415
                IH+DP ++ DP  F+PSRFD   RP+S++ FGSGPR C GIN+AK+ + +++H L  
Sbjct  355   VVSIHHDPEMFADPEKFDPSRFDAPLRPFSFLGFGSGPRMCPGINLAKLEISIFIHHLVC  414

Query  414   RYKWSVDDPDPSLERKAHIPRLRSGCPITL  325
             RYKW   + D S++    +  LR+  PI +
Sbjct  415   RYKWRALERDDSVQ-PTLVRMLRNKYPIVV  443



>ref|XP_003634499.1| PREDICTED: abscisic acid 8'-hydroxylase 3 isoform X1 [Vitis vinifera]
Length=477

 Score =   292 bits (747),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 155/433 (36%), Positives = 249/433 (58%), Gaps = 15/433 (3%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG P +GE+FS +S  +S  G Y+F++TR+  +G+ FK+ + G+  VF+   + +K
Sbjct  35    IPGTLGWPIVGESFSFISEFSSPLGIYNFMKTRQERYGKVFKSLVLGRFTVFMTGREASK  94

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              +      + +     +    +G  SLL    E+HKR+R L+++P S++ L    Q  + 
Sbjct  95    ILLTGKDGMVSLNLFYTGKQVLGPTSLLQTTGEAHKRLRHLIAEPLSLDGLKKHFQFINT  154

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSI-TDGSLLRRIERDCSTVSDAMLS  1114
             +  + L++    G+   VL+     T   + NM+MS+   G    +   +   +S +  S
Sbjct  155   LAIETLDQW--AGRKVLVLEEASTFTLKVIGNMIMSLEPTGEEQEKFRANFKIISSSFAS  212

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLER------  952
              P  IPGT +++G+KAR R+     +II  RR      N  +  +DFL+ ++++      
Sbjct  213   LPFKIPGTAFHRGMKARDRMYVMLDSIIQRRR------NGKEYRQDFLESLIKKHSKEGG  266

Query  951   DSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRN  772
             D   +  KL D ++ DN+LTL++AG  TT AA+ W +K L+EN  +   LREE   I  N
Sbjct  267   DKEDDDNKLTDNQLKDNILTLLVAGHDTTTAALTWLIKFLEENPPVLEHLREEHKEIQAN  326

Query  771   KPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDA  592
                G  +T  +++ M Y +KV+ ETLR + +L WF R A  + KI+G+ IKKGW VN+D 
Sbjct  327   GNGGTNLTWTEVSHMPYTNKVINETLRRATILPWFSRKAAQDFKIDGYQIKKGWSVNLDV  386

Query  591   TCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSR  412
               IH+DP ++ DP  FNPSRFD + RP+S++ FGSGPR C GIN+A++ + +++H L  R
Sbjct  387   VSIHHDPEVFPDPQKFNPSRFDAILRPFSFLGFGSGPRMCPGINLARLEISIFIHHLVCR  446

Query  411   YKWSVDDPDPSLE  373
             YKW   + D S++
Sbjct  447   YKWRPLEKDDSVQ  459



>ref|XP_003548125.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Glycine max]
Length=475

 Score =   291 bits (746),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 152/427 (36%), Positives = 245/427 (57%), Gaps = 5/427 (1%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG P +GE+FS LS  +S  G + F+  R+  +G+ FK+ + G+  VF+   + +K
Sbjct  35    IPGSLGWPIVGESFSFLSDFSSPSGIFSFMNKRQKRYGKVFKSFVLGRFTVFMTGREASK  94

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              +      + +     +    +G  SLL    E+HKR+RRL+ +P S++ L  +    + 
Sbjct  95    ILLTGKDGIVSLNLFYTGQQVLGPTSLLQTTGEAHKRLRRLIGEPLSIDGLKKYFHFINT  154

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSIT-DGSLLRRIERDCSTVSDAMLS  1114
                + L++    G+   VL+     T   + +M+MS+   G    +   +   +S +  S
Sbjct  155   QAMETLDQWQ--GRKVLVLEEASTFTLKVIGHMIMSLEPSGEEQEKFRSNFKIISSSFAS  212

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPES  934
              P  +PGT +++GIKAR R+ E   + I   RRR G+  + D     + +  + D   + 
Sbjct  213   LPFKLPGTAFHRGIKARDRMYEMLDSTIS--RRRSGQEFQQDFLGSLVMKHSKEDGEEDE  270

Query  933   EKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGAL  754
              KL D+++ DN+LTL++AG  TT AA+ W +K L EN  +  +LREE   I+ N+  G  
Sbjct  271   NKLTDKQLKDNILTLLVAGHDTTTAALTWLIKFLGENPIVLEQLREEHRQIVANRKSGTD  330

Query  753   ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYD  574
             +T  ++N M Y +KV+ ETLR + +L WF R A  + +I+G+ IKKGW VN+D   IH+D
Sbjct  331   LTWAEVNNMPYTAKVISETLRRATILPWFSRKASQDFEIDGYKIKKGWSVNLDVVSIHHD  390

Query  573   PAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVD  394
             P ++ DP  F+PSRFDE  RP+S++ FGSGPR C G+N+AK+ + V++H L +RY W   
Sbjct  391   PEVFSDPEKFDPSRFDETLRPFSFLGFGSGPRMCPGMNLAKLEICVFIHHLVNRYNWRPL  450

Query  393   DPDPSLE  373
             + D S++
Sbjct  451   EEDNSVQ  457



>ref|XP_010063878.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Eucalyptus grandis]
 gb|KCW71151.1| hypothetical protein EUGRSUZ_F04246 [Eucalyptus grandis]
Length=475

 Score =   291 bits (746),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 152/432 (35%), Positives = 248/432 (57%), Gaps = 14/432 (3%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG P +GE+FS +S  +S  G Y F++ R+  +G+ FK+ + G+  VF+   + +K
Sbjct  34    IPGTLGWPIIGESFSFISDFSSPSGIYSFMKKRQERYGKVFKSFVLGRFTVFMTGREASK  93

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              +      + +     +    +G  SLL    E HKR+RRL+++P S++ L  + Q  + 
Sbjct  94    ILLTGKDGMVSLNLFYTGQQVLGPTSLLQTTGEEHKRLRRLIAEPLSIDGLKKYFQFINA  153

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSIT-DGSLLRRIERDCSTVSDAMLS  1114
             +  + L++    G+   VL+     T   + +M+MS+   G    +   +   +S +  S
Sbjct  154   LAIETLDQWE--GRKVLVLEEASTFTLKVIGHMIMSLEPKGEEQEKFRSNFKIISSSFAS  211

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLER-----D  949
              P  +PGT +++GI+AR R+      +I  RR   G  N      DFL+ ++ +     D
Sbjct  212   LPFKVPGTAFHRGIQARDRMYSMLDNVISKRREGQGFQN------DFLESLIIKHSKAAD  265

Query  948   SFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNK  769
                + +KL D+++ DN+LTL++AG  TT AA+ W +K L EN ++  RLREE + I    
Sbjct  266   READKDKLTDKQMKDNVLTLLVAGHDTTTAALTWLMKFLGENPQVLQRLREEHMEIQAKG  325

Query  768   PKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDAT  589
               GA ++  ++N M Y +KV+ ETLR + +L WF R A  + +I+G+ I+KGW VN+D  
Sbjct  326   KGGANLSWSEVNNMPYTAKVISETLRRATILPWFSRKAAQDFEIDGYKIEKGWSVNLDVV  385

Query  588   CIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRY  409
              IH+DP I+  P  F PSRFDE  +P+S++ FGSGPR C GIN+AK+ + +++H L  RY
Sbjct  386   SIHHDPEIFPQPEVFYPSRFDEPLKPFSFLGFGSGPRMCPGINLAKLEISIFIHHLACRY  445

Query  408   KWSVDDPDPSLE  373
             KW+  + D S++
Sbjct  446   KWTPLERDDSVQ  457



>ref|NP_001242618.1| uncharacterized protein LOC100803766 [Glycine max]
 gb|ACU21314.1| unknown [Glycine max]
Length=475

 Score =   291 bits (744),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 152/427 (36%), Positives = 246/427 (58%), Gaps = 5/427 (1%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG P +GE+FS LS  +S  G + F+  R+  +G+ FK+ + G+  VF+   + +K
Sbjct  35    IPGSLGWPIVGESFSFLSDLSSPSGIFSFMNKRQKRYGKVFKSFVLGRFTVFMTGREASK  94

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              +      + +     +    +G  SLL    E+HKR+RRL+ +P S++ L  +    + 
Sbjct  95    ILLTGKDGIVSLNLFYTGQQVLGPTSLLQTTGEAHKRLRRLIGEPLSIDGLKKYFHFINT  154

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSIT-DGSLLRRIERDCSTVSDAMLS  1114
                + L++    G+   V +     T   + +M+MS+   G    +   +   +S +  S
Sbjct  155   QAMETLDQWD--GRKVLVPEEASTFTLKVIGHMIMSLEPSGEEQEKFRSNFKIISSSFAS  212

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPES  934
              P  +PGT +++GIKAR R+ E   + I   RRR G+  + D     + +  + D   + 
Sbjct  213   LPFKLPGTAFHRGIKARDRMYEMLDSTIS--RRRSGQEFQQDFLGSLVMKHSKEDGEEDE  270

Query  933   EKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGAL  754
              KL D+++ DN+LTL++AG  TT AA+ W +K L EN  +  +LREE   I+ N+  G  
Sbjct  271   NKLTDKQLKDNILTLLVAGHDTTTAALTWLIKFLGENPLVLEQLREEHRQIVANRKSGTD  330

Query  753   ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYD  574
             +T  ++N M Y +KV+ ETLR + +L WF R A  + +I+G+ IKKGW VN+D   IH+D
Sbjct  331   LTWAEVNNMPYTAKVISETLRRATILPWFSRKASQDFEIDGYKIKKGWSVNLDVVSIHHD  390

Query  573   PAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVD  394
             P +++DP  F+PSRFDE  RP+S++ FGSGPR C G+N+AK+ + V++H L +RYKW   
Sbjct  391   PEVFQDPEKFDPSRFDETLRPFSFLGFGSGPRMCPGMNLAKLEICVFIHHLVNRYKWRHL  450

Query  393   DPDPSLE  373
             + D S++
Sbjct  451   EKDNSVQ  457



>ref|XP_007152048.1| hypothetical protein PHAVU_004G097400g [Phaseolus vulgaris]
 gb|ESW24042.1| hypothetical protein PHAVU_004G097400g [Phaseolus vulgaris]
Length=474

 Score =   290 bits (742),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 153/421 (36%), Positives = 241/421 (57%), Gaps = 13/421 (3%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG P +GE+FS LS  +S  G + F++ R+  +G  FK+ + G+  +F+   + +K
Sbjct  34    IPGSLGWPIVGESFSFLSDFSSPSGIFSFMKKRQKRYGMVFKSFVLGRFTIFMTGREASK  93

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              +      + +     +    +G  SLL    E+HKR+RRL+ +P S++ L  +    + 
Sbjct  94    ILLTGKDGIVSLNLFYTGQQVLGPTSLLQTTGEAHKRLRRLIGEPLSIDGLKKYFHFINT  153

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSIT-DGSLLRRIERDCSTVSDAMLS  1114
                Q L++    G+   VL+     T   + +M+MS+   G    +   +   +S +  S
Sbjct  154   QAMQTLDQWE--GRKILVLEEASTFTLKVIGHMIMSLEPSGEEQEKFRSNFKIISSSFAS  211

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPES  934
              P  +PGT +++GIKAR R+ E   + I  RR      N  D  +DFL  ++ + S  + 
Sbjct  212   LPFKLPGTAFHRGIKARDRMYEMLDSTILRRR------NGQDFQQDFLGSLVRKHSKEDG  265

Query  933   E----KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKP  766
             E    KL D+++ DN+LTL++AG  TT AA+ W +K L EN  +  +LREE   I+  + 
Sbjct  266   EEDENKLTDKQLKDNILTLLVAGHDTTTAALTWLLKFLGENPIVLEQLREEHRQIVARRE  325

Query  765   KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATC  586
              G  +T  ++N M Y  KV+ ETLR + +L WF R A  + +IEG+ IKKGW +N+D   
Sbjct  326   SGTDLTWAEVNNMPYTVKVISETLRRATILPWFSRKASQDFQIEGYKIKKGWSINLDVVS  385

Query  585   IHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYK  406
             IH+DP ++ DP  F+PSRFDE  RP+S++ FGSGPR C G+N+AK+ + V++H L +RYK
Sbjct  386   IHHDPEVFPDPEKFDPSRFDEPLRPFSFLGFGSGPRMCPGMNLAKLEICVFIHHLVNRYK  445

Query  405   W  403
             W
Sbjct  446   W  446



>ref|XP_004290536.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Fragaria vesca 
subsp. vesca]
Length=477

 Score =   289 bits (740),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 162/449 (36%), Positives = 259/449 (58%), Gaps = 16/449 (4%)
 Frame = -2

Query  1698  AVYLLRGQTVRSKSCI-IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKT  1522
             A ++LR  T   KS + IPG LG P +GE+FS +S  +S  G Y F+  R+  +G+ FKT
Sbjct  20    AFFVLRSWTSSPKSMVGIPGSLGWPIVGESFSFISEFSSPSGIYSFMHKRQQRYGKVFKT  79

Query  1521  RIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLS  1342
              + G+  VF+   + +K + A    + +     +    +G  SLL    E HKR+RRL++
Sbjct  80    FVLGRFSVFMTGREASKMLLAGRDGMVSLNLFYTGQQVLGPTSLLQTTGEEHKRLRRLIA  139

Query  1341  DPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITD-GSL  1165
             +P S++ L  + Q  + +  + LE+    G++  VL+     T   + NM+MS+   G  
Sbjct  140   EPLSVDGLKKYFQFINNLAIEILEDWP--GRTVFVLEEASTFTLKVIGNMIMSLEPAGEE  197

Query  1164  LRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDE  985
               +   +   +S +  S P  IPGT ++ GI+AR R+     + I   +RR G G +   
Sbjct  198   QEKFRANFKLISSSFASLPFKIPGTAFHSGIQARDRMYAMLDSAIS--KRRNGEGFQ---  252

Query  984   DRDFLQEMLERDS-FPESE----KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENT  820
              +DFL+ ++ + S    SE    KL D+++ DN+LTL++AG  TT AA+ W +K L EN 
Sbjct  253   -QDFLESLIMKHSKLAGSEDNKDKLTDKQLKDNVLTLLVAGHDTTTAALTWLIKFLGENP  311

Query  819   EIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCK  640
              +  +LR+E   I  N+  G  +T  ++N M Y +KV+ ETLR + +L WF R A  N +
Sbjct  312   VVLEQLRDEHRQIQANR-DGVNLTWSEVNNMPYTAKVISETLRRATILPWFSRKAAQNFE  370

Query  639   IEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGIN  460
             I+G+ I+KGW +N+D   IH+DP ++ DP  F+PSRFDE  +P++++ FGSG R C GIN
Sbjct  371   IDGYKIEKGWSINLDVVSIHHDPEVFPDPEKFDPSRFDESLKPFTFLGFGSGQRMCPGIN  430

Query  459   MAKVTMLVYLHRLTSRYKWSVDDPDPSLE  373
             +AK+ + V++H L  +YKW   + D S++
Sbjct  431   LAKLEISVFIHHLVCKYKWKPLEKDDSVQ  459



>ref|XP_002300926.1| hypothetical protein POPTR_0002s07030g [Populus trichocarpa]
 gb|EEE80199.1| hypothetical protein POPTR_0002s07030g [Populus trichocarpa]
Length=460

 Score =   288 bits (738),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 158/448 (35%), Positives = 257/448 (57%), Gaps = 29/448 (6%)
 Frame = -2

Query  1653  IIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGA  1474
             +IPG LG P +GE+FS LSA +S  G + F++ R+  +G+ FKT + G+  VF+   + +
Sbjct  3     VIPGSLGWPVVGESFSFLSAFSSAAGIFSFMKNRQQRYGKVFKTFVLGRFTVFMTGREAS  62

Query  1473  KTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFD  1294
             K +      + +     +    +G  SLL    E+HKR+RRL+ +P S++ L  +    +
Sbjct  63    KILLTGKDGMVSLNLFYTGKQVLGPTSLLQTTGEAHKRLRRLIGEPLSVDGLKTYFHFIN  122

Query  1293  RMLCQRLEEQHRIGKSFTVLD---------FNMK------ITFDAMCNMLMSITD-GSLL  1162
              +  + L++    G++  VL+          N K       T   + NM+MS+   G   
Sbjct  123   TVAMETLDQWS--GRTVLVLEEASTVESLLLNQKRLLPTRFTLKVIGNMIMSLEPAGEEQ  180

Query  1161  RRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDED  982
              +   +   +S +  S P  IPGT Y+ GIKAR R+ +   +II  RR   G+  +    
Sbjct  181   EKFRSNFKIISSSFASLPFKIPGTAYHNGIKARDRMYDMLDSIIAGRRS--GKSIQ----  234

Query  981   RDFLQEMLERDSFPES-----EKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTE  817
             +DFL+ ++ + S  E      +KL D+++ DN+LTL++AG  TT AA+ W +K L+EN  
Sbjct  235   QDFLESLIMKHSKAEGGEDQEDKLTDKQLKDNILTLLVAGHDTTTAALTWLMKFLEENPA  294

Query  816   IQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKI  637
             +  +LREE ++I   +  GA +T  ++N M Y +KV+ ETLR + +L WF R A  + +I
Sbjct  295   VLEKLREEHINIQSKRTDGASLTWSEVNNMPYTNKVINETLRRATILPWFSRKAAQDFEI  354

Query  636   EGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINM  457
             +G++IKKGW +N+D   IH+DP ++ DP  F+PSRFD   + +S++ FGSGPR C GIN+
Sbjct  355   DGYEIKKGWSINLDVVSIHHDPQVFPDPEKFDPSRFDAPVKSFSFLGFGSGPRMCPGINL  414

Query  456   AKVTMLVYLHRLTSRYKWSVDDPDPSLE  373
             A++ + V++H L  RYKW   + D S++
Sbjct  415   ARLEICVFIHHLVIRYKWKPLEKDDSVQ  442



>gb|KDO71003.1| hypothetical protein CISIN_1g0156962mg, partial [Citrus sinensis]
Length=174

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = -2

Query  798  EEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIK  619
            EEQL+++++K  GA +TLED+++M+Y  KVVKETLRMSNVLLW+PRVAL++C I+GF+IK
Sbjct  1    EEQLAMIKDKADGAALTLEDVSSMSYGLKVVKETLRMSNVLLWYPRVALNDCTIDGFEIK  60

Query  618  KGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTML  439
            KGWHVNIDA  IHYDPA+YKDP  FNPSRF+EMQ+ YS+IPFGSGPRTCLG+NMAKVTML
Sbjct  61   KGWHVNIDAAYIHYDPALYKDPEQFNPSRFEEMQKSYSFIPFGSGPRTCLGMNMAKVTML  120

Query  438  VYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFNQGDYT  298
            ++LHRLTS Y W+VDDPD SLE+K+HIPRLRSGCPITL   N+  Y 
Sbjct  121  IFLHRLTSGYLWTVDDPDLSLEKKSHIPRLRSGCPITLKPLNKSKYA  167



>ref|XP_007019464.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY16689.1| Cytochrome P450 [Theobroma cacao]
Length=476

 Score =   282 bits (721),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 153/432 (35%), Positives = 243/432 (56%), Gaps = 14/432 (3%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG P +GE+ S LS  +S  G + F+  R+  +G+ FKT + G+  VF+   + +K
Sbjct  35    IPGSLGWPIIGESLSFLSDFSSPSGIFSFMNKRQQRYGKVFKTFVLGRFTVFMTGREASK  94

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              +      + +     +    +G  SLL    E+HKR+RRL+++P S++ L  F    + 
Sbjct  95    ILLTGKDGMVSLNLFYTGQQVLGPTSLLQANGEAHKRLRRLIAEPLSIDGLKKFFHFINS  154

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITD-GSLLRRIERDCSTVSDAMLS  1114
                + L++    G+   VL+     T   + NM+MS+   G        +   +S +  S
Sbjct  155   QAIETLDQWS--GRRVLVLEEASSFTLKVIGNMIMSLEPCGEEQEMFRANFKLISSSFAS  212

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDS----  946
              P  IPGT ++ GIKAR R+     +II  RR      N     +DFL+ ++ + S    
Sbjct  213   LPFKIPGTAFHCGIKARDRMYAMIDSIIARRR------NGEVIQQDFLESLIMKHSRGTE  266

Query  945   -FPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNK  769
                +  KL D+++ DN+LTL++AG  TT AA+ W +K L EN  +  +LR+E   I  N+
Sbjct  267   TGDDGNKLTDQQMKDNILTLLVAGHDTTTAALTWLIKFLGENPAVLEQLRDEHWEIQANR  326

Query  768   PKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDAT  589
               G  +T  ++N M Y +KV+ ETLR + +L WF R A  + +I+G++IKKGW VN+D  
Sbjct  327   KDGTDLTWLEVNKMPYTAKVISETLRRATILPWFSRKAAQDFEIDGYNIKKGWSVNLDVV  386

Query  588   CIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRY  409
              IH+DP  + DP +F+PSRFD   +P+S++ FGSGPR C G+N+AK+ + +++H L  RY
Sbjct  387   SIHHDPESFPDPQNFDPSRFDAPVKPFSFLGFGSGPRMCPGMNLAKLEISIFIHHLICRY  446

Query  408   KWSVDDPDPSLE  373
             KW   + D S++
Sbjct  447   KWRPLERDDSVQ  458



>emb|CBI18551.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   281 bits (720),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 153/433 (35%), Positives = 246/433 (57%), Gaps = 21/433 (5%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG P +GE+FS +S  +S  G Y+F++TR+  +G+ FK+ + G+  VF+   + +K
Sbjct  35    IPGTLGWPIVGESFSFISEFSSPLGIYNFMKTRQERYGKVFKSLVLGRFTVFMTGREASK  94

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              +      + +     +    +G  SLL    E+HKR+R L+++P S++ L    Q  + 
Sbjct  95    ILLTGKDGMVSLNLFYTGKQVLGPTSLLQTTGEAHKRLRHLIAEPLSLDGLKKHFQFINT  154

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSI-TDGSLLRRIERDCSTVSDAMLS  1114
             +  + L++    G+   VL+     T   + NM+MS+   G    +   +   +S +  S
Sbjct  155   LAIETLDQW--AGRKVLVLEEASTFTLKVIGNMIMSLEPTGEEQEKFRANFKIISSSFAS  212

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLER------  952
              P  IPGT +++G+KAR R+     +II  RR      N  +  +DFL+ ++++      
Sbjct  213   LPFKIPGTAFHRGMKARDRMYVMLDSIIQRRR------NGKEYRQDFLESLIKKHSKEGG  266

Query  951   DSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRN  772
             D   +  KL D ++ DN+LTL++AG  TT AA+ W +K L+EN        EE   I  N
Sbjct  267   DKEDDDNKLTDNQLKDNILTLLVAGHDTTTAALTWLIKFLEENPP------EEHKEIQAN  320

Query  771   KPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDA  592
                G  +T  +++ M Y +KV+ ETLR + +L WF R A  + KI+G+ IKKGW VN+D 
Sbjct  321   GNGGTNLTWTEVSHMPYTNKVINETLRRATILPWFSRKAAQDFKIDGYQIKKGWSVNLDV  380

Query  591   TCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSR  412
               IH+DP ++ DP  FNPSRFD + RP+S++ FGSGPR C GIN+A++ + +++H L  R
Sbjct  381   VSIHHDPEVFPDPQKFNPSRFDAILRPFSFLGFGSGPRMCPGINLARLEISIFIHHLVCR  440

Query  411   YKWSVDDPDPSLE  373
             YKW   + D S++
Sbjct  441   YKWRPLEKDDSVQ  453



>ref|XP_009598210.1| PREDICTED: abscisic acid 8'-hydroxylase 2-like [Nicotiana tomentosiformis]
Length=141

 Score =   269 bits (688),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = -2

Query  729  MTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPT  550
            M+YASKVVKETLRMSNVLLWFPRVALD+C IEGF+IKKGWH NIDATCIHYDPA+YKDP 
Sbjct  1    MSYASKVVKETLRMSNVLLWFPRVALDDCNIEGFEIKKGWHANIDATCIHYDPALYKDPM  60

Query  549  HFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLER  370
             FNPSRFDEMQ+PYSYIPFGSG RTCLGINMAKVTMLV+LHRLTS Y+W+VDDPDPSLE+
Sbjct  61   QFNPSRFDEMQKPYSYIPFGSGLRTCLGINMAKVTMLVFLHRLTSGYEWTVDDPDPSLEK  120

Query  369  KAHIPRLRSGCPITLT  322
            KAHIPRLRSGCPITLT
Sbjct  121  KAHIPRLRSGCPITLT  136



>ref|XP_004139645.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Cucumis sativus]
 ref|XP_004154457.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Cucumis sativus]
 gb|KGN44520.1| hypothetical protein Csa_7G324140 [Cucumis sativus]
Length=474

 Score =   279 bits (714),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 160/439 (36%), Positives = 247/439 (56%), Gaps = 23/439 (5%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG P +GE+FS +S  +S  G   F+  R+   G+ FKT + G++ VF+   D AK
Sbjct  34    IPGNLGWPIVGESFSFISEFSSPAGICSFMIKRQKRFGKVFKTSVLGRLMVFMTGSDAAK  93

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              +      + +     +    +G+ SLL    E+HKR+RRL+ +P S++ L  + Q  + 
Sbjct  94    ILLTGKDGMVSLNLFYTGKQVLGQSSLLQTNGEAHKRLRRLIGEPLSLDGLRKYFQFINN  153

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSIT-DGSLLRRIERDCSTVSDAMLS  1114
             +  + L+E    G+   VLD     T   + NM+MS+  +G    +   +   +S    S
Sbjct  154   LAIETLDEWS--GRKIFVLDEASTFTLKVIGNMIMSLEPEGEEQEKFRDNFKIISSCFSS  211

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDE--DRDFLQEMLERDSFP  940
              P+ IPGT +Y+G+KAR R+ E    II  RR        S E   +DFL  ++ + + P
Sbjct  212   LPLNIPGTAFYRGMKARKRMFEMLDLIIAKRR--------SGEVCRQDFLDSLIIKHNKP  263

Query  939   ----ESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRN  772
                 + EKL D ++ DN+LTL+IAG  TT AA+ W +K L EN  +  +LR E   I + 
Sbjct  264   GGENDEEKLTDAQLKDNILTLLIAGHDTTTAALTWVIKFLGENPNVLEQLRIEHQEI-QE  322

Query  771   KPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDA  592
             K KG  +T  D+N + Y +KV+ ETLR + +L W+ R A  + +I G+ IKKGW VN+D 
Sbjct  323   KRKGENLTWSDVNNLPYTAKVLSETLRRATILPWYSRKAALDFEIGGYQIKKGWSVNLDV  382

Query  591   TCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSR  412
               IH+D  ++ +P  F+PSRF+   +P+S++ FGSGPR C GIN+AK+ + V++H L  +
Sbjct  383   VSIHHDARVFPEPQKFDPSRFEAPLKPFSFLGFGSGPRMCPGINLAKLEISVFIHHLVCK  442

Query  411   YKWSV-----DDPDPSLER  370
             Y+W+      D   P+L R
Sbjct  443   YRWTSLEEGNDSVQPTLVR  461



>ref|XP_006575810.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Glycine max]
Length=472

 Score =   279 bits (713),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 149/427 (35%), Positives = 244/427 (57%), Gaps = 12/427 (3%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG P +GE+FS  S  +S  G  +F+  R+  +G+ FKT I G+  VF+   + +K
Sbjct  35    IPGSLGWPIVGESFSFFSDFSSPSGISNFMSKRQKRYGKVFKTFILGRFTVFMTGREASK  94

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              +      +       +    +G  SLL    E+HKR+RRL+ +P S++ L  +    + 
Sbjct  95    ILLTGKDGIVTLNLFYTGQQVLGPTSLLQTTGEAHKRLRRLIGEPLSIDGLKKYFHFINT  154

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSI-TDGSLLRRIERDCSTVSDAMLS  1114
                + L++  R    FT+           + +M+MS+   G    +   +   +S +  S
Sbjct  155   QAMETLDQWERRKVLFTL---------KVIGHMIMSLDPSGEEQEKFRSNFKIISSSFSS  205

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPES  934
             FP+ +PGT ++ GIKAR R+ E   + I   RRR G+  + D     + +  + D   + 
Sbjct  206   FPLKLPGTAFHHGIKARDRMYEMLDSTIS--RRRSGQEFQQDFLGSLVMKHRKEDGEEDE  263

Query  933   EKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGAL  754
              KL D+++ DN+LTL++AG  TT AA+ W +K LDEN  +  +LREE   I+ N+  G  
Sbjct  264   NKLTDQQLKDNILTLLVAGHDTTTAALTWLIKFLDENPIVLEKLREEHRRIIENRKSGTN  323

Query  753   ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYD  574
             +T  ++N M+Y +KV+ ETLR + +L WF R A  + +I+G+ ++KGW +N+D   IH+D
Sbjct  324   LTWSEVNNMSYTAKVISETLRRATILPWFSRKASQDFEIDGYKVRKGWSINLDVVSIHHD  383

Query  573   PAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVD  394
             P ++ DP  F+PSRFDE  RP+S++ FGSGPR C G+N+AK+ + V++H L ++Y W   
Sbjct  384   PEVFSDPEKFDPSRFDEPLRPFSFLGFGSGPRMCPGMNLAKLEISVFIHHLINKYTWRTL  443

Query  393   DPDPSLE  373
             + + S++
Sbjct  444   EEENSVQ  450



>ref|XP_010229421.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Brachypodium 
distachyon]
Length=479

 Score =   278 bits (712),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 148/432 (34%), Positives = 236/432 (55%), Gaps = 10/432 (2%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG +G P +GETF+ ++A ++  G   F+R R+   G+ FKT + G+  VF+   + AK
Sbjct  34    IPGTMGWPVVGETFAFIAAFSNPSGILSFMRDRQKRFGKVFKTYVLGRTTVFMTGREAAK  93

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              + +    + +     +    +G  SLL    + H+R+RRL++ P S+++L       + 
Sbjct  94    ILLSGKDGVVSLNLFYTGKQVLGPTSLLTTNGDEHRRLRRLIAHPLSVDALKKHFSFINA  153

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSIT-DGSLLRRIERDCSTVSDAMLS  1114
             +  Q L      G+   VL+     T   + NML+S+  +G    +   +   +S +  S
Sbjct  154   LAIQTLSSWSS-GRRILVLNEASSFTLKVIANMLVSLEPEGEEQEKFRANFKVISSSFAS  212

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEML---ERDSF  943
              P+ +PGT +++G+KAR R+      +I  RR     G   D   DFLQ +L    R S 
Sbjct  213   LPLKLPGTAFHEGLKARNRMYAMLDDVIARRRASADAGAGHD---DFLQMLLMKHARGSG  269

Query  942   PE--SEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNK  769
              E   EKL D ++ DN+LTL++AG  TT A + W VK L EN ++  +LREE + I    
Sbjct  270   GEDDEEKLTDAQLKDNILTLLVAGHDTTTAGLTWLVKFLGENPDVLQKLREEHMGIKEEL  329

Query  768   PKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDAT  589
                  +   D+N M Y +KV+ ETLR + +L W+ R A  +  I+G+ ++KG  VN+D  
Sbjct  330   GGEEHLRWSDMNNMPYTNKVMNETLRRATILPWYSRKAAQDFTIDGYQVEKGTSVNLDVV  389

Query  588   CIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRY  409
              IH+D  ++ DP  FNP RFD   +PYS++ FGSGPR C G+++AK+ + V++H L  RY
Sbjct  390   SIHHDATVFADPEKFNPDRFDSTLKPYSFLGFGSGPRMCPGMSLAKLEICVFVHHLVCRY  449

Query  408   KWSVDDPDPSLE  373
              W   + D S++
Sbjct  450   DWKPMEEDNSVQ  461



>ref|XP_006574443.1| PREDICTED: uncharacterized protein LOC100803766 isoform X1 [Glycine 
max]
Length=408

 Score =   274 bits (700),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/391 (35%), Positives = 225/391 (58%), Gaps = 5/391 (1%)
 Frame = -2

Query  1542  HGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHK  1363
             +G+ FK+ + G+  VF+   + +K +      + +     +    +G  SLL    E+HK
Sbjct  4     YGKVFKSFVLGRFTVFMTGREASKILLTGKDGIVSLNLFYTGQQVLGPTSLLQTTGEAHK  63

Query  1362  RIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMS  1183
             R+RRL+ +P S++ L  +    +    + L++    G+   VL+     T   + +M+MS
Sbjct  64    RLRRLIGEPLSIDGLKKYFHFINTQAMETLDQWD--GRKVLVLEEASTFTLKVIGHMIMS  121

Query  1182  IT-DGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMG  1006
             +   G    +   +   +S +  S P  +PGT +++GIKAR R+ E   + I   RRR G
Sbjct  122   LEPSGEEQEKFRSNFKIISSSFASLPFKLPGTAFHRGIKARDRMYEMLDSTIS--RRRSG  179

Query  1005  RGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDE  826
             +  + D     + +  + D   +  KL D+++ DN+LTL++AG  TT AA+ W +K L E
Sbjct  180   QEFQQDFLGSLVMKHSKEDGEEDENKLTDKQLKDNILTLLVAGHDTTTAALTWLIKFLGE  239

Query  825   NTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDN  646
             N  +  +LREE   I+ N+  G  +T  ++N M Y +KV+ ETLR + +L WF R A  +
Sbjct  240   NPLVLEQLREEHRQIVANRKSGTDLTWAEVNNMPYTAKVISETLRRATILPWFSRKASQD  299

Query  645   CKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLG  466
              +I+G+ IKKGW VN+D   IH+DP +++DP  F+PSRFDE  RP+S++ FGSGPR C G
Sbjct  300   FEIDGYKIKKGWSVNLDVVSIHHDPEVFQDPEKFDPSRFDETLRPFSFLGFGSGPRMCPG  359

Query  465   INMAKVTMLVYLHRLTSRYKWSVDDPDPSLE  373
             +N+AK+ + V++H L +RYKW   + D S++
Sbjct  360   MNLAKLEICVFIHHLVNRYKWRHLEKDNSVQ  390



>ref|XP_008461511.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like isoform X2 [Cucumis 
melo]
Length=444

 Score =   275 bits (702),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 159/439 (36%), Positives = 246/439 (56%), Gaps = 23/439 (5%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG P +GE+FS +S  +S  G   F+  R+   G+ FKT + G++ VF+   D AK
Sbjct  4     IPGNLGWPIVGESFSFISEFSSPAGICSFMIKRQKRFGKVFKTSVLGRLMVFMTGSDAAK  63

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              +      + +     +    +G+ SLL    E+HKR+RRL+ +P S++ L  + Q  + 
Sbjct  64    ILLTGKDGMVSLNLFYTGKQVLGRSSLLQTNGEAHKRLRRLIGEPLSLDGLRKYFQFINN  123

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSIT-DGSLLRRIERDCSTVSDAMLS  1114
             +  + L+E    G+   VLD     T   + NM+MS+  +G    +   +   +S    S
Sbjct  124   LAIETLDEWS--GRKIFVLDEASTFTLKVIGNMIMSLEPEGEEQDKFRDNFKIISSCFSS  181

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDE--DRDFLQEMLERDSFP  940
              P+ IPGT +Y+G+KAR R+ E    II  RR        S E   +DFL  ++ + +  
Sbjct  182   LPLNIPGTAFYRGMKARKRMFEMLDLIIAKRR--------SGEICRQDFLDSLIIKHNKA  233

Query  939   ----ESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRN  772
                 + EKL D ++ DN+LTL+IAG  TT AA+ W +K L EN  +  +LR E   I + 
Sbjct  234   GGENDEEKLTDAQLKDNILTLLIAGHDTTTAALTWLIKFLGENPNVLEQLRIEHQEI-QE  292

Query  771   KPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDA  592
             K KG  +T  D+N + Y +KV+ ETLR + +L W+ R A  + +I G+ IKKGW VN+D 
Sbjct  293   KRKGENLTWSDVNNLPYTAKVLSETLRRATILPWYSRKAALDFEIGGYQIKKGWSVNLDV  352

Query  591   TCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSR  412
               IH+D  ++ +P  F+PSRF+   +P+S++ FGSGPR C GIN+AK+ + V++H L  +
Sbjct  353   VSIHHDARVFPEPQKFDPSRFEAPLKPFSFLGFGSGPRMCPGINLAKLEISVFIHHLVCK  412

Query  411   YKWSV-----DDPDPSLER  370
             Y+W+      D   P+L R
Sbjct  413   YRWTSLEEGNDSVQPTLVR  431



>ref|XP_008461509.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like isoform X1 [Cucumis 
melo]
Length=474

 Score =   275 bits (703),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 159/439 (36%), Positives = 246/439 (56%), Gaps = 23/439 (5%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG P +GE+FS +S  +S  G   F+  R+   G+ FKT + G++ VF+   D AK
Sbjct  34    IPGNLGWPIVGESFSFISEFSSPAGICSFMIKRQKRFGKVFKTSVLGRLMVFMTGSDAAK  93

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              +      + +     +    +G+ SLL    E+HKR+RRL+ +P S++ L  + Q  + 
Sbjct  94    ILLTGKDGMVSLNLFYTGKQVLGRSSLLQTNGEAHKRLRRLIGEPLSLDGLRKYFQFINN  153

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSIT-DGSLLRRIERDCSTVSDAMLS  1114
             +  + L+E    G+   VLD     T   + NM+MS+  +G    +   +   +S    S
Sbjct  154   LAIETLDEWS--GRKIFVLDEASTFTLKVIGNMIMSLEPEGEEQDKFRDNFKIISSCFSS  211

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDE--DRDFLQEMLERDSFP  940
              P+ IPGT +Y+G+KAR R+ E    II  RR        S E   +DFL  ++ + +  
Sbjct  212   LPLNIPGTAFYRGMKARKRMFEMLDLIIAKRR--------SGEICRQDFLDSLIIKHNKA  263

Query  939   ----ESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRN  772
                 + EKL D ++ DN+LTL+IAG  TT AA+ W +K L EN  +  +LR E   I + 
Sbjct  264   GGENDEEKLTDAQLKDNILTLLIAGHDTTTAALTWLIKFLGENPNVLEQLRIEHQEI-QE  322

Query  771   KPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDA  592
             K KG  +T  D+N + Y +KV+ ETLR + +L W+ R A  + +I G+ IKKGW VN+D 
Sbjct  323   KRKGENLTWSDVNNLPYTAKVLSETLRRATILPWYSRKAALDFEIGGYQIKKGWSVNLDV  382

Query  591   TCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSR  412
               IH+D  ++ +P  F+PSRF+   +P+S++ FGSGPR C GIN+AK+ + V++H L  +
Sbjct  383   VSIHHDARVFPEPQKFDPSRFEAPLKPFSFLGFGSGPRMCPGINLAKLEISVFIHHLVCK  442

Query  411   YKWSV-----DDPDPSLER  370
             Y+W+      D   P+L R
Sbjct  443   YRWTSLEEGNDSVQPTLVR  461



>ref|XP_002440395.1| hypothetical protein SORBIDRAFT_09g000270 [Sorghum bicolor]
 gb|EES18825.1| hypothetical protein SORBIDRAFT_09g000270 [Sorghum bicolor]
Length=539

 Score =   275 bits (703),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 153/388 (39%), Positives = 229/388 (59%), Gaps = 27/388 (7%)
 Frame = -2

Query  1617  ETFSLLSATNSTKGCYDFVRTRRLWHGR-WFKTRIFGKIHVFVPSVDGAKTIFANDFALF  1441
             ET + +SA  S +G Y FV  R   +G   F+T + G  HVFV S D A+++ A D   F
Sbjct  120   ETLAFVSANRSGRGLYHFVEARHRRYGPPCFRTALLGATHVFVSSPDAARSLLA-DAGGF  178

Query  1440  NKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQH  1261
             +K YV+++A+ +G+ SLLC  H++H+ +RR ++  F+  + +     FD  L +R+  + 
Sbjct  179   SKRYVRTVAELLGEHSLLCASHDAHRALRRAVAPLFNAQATASLAANFD-ALARRIITRD  237

Query  1260  RIGK--SFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTR  1087
                K  +  VLD  + +TF+A+C+ML+  T     RR++ D   V+ AML+FP+ +PGTR
Sbjct  238   WAAKTTAVVVLDAALDVTFEAICDMLIGRTTTLKRRRLQSDVLAVTRAMLAFPLRLPGTR  297

Query  1086  YYKGIKARGRLMETFKTIIDSRRRRMGRGNE-----SDEDRDFLQEMLERDSFPESEK--  928
             ++ G++AR R+M+  +  I SR+R +    E     S  D DFLQ +L            
Sbjct  298   FHAGLRARKRIMDVLRQEIASRQRNIMDMEEMEEDDSKHDNDFLQSLLLLRRRKMKSSQQ  357

Query  927   ------------LEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLS  784
                         L D++I+DN+LTLIIAGQ TTA+A+ W VK L +N + Q  LR  QL 
Sbjct  358   QQSPSNSNDHLFLTDDQILDNILTLIIAGQVTTASAITWMVKYLADNKDFQETLRSVQLE  417

Query  783   ILRNKPKG---ALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKG  613
             +      G     +TL+ LN+M  A   VKE+LRM++++ WFPRVAL++C++ GF I KG
Sbjct  418   MALKHQHGDSDGPLTLQHLNSMELAYMTVKESLRMASIVSWFPRVALEDCQVAGFHINKG  477

Query  612   WHVNIDATCIHYDPAIYKDPTHFNPSRF  529
             W VNIDA  +HYD  +Y +PT F+PSRF
Sbjct  478   WIVNIDARALHYDATLYDNPTMFDPSRF  505



>ref|XP_011069606.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Sesamum indicum]
Length=383

 Score =   267 bits (683),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/385 (36%), Positives = 222/385 (58%), Gaps = 14/385 (4%)
 Frame = -2

Query  1542  HGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHK  1363
             +G+ FK+ + G+  VF+   + +K +      L +     +    +G  SLL    E+HK
Sbjct  7     YGKVFKSYVLGRFTVFMTGREASKILLTGKDGLVSLNLFYTGKQVLGPTSLLQQTGEAHK  66

Query  1362  RIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMS  1183
             R+RRL+ +P S++ L  +    +++  + L+  H  G+   VL+     T   + +M+MS
Sbjct  67    RLRRLIGEPLSVDGLKKYFPFINKLAVETLD--HWCGQKVLVLEEASTFTLKVIGHMIMS  124

Query  1182  IT-DGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMG  1006
             +   G    +   +   +S    S P  IPGT +Y+GIKAR R+     + I  RR+   
Sbjct  125   LEPTGEEQEKFRANFKIISSCFASLPFKIPGTAFYRGIKARDRMYAMLDSTIAQRRK---  181

Query  1005  RGNESDEDRDFLQEMLERDSFPESE-----KLEDEEIMDNLLTLIIAGQTTTAAAMMWSV  841
                ES + +DFL+ +L++ S   SE     KL D+++ DN+LTL++AG  TT AA+ W +
Sbjct  182   --GESFQ-QDFLESLLKKHSKDSSEQDDDNKLTDKQLKDNILTLLVAGHDTTTAALTWLI  238

Query  840   KLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPR  661
             K L+EN     RLREE   I  ++  G  +T  ++N M Y +KV+ ETLR + +L WF R
Sbjct  239   KFLEENPAALERLREEHQKIRSSREDGTNLTWAEVNNMPYTAKVISETLRKATILPWFSR  298

Query  660   VALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGP  481
              A  +  I+G++I+KGW VN+D   IH+DP I+ +P  F+PSRFDE  +P+S++ FGSGP
Sbjct  299   KAAQDFDIDGYEIQKGWSVNLDVVSIHHDPEIFPNPEKFDPSRFDEPLKPFSFLGFGSGP  358

Query  480   RTCLGINMAKVTMLVYLHRLTSRYK  406
             R C GIN+AK+ + +++H L  RY+
Sbjct  359   RMCPGINLAKLEISIFIHHLVCRYR  383



>gb|KDO71227.1| hypothetical protein CISIN_1g010899mg [Citrus sinensis]
Length=360

 Score =   263 bits (673),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 142/339 (42%), Positives = 210/339 (62%), Gaps = 22/339 (6%)
 Frame = -2

Query  1689  LLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFG  1510
             +LRG   RS   I PG  G+P +GET   ++A NS++G Y F++ R L +G  F+T IF 
Sbjct  29    MLRG---RSTVSIPPGSEGLPLIGETLQFMAAINSSQGFYQFIQVRHLKYGDCFRTNIFA  85

Query  1509  KIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFS  1330
               +VF  S   AK I  N+   F K Y+KS+ + VG  S+LC   + HK IR  L++ FS
Sbjct  86    TTNVFFSSTGAAKIILNNEGENFTKRYIKSVGEIVGDNSVLCASTQRHKLIRSRLANLFS  145

Query  1329  MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIE  1150
             ++SLSIF ++FD+++ + L +      +  VL   +K+TF AMC +L+S+  G  L  +E
Sbjct  146   LSSLSIFTKQFDQLVLENLSDWEHKAATVVVLREALKVTFKAMCKILLSLESGKELEMLE  205

Query  1149  RDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFL  970
              D + V DAML+FP+ +P T++Y+G+KAR R+M T + +I+ RR    +G E+ E  DFL
Sbjct  206   NDVTRVYDAMLAFPLKLPWTKFYRGVKARKRIMRTLEKMINIRR----KGLETHE--DFL  259

Query  969   QEMLERDSFPES------------EKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDE  826
             Q +L  D+  +             +KL DEEI DN+LT+IIAGQ TTA+A+ W VK L E
Sbjct  260   QCLLAEDAVDKDRASLSSSSSETPKKLTDEEIQDNILTMIIAGQDTTASAITWMVKYLSE  319

Query  825   NTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKV  709
             N E+ ++L+ E   ++  + K +L+TLEDLN M YASK+
Sbjct  320   NEEVLDKLKAEHFPLME-RTKKSLLTLEDLNRMPYASKM  357



>ref|XP_009419410.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Musa acuminata 
subsp. malaccensis]
Length=536

 Score =   254 bits (648),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 138/397 (35%), Positives = 214/397 (54%), Gaps = 15/397 (4%)
 Frame = -2

Query  1542  HGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHK  1363
             HGR FKT I G+  VFV   + ++ + +      +     +    +G  SLL    E HK
Sbjct  130   HGRVFKTSILGRPTVFVTGREASRILLSGKDGSVSLNLSYAGKQVLGPTSLLTTAGEEHK  189

Query  1362  RIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMS  1183
             ++RRL+++P S++SL    Q  D    + LE     G+   VL+     T   + +++MS
Sbjct  190   QLRRLIAEPLSVDSLKRHFQFIDDWAIKTLEGW--PGRPVFVLEEASTFTLKVITSIMMS  247

Query  1182  ITD-GSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMG  1006
             +   G        +   +S    S P+ IPGT +++GI+AR R+     ++I  RR    
Sbjct  248   LEPAGGEQDEFRANFKLISSTFSSLPLKIPGTTFHRGIQARNRMYAMLDSMISRRR----  303

Query  1005  RGNESDEDRDFLQEMLER------DSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWS  844
               N   E  DFLQ ++ +      D   ++ KL D ++ DN+LTL+IAG  TT AA+ W 
Sbjct  304   --NGEHEHHDFLQTLVRKHSKEDEDGGDDANKLTDTQLKDNVLTLLIAGHDTTTAALTWL  361

Query  843   VKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFP  664
             +K L EN      LREE   I   +   + +T  ++N+M Y +KV+ ETLR + +L WF 
Sbjct  362   IKFLGENPHALQNLREEHGRIRNARNGSSHLTWSEVNSMPYTNKVINETLRKATILPWFS  421

Query  663   RVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSG  484
             R A  +  ++G  IK+ W VN+D   +H+D  ++ DP  F PSRFD+  +PYS++ FGSG
Sbjct  422   RKAPRDFTVDGHSIKRDWSVNVDVVSMHHDADVFPDPEKFEPSRFDKPLKPYSFLGFGSG  481

Query  483   PRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLE  373
             PR C G+++AK+ + +++H L  RYKW   D D SL 
Sbjct  482   PRMCPGMHLAKLEICIFIHHLICRYKWKPLDEDSSLH  518



>emb|CDY67982.1| BnaCnng57170D, partial [Brassica napus]
Length=356

 Score =   245 bits (625),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 133/325 (41%), Positives = 192/325 (59%), Gaps = 8/325 (2%)
 Frame = -2

Query  1668  RSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVP  1489
             +S + I PG  G P +GET   + + NS KG Y+FVR+RR+ +G  F+T +FG+ HVF+ 
Sbjct  34    KSTADIPPGSHGFPVVGETLQFMLSVNSGKGFYEFVRSRRIRYGSCFRTSLFGETHVFLS  93

Query  1488  SVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIF  1309
             + + A+ +  N+  +F K Y+KS+A  VG +SLLC     HK +R    + FS  S ++ 
Sbjct  94    TTESARAVLNNESGMFTKRYIKSIAALVGDRSLLCASQHHHKILRSRFINLFSKKSTALM  153

Query  1308  VQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVS  1129
             V+ FD ++   L      G    + D  ++ITF AMC ML+S+ +   L  ++RD   V 
Sbjct  154   VRHFDELVVDALSGWEHRGTVVLLTDL-LQITFKAMCKMLISLENEEELGSLQRDVGFVC  212

Query  1128  DAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLE--  955
             +AML+FP+ +P TR++KGI ARGR+ME  + II  RR      N ++   DFLQ++L   
Sbjct  213   EAMLAFPLNLPWTRFHKGIMARGRVMEVLEKIIRERRNETNSHN-NNYHEDFLQQLLAVD  271

Query  954   ----RDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQL  787
                   S   S KL D EI DN+LT+IIAGQ TTA+A+ W VK L EN ++ N L EEQ 
Sbjct  272   SDGSASSSDHSTKLTDAEIKDNILTMIIAGQDTTASALTWMVKYLGENQKVLNILIEEQT  331

Query  786   SILRNKPKGALITLEDLNTMTYASK  712
              + +       + L+DL  MTYASK
Sbjct  332   QLAKQASHKPFLELDDLTEMTYASK  356



>gb|EAY96198.1| hypothetical protein OsI_18083 [Oryza sativa Indica Group]
Length=304

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/294 (43%), Positives = 180/294 (61%), Gaps = 25/294 (9%)
 Frame = -2

Query  1173  GSLLRRIERDCSTVSDAMLSFPV-MIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGN  997
             G  LR ++ D   V+ AML+ P+  +PGTR+ +G+ AR R+M          R  M   N
Sbjct  7     GGKLRPLQSDVFAVTQAMLALPLRCLPGTRFRRGLHARKRIMAAL-------REEMAARN  59

Query  996   ESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTE  817
                   D L  +++R      + L +++I+DN+LTLIIAGQ TTA A+ W VK L +N  
Sbjct  60    HHHHHHDLLSVLMQRRQLGHPDALTEDQILDNMLTLIIAGQVTTATAITWMVKYLSDNRL  119

Query  816   IQNRLREEQLSILRNKPKGAL-ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCK  640
             IQ++LR E     R + KG   +T++ LN M YA K VKE+LRM+ ++ WFPRVAL +C+
Sbjct  120   IQDKLRAEAF---RLELKGDYSLTMQHLNAMDYAYKAVKESLRMATIVSWFPRVALKDCQ  176

Query  639   IEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDE------------MQRPYSYIP  496
             + GF IKK W +NIDA  +HYDP ++ +PT F+PSRFDE             Q+    + 
Sbjct  177   VAGFHIKKDWILNIDARSLHYDPDVFDNPTVFDPSRFDEEGEGDDAKLGRAQQQKRRLLV  236

Query  495   FGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCP  334
             FG+G RTCLG+N AK+ ML++LHRL + ++W + D DP L R  ++PRL++  P
Sbjct  237   FGAGGRTCLGMNHAKIMMLIFLHRLLTNFRWEMADDDPPL-RNGNVPRLKNDAP  289



>ref|XP_010673159.1| PREDICTED: abscisic acid 8'-hydroxylase 4 isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=430

 Score =   241 bits (614),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 133/327 (41%), Positives = 194/327 (59%), Gaps = 8/327 (2%)
 Frame = -2

Query  1668  RSKSCIIPGKLGI-PFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFV  1492
             +S+  I PG  G+ P++GET   ++A  S +G Y FV+ R L +G  FKT IFG+ HVFV
Sbjct  34    KSQINIPPGSRGLFPYIGETLQFIAAIYSKQGFYSFVQARHLRYGNCFKTHIFGETHVFV  93

Query  1491  PSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSI  1312
              S   AK I +ND   F K Y++S+ + VG +SLLC  H+SHK +RR L D F+  S++ 
Sbjct  94    SSTKAAKEIMSNDLGKFTKKYIRSIGEVVGSESLLCASHQSHKLLRRHLLDLFTSKSITD  153

Query  1311  FVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTV  1132
             F ++FD ++   L      G    +LD  +K+TF AMC ML+S+  G+ L  +++D   V
Sbjct  154   FTKQFDELVIHTLLTWEYKGH-VVILDEALKMTFKAMCKMLLSLEAGNELYMLQKDVDCV  212

Query  1131  SDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRR-RRMGRGNESDEDRDFLQEM--  961
               AML+ P+  P T + KG+KAR R+M+    II  RR +   +       +DFLQ +  
Sbjct  213   CHAMLALPLKFPWTTFSKGLKARKRIMDMLGKIIQERRIKHSAQVPVVHHHQDFLQYLLL  272

Query  960   -LERDSFPESEK--LEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQ  790
              L+R+S    ++  L D  I DN+LT+IIAGQ TTA+AM W VK LDEN  +   L +E 
Sbjct  273   ALDRESCSSDQEPTLTDAHIKDNILTMIIAGQDTTASAMTWMVKYLDENQGVLEVLLDEV  332

Query  789   LSILRNKPKGALITLEDLNTMTYASKV  709
              +  +     + +TLE+LN MTY +K+
Sbjct  333   HNQQKIAAHKSFLTLEELNEMTYGAKI  359


 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  516  RPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGC  337
            + YSY+ FG+G RTCLG+N+A+  MLV+L+RL + YKW V D D SLE  A   RL+SGC
Sbjct  362  KAYSYLAFGAGGRTCLGMNLARTMMLVFLYRLLTTYKWEVTDRDSSLENWALFSRLKSGC  421

Query  336  PITLTAFNQ  310
            PI +T  ++
Sbjct  422  PIQVTRLHK  430



>ref|XP_006854521.1| hypothetical protein AMTR_s00030p00013570 [Amborella trichopoda]
 gb|ERN15988.1| hypothetical protein AMTR_s00030p00013570 [Amborella trichopoda]
Length=411

 Score =   238 bits (608),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 131/397 (33%), Positives = 217/397 (55%), Gaps = 11/397 (3%)
 Frame = -2

Query  1707  IGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWF  1528
             I   +Y+L  +        IPG LG P +GE+ S ++  ++  G + F++ R+  +G+ F
Sbjct  19    ISALLYVLSSRRTLRAIQKIPGSLGWPIIGESLSFMAEFSTPSGIHAFIQKRQQRYGKVF  78

Query  1527  KTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRL  1348
             KT I G++ VF+   + +K + +    L +     +    +G  SLL    E HKR+RRL
Sbjct  79    KTSILGRLTVFMTGREASKILLSGKDGLVSLNLFYTGKQVMGPTSLLQTTGEEHKRLRRL  138

Query  1347  LSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSI-TDG  1171
             + +P  +++L  ++   D +    L++    G++  VL+     T   + +++MS+ + G
Sbjct  139   IGEPLCLDALKKYLPFIDSLASDTLDQW--AGRTVFVLEEASSFTLKVIGHIIMSLESHG  196

Query  1170  SLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNES  991
                     +  T+S A  + P+ IPG  +YKGIKAR R+      II  RR       E 
Sbjct  197   EEQENFRNNFKTISSAFATLPLKIPGFAFYKGIKARDRMYSMLDIIIHKRR-----SGEK  251

Query  990   DEDRDFLQEMLERDSF-PESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEI  814
               D DFLQ ++   S   E ++L D ++ DN+LTL+IAG  TT AA+ W +K L+EN   
Sbjct  252   ISD-DFLQSLITNYSTRTEEDRLTDSQLKDNILTLLIAGHDTTTAALTWVIKFLEENPIA  310

Query  813   QNRLREEQLSILRNKPKG-ALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKI  637
               ++REE   I   +  G   ++  ++N M Y +KV+ ETLR++ +L W  R A  + +I
Sbjct  311   LQKVREEHQQIWERRRDGIPQLSWSEVNNMPYTNKVINETLRIATILPWNSRKAAQDFEI  370

Query  636   EGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFD  526
             +G++IKKGW +N+D   +H+DP ++ DP  F+PSRFD
Sbjct  371   DGYEIKKGWSINLDVVSVHHDPNLFMDPEKFDPSRFD  407



>gb|EEC76480.1| hypothetical protein OsI_14219 [Oryza sativa Indica Group]
 gb|EEE60255.1| hypothetical protein OsJ_13271 [Oryza sativa Japonica Group]
Length=536

 Score =   242 bits (617),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 143/441 (32%), Positives = 231/441 (52%), Gaps = 70/441 (16%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG +G P +GETFS +S  +S  G   F+R R+   G+ FKT + G++ VF+   + AK
Sbjct  33    IPGTMGWPVVGETFSFISGFSSPAGILSFMRDRQKRFGKVFKTYVLGRMTVFMTGREAAK  92

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLS--------  1315
              + +    + +     +    +G  SLL    + HK++RRL+ +P S+++L         
Sbjct  93    ILLSGKDGVVSLNLFYTGKQVLGPTSLLTTNGDEHKKLRRLIGEPLSIDALKKHFDFIND  152

Query  1314  IFVQKFDRMLCQR---LEEQHRIGKSFTVLDFNMKITFDAMCNMLMSIT-DGSLLRRIER  1147
             + VQ  D  L +R   LEE      S  +  F +K+    + NML+S+  +G    +   
Sbjct  153   LAVQTLDTWLDRRVLVLEE----ASSVIIKLFTLKV----IANMLISLEPEGEEQEKFRA  204

Query  1146  DCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQ  967
             +   +S +  S P+ IPGT +++G+KAR R+     ++I +RRR  G     +   DFLQ
Sbjct  205   NFKIISSSFASLPLKIPGTAFHRGLKARNRMYAMLDSVI-ARRRDGG-----EVRNDFLQ  258

Query  966   EMLERDS---------------FPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLL  832
              +L + +                 +++KL D ++ DN+LTL++AG  TT A + W +K L
Sbjct  259   TLLRKHAKDGTAADEDDGGGGGDRDADKLTDAQLKDNILTLLVAGHDTTTAGLTWLIKFL  318

Query  831   DENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVAL  652
              EN E   +LR                             V+ ETLR + +L WF R A 
Sbjct  319   GENPEALQKLR-----------------------------VMNETLRRATILPWFSRKAA  349

Query  651   DNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTC  472
              +  I+G++IKKG  VN+D   IH+DP+++ DP  F+P+RFD   +PYS++ FGSGPR C
Sbjct  350   QDFSIDGYEIKKGTSVNLDVVSIHHDPSVFADPYKFDPNRFDGTLKPYSFLGFGSGPRMC  409

Query  471   LGINMAKVTMLVYLHRLTSRY  409
              G+++A++ + V++H L  RY
Sbjct  410   PGMSLARLEICVFIHHLVCRY  430



>gb|KHN15436.1| Abscisic acid 8'-hydroxylase 3, partial [Glycine soja]
Length=394

 Score =   233 bits (595),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 127/391 (32%), Positives = 213/391 (54%), Gaps = 20/391 (5%)
 Frame = -2

Query  1542  HGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHK  1363
             +G+ FKT I G+  VF+   + +K +      +       +    +G  SLL    E+HK
Sbjct  1     YGKVFKTFILGRFTVFMTGREASKILLTGKDGIVTLNLFYTGQQVLGPTSLLQTTGEAHK  60

Query  1362  RIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMS  1183
             R+RRL+ +P S++ L  +    +    + L++  R  +   VL+     T   + +M+MS
Sbjct  61    RLRRLIGEPLSIDGLKKYFHFINTQAMETLDQWER--RKVLVLEEASTFTLKVIGHMIMS  118

Query  1182  I-TDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMG  1006
             +   G    +   +   +S +  SFP+ +PGT ++ GIKAR R+ E   + I   RRR G
Sbjct  119   LDPSGEEQEKFRSNFKIISSSFSSFPLKLPGTAFHHGIKARDRMYEMLDSTIS--RRRSG  176

Query  1005  RGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDE  826
             +  + D     + +  + D   +  KL D+++ DN+LTL++AG  TT AA+ W +K LDE
Sbjct  177   QEFQQDFLGSLVMKHRKEDGEEDENKLTDQQLKDNILTLLVAGHDTTTAALTWLIKFLDE  236

Query  825   NTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDN  646
             N  +  +LREE   I+ N+  G  +T  ++N M Y +KV+ ETLR + +L WF R A  +
Sbjct  237   NPIVLEKLREEHRRIIENRKSGTNLTWSEVNNMPYTAKVISETLRRATILPWFSRKASQD  296

Query  645   CKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLG  466
              +I+G+ ++KGW +N+D   IH+DP               E  RP+S++ FGSGPR C G
Sbjct  297   FEIDGYKVRKGWSINLDVVSIHHDP---------------EPLRPFSFLGFGSGPRMCPG  341

Query  465   INMAKVTMLVYLHRLTSRYKWSVDDPDPSLE  373
             +N+AK+ + V++H L ++Y W   + + S++
Sbjct  342   MNLAKLEISVFIHHLINKYTWRTLEEENSVQ  372



>gb|KHN00517.1| Taxane 13-alpha-hydroxylase [Glycine soja]
Length=161

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 129/171 (75%), Gaps = 16/171 (9%)
 Frame = -2

Query  822  TEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNC  643
            T +    +EEQLSI + K +GA I  EDLN+M Y  KV KETLRMSNVLLWFPRVAL++C
Sbjct  2    TSVHIDSQEEQLSITKMK-QGASIYHEDLNSMRYGLKVFKETLRMSNVLLWFPRVALEDC  60

Query  642  KIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGI  463
             IEG+DIKKGWHVNIDAT I                RFDEMQ+PYS+IPFGSGPRTCLGI
Sbjct  61   TIEGYDIKKGWHVNIDATYIQ---------------RFDEMQKPYSFIPFGSGPRTCLGI  105

Query  462  NMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFNQ  310
            NMAKVTMLV+LHRLT  Y  ++DD D  LE+KAHIPR+RSGCPITL + ++
Sbjct  106  NMAKVTMLVFLHRLTGGYTGTLDDSDTCLEKKAHIPRIRSGCPITLKSLSK  156



>ref|XP_004308741.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Fragaria vesca 
subsp. vesca]
Length=493

 Score =   236 bits (601),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 151/491 (31%), Positives = 255/491 (52%), Gaps = 13/491 (3%)
 Frame = -2

Query  1791  VELGKLRMVFGSMVSHYYYDVFLGL-LVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGE  1615
             +ELG + MV   + S  +  VF+ L  + + +  +L        K C+ PG LG+PF+G 
Sbjct  1     MELGSMWMVV--LCSTSFVGVFVTLKWLLMNVNRWLYETPLGVKKHCLPPGDLGLPFIGN  58

Query  1614  TFSLLSATNSTKGCYDFVRT--RRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALF  1441
              +S L A  S+     F+ +   R      +K  +FG   V   + +  K +  +D A F
Sbjct  59    MWSFLKAYKSSDP-ESFIDSFVSRFGKTGIYKAFMFGSPSVICTAPETCKRVLTDDDA-F  116

Query  1440  NKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFS-MNSLSIFVQKFDRMLCQRLEEQ  1264
               G+  +  + +GKKS + +P E HKR+RRL + P +   +LS+++   + ++   LE+ 
Sbjct  117   QPGWPAATVELIGKKSFVSIPFEEHKRLRRLTAAPINGHEALSMYIPYIEEIVISSLEKL  176

Query  1263  HRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRY  1084
               +G+    L    KITF  +  + +S    S++  +E++ + ++  + +  +  PG  Y
Sbjct  177   ATMGQ-MEFLTQLRKITFKIIMYIFLSTESESVMEALEKEYTNLNYGVRAMAINFPGFAY  235

Query  1083  YKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMD  904
             +K +KAR  L+ TF++I+D RR +   GN   + +D +  +++     +  KL DEEI+D
Sbjct  236   HKALKARRNLVATFQSIVDERRAQKKAGNFFTKKKDMMDALVDVQD-EDGRKLTDEEIID  294

Query  903   NLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSIL-RNKPKGALITLEDLNTM  727
              L+  + AG  ++   MMW+  LL E+ ++  + + EQ  IL R  P    +TL++   M
Sbjct  295   ILVMYLNAGHESSGHTMMWATVLLQEHPKVFQKAKAEQEEILERRPPTQKGLTLQEYREM  354

Query  726   TYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTH  547
              Y SKV+ ETLR ++  L   R A  +  I G+ I KGW        IH+D  IY +P  
Sbjct  355   EYLSKVIDETLRYNSFSLMVFREAKMDVNINGYIIPKGWKALTWFREIHWDSEIYPNPNE  414

Query  546   FNPSRFDE-MQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLER  370
             FNPSR+D    +P +++PFG+G R C G ++AK+ + V+LH     Y+    DP   +  
Sbjct  415   FNPSRWDNYTPKPATFLPFGAGSRLCPGNDLAKLEIAVFLHHFLLDYELERVDPKCPMMH  474

Query  369   KAHIPRLRSGC  337
               H PR +  C
Sbjct  475   LPH-PRPKDNC  484



>ref|NP_001173703.1| Os03g0836100 [Oryza sativa Japonica Group]
 gb|AAR88592.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 gb|ABF99755.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAH92431.1| Os03g0836100 [Oryza sativa Japonica Group]
Length=537

 Score =   237 bits (604),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 143/442 (32%), Positives = 231/442 (52%), Gaps = 71/442 (16%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG +G P +GETFS +S  +S  G   F+R R+   G+ FKT + G++ VF+   + AK
Sbjct  33    IPGTMGWPVVGETFSFISGFSSPAGILSFMRDRQKRFGKVFKTYVLGRMTVFMTGREAAK  92

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLS--------  1315
              + +    + +     +    +G  SLL    + HK++RRL+ +P S+++L         
Sbjct  93    ILLSGKDGVVSLNLFYTGKQVLGPTSLLTTNGDEHKKLRRLIGEPLSIDALKKHFDFIND  152

Query  1314  IFVQKFDRMLCQR---LEEQHRIGKSFTVLDFNMKITFDAMCNMLMSIT-DGSLLRRIER  1147
             + VQ  D  L +R   LEE      S  +  F +K+    + NML+S+  +G    +   
Sbjct  153   LAVQTLDTWLDRRVLVLEE----ASSVIIKLFTLKV----IANMLISLEPEGEEQEKFRA  204

Query  1146  DCSTVSDAMLSFPVMIPGTRYYKGI-KARGRLMETFKTIIDSRRRRMGRGNESDEDRDFL  970
             +   +S +  S P+ IPGT +++G+ KAR R+     ++I +RRR  G     +   DFL
Sbjct  205   NFKIISSSFASLPLKIPGTAFHRGLKKARNRMYAMLDSVI-ARRRDGG-----EVRNDFL  258

Query  969   QEMLERDS---------------FPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKL  835
             Q +L + +                 +++KL D ++ DN+LTL++AG  TT A + W +K 
Sbjct  259   QTLLRKHAKDGTAADEDDGGGGGDRDADKLTDAQLKDNILTLLVAGHDTTTAGLTWLIKF  318

Query  834   LDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVA  655
             L EN E   +LR                             V+ ETLR + +L WF R A
Sbjct  319   LGENPEALQKLR-----------------------------VMNETLRRATILPWFSRKA  349

Query  654   LDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRT  475
               +  I+G++IKKG  VN+D   IH+DP+++ DP  F+P+RFD   +PYS++ FGSGPR 
Sbjct  350   AQDFSIDGYEIKKGTSVNLDVVSIHHDPSVFADPYKFDPNRFDGTLKPYSFLGFGSGPRM  409

Query  474   CLGINMAKVTMLVYLHRLTSRY  409
             C G+++A++ + V++H L  RY
Sbjct  410   CPGMSLARLEICVFIHHLVCRY  431



>gb|AHA85935.1| abscisic acid 8-hydroxylase 3, partial [Arachis hypogaea]
Length=293

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/252 (43%), Positives = 167/252 (66%), Gaps = 12/252 (5%)
 Frame = -2

Query  1110  PVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESE  931
             P+ +PGT +++GIKAR R+ E   +II   RRR G+    +  +DFL+ ++ + S   +E
Sbjct  30    PIKLPGTAFHRGIKARDRMYEMLDSII--ARRRSGQ----EFQQDFLESLIMKHSKGGAE  83

Query  930   ------KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNK  769
                   KL D+++ DN+LTL++AG  TT AA+ W +K L+EN  +  +LREE   I+ N+
Sbjct  84    GEDDENKLTDKQLKDNVLTLLVAGHDTTTAALTWLIKFLEENPHVLEQLREEHRGIIANR  143

Query  768   PKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDAT  589
               G  +T  ++N M Y +KV+ ETLR + VL W+ R A  + +++G+ IKKGW VN+D  
Sbjct  144   KSGTDLTWSEVNNMPYTAKVISETLRRATVLPWYSRKASQDFEVDGYKIKKGWSVNLDVV  203

Query  588   CIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRY  409
              IH+DP ++ DP +F+PSRFD+  RP+S++ FGSGPR C G+N+AK+ + V++H L +RY
Sbjct  204   SIHHDPEVFPDPQNFDPSRFDDPLRPFSFLGFGSGPRMCPGMNLAKIEICVFIHHLVTRY  263

Query  408   KWSVDDPDPSLE  373
             KW   D D S++
Sbjct  264   KWKPLDRDDSVQ  275



>ref|XP_010921143.1| PREDICTED: taxane 13-alpha-hydroxylase-like isoform X1 [Elaeis 
guineensis]
Length=499

 Score =   234 bits (596),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 154/480 (32%), Positives = 247/480 (51%), Gaps = 19/480 (4%)
 Frame = -2

Query  1731  VFLGLLVGIGIAVYLLRGQTVRSKS------CIIPGKLGIPFLGETFSLLSATNSTKGCY  1570
             VFL +++   + V +L G+  R K+       + PG LG+P  GET S L A    K   
Sbjct  18    VFLAVVL---VIVGVLFGRYYRFKTFSLHGTSLPPGSLGLPLFGETISFLKAQTHDK-TQ  73

Query  1569  DFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIF-ANDFALFNKGYVKSMADAVGKKS  1393
             ++V TR   HG  FKT + GK  + +    G + IF AND  + +K    +++  +GK +
Sbjct  74    EWVDTRIKRHGPIFKTSLMGKPTIVITGTAGNRFIFTANDNTITSK-QPTTVSSIIGKYN  132

Query  1392  LLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKIT  1213
                +   SHK IR  ++      SL  +V+  D ++ QR+ ++    +S  ++    +IT
Sbjct  133   TFELTGHSHKVIRSAMASVLKPESLQRYVRDMDSLVKQRIFQELDGKESVKIVPLMKRIT  192

Query  1212  FDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTI  1033
             F   C +L  + DG  L  + +D +T    M S  +  PGT +++G+ AR R+ E F  +
Sbjct  193   FSMACALLFRLPDGKELDLVFQDLTTALKGMWSLHLNFPGTSFHRGMVARRRIFEYFSNL  252

Query  1032  IDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAM  853
             I+ RRR++  GN S E+ D +   L+  +    E+L ++ ++DN++TLII    T    +
Sbjct  253   IEERRRKLSEGNVSSEN-DVISSFLKLRN-ENGEELSEDMLVDNIMTLIIGSYDTITFLL  310

Query  852   MWSVKLLDENTEIQNRLREEQLSILRNKP-KGALITLEDLNTMTYASKVVKETLRMSNVL  676
                V+ L  +  I + + EEQ  ILR+K      +T  D+  M Y  +V +E LR++  +
Sbjct  311   TQFVRHLARDKMIYDYILEEQKKILRDKEGTDESLTWNDIQKMKYTWRVGQELLRITPPV  370

Query  675   LWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQR---PYS  505
                 + A+ +    GF I KGW V   ++  H D  I+  P  F+PSRF+   +   PYS
Sbjct  371   FGNFKTAITDTSFGGFPIPKGWQVFWVSSGTHMDEHIFPKPEKFDPSRFEPTSKSYPPYS  430

Query  504   YIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITL  325
             YIPFG GP  C G   A++ +L+ +H L + Y+WS   PD  + R A +P    G PI L
Sbjct  431   YIPFGGGPHVCPGSEFARMEVLLIMHHLVTNYEWSEMIPDEPITR-APLPYPAMGLPIKL  489



>ref|XP_010921144.1| PREDICTED: cytochrome P450 716B1-like isoform X2 [Elaeis guineensis]
Length=471

 Score =   232 bits (592),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 146/450 (32%), Positives = 233/450 (52%), Gaps = 10/450 (2%)
 Frame = -2

Query  1659  SCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVD  1480
             + + PG LG+P  GET S L A    K   ++V TR   HG  FKT + GK  + +    
Sbjct  17    TSLPPGSLGLPLFGETISFLKAQTHDK-TQEWVDTRIKRHGPIFKTSLMGKPTIVITGTA  75

Query  1479  GAKTIF-ANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQ  1303
             G + IF AND  + +K    +++  +GK +   +   SHK IR  ++      SL  +V+
Sbjct  76    GNRFIFTANDNTITSK-QPTTVSSIIGKYNTFELTGHSHKVIRSAMASVLKPESLQRYVR  134

Query  1302  KFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDA  1123
               D ++ QR+ ++    +S  ++    +ITF   C +L  + DG  L  + +D +T    
Sbjct  135   DMDSLVKQRIFQELDGKESVKIVPLMKRITFSMACALLFRLPDGKELDLVFQDLTTALKG  194

Query  1122  MLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSF  943
             M S  +  PGT +++G+ AR R+ E F  +I+ RRR++  GN S E+ D +   L+  + 
Sbjct  195   MWSLHLNFPGTSFHRGMVARRRIFEYFSNLIEERRRKLSEGNVSSEN-DVISSFLKLRN-  252

Query  942   PESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKP-  766
                E+L ++ ++DN++TLII    T    +   V+ L  +  I + + EEQ  ILR+K  
Sbjct  253   ENGEELSEDMLVDNIMTLIIGSYDTITFLLTQFVRHLARDKMIYDYILEEQKKILRDKEG  312

Query  765   KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATC  586
                 +T  D+  M Y  +V +E LR++  +    + A+ +    GF I KGW V   ++ 
Sbjct  313   TDESLTWNDIQKMKYTWRVGQELLRITPPVFGNFKTAITDTSFGGFPIPKGWQVFWVSSG  372

Query  585   IHYDPAIYKDPTHFNPSRFDEMQR---PYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTS  415
              H D  I+  P  F+PSRF+   +   PYSYIPFG GP  C G   A++ +L+ +H L +
Sbjct  373   THMDEHIFPKPEKFDPSRFEPTSKSYPPYSYIPFGGGPHVCPGSEFARMEVLLIMHHLVT  432

Query  414   RYKWSVDDPDPSLERKAHIPRLRSGCPITL  325
              Y+WS   PD  + R A +P    G PI L
Sbjct  433   NYEWSEMIPDEPITR-APLPYPAMGLPIKL  461



>ref|XP_009373442.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=493

 Score =   233 bits (593),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 149/478 (31%), Positives = 243/478 (51%), Gaps = 19/478 (4%)
 Frame = -2

Query  1731  VFLGLLVGIGIAVYLLRGQT----VR----SKSCIIPGKLGIPFLGETFSLLSATNST-K  1579
             VF   + G G  + +L+       VR    +K  + PG+LG PF+G T S + A  S   
Sbjct  10    VFTASVGGFGALLLILKKANEWLFVRKLGENKHTLPPGELGWPFIGNTLSFIKALKSDDP  69

Query  1578  GCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGK  1399
               +     +R      +K  +FGK  + V + +  K +  +    F  G+ KS ++ +G+
Sbjct  70    ESFISNHVKRFGSTGIYKACLFGKPTIIVTTPETCKQVLMDSLQ-FKTGWPKSTSELMGR  128

Query  1398  KSLLCVPHESHKRIRRLLSDPFSMN-SLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNM  1222
             KS L +  E HKR+R+L + P S + +LS++ +  + ++   L+E  +  K    L    
Sbjct  129   KSFLGLSEEEHKRLRKLTAAPISGHKALSMYQEYIEDVIVSSLDELAKAKKPVEFLTEIR  188

Query  1221  KITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETF  1042
             KITF  +  + +S   G+LL  +E+D + ++  + +  + +PG  ++K +KAR R+++  
Sbjct  189   KITFRIIMFIFLSCEVGTLLETMEKDYTLMNHGLRAMAINLPGFDFHKALKARKRMVKII  248

Query  1041  KTIIDSRRRRMGRGNESD--EDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTT  868
             + I+D RR R    NE+    +R  L +ML         KL+DEEI+D +L  + AG  +
Sbjct  249   QGIVDGRRAR----NEAQISRERTDLTDMLIETEDENGNKLDDEEIIDIILMYLNAGHES  304

Query  867   TAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRM  688
             TA A +W+   L E+ E   + + EQL IL+               M Y SKV+ ETLR+
Sbjct  305   TAHATLWATLFLHEHPEYYQKAKAEQLEILKTASPEEGFNFRGTKQMEYLSKVIDETLRI  364

Query  687   SNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQ-RP  511
              NV L+  R A    KI G+ I +GW V +    +H +P  Y DP  FNPSR++E   + 
Sbjct  365   VNVSLYSYREAATEVKISGYTIPRGWKVMMWYRGVHLNPEYYPDPKEFNPSRWNESNAKA  424

Query  510   YSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGC  337
              S+IPFG G R C GI++ K+ + ++LH     Y+    +P   +    H PR +  C
Sbjct  425   GSFIPFGMGSRLCPGIDLTKLEITIFLHYFLLNYELERLNPAIGVSYLPH-PRPKDNC  481



>ref|XP_009373441.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=502

 Score =   233 bits (593),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 142/449 (32%), Positives = 232/449 (52%), Gaps = 11/449 (2%)
 Frame = -2

Query  1668  RSKSCIIPGKLGIPFLGETFSLLSATNST-KGCYDFVRTRRLWHGRWFKTRIFGKIHVFV  1492
              +K  + PG+LG PF+G T S + A  S     +     +R      +K  +FGK  + V
Sbjct  48    ENKHTLPPGELGWPFIGNTLSFIKALKSDDPESFISNHVKRFGSTGIYKACLFGKPTIIV  107

Query  1491  PSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMN-SLS  1315
              + +  K +  +    F  G+ KS ++ +G+KS L +  E HKR+R+L + P S + +LS
Sbjct  108   TTPETCKQVLMDSLQ-FKTGWPKSTSELMGRKSFLGLSEEEHKRLRKLTAAPISGHKALS  166

Query  1314  IFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCST  1135
             ++ +  + ++   L+E  +  K    L    KITF  +  + +S   G+LL  +E+D + 
Sbjct  167   MYQEYIEDVIVSSLDELAKAKKPVEFLTEIRKITFRIIMFIFLSCEVGTLLETMEKDYTL  226

Query  1134  VSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESD--EDRDFLQEM  961
             ++  + +  + +PG  ++K +KAR R+++  + I+D RR R    NE+    +R  L +M
Sbjct  227   MNHGLRAMAINLPGFDFHKALKARKRMVKIIQGIVDGRRAR----NEAQISRERTDLTDM  282

Query  960   LERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSI  781
             L         KL+DEEI+D +L  + AG  +TA A +W+   L E+ E   + + EQL I
Sbjct  283   LIETEDENGNKLDDEEIIDIILMYLNAGHESTAHATLWATLFLHEHPEYYQKAKAEQLEI  342

Query  780   LRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVN  601
             L+               M Y SKV+ ETLR+ NV L+  R A    KI G+ I +GW V 
Sbjct  343   LKTASPEEGFNFRGTKQMEYLSKVIDETLRIVNVSLYSYREAATEVKISGYTIPRGWKVM  402

Query  600   IDATCIHYDPAIYKDPTHFNPSRFDEMQ-RPYSYIPFGSGPRTCLGINMAKVTMLVYLHR  424
             +    +H +P  Y DP  FNPSR++E   +  S+IPFG G R C GI++ K+ + ++LH 
Sbjct  403   MWYRGVHLNPEYYPDPKEFNPSRWNESNAKAGSFIPFGMGSRLCPGIDLTKLEITIFLHY  462

Query  423   LTSRYKWSVDDPDPSLERKAHIPRLRSGC  337
                 Y+    +P   +    H PR +  C
Sbjct  463   FLLNYELERLNPAIGVSYLPH-PRPKDNC  490



>dbj|BAG71199.1| ent-kaurenoic acid oxidase [Lactuca sativa]
Length=493

 Score =   232 bits (591),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 140/471 (30%), Positives = 251/471 (53%), Gaps = 18/471 (4%)
 Frame = -2

Query  1764  FGSMVSHYYYDVFLGLLV-------GIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFS  1606
             FG M   YY  +FLGL++        + I +Y  R    + + C+ PG +G PF+G  +S
Sbjct  6     FGGM--SYYVGIFLGLMLILKWVLKSVNIWIYE-RNLEKKKRKCLPPGDMGWPFIGNMWS  62

Query  1605  LLSATNST-KGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGY  1429
              L A  S     +     RR      +K+ +FG   + V   +  + +  +D A F  G+
Sbjct  63    FLRAFKSNDPDAFISNFLRRFGSRGLYKSFMFGSPSIIVTVPEACRKVLFDDEA-FQPGW  121

Query  1428  VKSMADAVGKKSLLCVPHESHKRIRRLLSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIG  1252
               +  + +GKKS + + +E HKR+R+L + P +   +LS ++Q  +  +   LE+  ++G
Sbjct  122   PTATRELIGKKSFIGISYEDHKRLRKLTAAPVNGHEALSTYMQYIETNVVLALEKWSKMG  181

Query  1251  KSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGI  1072
             +    L +  K+TF  + ++ +S     ++  +E++ + ++  + +  + IPG  YY  +
Sbjct  182   R-IEFLTYLRKLTFQIIMHIFLSTESEHVMDALEKEYTVLNYGVRAMAINIPGFAYYNAL  240

Query  1071  KARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLT  892
             KAR  L+   +T++  RR++    NE    +D L  +L+     +  KL+DEEI+D L+ 
Sbjct  241   KARKNLVAILQTVVYERRKKR-EANEGMSKKDMLDALLDTTD-EKGRKLDDEEIIDTLVM  298

Query  891   LIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRN-KPKGALITLEDLNTMTYAS  715
              + AG  ++    MWS  LL  + E  +  +EEQ  I++N  P    +TL++   M Y S
Sbjct  299   YLNAGHESSGHITMWSTILLQAHPEFFHIAKEEQERIVKNMPPTQEGLTLKEYRQMEYLS  358

Query  714   KVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPS  535
             KV+ ETLR+    L   R A  +  I+G+ I KGW V +    +H++P +Y  P  FNPS
Sbjct  359   KVIDETLRLVTFSLMTFREAKKDVDIKGYFIPKGWKVLLWFRSVHHNPELYPQPKEFNPS  418

Query  534   RFDEM-QRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPD  385
             R+D++  +P +++PFG+G R C G ++AK+ + ++LH     Y++  ++P+
Sbjct  419   RWDDLVPKPGTFLPFGAGSRLCPGNDLAKLEIAIFLHHFLVNYEFERENPE  469



>ref|XP_002526524.1| Ent-kaurenoic acid oxidase, putative [Ricinus communis]
 gb|EEF35915.1| Ent-kaurenoic acid oxidase, putative [Ricinus communis]
Length=492

 Score =   231 bits (590),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 145/463 (31%), Positives = 244/463 (53%), Gaps = 15/463 (3%)
 Frame = -2

Query  1701  IAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVR--TRRLWHGRWF  1528
             +  +L   Q    +  + PG LG PF+G  +S L A  S      F+R  T R   G  +
Sbjct  27    VNCWLYENQLGEMQYSLPPGDLGWPFIGNMWSFLRAFKSNDPD-SFMRNFTARYGSGGIY  85

Query  1527  KTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRL  1348
             K  +FGK  V V + +  K +  +D A F  G+  S  + +GKKS + + +E HKR+RRL
Sbjct  86    KAFMFGKPSVLVTTSEACKRVLTDDDA-FKPGWPSSTTELIGKKSFIGISYEEHKRLRRL  144

Query  1347  LSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDG  1171
              + P +   +LS+++   +  +   LE+   +G+    L    K+TF  +  + +S    
Sbjct  145   TASPVNGHEALSVYMHYIEDKVKSALEKWSTMGE-IQFLTQLRKLTFRIIMYIFLSSESH  203

Query  1170  SLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRR-RRMGRGNE  994
             S++  +ER+ +T++  + +  + +PG  YYK +KAR  L+   + ++D+RR ++ G    
Sbjct  204   SVMEALEREYTTLNYGVRAMAINLPGFAYYKALKARKNLVAVLQFVVDARRNQKKGAEPN  263

Query  993   SDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEI  814
             S + +D +  +L+ +   +  KL DEEI+D LL  + AG  ++    MW+   L E+ E 
Sbjct  264   SSKKKDMMDALLDVED-EKGRKLSDEEIVDVLLMYLNAGHESSGHITMWATVFLQEHPEF  322

Query  813   QNRLREEQLSILRNKP---KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNC  643
               + R+EQ  I++ +P   KG  +TL+++  M Y SKV+ ETLR+    L   R A  N 
Sbjct  323   LQKARQEQEEIIKRRPPTQKG--LTLKEVRDMEYLSKVIDETLRLITFSLVVFREAKTNV  380

Query  642   KIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFD-EMQRPYSYIPFGSGPRTCLG  466
              I G+ I KGW + +    +H DP IY +P  FNPSR+D    +  +++PFG+G R C G
Sbjct  381   NISGYVIPKGWKILVWFRSVHLDPEIYPNPREFNPSRWDNHTAKAGTFLPFGAGSRMCPG  440

Query  465   INMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGC  337
              ++AK+ + ++LH     Y+    +P  S+    H  R +  C
Sbjct  441   NDLAKLEIAIFLHHFLLNYELERLNPGSSMMYLPH-SRPKDNC  482



>ref|XP_002968540.1| hypothetical protein SELMODRAFT_89153 [Selaginella moellendorffii]
 gb|EFJ30794.1| hypothetical protein SELMODRAFT_89153 [Selaginella moellendorffii]
Length=464

 Score =   229 bits (585),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 139/444 (31%), Positives = 226/444 (51%), Gaps = 10/444 (2%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKT  1468
             PG +G P+LGET  L S   +      F  +++  +G  FKT I G   V + S + AK 
Sbjct  24    PGTMGWPYLGETLQLYSQNPNA-----FFSSKQKRYGDIFKTHILGCPSVMIASPEAAKF  78

Query  1467  IFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRM  1288
             I  +   LF   +  S    +G  +L     E H+R+RRL+   F  + +   V + + +
Sbjct  79    ILVSHAHLFKTTFPSSKEGIIGPHALFFHEGEYHRRLRRLVQGCFGPDVIRDLVPELETI  138

Query  1287  LCQRLEEQHRIGKSFTVLDFNMKITFD-AMCNMLMSITDGSLLRRIERDCSTVSDAMLSF  1111
               Q L+   R G          K  FD  +  +     DG     ++R   T+     SF
Sbjct  139   SIQALDSLDRAGGIINTFQEMKKYAFDVGVLKIFGGSLDGLDKEDLKRAYQTLERGYNSF  198

Query  1110  PVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESE  931
             P+ I GT Y   +KAR RL      II  RRR+  + + +   +DFL  ++E       +
Sbjct  199   PIDIAGTPYNAAMKARKRLSSIVSRIILDRRRQQKQAD-NGRCKDFLSTLMESQD-DSCK  256

Query  930   KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGAL-  754
              L D++I DN++ +I A Q TTA+ + W +K L EN  +   +  E  +I R+KP+GA  
Sbjct  257   NLTDDQIADNVIGVIFAAQDTTASVLTWLLKYLKENPALLESVTAEHENIRRSKPEGAKG  316

Query  753   ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYD  574
             +T  D   M   S+V++ET+R++ +L +  R A+ + +  G+ I KGW V      IH+ 
Sbjct  317   LTWADTKNMPLTSRVIQETMRLATILSFTFREAVQDVEYNGYVIPKGWKVMPLFRNIHHS  376

Query  573   PAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVD  394
             P  + +P  FNPSRF+E  +P +++PFG+G  +C G  +AK+ MLV +H +T++++W   
Sbjct  377   PEFFLEPQKFNPSRFEEHPKPNTFMPFGNGIHSCPGRELAKLEMLVLVHNITTQFRWEFA  436

Query  393   DPDPSLERKAHIPRLRSGCPITLT  322
              P   ++     P  ++G PI++T
Sbjct  437   GPTEGVQY-GPFPVPKAGLPISIT  459



>ref|XP_010065107.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Eucalyptus grandis]
Length=390

 Score =   226 bits (577),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 110/287 (38%), Positives = 172/287 (60%), Gaps = 12/287 (4%)
 Frame = -2

Query  1215  TFDAMCNMLMSI-TDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFK  1039
             T   + +M+MS+   G    +   +   +S +  S P  +PGT +++GI+AR R+     
Sbjct  92    TLKVIGHMIMSLEPKGEEQEKFRSNFKIISSSFASLPFKVPGTAFHRGIQARDRMYSMLD  151

Query  1038  TIIDSRRRRMGRGNESDEDRDFLQEMLER-----DSFPESEKLEDEEIMDNLLTLIIAGQ  874
              +I  RR   G  N      DFL+ ++ +     D   + +KL D+++ DN+LTL++AG 
Sbjct  152   NVISKRREGQGFKN------DFLESLIIKHSKAADGEADKDKLTDKQMKDNVLTLLVAGH  205

Query  873   TTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETL  694
              TT AA+ W +K L EN ++  RLREE + I      GA ++  ++N M Y +KV+ ETL
Sbjct  206   NTTTAALTWLMKFLGENPQVLQRLREEHMEIQAKGKGGANLSWSEVNNMPYTAKVISETL  265

Query  693   RMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQR  514
             R + +L WF R A  + +I+G+ I+KGW VN+D   IH+DP I+  P  F PSRFDE  +
Sbjct  266   RRATILPWFSRKAAQDFEIDGYKIEKGWSVNLDVVSIHHDPEIFPQPEVFYPSRFDEPLK  325

Query  513   PYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLE  373
             P+S++ FGSGPR C GIN+AK+ + +++H L  RYKW+  + D S++
Sbjct  326   PFSFLGFGSGPRMCPGINLAKLEISIFIHHLACRYKWTPLERDDSVQ  372



>ref|XP_011013095.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Populus euphratica]
Length=493

 Score =   228 bits (582),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 145/478 (30%), Positives = 248/478 (52%), Gaps = 21/478 (4%)
 Frame = -2

Query  1791  VELGKLRMVFGSMVSHYYYDVFLGLLVGIGI----AVYLLRGQTVRSKSCIIPGKLGIPF  1624
             +ELG + +V           +F GL VG  I      +L   Q    +  + PG LG PF
Sbjct  1     MELGSIWVVLAV--------IFGGLGVGKWILKKVNWWLYEAQLGEKQYSLPPGDLGWPF  52

Query  1623  LGETFSLLSATNSTKGCYDFVRT--RRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDF  1450
             +G  +S L A  S+     F+RT   +  H   +K  +FG   VFV + +  + + +ND 
Sbjct  53    IGNMWSFLRAFKSSDPD-SFMRTFINKYGHAGIYKAFMFGNPSVFVTTPEACRRVLSNDD  111

Query  1449  ALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMN-SLSIFVQKFDRMLCQRL  1273
             A F  G+  +    +G+KS + + +E HK +RRL S P + + +LS ++   +  +   L
Sbjct  112   A-FKPGWPIATVKLIGRKSFIGISYEEHKHLRRLTSAPVNGHEALSAYIPYIEENVIAML  170

Query  1272  EEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPG  1093
             E+   +G+    L    K+TF  +  + +S     ++  +E+D +T++  + +  + +PG
Sbjct  171   EKWTTMGR-IEFLTQMRKLTFKIIMYIFLSSESEVVMEVLEKDYTTLNYGVRAMAINVPG  229

Query  1092  TRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEE  913
               YYK  KAR RL+ TF++I+D RR     G+ + + +D +  +L  +      KL DEE
Sbjct  230   FAYYKAFKARKRLVATFQSILDKRRNLRKNGDVNAKKKDMMDSLLGVED-ENGRKLTDEE  288

Query  912   IMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNK-PKGALITLEDL  736
             I+D +L  + AG  ++     W    L E+ +   + +EEQ  I++ + P    ++L+++
Sbjct  289   IIDVMLMYLNAGHESSGHITTWGTIFLQEHPKFLQKAKEEQEQIVKKRLPTQKGLSLKEV  348

Query  735   NTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKD  556
               M Y SKV+ ETLR+    L   R A  +  I G+ I KGW V +    +H DP IY +
Sbjct  349   REMDYLSKVIDETLRLITFSLTVFREAKTDFNINGYIIPKGWKVLVWFRTVHLDPEIYPN  408

Query  555   PTHFNPSRFDEMQ-RPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPD  385
             P  FNPSR+D    +P +++PFG+G R C G ++AK+ + ++LH     Y+   ++P+
Sbjct  409   PKEFNPSRWDNYTPKPGTFLPFGAGSRLCPGNDLAKLEISIFLHYFLLGYRLERENPE  466



>gb|KCW71147.1| hypothetical protein EUGRSUZ_F042432, partial [Eucalyptus grandis]
Length=400

 Score =   225 bits (574),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 126/381 (33%), Positives = 207/381 (54%), Gaps = 20/381 (5%)
 Frame = -2

Query  1650  IPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAK  1471
             IPG LG P +GE+FS +S  +S  G Y F++ R+  +G+ FK+ + G+  VF+   + +K
Sbjct  34    IPGTLGWPIIGESFSFISDFSSPSGIYSFMKKRQERYGKVFKSFVLGRFTVFMTGREASK  93

Query  1470  TIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
              +      + +     +    +G  SLL    E HKR+RRL+++P S++ L  + Q  + 
Sbjct  94    ILLTGKDGMVSLNLFYTGQQVLGPTSLLQTTGEEHKRLRRLIAEPLSIDGLKKYFQFINA  153

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSIT-DGSLLRRIERDCSTVSDAMLS  1114
             +  + L++    G+   VL+     T   + +M+MS+   G    +   +   +S +  S
Sbjct  154   LAIETLDQWE--GRKVLVLEEASTFTLKVIGHMIMSLEPKGEEQEKFRSNFKIISSSFAS  211

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLER-----D  949
              P  +PGT +++GI+AR R+      +I  RR   G  N      DFL+ ++ +     D
Sbjct  212   LPFKVPGTAFHRGIQARDRMYSMLDNVISKRREGQGFQN------DFLESLIIKHGKAAD  265

Query  948   SFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNK  769
                + +KL D+++ DN+LTL++AG  TT AA+ W +K L EN +      EE + I    
Sbjct  266   READKDKLTDKQMKDNVLTLLVAGHDTTTAALTWLMKFLGENPQ------EEHMEIQAKG  319

Query  768   PKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDAT  589
               GA ++  ++N M Y +KV+ ETLR + +L WF R A  + +I+G+ I+KGW VN+D  
Sbjct  320   KGGANLSWSEVNNMPYTAKVISETLRRATILPWFSRKAAQDFEIDGYKIEKGWSVNLDVV  379

Query  588   CIHYDPAIYKDPTHFNPSRFD  526
              IH+DP I+  P  F PSRFD
Sbjct  380   SIHHDPEIFPQPEVFYPSRFD  400



>ref|XP_010097724.1| Ent-kaurenoic acid oxidase 1 [Morus notabilis]
 gb|EXB70679.1| Ent-kaurenoic acid oxidase 1 [Morus notabilis]
Length=493

 Score =   228 bits (580),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 154/500 (31%), Positives = 256/500 (51%), Gaps = 36/500 (7%)
 Frame = -2

Query  1776  LRMVFGSMVSHYYYDVFLGLLVGIGIAV---YLLRG--------QTVRSKSCIIPGKLGI  1630
             + + FGS+V        L LL  +G  V   +LLR         +    K  + PG LG 
Sbjct  1     MELEFGSVV--------LALLSSLGCFVVLKWLLRNVNWWLYETKLGEKKYSLPPGDLGW  52

Query  1629  PFLGETFSLLSA---TNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFA  1459
             PF+G  +S L A   +N       FV   R  H   +K  +FG   + V + +  + +  
Sbjct  53    PFIGNMWSFLKAFKSSNPDSFISSFVS--RYGHTGMYKAFLFGNPSIIVTTPETCRRVLT  110

Query  1458  NDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFS-MNSLSIFVQKFDRMLC  1282
             +D + F  G+ +S  + +GKKS + +  E HKR+R+L + P +   +LS++++  +  + 
Sbjct  111   DDES-FKPGWPRSTVELIGKKSFIGISFEEHKRLRKLTAAPVNGHEALSMYIKYIEENVV  169

Query  1281  QRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVM  1102
               LE+   +G+    L    K+TF  +  + +S    S++  +E + + ++  + +  + 
Sbjct  170   ASLEKWATMGE-IEFLTQVRKLTFRIIMYIFLSTESESVMGALENEYTALNYGVRAMAIN  228

Query  1101  IPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGN-ESDEDRDFLQEMLERDSFPESEKL  925
             IPG  Y++  KAR  L+  F++I+D RR +  +GN  S + +D +  +L+ +      KL
Sbjct  229   IPGFAYHRARKARKNLVSVFQSIVDERRSQRRKGNVSSTKKKDMMDALLDVED-ENGRKL  287

Query  924   EDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKP---KGAL  754
              DEEI+D LL  + AG  ++   MMW+V  L    EI  + + EQ  I++ +P   KG  
Sbjct  288   TDEEIIDVLLMYLNAGHESSGHTMMWAVVFLQHRPEIFQKAKAEQEEIIKKRPPTQKG--  345

Query  753   ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYD  574
             ++L+++  M Y SKVV ETLR+    L   R A  + ++ G+ I KGW V +    +H D
Sbjct  346   LSLKEIREMDYLSKVVDETLRVVTFSLTVFREAKQDVQVTGYTIPKGWKVLVWFRSVHLD  405

Query  573   PAIYKDPTHFNPSRFDEMQ-RPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSV  397
             P IY DP  FNPSR+D    R  S++PFG+G R C G ++AK+ + ++LH     Y+   
Sbjct  406   PEIYPDPKEFNPSRWDNYTPRAGSFLPFGAGSRLCPGNDLAKLEISIFLHHFLLGYRLKR  465

Query  396   DDPDPSLERKAHIPRLRSGC  337
              +PD  L    H  R +  C
Sbjct  466   ANPDCPLMYLPH-SRPKDNC  484



>ref|XP_002975946.1| hypothetical protein SELMODRAFT_104642 [Selaginella moellendorffii]
 gb|EFJ22851.1| hypothetical protein SELMODRAFT_104642 [Selaginella moellendorffii]
Length=464

 Score =   227 bits (578),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 140/447 (31%), Positives = 229/447 (51%), Gaps = 16/447 (4%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKT  1468
             PG +G P+LGET  L S   +      F  +++  +G  FKT I G   V + S + AK 
Sbjct  24    PGTMGWPYLGETLQLYSQNPNA-----FFSSKQKRYGDIFKTHILGCPSVMIASPEAAKF  78

Query  1467  IFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRM  1288
             I  +   LF   +  S    +G  +L     E H+R+RRL+   F  + +   V + + +
Sbjct  79    ILVSHAHLFKTTFPSSKEGIIGPHALFFHEGEYHRRLRRLVQGCFGPDVIRDLVPELETI  138

Query  1287  LCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSL----LRRIERDCSTVSDAM  1120
               Q L+   R G          K  FD     ++ I  GSL       ++R   T+    
Sbjct  139   SIQALDSLDRAGGIINTFQEMKKYAFDVG---VLKIFGGSLDELDKEDLKRAYQTLERGY  195

Query  1119  LSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFP  940
              SFP+ I GT Y   +KAR RL      II  RRR+  + + +   +DFL  ++E     
Sbjct  196   NSFPIDIAGTPYNAAMKARKRLSSIVSRIILDRRRQQKQAD-NGRCKDFLSTLMESQD-D  253

Query  939   ESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKG  760
               + L D++I DN++ +I A Q TTA+ + W +K L EN  + + +  E  +I R+KP+G
Sbjct  254   SCKNLTDDQIADNVIGVIFAAQDTTASVLTWLLKYLKENPALLDSVTAEHENIRRSKPEG  313

Query  759   AL-ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCI  583
             A  +T  D   M   S+V++ET+R++ +L +  R A+ + +  G+ I KGW V      I
Sbjct  314   AKGLTWADTKNMPLTSRVIQETMRLATILSFTFREAVQDVEYNGYVIPKGWKVMPLFRNI  373

Query  582   HYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKW  403
             H+ P  + +P  F+PSRF+E  +P +++PFG+G  +C G  +AK+ MLV +H +T++++W
Sbjct  374   HHSPEFFLEPQKFDPSRFEEHPKPNTFMPFGNGIHSCPGRELAKLEMLVLVHNITTQFRW  433

Query  402   SVDDPDPSLERKAHIPRLRSGCPITLT  322
                 P   ++     P  ++G PI++T
Sbjct  434   EFAGPTEGVQY-GPFPVPKAGLPISIT  459



>gb|AGI65630.1| ent-kaurenoic acid oxidase [Malus domestica]
Length=503

 Score =   228 bits (580),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 143/459 (31%), Positives = 244/459 (53%), Gaps = 16/459 (3%)
 Frame = -2

Query  1689  LLRGQTVRSKSCIIPGKLGIPFLGETFSLLSA--TNSTKGCYD-FVRTRRLWHGRWFKTR  1519
             L   Q    +  + PG LG+PF+G  +S L A  +N+ +   D FV   R      +K  
Sbjct  41    LYETQLGERQYSLPPGDLGLPFIGNMWSFLRAFKSNNPESFLDKFVS--RFGKTGIYKAF  98

Query  1518  IFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSD  1339
             +FG   + V + + +K +  +D A F  G+  S  + +GKKS + + +E HKR+RRL + 
Sbjct  99    MFGFPSIIVTTPETSKRVLTDDDA-FKPGWPVSTVELIGKKSFIGISYEEHKRLRRLTAA  157

Query  1338  PFSMN-SLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLL  1162
             P + + +LS++++  + ++   LE+  ++G+    L    K+TF  +  + +S     ++
Sbjct  158   PVNGHEALSVYMKYIEEIVITSLEKWSKLGQ-IEFLTQLRKLTFKIIMYIFLSSESEPVM  216

Query  1161  RRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDED  982
               +ER+ + ++  + +  + +PG  Y+K +KAR  L+  F++I+D RR +   GN   + 
Sbjct  217   EALEREYTVLNYGVRAMAINLPGFAYHKALKARKNLVAIFQSIVDERRAQRKSGNYYVKK  276

Query  981   RDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRL  802
             +D +  +L+ +   +  KL DE+I+D LL  + AG  ++   +MW+   L  N E   R 
Sbjct  277   KDMMDALLDVED-DDGRKLNDEDIIDVLLMYLNAGHESSGHTIMWATVFLQANPEAFQRA  335

Query  801   REEQLSILRNKP---KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEG  631
             + EQ  IL+ +P   KG  +TL++   M Y S+V+ ETLR+    L   R A  + KI G
Sbjct  336   KAEQEEILKRRPPTQKG--LTLKEYREMDYLSQVIDETLRVITFSLTVFREAKKDVKING  393

Query  630   FDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFD-EMQRPYSYIPFGSGPRTCLGINMA  454
             + I KGW V +    IHYD  +Y +PT FNPSR+D    +  S++PFG+G   C G ++A
Sbjct  394   YSIPKGWKVLVWFRSIHYDSELYPNPTEFNPSRWDNHTPKALSFLPFGAGSHLCPGNDLA  453

Query  453   KVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGC  337
             K+ + ++LH     YK    +P   L    H  R +  C
Sbjct  454   KLEIAIFLHHFLLNYKMERTNPGCPLMYLPHT-RPKDNC  491



>gb|AGZ93669.1| ent-kaurene acid oxidase [Malus domestica]
Length=503

 Score =   228 bits (580),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 142/459 (31%), Positives = 244/459 (53%), Gaps = 16/459 (3%)
 Frame = -2

Query  1689  LLRGQTVRSKSCIIPGKLGIPFLGETFSLLSA--TNSTKGCYD-FVRTRRLWHGRWFKTR  1519
             L   Q    +  + PG LG+PF+G  +S L A  +N+ +   D FV   R      +K  
Sbjct  41    LYETQLGERQYSLPPGDLGLPFIGNMWSFLRAFKSNNPESFLDKFVS--RFGKTGIYKAF  98

Query  1518  IFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSD  1339
             +FG   + V + + +K +  +D A F  G+  S  + +GKKS + + +E HKR+RRL + 
Sbjct  99    MFGFPSIIVTTPETSKRVLTDDDA-FKPGWPVSTVELIGKKSFIGISYEEHKRLRRLTAA  157

Query  1338  PFSMN-SLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLL  1162
             P + + +LS++++  + ++   LE+  ++G+    L    K+TF  +  + +S     ++
Sbjct  158   PVNGHEALSVYMKYIEEIVITSLEKWSKLGQ-IEFLTQLRKLTFKVIMYIFLSSESEPVM  216

Query  1161  RRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDED  982
               +ER+ + ++  + +  + +PG  Y+K +KAR  L+  F++I+D RR +   GN   + 
Sbjct  217   EALEREYTVLNYGVRAMAINLPGFAYHKALKARKNLVAIFQSIVDERRAQRKSGNYYVKK  276

Query  981   RDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRL  802
             +D +  +L+ +   +  KL DE+I+D LL  + AG  ++   +MW+   L  N E   R 
Sbjct  277   KDMMDALLDVED-DDGRKLNDEDIIDVLLMYLNAGHESSGHTIMWATVFLQANPEAFQRA  335

Query  801   REEQLSILRNKP---KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEG  631
             + EQ  IL+ +P   KG  +TL++   M Y S+V+ ETLR+    L   R A  + KI G
Sbjct  336   KAEQEEILKRRPPTQKG--LTLKEYREMDYLSQVIDETLRVITFSLTVFREAKKDVKING  393

Query  630   FDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFD-EMQRPYSYIPFGSGPRTCLGINMA  454
             + I KGW V +    IHYD  +Y +P  FNPSR+D    +  S++PFG+G   C G ++A
Sbjct  394   YSIPKGWKVLVWFRSIHYDSELYPNPMEFNPSRWDNHTPKALSFLPFGAGSHLCPGNDLA  453

Query  453   KVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGC  337
             K+ + ++LH    +YK    +P   L    H  R +  C
Sbjct  454   KLEIAIFLHHFLLKYKMERTNPGCPLMYLPHT-RPKDNC  491



>ref|XP_002264215.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Vitis vinifera]
 emb|CBI16744.3| unnamed protein product [Vitis vinifera]
Length=488

 Score =   226 bits (577),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 148/479 (31%), Positives = 245/479 (51%), Gaps = 19/479 (4%)
 Frame = -2

Query  1740  YYDVFLGLL----VGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGC  1573
             Y  +F G L    V + +  ++  G+       + PG LG P +G  ++ L A   TK  
Sbjct  10    YTAIFAGALALRWVLLRVNKWVYEGRLKGKSYHLPPGDLGWPLIGNMWTFLRAF-KTKNP  68

Query  1572  YDFVR--TRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGK  1399
               F+     R   G  +KT +FG   + V S +G + +  +D   F  G+  S  + +GK
Sbjct  69    DSFISNIVERYGKGGIYKTFMFGNPSILVTSPEGCRKVLTDDDN-FKPGWPTSTEELIGK  127

Query  1398  KSLLCVPHESHKRIRRLLSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNM  1222
             KS + + +E HKR+RRL S P +   +LS+++   ++ +   LE+  ++G +   L    
Sbjct  128   KSFVSISYEEHKRLRRLTSAPVNGHEALSLYIPYIEKNVISDLEKWSKMG-NIEFLTGVR  186

Query  1221  KITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETF  1042
             K+TF  +  + +S   G ++  +E++ + ++  + +  + IPG  ++K  KAR  L+ T 
Sbjct  187   KLTFKIIMYIFLSAESGDVMEALEKEYTILNYGVRALAINIPGFAFHKAFKARKNLVATL  246

Query  1041  KTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTA  862
             +  +D RR+R  R N S  ++D L  +L  +      KL DEEI+D L+  + AG  ++ 
Sbjct  247   QATVDERRQRE-RENSSAREKDMLDALLHVED-ENGRKLTDEEIIDLLIMYLNAGHESSG  304

Query  861   AAMMWSVKLLDENTEIQNRLREEQLSILRNKP---KGALITLEDLNTMTYASKVVKETLR  691
                MW+  LL  + EI  R + EQ  I++N+P   KG  +TL ++  M Y S+V+ ETLR
Sbjct  305   HVTMWATLLLQGHPEIFQRAKAEQEEIVKNRPPTQKG--LTLREVRKMEYLSQVIDETLR  362

Query  690   MSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQ-R  514
                  L   R A  +  I G+   KGW V +    +HYDP IY +P  FNPSR+D    +
Sbjct  363   WLTFSLMVFREAKADVNIGGYLFPKGWKVLVWFRAVHYDPEIYPNPEVFNPSRWDNFTPK  422

Query  513   PYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGC  337
               +++PFG+G R C G ++AK+ + ++LH     Y+    +P   L    H PR    C
Sbjct  423   AGTFLPFGAGSRLCPGNDLAKLEISIFLHYFLLNYRLERVNPGCELMYLPH-PRPVDNC  480



>ref|XP_004510262.1| PREDICTED: beta-amyrin 11-oxidase-like [Cicer arietinum]
Length=492

 Score =   226 bits (577),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 132/446 (30%), Positives = 233/446 (52%), Gaps = 25/446 (6%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGR--WFKTRIFGKIHVFVPSVDGA  1474
             PG +G P +G  F+ +   +S +    F+    L +GR   +KT +FG   + +   +  
Sbjct  45    PGHMGWPLIGNLFTFIQDFSSGQPD-SFITNLILKYGRNGIYKTHLFGNPSIIICEPEMG  103

Query  1473  KTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPF-SMNSLSIFVQKF  1297
             K + +ND   F  GY KS+ +    + ++ V  E H+  RRL++ P     +L++++++ 
Sbjct  104   KRVISND-ENFKLGYPKSIKELARCRPMIDVSKEEHRHFRRLITSPIVGHKALAMYIERL  162

Query  1296  DRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAML  1117
             + ++   LEE   +      L    K++F A+ ++ M  ++ ++++ I    + + + M 
Sbjct  163   EDIVVNSLEELSSMKHPIEFLKEMKKVSFKAIVHVFMGTSNDNIIKSIGSSFTDLYNGMY  222

Query  1116  SFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLE-RDSFP  940
             S P+  PG  ++K +KAR +L +  + ++D +R  +  G + +E +D +  +LE +D   
Sbjct  223   SIPINAPGFTFHKALKARKKLAKIVQPVVDEKRLMIKNGQQVEEKKDLMDILLEVKDE--  280

Query  939   ESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKG  760
                KLEDE+I D L+ L+ AG  +TA ++MWSV  L ++  I  + +EEQ  ILR +P  
Sbjct  281   NGRKLEDEDISDLLIGLLFAGHESTATSLMWSVIHLTQHPHILKKAKEEQEEILRTRPDS  340

Query  759   AL-ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCI  583
                ++L ++  MTY S V+ ETLR +N+     R A  +  + G+ I KGW V I A  I
Sbjct  341   QKRLSLNEVKQMTYLSHVINETLRCANIAFSIFREATSDVNLNGYLIPKGWRVLIWARAI  400

Query  582   HYDPAIYKDPTHFNPSRFDEMQ-RPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYK  406
             H     Y +P  FNPSR+D    +  ++IPFG+G R C G ++ K+ + ++LH     Y+
Sbjct  401   HMSDEYYPNPQEFNPSRWDNYTPKAGTFIPFGAGSRLCPGADLVKLEISIFLHYFLLNYR  460

Query  405   WSVDDPDPSLERKAHIPRLRSGCPIT  328
                            + R+   CPIT
Sbjct  461   ---------------LERINPQCPIT  471



>ref|XP_002984649.1| hypothetical protein SELMODRAFT_120725 [Selaginella moellendorffii]
 gb|EFJ14294.1| hypothetical protein SELMODRAFT_120725 [Selaginella moellendorffii]
Length=471

 Score =   226 bits (575),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 136/453 (30%), Positives = 222/453 (49%), Gaps = 9/453 (2%)
 Frame = -2

Query  1731  VFLGLLVGIGIAV--YLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVR  1558
             V +  LV IG A   YL R +  ++   + PG LG+P LGET   +  T S +  ++F+ 
Sbjct  4     VLVLYLVCIGAAALAYLQRWRRFKAMD-LPPGSLGLPLLGETLQFIRYTKSNRP-WEFIE  61

Query  1557  TRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVP  1378
              R   +G+ FKT +FG   V V    G K +F+N   L    +   M   VG  ++  + 
Sbjct  62    QREAKYGKIFKTSLFGSPMVMVSPPQGNKLVFSNHNLLVETAWPSPMKTLVGSNAINFMS  121

Query  1377  HESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMC  1198
              E  K  R +L    S  ++   V     M+   L +  + G++        +  F   C
Sbjct  122   GEEAKSFRDVLMTFLSAQAVQSQVVPTSNMIQDHLHKHWKHGETVLAYSLIKQALFSVTC  181

Query  1197  NMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRR  1018
                +S++D      +    + +   ++S P+ +P T ++   K R  L + F   I  RR
Sbjct  182   CAFLSVSDEEEQLELLEPLAKIIKGLISLPLDLPWTNFHHAKKGRVELYKMFDKYIARRR  241

Query  1017  RRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVK  838
               +  G+   +D   L    + D+    + + D++I DN+L+L+ AG  T+++++  ++K
Sbjct  242   IELENGSSCQQDLLSLLLSTKLDN---GKLMNDDQIKDNILSLLFAGHDTSSSSLAMTLK  298

Query  837   LLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRV  658
              L +N      LR E + IL  K  G  +   DL  M Y   V++ETLR+        R 
Sbjct  299   CLAQNPACYQELRREHMDILSAKQPGEELNQNDLRKMKYTWMVIQETLRVMPTGFGILRK  358

Query  657   ALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQR--PYSYIPFGSG  484
             AL + +++GF I KGW + I     +  P  + +P  F PSRF E     PY+YIPFG G
Sbjct  359   ALKDVEMDGFTIPKGWQLLISGYRSYRKPEFFAEPFKFEPSRFAEGTGPVPYTYIPFGGG  418

Query  483   PRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPD  385
             PR C GI +AK+ ++V+LH L +RY+W++ +PD
Sbjct  419   PRICPGIQLAKMQVMVFLHHLVTRYEWTLVEPD  451



>ref|XP_009376861.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Pyrus x bretschneideri]
Length=503

 Score =   226 bits (577),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 141/459 (31%), Positives = 244/459 (53%), Gaps = 16/459 (3%)
 Frame = -2

Query  1689  LLRGQTVRSKSCIIPGKLGIPFLGETFSLLSA--TNSTKGCYD-FVRTRRLWHGRWFKTR  1519
             L   Q    +  + PG LG+PF+G  +S L A  +N+ +   D FV   R      +K  
Sbjct  41    LYETQLGERRYSLPPGDLGLPFIGNMWSFLRAFKSNNPESFLDKFVS--RFGKTGIYKAF  98

Query  1518  IFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSD  1339
             +FG   + V + + +K +  +D A F  G+  S  + +GKKS + + +E HKR+RRL + 
Sbjct  99    MFGFPSIIVTTPETSKRVLTDDDA-FKPGWPVSTVELIGKKSFIGISYEEHKRLRRLTAA  157

Query  1338  PFSMN-SLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLL  1162
             P + + +LS++++  + ++   LE+  ++G+    L    K+TF  + ++ +S     ++
Sbjct  158   PVNGHEALSVYMKYIEEIVITSLEKWSKLGQ-IEFLTQLRKLTFKIIMHIFLSSESEPVM  216

Query  1161  RRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDED  982
               +ER+ + ++  + +  + +PG  Y+K +KAR  L+  F++I+D RR +   GN   + 
Sbjct  217   EALEREYTVLNYGVRAMAINLPGFAYHKALKARKNLVAIFQSIVDERRAQRKSGNYYVKK  276

Query  981   RDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRL  802
             +D +  +L+ +   +  KL DE+I+D LL  + AG  ++   +MW+   L  N E   R 
Sbjct  277   KDMMDALLDVED-DDGRKLNDEDIIDVLLMYLNAGHESSGHTIMWATVFLQANPEAFQRA  335

Query  801   REEQLSILRNKP---KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEG  631
             + EQ  IL+ +P   KG  +TL++   M Y  +V+ ETLR+    L   R A  + KI G
Sbjct  336   KAEQEEILKRRPPTQKG--LTLKEYREMDYLCQVIDETLRVITFSLTVFREAKKDVKING  393

Query  630   FDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQ-RPYSYIPFGSGPRTCLGINMA  454
             + I KGW V +    IHYD  +Y +P  FNPSR+D    + +S++PFG+G   C G ++A
Sbjct  394   YSIPKGWKVLVWFRSIHYDSELYPNPMEFNPSRWDNFTPKAFSFLPFGAGSHLCPGNDLA  453

Query  453   KVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGC  337
             K+ + ++LH     YK    +P   L    H  R +  C
Sbjct  454   KLEIAIFLHHFLLNYKMERTNPGCPLMYLPHT-RPKDNC  491



>ref|XP_008354800.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Malus domestica]
Length=503

 Score =   226 bits (576),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 142/459 (31%), Positives = 243/459 (53%), Gaps = 16/459 (3%)
 Frame = -2

Query  1689  LLRGQTVRSKSCIIPGKLGIPFLGETFSLLSA--TNSTKGCYD-FVRTRRLWHGRWFKTR  1519
             L   Q    +  + PG LG+PF+G  +S L A  +N+ +   D FV   R      +K  
Sbjct  41    LYETQLGERQYSLPPGDLGLPFIGNMWSFLRAFKSNNPEAFLDKFVS--RFGKTGIYKAF  98

Query  1518  IFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSD  1339
             +FG   + V + + +K +  +D A F  G+  S  + +GKKS + + +E HKR+RRL + 
Sbjct  99    MFGFPSIIVTTPETSKRVLTDDDA-FKPGWPVSTVELIGKKSFIGISYEEHKRLRRLTAA  157

Query  1338  PFSMN-SLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLL  1162
             P + + +LS++++  + ++   LE+  ++G+    L    K+TF  +  + +S     ++
Sbjct  158   PVNGHEALSVYMKYIEEIVITSLEKWSKLGQ-IEFLTQLRKLTFKIIMYIFLSSESEPVM  216

Query  1161  RRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDED  982
               +ER+ + ++  + +  + +PG  Y+K +KAR  L+  F++I+D RR +   GN   + 
Sbjct  217   EALEREYTVLNYGVRAMAINLPGFAYHKALKARKNLVAIFQSIVDERRAQRKSGNYYVKK  276

Query  981   RDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRL  802
             +D +  +L+ +   +  KL DE+I+D LL  + AG  ++   +MW+   L  N E   R 
Sbjct  277   KDMMDALLDVED-DDGRKLNDEDIIDVLLMYLNAGHESSGHTIMWATVFLQANPEAFQRA  335

Query  801   REEQLSILRNKP---KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEG  631
             + EQ  IL+ +P   KG  +TL++   M Y S+V+ ETLR+    L   R A  + KI G
Sbjct  336   KAEQEEILKRRPPTQKG--LTLKEYREMDYLSQVIDETLRVITFSLTVFREAKKDVKING  393

Query  630   FDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFD-EMQRPYSYIPFGSGPRTCLGINMA  454
             + I KGW V +    IHYD  +Y +P  FNPSR+D    +  S++PFG+G   C G ++A
Sbjct  394   YSIPKGWKVLVWFRSIHYDSELYPNPXEFNPSRWDNHTPKALSFLPFGAGSHLCPGNDLA  453

Query  453   KVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGC  337
             K+ + ++LH     YK    +P   L    H  R +  C
Sbjct  454   KLEIAIFLHHFLLNYKMERTNPGCPLMYLPHT-RPKDNC  491



>gb|KDP28926.1| hypothetical protein JCGZ_14697 [Jatropha curcas]
Length=493

 Score =   226 bits (575),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 141/444 (32%), Positives = 239/444 (54%), Gaps = 15/444 (3%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRT--RRLWHGRWFKTRIFGKIHVFVPSVDGA  1474
             PG LG PF+G  +S L A  S      F+RT   R   G  +K  +FGK  +FV + +  
Sbjct  46    PGDLGWPFIGNMWSFLRAFKSADPD-SFMRTFAARYGGGGMYKALMFGKPSIFVTTPETC  104

Query  1473  KTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFS-MNSLSIFVQKF  1297
             K +  +D A F  G+  S  + +GKKS L + +E HKR+RRL S P +   +LS+++Q  
Sbjct  105   KRVLTDDEA-FKPGWPSSTMELIGKKSFLGISYEEHKRLRRLTSSPVNGHEALSLYLQYI  163

Query  1296  DRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAML  1117
             ++ +   L++   +G+    L    K+TF  +  + +S     ++  +ER+ ++++  + 
Sbjct  164   EQNVASALDKWASMGQ-IEFLTQLRKLTFRIIMYIFLSSESEPVMEALEREYTSLNYGVR  222

Query  1116  SFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPE  937
             +  + +PG  Y+K +KAR  L+   ++ +  R+ +  +G  S + RD +  +++ +    
Sbjct  223   AMAINLPGFAYHKALKARKNLVAVLQSTVKERKNQR-KGAMSSKKRDMMDALIDVED-EN  280

Query  936   SEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKP---  766
               KL +EEI+D LL  + AG  ++    MW+  LL E+ E   + +EEQ  I++ +P   
Sbjct  281   GRKLSEEEIVDVLLMYLNAGHESSGHITMWATILLQEHPEFLQKAKEEQEEIIKRRPPTQ  340

Query  765   KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATC  586
             KG  +TL ++  M Y SKV+ ETLR+    L   R A  N  + G+ I KGW V +    
Sbjct  341   KG--LTLNEVREMKYLSKVIDETLRLITFSLTVFREAKANINLNGYIIPKGWKVLVWFRS  398

Query  585   IHYDPAIYKDPTHFNPSRFDE-MQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRY  409
             +H DP IY +P  FNPSR+D  + +  +++PFG+G R C G ++AK+ + ++LH     Y
Sbjct  399   VHLDPEIYPNPKEFNPSRWDNRIVKAGTFLPFGAGSRMCPGNDLAKLEISIFLHHFLLNY  458

Query  408   KWSVDDPDPSLERKAHIPRLRSGC  337
             +    +P+ SL    H  R +  C
Sbjct  459   QLQRLNPECSLMYLPH-SRPKDNC  481



>gb|AGF25266.1| ent-kaurenoic acid oxidase [Pyrus communis]
Length=503

 Score =   226 bits (575),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 141/459 (31%), Positives = 243/459 (53%), Gaps = 16/459 (3%)
 Frame = -2

Query  1689  LLRGQTVRSKSCIIPGKLGIPFLGETFSLLSA--TNSTKGCYD-FVRTRRLWHGRWFKTR  1519
             L   Q    +  + PG LG+PF+G  +S L A  +N+ +   D FV   R      +K  
Sbjct  41    LYETQLGERRYSLPPGDLGLPFIGNMWSFLRAFKSNNPESFLDKFVS--RFGKTGIYKAF  98

Query  1518  IFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSD  1339
             +FG   + V + + +K +  +D A F  G+  S  + +GKKS + + +E HKR+RRL + 
Sbjct  99    MFGFPSIIVTTPETSKRVLTDDDA-FKPGWPVSTVELIGKKSFIGISYEEHKRLRRLTAA  157

Query  1338  PFSMN-SLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLL  1162
             P + + +LS++++  + ++   LE+  ++G+    L    K+TF  +  + +S     ++
Sbjct  158   PVNGHEALSVYMKYIEEIVITSLEKWSKLGQ-IEFLTQLRKLTFKIIMYIFLSSESEPVM  216

Query  1161  RRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDED  982
               +ER+ + ++  + +  + +PG  Y+K +KAR  L+  F++I+D RR +   GN   + 
Sbjct  217   EALEREYTVLNYGVRAMAINLPGFAYHKALKARKNLVAIFQSIVDERRAQRKSGNYYVKK  276

Query  981   RDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRL  802
             +D +  +L+ +   +  KL DE+I+D LL  + AG  ++   +MW+   L  N E   R 
Sbjct  277   KDMMDALLDVED-DDGRKLNDEDIIDVLLMYLNAGHESSGHTIMWATVFLQANPEAFQRA  335

Query  801   REEQLSILRNKP---KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEG  631
             + EQ  IL+ +P   KG  +TL++   M Y  +V+ ETLR+    L   R A  + KI G
Sbjct  336   KAEQEEILKRRPPTQKG--LTLKEYREMDYLCQVIDETLRVITFSLTVFREAKKDVKING  393

Query  630   FDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQ-RPYSYIPFGSGPRTCLGINMA  454
             + I KGW V +    IHYD  +Y +P  FNPSR+D    + +S++PFG+G   C G ++A
Sbjct  394   YSIPKGWKVLVWFRSIHYDSELYPNPMEFNPSRWDNFTPKAFSFLPFGAGSHLCPGNDLA  453

Query  453   KVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGC  337
             K+ + ++LH     YK    +P   L    H  R +  C
Sbjct  454   KLEIAIFLHHFLLNYKMERTNPGCPLMYLPHT-RPKDNC  491



>ref|XP_004517250.1| PREDICTED: taxadiene 5-alpha hydroxylase-like [Cicer arietinum]
Length=479

 Score =   225 bits (573),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 135/461 (29%), Positives = 242/461 (52%), Gaps = 20/461 (4%)
 Frame = -2

Query  1683  RGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKI  1504
             + Q+ + K  + PGK+G P +GET    +A    K   +FV  R   HG+ FKTR+ G  
Sbjct  28    KQQSNKDKRKLPPGKMGFPLIGETMQFFNAQRRNKLYEEFVHPRIAKHGKIFKTRLIGSP  87

Query  1503  HVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMN  1324
              V V   D  K + +N+F L    +  S    +GK S++    E H+ +R ++       
Sbjct  88    TVIVNGADANKFLLSNEFKLVKSSWPSSSVHLMGKDSIMEKDGERHRFLRGVIGTSLGYA  147

Query  1323  SLSIFVQKFDRMLCQRL------EEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLL  1162
              L   V K    +   L      +E+  + KS  VL F+  I F+  C + +++  G +L
Sbjct  148   GLESLVPKLCNFVKLYLVKNWHGQEEISLYKSTKVLTFS--IVFE--CLLGINVEQG-ML  202

Query  1161  RRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGN-ESDE  985
                ER    V + + S  +  PG+++++ +KAR  + +    ++  +R+ M  G  E +E
Sbjct  203   DTFER----VLEGVFSPAIKFPGSKFWRAMKARKEIEKMIVKVVREKRKEMEEGRLEREE  258

Query  984   DRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNR  805
             DR  + +++      + E + ++EI+DN++ L+ A   TT+ A+  + K++ ++ +  ++
Sbjct  259   DRMLMSKLVY--GMIQGE-ISEKEIIDNVVLLVFAAHDTTSFAVAMTFKMMAQHPDCYDK  315

Query  804   LREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFD  625
             + +E ++I+RNK  G  + +ED+  M Y  +V +E++R+   +    R A+ + + EGF 
Sbjct  316   VLQEHVNIMRNKRWGESLNIEDIKKMKYTWQVARESMRLFPPIFGSFRKAIIDIEYEGFT  375

Query  624   IKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVT  445
             I KGW V       HY+   +KDP  FNPSRFDE    Y ++PFG GPR C G  +AK+ 
Sbjct  376   IPKGWKVLWTTYGTHYNEKYFKDPLSFNPSRFDEGIGQYVFVPFGGGPRVCAGYQLAKLN  435

Query  444   MLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             +L+ +H + ++Y+WS+  P+ ++     +P    G PI ++
Sbjct  436   ILILVHYVVTQYEWSLLHPNETVTMDP-LPFPSLGMPIKIS  475



>gb|ABK25038.1| unknown [Picea sitchensis]
 gb|ADY68773.1| cytochrome P450 90A20 [Picea sitchensis]
Length=487

 Score =   225 bits (573),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 145/454 (32%), Positives = 231/454 (51%), Gaps = 23/454 (5%)
 Frame = -2

Query  1713  VGIGIAVYLLR---GQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLW  1543
              G+   V  L+   G+  R++  + PG +G P LGET  L++A   T     FV TRR  
Sbjct  17    AGLAFLVLFLQWVFGKGRRTRKGLPPGSMGWPLLGETLQLIAAYK-TSNPEPFVDTRRSR  75

Query  1542  HGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHK  1363
             +G+ FKT +FGK  +F    +  K I  N+  LF   Y  S+ + +GK SLL +    HK
Sbjct  76    YGKVFKTHLFGKPTIFSTDPEVNKFILQNEGKLFATSYPSSITNLLGKHSLLLIQGNLHK  135

Query  1362  RIRRLLSDPFSMNSLSIFVQKFD--RMLCQRLE--EQHRIGKSFTVLDFNMKITFDAMCN  1195
             R+  L +  F+ +S+      FD  +++C  L+  + H +     + D   KITF+    
Sbjct  136   RLHSL-TLSFANSSVLKDHLMFDIEKLVCLTLDGWKDHVL-----LQDEAKKITFELTVK  189

Query  1194  MLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRR  1015
              L+S   G     + ++   + D   S PV +P T Y K +KAR ++ E  + ++  RR 
Sbjct  190   QLLSFDPGQWSENLRKEYLQLIDGFFSLPVPLPFTTYGKALKARAKVAEELRLVLKRRR-  248

Query  1014  RMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKL  835
                  +ES +  D L  +L   S   S+ L D++I+D LL+L++AG  TT+  M  +VK 
Sbjct  249   ----DSESSDHYDMLAALLNEKSTTTSDGLSDDQIIDLLLSLLVAGYETTSTIMTLAVKF  304

Query  834   LDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVA  655
             L E  +   +L+EE  +I + KP    +   D  +M +   V+ ETLR++N++    R A
Sbjct  305   LTETPDALAQLKEEHEAIRKQKPGAQRLEWSDYKSMAFTQCVISETLRIANIISGVFRRA  364

Query  654   LDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYS----YIPFGS  487
             L + +I+GF+I + W V      +H D  +Y D   FNP R+       S    + PFG 
Sbjct  365   LCDVEIKGFNIPQDWLVFPCFRAVHLDQELYSDARKFNPWRWQGNHPSTSSGTVFTPFGG  424

Query  486   GPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPD  385
             GPR C G  +A+V + V+LH + + + W V + D
Sbjct  425   GPRLCPGYELARVEISVFLHHMVTLFSWEVVEED  458



>ref|XP_009347589.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Pyrus x bretschneideri]
Length=503

 Score =   224 bits (572),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 141/459 (31%), Positives = 242/459 (53%), Gaps = 16/459 (3%)
 Frame = -2

Query  1689  LLRGQTVRSKSCIIPGKLGIPFLGETFSLLSA--TNSTKGCYD-FVRTRRLWHGRWFKTR  1519
             L   Q    +  + PG LG+PF+G  +S L A  +N+ +   D FV   R      +K  
Sbjct  41    LYETQLGERRYSLPPGDLGLPFIGNMWSFLRAFKSNNPESFLDKFVS--RFGKTGIYKAF  98

Query  1518  IFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSD  1339
             +FG   + V + + +K +  +D A F  G+  S  + +GKKS + + +E HKR+RRL + 
Sbjct  99    MFGFPSIIVTTPETSKRVLTDDDA-FKPGWPVSTVELIGKKSFIGISYEEHKRLRRLTAA  157

Query  1338  PFSMN-SLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLL  1162
             P + + +LS++++  + ++   LE+  ++G     L    K+TF  +  + +S     ++
Sbjct  158   PVNGHEALSVYMKYIEEIVITSLEKWSKLGH-IEFLTQLRKLTFKIIMYIFLSSESEPVM  216

Query  1161  RRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDED  982
               +ER+ + ++  + +  + +PG  Y+K +KAR  L+  F++I+D RR +   GN   + 
Sbjct  217   EALEREYTVLNYGVRAMAINLPGFAYHKALKARKNLVAIFQSIVDERRAQRKSGNYYLKK  276

Query  981   RDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRL  802
             +D +  +L+ +   +  KL DE+I+D LL  + AG  ++   +MW+   L  N E   R 
Sbjct  277   KDMMDALLDVED-DDGRKLNDEDIIDVLLMYLNAGHESSGHTIMWATVFLQANPEAFQRA  335

Query  801   REEQLSILRNKP---KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEG  631
             + EQ  IL+ +P   KG  +TL++   M Y  +V+ ETLR+    L   R A  + KI G
Sbjct  336   KAEQEEILKRRPPTQKG--LTLKEYREMDYLCQVIDETLRVITFSLTVFREAKKDVKING  393

Query  630   FDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQ-RPYSYIPFGSGPRTCLGINMA  454
             + I KGW V +    IHYD  +Y +P  FNPSR+D    + +S++PFG+G   C G ++A
Sbjct  394   YSIPKGWKVLVWFRSIHYDSELYPNPMEFNPSRWDNFTPKAFSFLPFGAGSHLCPGNDLA  453

Query  453   KVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGC  337
             K+ + ++LH     YK    +P   L    H  R +  C
Sbjct  454   KLEIAIFLHHFLLNYKMERTNPGCPLMYLPHT-RPKDNC  491



>ref|XP_010064128.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Eucalyptus grandis]
Length=350

 Score =   220 bits (561),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 108/291 (37%), Positives = 172/291 (59%), Gaps = 12/291 (4%)
 Frame = -2

Query  1227  NMKITFDAMCNMLMSIT-DGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLM  1051
             N ++T   + +M+MS+   G    +   +   +S +  S    +PGT +++GI+AR R+ 
Sbjct  41    NYQLTLKVIGHMIMSLEPKGEEQEKFRSNFKIISSSFASLSFKVPGTAFHRGIQARDRMY  100

Query  1050  ETFKTIIDSRRRRMGRGNESDEDRDFLQEMLER-----DSFPESEKLEDEEIMDNLLTLI  886
                  +I  RR      N      DFL+ ++ +     D   + +KL D+++ DN+LTL+
Sbjct  101   SMLDNVISKRREGQRFQN------DFLESLIIKHSKAADGEADKDKLTDKQMKDNVLTLL  154

Query  885   IAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVV  706
             +AG  TT AA+ W +K L EN ++  RLREE + I      GA ++  ++N M Y +KV+
Sbjct  155   VAGHNTTTAALTWLMKFLGENPQVLQRLREEHMEIQAKGKGGANLSWSEVNNMPYTAKVI  214

Query  705   KETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFD  526
              ETLR + +L WF R A  + +I+G  I+KGW VN+D   IH+DP ++  P  F+PSRFD
Sbjct  215   SETLRRATILPWFSRKAAQDFEIDGHKIEKGWSVNLDVVSIHHDPEVFPQPEVFDPSRFD  274

Query  525   EMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLE  373
             E  +P+S++ FGSGPR C GIN+AK+ + V++  L  RYKW+  + D S++
Sbjct  275   EPLKPFSFLGFGSGPRMCPGINLAKLEISVFIRHLACRYKWTPLERDDSVQ  325



>ref|XP_010469584.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Camelina sativa]
 ref|XP_010469585.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Camelina sativa]
Length=489

 Score =   224 bits (571),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 144/482 (30%), Positives = 249/482 (52%), Gaps = 28/482 (6%)
 Frame = -2

Query  1731  VFLGLLVGI----GIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDF  1564
             V LGL V      G+ V++   +    K  + PG LG P +G  +S L A   T     F
Sbjct  14    VVLGLFVLKWVLKGVNVWIYESKLGEKKHYLPPGDLGWPVIGNMWSFLRAFK-TSDPESF  72

Query  1563  VRTRRLWHGR--WFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSL  1390
             +R+    +GR   +K  +FG   V V + +  + +  +D A F+ G+ KS    +G++S 
Sbjct  73    IRSYNTRYGRTGIYKAHMFGYPCVLVTTPETCRRVLTDDDA-FHIGWPKSTMKLIGRRSF  131

Query  1389  LCVPHESHKRIRRLLSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKIT  1213
             + +  E HKR+RRL S P +   +LS+++Q  +  +   LE+  ++G+    L    K+T
Sbjct  132   IGISFEEHKRLRRLTSAPVNGPEALSVYIQYIEETVITGLEKWSKMGE-IEFLSHVRKLT  190

Query  1212  FDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTI  1033
             F  + ++ +S     ++  +ER+ + ++  + +  + +PG  Y++ +KAR +L+  F++I
Sbjct  191   FKIIMHIFLSSESEHVMDALEREYTNLNYGVRAMGINLPGFAYHRALKARKKLVAVFQSI  250

Query  1032  IDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAM  853
             + +RR +  + N S   +D L  +++ +       L+DEEI+D LL  + AG  ++   +
Sbjct  251   VTNRRNQREQ-NVSSRRKDMLDNLIDVED-ENGRTLDDEEIIDILLMYLNAGHESSGHLI  308

Query  852   MWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLL  673
             MWS  LL E+ EI  + +EEQ  ILR +  G  +TL++   M Y S+V+ ETLR+    L
Sbjct  309   MWSTILLQEHPEILQKAKEEQERILRKRAPGQKLTLKETREMEYLSQVIDETLRVITFSL  368

Query  672   WFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQ-RPYSYIP  496
                R A  + +I G+ I KGW V      +H DP IY DP  F+PSR+     +  +++P
Sbjct  369   TAFREAKSDVQINGYIIPKGWKVLTWFRDVHLDPEIYPDPKKFDPSRWKGYTPKAGTFLP  428

Query  495   FGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAF  316
             FG G   C G ++AK+ + ++LH    +Y+               + R   GCP+     
Sbjct  429   FGLGSHLCPGNDLAKLEISIFLHHFLLKYR---------------VERSNPGCPVMFLPH  473

Query  315   NQ  310
             N+
Sbjct  474   NR  475



>ref|XP_006418058.1| hypothetical protein EUTSA_v10009356mg [Eutrema salsugineum]
 gb|ESQ36411.1| hypothetical protein EUTSA_v10009356mg [Eutrema salsugineum]
Length=491

 Score =   224 bits (570),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 138/439 (31%), Positives = 240/439 (55%), Gaps = 13/439 (3%)
 Frame = -2

Query  1701  IAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRT--RRLWHGRWF  1528
             + V++       ++  + PG LG PF+G   S L A   T     F RT  +R      +
Sbjct  29    VNVWVYESSLGENRHYLPPGDLGWPFIGNMLSFLRAFK-TSDPDSFTRTLVKRYGPKGMY  87

Query  1527  KTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRL  1348
             K  +FG   + V + D  + +  +D A F  G+  S  + +G+KS + +  E HKR+RRL
Sbjct  88    KAHMFGNPSIIVTTPDTCRRVLTDDDA-FRPGWPTSTMELIGRKSFIGISFEEHKRLRRL  146

Query  1347  LSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDG  1171
              S P +   +LS+++   +  +   L++  +IG+ F  L    K+TF  +  + +S    
Sbjct  147   TSAPVNGHEALSVYIPYIEENVITALDKWTKIGE-FEFLTHLRKLTFRIIMYIFLSTESE  205

Query  1170  SLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNES  991
             +++  +ER+ + ++  + +  V IPG  Y++ +KAR +L+  F++I+  RR +  + N S
Sbjct  206   NVMDALEREYTALNYGVRAMAVNIPGFAYHRALKARKKLVAAFQSIVTERRNQRKQNNSS  265

Query  990   DEDRDFLQEMLE-RDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEI  814
             ++ +D L  +L+ +D   + + L+DEEI+D LL  + AG  ++   +MW+   L E+ E 
Sbjct  266   NK-KDMLDNLLDVKDE--KGKTLDDEEIIDVLLMYLNAGHESSGHTIMWATIFLQEHPEF  322

Query  813   QNRLREEQLSILRNKPKGAL-ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKI  637
               R + EQ  IL+N+PKG   +TL++   M + S+VV ETLR+    L   R A  + ++
Sbjct  323   LQRAKAEQEMILKNRPKGQKGLTLKETRQMEFLSQVVDETLRVITFSLTAFREAKTDVEM  382

Query  636   EGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDE--MQRPYSYIPFGSGPRTCLGI  463
              G+ I KGW V      +H DP IY DP  F+PSR+D+  + +  S++PFG+G   C G 
Sbjct  383   NGYLIPKGWKVLTWFRDVHMDPEIYPDPRKFDPSRWDKGFVPKAGSFLPFGAGSHLCPGN  442

Query  462   NMAKVTMLVYLHRLTSRYK  406
             ++AK+ + V+LH    +Y+
Sbjct  443   DLAKLEISVFLHHFILKYR  461



>ref|XP_010691952.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=488

 Score =   223 bits (569),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 134/452 (30%), Positives = 241/452 (53%), Gaps = 9/452 (2%)
 Frame = -2

Query  1701  IAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGR--WF  1528
             + ++L   +    +  + PG LG+P +G  +S L A  S      F+ +  +  G+   +
Sbjct  27    VNIWLYESKLGVKRHNLPPGDLGLPLIGNMWSFLRAFKSDNPD-SFINSFFIRFGKTGIY  85

Query  1527  KTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRL  1348
             K  +FG   + V + +  + +  ND   F  G+  S A+ +G+KS + + +E HKR+R++
Sbjct  86    KAFMFGSPSIIVTTAETCRKVL-NDDEHFKPGWPLSTAELIGRKSFVSISYEDHKRLRKI  144

Query  1347  LSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDG  1171
              S P +   +L+ +++  + ++   L++  R+G+    L    K+TF  +  + +S    
Sbjct  145   TSAPINGHEALTKYIEYIEDIVITDLDKWSRMGE-IEFLTHLRKLTFRIIMYIFLSSESE  203

Query  1170  SLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNES  991
              ++  +ER+ + ++  + S  + IPG  Y+K  KAR RL+  F++IID RR     G   
Sbjct  204   PVMEALEREYTKLNYGVRSMAINIPGFAYHKARKARKRLVAVFQSIIDERRALKRDGVAI  263

Query  990   DEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQ  811
                +D +  +LE +      KL DEEI+D L+  + AG  ++   +MW+  LL +N E  
Sbjct  264   KAKKDMMDALLEVED-ENRRKLTDEEIIDLLVMYLNAGHESSGHTLMWATVLLQQNPEFM  322

Query  810   NRLREEQLSILRNKPKGAL-ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIE  634
              + + EQ  I++ +P G   +TL++   MTY S+VV ETLR         R A+ + KI 
Sbjct  323   QKAKAEQEDIVKRRPAGQKGLTLKETRQMTYLSQVVDETLRWLTFSFVVFREAISDVKIN  382

Query  633   GFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEM-QRPYSYIPFGSGPRTCLGINM  457
             G+ I +GW V +     H DP I+ +P  FNPSR++++  R  +++PFG+G R C G ++
Sbjct  383   GYTIPQGWKVLVWFRTCHLDPEIWPEPMKFNPSRWNDLVPRAGTFLPFGAGSRLCPGNDL  442

Query  456   AKVTMLVYLHRLTSRYKWSVDDPDPSLERKAH  361
             AK+ +L++LH     Y+    +PD +++   H
Sbjct  443   AKLEILIFLHYFLLNYRLERVNPDCAVQYLPH  474



>ref|XP_010933628.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Elaeis guineensis]
Length=492

 Score =   223 bits (569),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 137/450 (30%), Positives = 234/450 (52%), Gaps = 18/450 (4%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGR---WFKTRIFGKIHVFVPSVDG  1477
             PG +G+PFLGET S L      +   DF+ ++R  +G     +++ +FG   +   S   
Sbjct  55    PGHMGLPFLGETLSFLWYNKILRRPDDFIHSKRNRYGEGVGMYRSYLFGSPTIITCSPAS  114

Query  1476  AKTIF--ANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSM-NSLSIFV  1306
              K +   A DF +   G+     +  G+ S++ V  + H R+R  + D  +  NSL    
Sbjct  115   NKFVLQSAEDFRI---GW--PAPELAGRDSIINVEGKQHARLRGFILDAINQPNSLRRIA  169

Query  1305  QKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSD  1126
             +     +   L+     G    +L+ N K+TF+ +C+M +S+  G  L  I +    +  
Sbjct  170   RMVQPRMVSALQCWAEKGTINALLETN-KVTFENICSMFISMEPGPRLDEIHKYFEGLIA  228

Query  1125  AMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDS  946
                ++P+  PGT ++  ++ R +L    K  ++ R++R    +E+DE+ D +  ++ R  
Sbjct  229   GFRAYPISFPGTPFHHALRCRKKLAAMLKVELEKRKQRK---SETDENNDLMDSLM-RVK  284

Query  945   FPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKP  766
               E ++L D+E++DN++T +I G  +TA AMMW++  + ++ E+  RLREE   I + K 
Sbjct  285   DEEGKQLSDDEVVDNMITFVIGGYKSTALAMMWALYHISKSPEVLQRLREENTVISKRK-  343

Query  765   KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATC  586
             KG  IT+ED++ M Y +KVV+ET+R++N      RVA  +   +GF I KGW V +    
Sbjct  344   KGDFITMEDVSQMKYTAKVVEETIRLANPASSIFRVANRDVDYKGFVIPKGWQVLVWIRS  403

Query  585   IHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYK  406
             +H D   + +P  FNP R++    P +Y  FG GPR C G  +A++ + + LH L   YK
Sbjct  404   LHIDAKNFDNPLSFNPERWNRPPEPGTYQVFGGGPRICAGNMLARLQLTIILHHLALGYK  463

Query  405   WSVDDPDPSLERKAHIPRLRSGCPITLTAF  316
             W + +P   L    + P+   G  +T  A 
Sbjct  464   WELLNPKAKLTYTPY-PKPVDGAAMTFHAL  492



>emb|CBV36747.1| ent-kaurenoic acid oxidase [Helianthus annuus]
 emb|CBV36750.1| ent-kaurenoic acid oxidase [Helianthus annuus]
Length=492

 Score =   223 bits (568),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 141/481 (29%), Positives = 245/481 (51%), Gaps = 26/481 (5%)
 Frame = -2

Query  1722  GLLVGIGIAVYLL--------------RGQTVRSKSCIIPGKLGIPFLGETFSLLSA---  1594
             G +VGI + V L+              R      ++ + PG +G P +G  ++ L A   
Sbjct  10    GFVVGILLGVMLILKWGLKCLNTWINERDLEESKRARLPPGDMGWPLIGNMWTFLRAFKS  69

Query  1593  TNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMA  1414
             +N       FV   R   G  +K+ +FGK  + V   +  + +   D A F  G+  +  
Sbjct  70    SNPDSFISSFVD--RFGSGGMYKSFMFGKPSIIVTVPEACRRVLFEDDA-FKPGWPTATR  126

Query  1413  DAVGKKSLLCVPHESHKRIRRLLSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTV  1237
             + +G+KS + + +E HKR+R+L + P +   +LSI++Q  +  +   LE+  ++G+   V
Sbjct  127   ELIGRKSFVSISYEDHKRLRKLTAAPVNGHEALSIYMQYIESKVVSALEKWSQMGQ-IEV  185

Query  1236  LDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGR  1057
             L    K+TF  +  + +S     +L  +E++ + ++  + +  + IPG  YY  +KAR +
Sbjct  186   LTQLRKLTFQIIMYIFLSSESEDVLEALEKEYTKINYGVRAMAINIPGFVYYSALKARKK  245

Query  1056  LMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAG  877
             L+   +  +  RR++    N+    RD L  +LE +     +KL+DEEI+D L+  + AG
Sbjct  246   LVTILQASVSERRKKREE-NQGMSKRDMLDALLETED-ENGKKLDDEEIIDTLVMYLNAG  303

Query  876   QTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKET  697
               ++    MW+   L  + E     +EEQ  I ++ P G  +TL++   M Y SKV+ ET
Sbjct  304   HESSGHVTMWATIFLQSHPEYFKIAKEEQERIAKDMPPGQGLTLKEFRQMEYLSKVIDET  363

Query  696   LRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEM-  520
             LR+    L   R A  +  I+G+ I KGW+V +    +H++P IY  P  FNPSR+D + 
Sbjct  364   LRLVTFSLMTFREAKKDVDIKGYLIPKGWNVLVWFRSVHHNPDIYPQPKEFNPSRWDNLV  423

Query  519   QRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSG  340
              +P +++PFG+G R C G ++AK+ + ++LH     YK    +P   +    H PR +  
Sbjct  424   PKPGTFLPFGAGTRLCPGNDLAKLEIAIFLHHFLLNYKLERVNPACPMMYLPH-PRPKDN  482

Query  339   C  337
             C
Sbjct  483   C  483



>ref|XP_008356451.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Malus domestica]
Length=493

 Score =   223 bits (568),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 144/478 (30%), Positives = 240/478 (50%), Gaps = 19/478 (4%)
 Frame = -2

Query  1731  VFLGLLVGIGIAVYLLRGQT----VR----SKSCIIPGKLGIPFLGETFSLLSATNSTKG  1576
             VF   + G G  + +L+       VR    +K  + PG LG PF+G T S + A  S   
Sbjct  10    VFTASVGGFGALLLILKKANEWLFVRKLGENKHTLPPGDLGWPFIGNTLSFIKALKSDHP  69

Query  1575  -CYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGK  1399
               +     +R      +K  +FGK  + V + +  K +  +    F  G+ KS ++ +G+
Sbjct  70    ESFISNHVKRFGSTGIYKACLFGKPTIIVTTAETCKQVLMDSLQ-FKTGWPKSTSELMGR  128

Query  1398  KSLLCVPHESHKRIRRLLSDPFSMN-SLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNM  1222
             KS + +  E HKR+R+L + P S + +LS++ +    ++   L+E     K    L    
Sbjct  129   KSFMSLSGEEHKRLRKLTAAPISGHKALSMYHEYIKDVIVSSLDELAEAEKPVEFLTEIR  188

Query  1221  KITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETF  1042
             KITF  +  + +S   G+ L  +E++ + ++  + +  + +PG  ++K +KAR R+++  
Sbjct  189   KITFRIIMFIFLSCEVGTPLETMEKEYAIMNHGLRAMAINLPGFAFHKALKARRRMVKII  248

Query  1041  KTIIDSRRRRMGRGNESD--EDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTT  868
             + I+D RR R    NE+    +R  L +ML         KL+DEEI+D +L  + AG  +
Sbjct  249   QGILDGRRAR----NEAQISRERTDLTDMLMETEDENGNKLDDEEIIDIVLMYLNAGHES  304

Query  867   TAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRM  688
             TA A +W+   L EN E   + + EQL IL+       +  +    M Y SKV+ ETLR+
Sbjct  305   TAHATLWATLFLHENPEYYQKAKAEQLEILKTASPEEGLNFKGTKQMEYLSKVIDETLRI  364

Query  687   SNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFD-EMQRP  511
              NV L+  R A  + K+ G+ I +GW V +    +H +P  Y DP  FNPSR++    + 
Sbjct  365   VNVSLYSYREAATDVKVSGYTIPRGWKVMMWYRGVHLNPEYYPDPKKFNPSRWNGSNAKA  424

Query  510   YSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGC  337
              S+IPFG G R C G ++ K+ + ++LH     Y+    +P   +    H PR +  C
Sbjct  425   RSFIPFGIGSRLCPGSDLTKLEITIFLHYFLLNYELERLNPAIGVSYLPH-PRPKDNC  481



>emb|CDY49505.1| BnaC05g03170D [Brassica napus]
Length=490

 Score =   222 bits (566),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 134/438 (31%), Positives = 238/438 (54%), Gaps = 11/438 (3%)
 Frame = -2

Query  1701  IAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRT--RRLWHGRWF  1528
             + V+L       +K  + PG LG PF+G   S L A   T     F RT  +R      +
Sbjct  29    VNVWLYESSLGENKHYLPPGDLGWPFIGNMPSFLRAFK-TSDPDSFARTLVQRYGPKGVY  87

Query  1527  KTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRL  1348
             KT +FG   + V + D  + +  +D A F  G+  S  + +G+KS + +P+E HKR+RRL
Sbjct  88    KTHMFGNPSIIVTTPDTCRRVLTDDDA-FRPGWPTSTMELIGRKSFIGIPYEEHKRLRRL  146

Query  1347  LSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDG  1171
              + P +   +LS+++   +  +   L++  ++G+ F  L    K+TF  +  + +S    
Sbjct  147   TAAPVNGHEALSLYIPYIEENVITALDKWSKMGE-FEFLTHLRKLTFRIIMYIFLSTESE  205

Query  1170  SLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNES  991
             +++  +ER+ + ++  + +  V IPG  Y++ +KAR +L+  F++I+ + RR   + N S
Sbjct  206   NVMDALEREYTALNYGVRAMAVNIPGFAYHRALKARKKLVAAFQSIV-TERRNQRKQNSS  264

Query  990   DEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQ  811
                +D L  +++ +     + L+DEEI+D LL  + AG  ++   +MW+   L E+ E  
Sbjct  265   SNKKDMLDNLIDVED-ENGKTLDDEEIVDVLLMYLNAGHESSGHTIMWATIFLQEHPEFL  323

Query  810   NRLREEQLSILRNKPKGAL-ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIE  634
              R + EQ  IL N+PKG   +TL++   M + S+VV ETLR+    L   R A  + ++ 
Sbjct  324   QRAKAEQEMILENRPKGQKGLTLKETRQMEFLSQVVDETLRVITFSLTAFREAKTDVEMN  383

Query  633   GFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDE--MQRPYSYIPFGSGPRTCLGIN  460
             G+ I KGW V      +H DP ++ DP  F+PSR+D+  + +  +++PFG+G   C G +
Sbjct  384   GYLIPKGWKVLTWFRDVHMDPEVFPDPRKFDPSRWDKGFIPKAGAFLPFGAGSHLCPGND  443

Query  459   MAKVTMLVYLHRLTSRYK  406
             +AK+ + ++LH    +Y+
Sbjct  444   LAKLEISIFLHHFLLKYR  461



>ref|XP_007141387.1| hypothetical protein PHAVU_008G191000g [Phaseolus vulgaris]
 gb|ESW13381.1| hypothetical protein PHAVU_008G191000g [Phaseolus vulgaris]
Length=478

 Score =   222 bits (565),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 132/471 (28%), Positives = 244/471 (52%), Gaps = 28/471 (6%)
 Frame = -2

Query  1701  IAVYLLRGQT-VRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFK  1525
             ++ + LR +   + K  + PG++G+P +GET    +A    K   +F   R L HG+ F+
Sbjct  21    VSFHFLRHEHRCKDKRKLPPGEMGLPLIGETMEFFNAQRRNKLYEEFFHPRILKHGKIFR  80

Query  1524  TRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLL  1345
             TRI G   V V   +  K + +N+F L    +  S  + +G+ S++    E H+ +R ++
Sbjct  81    TRIMGSPTVVVNGAEANKFLLSNEFKLVKSSWPSSSVELMGRDSIMEKDGERHRFLRGVI  140

Query  1344  SDPFSMNSLSIFVQKFDRMLCQRLE----------EQHRIGKSFTVLDFNMKITFDAMCN  1195
                     L + V K    LC  ++          +  RI +S  VL F+  I F+  C 
Sbjct  141   GTSLGYAGLELLVPK----LCNSVQFHLATNWKGKKNLRIHRSTKVLSFS--IVFE--CL  192

Query  1194  MLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRR  1015
             + + +  G +L   ER    V + + S  VM PG+++++  KAR  + +    ++  +R 
Sbjct  193   LGIKVEPG-MLDTFER----VLEGVFSPAVMFPGSKFWRAKKARVEIEKMLVKVVREKRE  247

Query  1014  RMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKL  835
              M R  E ++D   L +++   S     ++ ++E++DN++ L+ A   TT+ A+  + K+
Sbjct  248   EMERSLEREQDGMLLSKLV---SGMIQGEISEKEVIDNVVLLVFAAHDTTSFAVAMTFKM  304

Query  834   LDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVA  655
             L ++ +   ++ +E + I+ NK +G  +T+ED+  M Y  +V +E++R+   +    R A
Sbjct  305   LSQHPDCYGKILQEHVGIMSNKTRGENLTMEDIKKMKYTWQVARESMRLFPPIFGSFRKA  364

Query  654   LDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRT  475
             + + + EGF I +GW V       HY+   +KDP  F PSRF+E    Y+++PFG GPR 
Sbjct  365   ITDIEYEGFIIPRGWKVLWTTYGTHYNEEYFKDPMSFKPSRFEEGVAQYAFVPFGGGPRV  424

Query  474   CLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             C G  +AK+ +L+++H + ++Y+W +  PD  +     +P    G PI ++
Sbjct  425   CAGYQLAKLNILIFVHYVVTQYEWFLLHPDEPVTMDP-LPFPSLGMPIRIS  474



>ref|XP_003617455.1| Taxane 13-alpha-hydroxylase [Medicago truncatula]
 gb|AET00414.1| cytochrome P450 family protein [Medicago truncatula]
Length=479

 Score =   221 bits (564),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 127/456 (28%), Positives = 234/456 (51%), Gaps = 10/456 (2%)
 Frame = -2

Query  1683  RGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKI  1504
             + Q  + K  + PG++G P +GET    +A    K   DFV  R   HG+ FKTRI G  
Sbjct  28    KQQNNKDKRKLPPGEMGFPLIGETMEFFNAQRRNKLYEDFVHPRITKHGKIFKTRIIGSP  87

Query  1503  HVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMN  1324
              V V   +  K I +N+F L    +  S    +GK S++    E H+ +R ++   F   
Sbjct  88    TVIVNGAEANKFILSNEFKLVKSSWPSSSVHLMGKDSIMEKDGERHRFLRGVIGTSFGYA  147

Query  1323  SLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSI-TDGSLLRRIER  1147
              L   V K    +   L +  +  +  ++      +TF  +   L+ I  +  ++   ER
Sbjct  148   GLETLVPKLCNFVKLYLSKNWQGQEEISLYRSTKVLTFSIVFECLLGINVEPGMVDTFER  207

Query  1146  DCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGN-ESDEDRDFL  970
                 V + + S  +  PG+++++ +KAR  + +    ++  +R+ +  G  + +EDR  +
Sbjct  208   ----VLEGVFSPAIKFPGSKFWRAMKARKEIEKMIVKVVREKRKEIEEGKLKREEDRMLM  263

Query  969   QEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQ  790
              +++      + E + ++EI+DN++ L+ A   TT+ A+  + K+L ++     ++ +E 
Sbjct  264   SKLVY--GMIQGE-ITEKEIIDNVVLLVFAAHDTTSFAVAMTFKMLAQHPHCYGKVLQEH  320

Query  789   LSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGW  610
             + I+ +K +G  + +ED+  M Y  +V +E++R+   +    R A+ + + EGF I KGW
Sbjct  321   VDIMNDKRRGESLNVEDIKKMKYTWQVARESMRLFPPIFGSFRKAITDIEYEGFTIPKGW  380

Query  609   HVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYL  430
              V       HY+   +KDPT F PSRF+E    Y+++PFG GPR C G  +AK+ +L+ +
Sbjct  381   KVLWTTYGTHYNEEYFKDPTSFKPSRFEEGIAQYAFVPFGGGPRVCAGYQLAKLNILILV  440

Query  429   HRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             H + ++Y+WS+  PD ++     +P    G PI ++
Sbjct  441   HYVVTQYEWSLLHPDETVTMDP-LPFPSLGMPIRIS  475



>ref|XP_009119194.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Brassica rapa]
 ref|XP_009119195.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Brassica rapa]
 ref|XP_009119196.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Brassica rapa]
 emb|CDY46834.1| BnaA10g03180D [Brassica napus]
Length=490

 Score =   221 bits (564),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 133/438 (30%), Positives = 238/438 (54%), Gaps = 11/438 (3%)
 Frame = -2

Query  1701  IAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRT--RRLWHGRWF  1528
             + V+L       +K  + PG +G PF+G   S L A   T     F RT  +R      +
Sbjct  29    VNVWLYESSLGENKHYLPPGDMGWPFIGNMPSFLRAFK-TSDPDSFARTLVKRYGPKGVY  87

Query  1527  KTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRL  1348
             KT +FG   + V + D  + +  +D A F  G+  S  + +G+KS + +P+E HKR+RRL
Sbjct  88    KTHMFGNPSIIVTTPDTCRRVLTDDDA-FRPGWPTSTMELIGRKSFIGIPYEEHKRLRRL  146

Query  1347  LSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDG  1171
              + P +   +LS+++   +  +   L++  ++G+ F  L    K+TF  +  + +S    
Sbjct  147   TAAPVNGHEALSLYIPYIEENVITALDKWSKMGE-FEFLTHLRKLTFRIIMYIFLSTESE  205

Query  1170  SLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNES  991
             +++  +ER+ + ++  + +  V IPG  Y++ +KAR +L+  F++I+ + RR   + N S
Sbjct  206   NVMDALEREYTALNYGVRAMAVNIPGFAYHRALKARKKLVAAFQSIV-TERRNQRKQNSS  264

Query  990   DEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQ  811
                +D L  +++ +     + L+DEEI+D LL  + AG  ++   +MW+   L E+ E  
Sbjct  265   SNKKDMLDNLIDVED-ENGKTLDDEEIIDVLLMYLNAGHESSGHTIMWATIFLQEHPEFL  323

Query  810   NRLREEQLSILRNKPKGAL-ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIE  634
              R + EQ  IL N+PKG   +TL++   M + S+VV ETLR+    L   R A  + ++ 
Sbjct  324   QRAKAEQEMILENRPKGQKGLTLKETRQMEFLSQVVDETLRVITFSLTAFREAKTDVEMN  383

Query  633   GFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDE--MQRPYSYIPFGSGPRTCLGIN  460
             G+ I KGW V      +H DP ++ DP  F+PSR+D+  + +  +++PFG+G   C G +
Sbjct  384   GYLIPKGWKVLTWFRDVHMDPEVFPDPRKFDPSRWDKGFIPKAGAFLPFGAGSHLCPGND  443

Query  459   MAKVTMLVYLHRLTSRYK  406
             +AK+ + ++LH    +Y+
Sbjct  444   LAKLEISIFLHHFLLKYR  461



>gb|AHF49536.1| CYP450 716-like protein (mitochondrion) [Ginkgo biloba]
Length=485

 Score =   221 bits (563),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 148/477 (31%), Positives = 225/477 (47%), Gaps = 13/477 (3%)
 Frame = -2

Query  1719  LLVGIGIAVYLLRGQTVRSKS-CIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLW  1543
             L +G  + +   R Q  R +     PG  G+P +GET   L    S K   +F  TR   
Sbjct  17    LFLGFLLVISAFRYQYGRGRGRNAPPGTFGLPLIGETLEFLGCQRSGKPA-EFFDTRINK  75

Query  1542  HGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGK---KSLLCVPHE  1372
             +G  FKT I G       S  G + +F+N+    NK  V S   +VGK   KS+L    +
Sbjct  76    YGEIFKTSIVGHPTAMFCSPAGNRLLFSNE----NKLVVSSWPSSVGKLFGKSILTATGD  131

Query  1371  SHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNM  1192
               KR+RR+L       +L  FV + D +  + L ++    +   V       TF   CN+
Sbjct  132   EAKRLRRMLMMFLRPEALQTFVGRVDLIARRHLADEWIGKEEVRVFPLMEHYTFSLACNL  191

Query  1191  LMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRR  1012
               S+ D   + ++      +   +L  P+ +PGTRY K   A   +    ++IID RR  
Sbjct  192   FASVDDEGEIAKLSHHFMVLLKGVLQIPIDLPGTRYNKAKHAASAIRRELQSIIDHRRIA  251

Query  1011  MGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLL  832
             +  GN S E +D +  +L      E + L DEEI DN+L L  A   T++A +   +K L
Sbjct  252   LAHGNASLE-QDLMSYLLSNVD-EEGKSLTDEEIKDNILQLFFASHDTSSATLTLLLKYL  309

Query  831   DENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVAL  652
              E+ +   R+ +EQL I  +K  G L+  E+L  M Y+ +  +ETLRM+  +    R A+
Sbjct  310   AEHPDCYERILKEQLEIAGSKAGGQLLEWEELQKMKYSWRAAQETLRMTPPVQGSFREAI  369

Query  651   DNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEM-QRPYSYIPFGSGPRT  475
              +    GF I +GW         H     ++DP  F+PSRF+     PY+++PFG G R 
Sbjct  370   TDFTYGGFTIPRGWKCYWTVNSTHKKAEYFEDPEKFDPSRFEGAGPAPYTFVPFGGGHRM  429

Query  474   CLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFNQGD  304
             C G   A++ MLV+LH +   +KW + D D  +     +P   +G PI L      D
Sbjct  430   CPGNEFARMEMLVFLHNIAKSFKWELVDKDEKISVDP-MPAPVNGLPIKLHHLESRD  485



>sp|Q50EK1.1|C16B1_PICSI RecName: Full=Cytochrome P450 716B1; AltName: Full=Cytochrome 
P450 CYPA1 [Picea sitchensis]
 gb|AAX07436.1| cytochrome P450 CYPA1 [Picea sitchensis]
Length=493

 Score =   221 bits (564),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 148/479 (31%), Positives = 230/479 (48%), Gaps = 18/479 (4%)
 Frame = -2

Query  1737  YDVFLGLLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVR  1558
             + VFL   +G+    YL+     ++   I PG  G P +GET   L          DF  
Sbjct  23    FTVFLASFIGLAFFFYLISNHRTKAWRGIPPGTFGWPLIGETLEFLGCQRKGN-PRDFFD  81

Query  1557  TRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVG---KKSLL  1387
             +R   +G  F T + G   V   S +G + +F+N+    NK  V S   +VG   + SL+
Sbjct  82    SRTQKYGNVFTTSLVGHPTVVFCSPEGNRFLFSNE----NKLVVNSWPSSVGNLFRSSLI  137

Query  1386  CVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGK-SFTVLDFNMKITF  1210
                 +  KR+RR+L       +L  FV + D M  + L E H IGK     L    + TF
Sbjct  138   TTVGDDAKRLRRILMTFLRPEALREFVGRVDSMTKRHLAE-HWIGKDEVMALPLLKRYTF  196

Query  1209  DAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTII  1030
                C++  SI     L R+          ++  P+ +PGTRY K   A   + +   +II
Sbjct  197   SLACDLFASINTKDDLDRLWLHFMVFVKGVMQIPIDLPGTRYNKTKHAANAIRQQLGSII  256

Query  1029  DSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMM  850
             + R+  +  GN S E +D L  +L      + E L D EI DN+L L+ AG  T+++ + 
Sbjct  257   NERKIALEAGNASPE-QDLLSFLLSNVD-EQGESLTDNEIQDNILLLLYAGHDTSSSTLT  314

Query  849   WSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLW  670
               +K L EN      +  EQL+I  +K +G L+  EDL  M Y+ +V +E LR+   +  
Sbjct  315   VLLKFLAENPHCYEEVLREQLNIAGSKEEGQLLEWEDLQRMKYSWRVAQEALRLFPAVQG  374

Query  669   FPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFD-EMQRPYSYIPF  493
               R A+     +GF I KGW ++      H     + +P  F+PSRF+ E   PY+++PF
Sbjct  375   SFRKAIKEFIYDGFTIPKGWKLHWTVNSTHQKSEYFSNPEKFDPSRFEGEGPPPYTFVPF  434

Query  492   GSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKA--HIPRLRSGCPITLT  322
             G GPR C G   A++ +L++LH +   + W++ +P   LE+     +P   +G PI L 
Sbjct  435   GGGPRMCPGNEFARMEILIFLHNIVKNFNWNLVNP---LEKVIVDPMPAPVNGLPIKLV  490



>emb|CBV36749.1| ent-kaurenoic acid oxidase [Helianthus annuus]
 emb|CBV36751.1| ent-kaurenoic acid oxidase [Helianthus annuus]
Length=481

 Score =   221 bits (562),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 136/458 (30%), Positives = 237/458 (52%), Gaps = 25/458 (5%)
 Frame = -2

Query  1722  GLLVGIGIAVYLL--------------RGQTVRSKSCIIPGKLGIPFLGETFSLLSA---  1594
             G +VGI + V L+              R      ++ + PG +G P +G  ++ L A   
Sbjct  10    GFVVGILLGVMLILKWGLKCLNTWINERDLEESKRARLPPGDMGWPLIGNMWTFLRAFKS  69

Query  1593  TNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMA  1414
             +N       FV   R   G  +K+ +FGK  + V   +  + +   D A F  G+  +  
Sbjct  70    SNPDSFISSFVD--RFGSGGMYKSFMFGKPSIIVTVPEACRRVLFEDDA-FKPGWPTATR  126

Query  1413  DAVGKKSLLCVPHESHKRIRRLLSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTV  1237
             + +G+KS + + +E HKR+R+L + P +   +LSI++Q  +  +   LE+  ++G+   V
Sbjct  127   ELIGRKSFVSISYEDHKRLRKLTAAPVNGHEALSIYMQYIESKVVSALEKWSQMGQ-IEV  185

Query  1236  LDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGR  1057
             L    K+TF  +  + +S     +L  +E++ + ++  + +  + IPG  YY  +KAR +
Sbjct  186   LTQLRKLTFQIIMYIFLSSESEDVLEALEKEYTKINYGVRAMAINIPGFVYYSALKARKK  245

Query  1056  LMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAG  877
             L+   +  +  RR++    N+    RD L  +LE +     +KL+DEEI+D L+  + AG
Sbjct  246   LVTILQASVSERRKKREE-NQGMSKRDMLDALLETED-ENGKKLDDEEIIDTLVMYLNAG  303

Query  876   QTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKET  697
               ++    MW+   L  + E     +EEQ  I ++ P G  +TL++   M Y SKV+ ET
Sbjct  304   HESSGHVTMWATIFLQSHPEYFKIAKEEQERIAKDMPPGQGLTLKEFRQMEYLSKVIDET  363

Query  696   LRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEM-  520
             LR+    L   R A  +  I+G+ I KGW+V +    +H++P IY  P  FNPSR+D + 
Sbjct  364   LRLVTFSLMTFREAKKDVDIKGYLIPKGWNVLVWFRSVHHNPDIYPQPKEFNPSRWDNLV  423

Query  519   QRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYK  406
              +P +++PFG+G R C G ++AK+ + ++LH     YK
Sbjct  424   PKPGTFLPFGAGTRLCPGNDLAKLEIAIFLHHFLLNYK  461



>sp|Q50EK0.1|C16B2_PICSI RecName: Full=Cytochrome P450 716B2; AltName: Full=Cytochrome 
P450 CYPA2 [Picea sitchensis]
 gb|AAX07437.1| cytochrome P450 CYPA2 [Picea sitchensis]
Length=497

 Score =   221 bits (562),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 149/477 (31%), Positives = 226/477 (47%), Gaps = 14/477 (3%)
 Frame = -2

Query  1737  YDVFLGLLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVR  1558
             + VFL   +G+    YL+     ++   I PG  G P +GET   L          DF  
Sbjct  23    FTVFLASFIGLAFFFYLISNHRTKAWRGIPPGTFGWPLIGETLEFLGCQRKGN-PRDFFD  81

Query  1557  TRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVG---KKSLL  1387
             +R   +G  F T + G   V   S +G + +F+N+    NK  V S   +VG   + SL+
Sbjct  82    SRTQKYGNVFTTSLVGHPTVVFCSPEGNRFLFSNE----NKLVVNSWPSSVGNLFRSSLI  137

Query  1386  CVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGK-SFTVLDFNMKITF  1210
                 +  KR+RR+L       +L  FV + D M  + L E H IGK   T L    + TF
Sbjct  138   TTVGDDAKRLRRILMTFLRPEALREFVGRVDSMTKRHLAE-HWIGKDEVTALPLLKRYTF  196

Query  1209  DAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTII  1030
                C++  SI +   L R+          ++  P+ +PGTRY K   A   + +   +II
Sbjct  197   SLACDLFASINNKDDLGRLWLHFMVFVKGVMQIPIDLPGTRYNKAKHAANAIRQQLGSII  256

Query  1029  DSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMM  850
             + R+  +  GN S E +D L  +L      + E L D EI DN+L L+ AG  T+++ + 
Sbjct  257   NERKIGLEAGNASPE-QDLLSFLLSNVD-EQGESLTDNEIQDNILLLLYAGHDTSSSTLT  314

Query  849   WSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLW  670
               +K L EN      +  EQL I  +K  G L+  EDL  M Y+ +V +E LR+      
Sbjct  315   VLLKFLAENPHCYEEVLREQLDIAGSKEAGQLLEWEDLQRMKYSWRVAQEALRLFPAAQG  374

Query  669   FPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFD-EMQRPYSYIPF  493
               R A+     +GF I KGW +       H     + +P  F+PSRF+ E   PY+++PF
Sbjct  375   SFRKAIKEFIYDGFTIPKGWKMYWTVNSTHRKSEYFSNPETFDPSRFEGEGPPPYTFVPF  434

Query  492   GSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             G GPR C G   A++ +LV+LH +    KW++ +P   +     +P   +G PI L 
Sbjct  435   GGGPRMCPGNEFARLEILVFLHNIVKNCKWNLVNPGEKVIVDP-MPAPVNGLPIKLV  490



>emb|CDY48265.1| BnaA05g10890D [Brassica napus]
Length=489

 Score =   221 bits (562),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 135/461 (29%), Positives = 234/461 (51%), Gaps = 24/461 (5%)
 Frame = -2

Query  1701  IAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRT--RRLWHGRWF  1528
             + V++   +    +  + PG LG PF+G     L A   T     F+RT   R  H   +
Sbjct  28    VNVWIYESKLGEKRHYLPPGDLGWPFIGNMLPFLRAFK-TSDPDSFIRTYITRYGHNGVY  86

Query  1527  KTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRL  1348
             K  +FG   V V + +  + +  +D   F  G+ KS  + +GKKS + +  E HKR+RRL
Sbjct  87    KVHMFGNPSVIVTTPETCRKVLTDD-DCFQPGWPKSTMELIGKKSFIGISFEEHKRLRRL  145

Query  1347  LSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDG  1171
              + P +   +LS++++  +  +   LE   ++G+    L    K+TF  +  + MS    
Sbjct  146   TAAPVNGHEALSVYIKYIEETVVTALENWSKMGE-IEFLTHVRKLTFRIIMYIFMSTESE  204

Query  1170  SLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNES  991
              ++  +ER+ + ++  + +  + IPG  Y+K +KAR +L+  F++ + +RR +  + N S
Sbjct  205   HVMDALEREYTNLNYGVRAMAINIPGFAYHKALKARKKLVAAFQSSVTNRRNQR-KQNVS  263

Query  990   DEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQ  811
                +D L  ++E         LEDEEI+D LL  + AG  ++   +MW+   L E+ EI 
Sbjct  264   TNKKDMLDNLIEAKD-ENGRTLEDEEIIDVLLMYLNAGHESSGHTIMWATIFLQEHPEIL  322

Query  810   NRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEG  631
              + +EEQ  I++ +  G  +TL++   M Y S+V+ ETLR+    L   R A  + ++ G
Sbjct  323   QKAKEEQERIVKKRAPGQSLTLKETREMEYLSQVIDETLRVITFSLTAFREAKSDVQMNG  382

Query  630   FDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQ-RPYSYIPFGSGPRTCLGINMA  454
             + I KGW V      +H DP IY DP  F+PSR++    +  +++PFG G   C G ++A
Sbjct  383   YIIPKGWKVLTWFRDVHLDPEIYPDPKKFDPSRWEGYTPKAGTFLPFGLGSHLCPGNDLA  442

Query  453   KVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPI  331
             K+ + ++LH    +Y+               + R   GCP+
Sbjct  443   KLEISIFLHHFLLKYR---------------VERSNPGCPV  468



>ref|XP_009143990.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Brassica rapa]
 ref|XP_009143991.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Brassica rapa]
 ref|XP_009143992.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Brassica rapa]
 ref|XP_009143993.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Brassica rapa]
 ref|XP_009143994.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Brassica rapa]
Length=489

 Score =   220 bits (561),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 135/461 (29%), Positives = 234/461 (51%), Gaps = 24/461 (5%)
 Frame = -2

Query  1701  IAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRT--RRLWHGRWF  1528
             + V++   +    +  + PG LG PF+G     L A   T     F+RT   R  H   +
Sbjct  28    VNVWIYESKLGEKRHYLPPGDLGWPFIGNMLPFLRAFK-TSDPDSFIRTYITRYGHNGVY  86

Query  1527  KTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRL  1348
             K  +FG   V V + +  + +  +D   F  G+ KS  + +GKKS + +  E HKR+RRL
Sbjct  87    KVHMFGNPSVIVTTPETCRKVLTDD-DCFQPGWPKSTMELIGKKSFIGISFEEHKRLRRL  145

Query  1347  LSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDG  1171
              + P +   +LS++++  +  +   LE   ++G+    L    K+TF  +  + MS    
Sbjct  146   TAAPVNGHEALSVYIKYIEETVVTALENWSKMGE-IEFLTHVRKLTFRIIMYIFMSTESE  204

Query  1170  SLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNES  991
              ++  +ER+ + ++  + +  + IPG  Y+K +KAR +L+  F++ + +RR +  + N S
Sbjct  205   HVMDALEREYTNLNYGVRAMAINIPGFAYHKALKARKKLVAAFQSSVTNRRNQR-KQNVS  263

Query  990   DEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQ  811
                +D L  ++E         LEDEEI+D LL  + AG  ++   +MW+   L E+ EI 
Sbjct  264   TNKKDMLDNLIEAKD-ENGRTLEDEEIIDVLLMYLNAGHESSGHTIMWATIFLQEHPEIL  322

Query  810   NRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEG  631
              + +EEQ  I++ +  G  +TL++   M Y S+V+ ETLR+    L   R A  + ++ G
Sbjct  323   QKAKEEQERIVKKRAPGQSLTLKETREMEYLSQVIDETLRVITFSLTAFREAKSDVQMNG  382

Query  630   FDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQ-RPYSYIPFGSGPRTCLGINMA  454
             + I KGW V      +H DP IY DP  F+PSR++    +  +++PFG G   C G ++A
Sbjct  383   YIIPKGWKVLTWFRDVHLDPEIYPDPKKFDPSRWEGYTPKAGTFLPFGLGSHLCPGNDLA  442

Query  453   KVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPI  331
             K+ + ++LH    +Y+               + R   GCP+
Sbjct  443   KLEISIFLHHFLLKYR---------------VERSNPGCPV  468



>ref|XP_011010024.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X2 [Populus 
euphratica]
 ref|XP_011010025.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X2 [Populus 
euphratica]
Length=493

 Score =   220 bits (561),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 138/470 (29%), Positives = 243/470 (52%), Gaps = 17/470 (4%)
 Frame = -2

Query  1755  MVSHYYYDVFLGLLVGIGIAVYLLR--------GQTVRSKSCIIPGKLGIPFLGETFSLL  1600
             M S   + V   +  G+G+  ++L+         +    +  + PG LG PF+G  +S L
Sbjct  1     MESGSIWVVLAVMFGGLGVGKWILKKVNWWWYEAELGEKQYSLPPGDLGWPFIGNMWSFL  60

Query  1599  SATNSTKGCYDFVRT--RRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYV  1426
              A   +     F+RT   +  H   +K  +FG   +FV + +  + + +ND A F  G+ 
Sbjct  61    RAFKFSDPD-SFMRTFINKYGHNGIYKAFMFGNPSIFVTTPEACRKVLSNDDA-FKPGWP  118

Query  1425  KSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMN-SLSIFVQKFDRMLCQRLEEQHRIGK  1249
              S    VG+KS + + +E HK +RRL S P + + +LS ++   +      LE+   +GK
Sbjct  119   ISTLKLVGRKSFIGISYEEHKHLRRLTSAPVNGHEALSAYIPYIEENAIAMLEKWTTMGK  178

Query  1248  SFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIK  1069
                 L    K+TF  +  + +S     ++  +E+D +T++  + +  + +PG  YYK +K
Sbjct  179   -IEFLTQVRKLTFRIIMYIFLSSESEVVMEALEKDYTTLNYGVRAMAINLPGFAYYKALK  237

Query  1068  ARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTL  889
             AR RL+  F++I++ RR     G  + + +D +  +L  +      KL DEEI+D +L  
Sbjct  238   ARKRLVAVFQSIVNERRNLRKNGALNAKKKDMMDSLLGVED-ENGRKLTDEEIIDVILMY  296

Query  888   IIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNK-PKGALITLEDLNTMTYASK  712
             + AG  ++     W+   L E+ +   + +EEQ  I++ + P    ++L+++  M Y SK
Sbjct  297   LNAGHESSGHITTWATIFLQEHPKFLQKAKEEQEQIVKRRLPAQKGLSLKEVREMDYLSK  356

Query  711   VVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSR  532
             V+ ETLR+    L   R A  +  I G+ I KGW V +    +H DP IY +P  FNPSR
Sbjct  357   VIDETLRLITFSLTVFREAKTDFSINGYIIPKGWKVLVWFRTVHLDPEIYPNPKEFNPSR  416

Query  531   FDEMQ-RPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPD  385
             +D    +P +++PFG+G R C G ++AK+ + ++LH     Y+   ++P+
Sbjct  417   WDNYTPKPGTFLPFGAGSRLCPGNDLAKLEISIFLHYFLLDYRLGRENPE  466



>ref|XP_010413993.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Camelina sativa]
 ref|XP_010413994.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Camelina sativa]
Length=492

 Score =   220 bits (560),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 138/468 (29%), Positives = 242/468 (52%), Gaps = 24/468 (5%)
 Frame = -2

Query  1701  IAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGR--WF  1528
             + V++   +    K  + PG LG P +G  +S L A   T     F+R+    +GR   +
Sbjct  31    VNVWIYESKLGEKKHYLPPGDLGWPVIGNMWSFLRAFK-TSDPESFIRSYNTRYGRTGIY  89

Query  1527  KTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRL  1348
             K  +FG   V V + +  + +  +D A F+ G+ KS    +G++S + +  E HKR+RRL
Sbjct  90    KAHMFGYPCVLVTTPETCRRVLTDDDA-FHIGWPKSTMKLIGRRSFIGISFEEHKRLRRL  148

Query  1347  LSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDG  1171
              S P +   +LS+++Q  +  +   LE+   +G+    L    K+TF  + ++ +S    
Sbjct  149   TSAPVNGTEALSVYIQFIEETVITDLEKWSNMGE-IEFLSHVRKLTFKIIMHIFLSSESE  207

Query  1170  SLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNES  991
              ++  +ER+ + ++  + +  + +PG  Y++ +KAR +L+  F++I+ +RR +  + N S
Sbjct  208   HVMDALEREYTNLNYGVRAMGINLPGFAYHRALKARKKLVAVFQSIVTNRRNQREQ-NVS  266

Query  990   DEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQ  811
                +D L  +++ +       L+DEEI+D LL  + AG  ++   +MWS  LL E+ EI 
Sbjct  267   SRRKDMLDNLIDVED-ENGRTLDDEEIIDILLMYLNAGHESSGHLIMWSTILLQEHPEIL  325

Query  810   NRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEG  631
              + +EEQ  ILR +  G  +TL++   M Y S+V+ ETLR+    L   R A  + +I G
Sbjct  326   QKAKEEQERILRKRAPGQKLTLKETREMEYLSQVIDETLRVITFSLTAFREAKSDLQING  385

Query  630   FDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQ-RPYSYIPFGSGPRTCLGINMA  454
             + I KGW V      +H DP IY DP  F+PSR+     +  +++PFG G   C G ++A
Sbjct  386   YIIPKGWKVLTWFRDVHLDPEIYPDPKKFDPSRWKGYTPKAGTFLPFGLGSHLCPGNDLA  445

Query  453   KVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFNQ  310
             K+ + ++LH    +Y+               + R   GCP+     N+
Sbjct  446   KLEISIFLHHFLLKYR---------------VERSNPGCPVMFLPHNR  478



>emb|CDY12205.1| BnaC04g12350D [Brassica napus]
Length=490

 Score =   220 bits (560),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 131/447 (29%), Positives = 233/447 (52%), Gaps = 10/447 (2%)
 Frame = -2

Query  1701  IAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRT--RRLWHGRWF  1528
             + V++   +    +  + PG LG PF+G     L A   T     F+RT   R  H   +
Sbjct  28    VNVWIYESKLGEKRHYLPPGDLGWPFIGNMLPFLRAFK-TSDPDSFIRTYITRYGHNGVY  86

Query  1527  KTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRL  1348
             K  +FG   V V + +  + +  +D   F  G+ KS  + +GKKS + +  E HKR+RRL
Sbjct  87    KVHMFGNPSVIVTTPETCRKVLTDD-ECFQPGWPKSTMELIGKKSFIGISFEEHKRLRRL  145

Query  1347  LSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDG  1171
              + P +   +LS++++  +  +   LE   ++G+    L    K+TF  +  + MS    
Sbjct  146   TAAPVNGHEALSVYIKYIEETVVTALENWSKMGE-IEFLTHVRKLTFRIIMYIFMSTESE  204

Query  1170  SLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNES  991
              ++  +ER+ + ++  + +  + IPG  Y+K +KAR +L+  F++ + +RR +  +   +
Sbjct  205   HVMDALEREYTNLNYGVRAMAINIPGFAYHKALKARKKLVAAFQSSVTNRRNQRKQNVTT  264

Query  990   DEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQ  811
                +D L  +++         LEDEEI+D LL  + AG  ++   +MW+   L E+ EI 
Sbjct  265   SNKKDMLDNLIDAKD-ENGRTLEDEEIIDVLLMYLNAGHESSGHTIMWATIFLQEHPEIL  323

Query  810   NRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEG  631
              + +EEQ  I++ +  G  +TL++   M Y S+V+ ETLR+    L   R A  + ++ G
Sbjct  324   QKAKEEQERIVKKRVPGQSLTLKETREMEYLSQVIDETLRVITFSLTAFREAKSDVQMNG  383

Query  630   FDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFD-EMQRPYSYIPFGSGPRTCLGINMA  454
             + I KGW V      +H DP IY DP  F+PSR++  + +  +++PFG G   C G ++A
Sbjct  384   YIIPKGWKVLTWFRDVHLDPEIYPDPKKFDPSRWEGYIPKAGTFLPFGLGSHLCPGNDLA  443

Query  453   KVTMLVYLHRLTSRYKWSVDDPDPSLE  373
             K+ + ++LH    +Y+  VD  +P  +
Sbjct  444   KLEISIFLHHFLLKYR--VDRSNPGCQ  468



>ref|XP_002980510.1| hypothetical protein SELMODRAFT_233532 [Selaginella moellendorffii]
 gb|EFJ18161.1| hypothetical protein SELMODRAFT_233532 [Selaginella moellendorffii]
Length=443

 Score =   218 bits (556),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 129/423 (30%), Positives = 209/423 (49%), Gaps = 6/423 (1%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKT  1468
             PG LG+P LGET   +  T S +  ++F+  R   +G+ FKT +FG   V V    G K 
Sbjct  5     PGSLGLPLLGETLQFIRYTKSNR-PWEFIEQREAKYGKIFKTSLFGSPMVMVSPPQGNKL  63

Query  1467  IFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRM  1288
             +F+N   L    +   M   VG  ++  +  E  K  R +L    S  ++   V     M
Sbjct  64    VFSNHNLLVETAWPSPMKTLVGSNAINFMSGEEAKSFRDVLMTFLSAQAVQSQVVPTSNM  123

Query  1287  LCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFP  1108
             +   L +  + G++        +  F   C   +S++D      +    + +   ++S P
Sbjct  124   IQDHLHKHWKHGETVLAYSLIKQALFSVTCCAFLSVSDEEEQLELLEPLAKIIKGLISLP  183

Query  1107  VMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEK  928
             + +P T ++   K R  L + F   I  RR  +  G+ S +D   L    + D+    + 
Sbjct  184   LDLPWTNFHHAKKGRVELYKMFDKYIARRRIELENGSSSQQDLLSLLLSTKLDN---GKL  240

Query  927   LEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALIT  748
             + D++I DN+L+L+ AG  T+++++  ++K L +N      LR E L IL  K  G  + 
Sbjct  241   MNDDQIKDNILSLLFAGHDTSSSSLAMTLKCLAQNPACYQELRREHLDILSAKQPGEELN  300

Query  747   LEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPA  568
               DL  M Y   V++ETLR+        R AL + +++GF I KGW + I     +  P 
Sbjct  301   QNDLRKMKYTWMVIQETLRVMPTGFGILRKALKDIEMDGFTIPKGWQLLISGYRSYRKPE  360

Query  567   IYKDPTHFNPSRFDEMQR--PYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVD  394
              + +P  F PSRF E     PY+YIPFG GPR C GI +AK+ ++V+LH L +RY+W++ 
Sbjct  361   FFAEPFKFEPSRFAEGTGPVPYTYIPFGGGPRICPGIQLAKMQVMVFLHHLVTRYEWTLV  420

Query  393   DPD  385
             +PD
Sbjct  421   EPD  423



>ref|XP_009142864.1| PREDICTED: taxadiene 5-alpha hydroxylase [Brassica rapa]
Length=488

 Score =   219 bits (559),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 131/442 (30%), Positives = 225/442 (51%), Gaps = 8/442 (2%)
 Frame = -2

Query  1644  GKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTI  1465
             G++G+P++GET     A  + +   DFV  R + HG  FKT+I G   + V   +  + I
Sbjct  49    GEMGLPWIGETMEFYKAQKNNRVFEDFVNPRIIKHGNLFKTKIMGSPTIVVNGAEANRLI  108

Query  1464  FANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRML  1285
              +N+F+L    +  S    +G   ++    E H+ +R ++++  S N L   +      +
Sbjct  109   LSNEFSLVVSSWPSSSVQLMGMNCIMAKQGEKHRVLRGIVANSLSYNGLESLLPNLCDTV  168

Query  1284  CQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSI-TDGSLLRRIERDCSTVSDAMLSFP  1108
                L+ Q R  +  ++      +TF  +   L  I  +  +L   ER    V + + + P
Sbjct  169   RSHLDTQWRGKEEISLYRSTKALTFTVVFECLYGIKVELGMLEIFER----VLEGVFALP  224

Query  1107  VMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEK  928
             V  P +R+ +  KAR  +       +  +RR M +    +     L   L +       +
Sbjct  225   VEFPCSRFARAKKARVEIETLLVEKVREKRREMEQEEGGERPNTTLFSRLVQGLI--KGE  282

Query  927   LEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALIT  748
             + +EE++DN++ L+ A   TT+ AM  + K+L ++    + L +E + I  NK +G  +T
Sbjct  283   ITEEEVVDNMVLLVFAAHDTTSYAMAMTFKMLAQHPTCLHTLLKEHVQIKANKGEGEYLT  342

Query  747   LEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPA  568
             +ED+  M Y+ +VV+ET+R+S  +    R A+ +    GF I KGW V       HY+P 
Sbjct  343   VEDVKKMKYSWQVVRETMRLSPPIFGSFRKAVVDINYGGFTIPKGWKVLWTTYGTHYNPE  402

Query  567   IYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDP  388
             I++DP  FNPSRFD+  + Y+Y+PFG GPR C G  +AKV++LV+LH + + Y WS+  P
Sbjct  403   IFEDPMSFNPSRFDKAVQAYTYLPFGGGPRLCAGHQLAKVSILVFLHFVVTSYDWSLVYP  462

Query  387   DPSLERKAHIPRLRSGCPITLT  322
             D ++     +P    G PI ++
Sbjct  463   DETISMDP-LPLPSLGMPIKIS  483



>ref|XP_008454553.1| PREDICTED: LOW QUALITY PROTEIN: taxadiene 5-alpha hydroxylase-like 
[Cucumis melo]
Length=479

 Score =   219 bits (558),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 136/448 (30%), Positives = 230/448 (51%), Gaps = 11/448 (2%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKT  1468
             PG LG+PF+G++ SLL A   T     +++ R   +G   K  +FGK  VFV      K 
Sbjct  32    PGALGVPFIGQSLSLLGAMR-TNTAEKWLQQRVDKYGPVSKMTLFGKPTVFVHGAAANKA  90

Query  1467  I-FANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDR  1291
             + F+ +    +   ++S+   +GK++L  +  E HKR+R  L       +L  +V+K D 
Sbjct  91    VVFSGEEGTVSNRQIESLKMILGKRNLTELSGEDHKRVRGALVWFLRPQTLRSYVEKMDG  150

Query  1290  MLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSF  1111
              + + L          TV      +TFD +C++L  I +G+  + I +   T+ + + S 
Sbjct  151   EVRRHLNMYWHGNNKVTVAPLMKTLTFDIICSLLFGIEEGTTRKSIIQCFKTMVEGIWSV  210

Query  1110  PVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDR-DFLQEMLERDSFPES  934
             P+ +P TRY   +KA  ++ +  K ++  + +RM +  +  +   D +  +L   +  + 
Sbjct  211   PINLPFTRYNHSLKASAKVQQILKQLLKDKAKRMEQKKKMKKKMKDLITYLLRIKNKDKE  270

Query  933   EKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGAL  754
             + L +EEI+ N++ L+IAG  TT+  +   +++L  N  +   + +E   I R+K +G  
Sbjct  271   QALTEEEILHNIILLMIAGHDTTSILLTLMLRVLATNPTVYADVLQEHEEIARSKERGEA  330

Query  753   ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYD  574
             +T ED++ M Y  +V  ETLR+   +    RVAL + ++  + I KGW +   A+  H D
Sbjct  331   LTWEDVSKMKYTWRVAMETLRLYPPVFGGFRVALKDIQLGAYTIPKGWQIFWAASTTHLD  390

Query  573   PAIYKDPTHFNPSRFDEMQR---PYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKW  403
               I+ DP  F PSRFD+ Q    P+S+I FG GPR C G   AK+  LV +H L +++ W
Sbjct  391   ETIFGDPQKFEPSRFDQTQTPIPPFSFIAFGGGPRICPGYEFAKLETLVTIHYLITQFTW  450

Query  402   SVDDPDPSLERKAHIPRL--RSGCPITL  325
             ++     SL R    P L    G PI +
Sbjct  451   NLSCSQDSLTRD---PTLMPNKGLPIQI  475



>ref|XP_008238332.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Prunus mume]
Length=493

 Score =   219 bits (558),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 133/479 (28%), Positives = 244/479 (51%), Gaps = 28/479 (6%)
 Frame = -2

Query  1731  VFLGLLVGIGIAVYLLR--------GQTVRSKSCIIPGKLGIPFLGETFSLLSATNST--  1582
             VF   + G G  + +L+         +    K+ + PG +G PF+G T S L A  S   
Sbjct  9     VFTASIGGFGAILLILKRANEWYFVSRLGEKKNTLPPGDMGWPFIGNTLSFLKALKSNDP  68

Query  1581  ----KGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMA  1414
                   C+     +R      +K  +FGK  +   + +  + +  +    F  G+ K+ A
Sbjct  69    DSFISNCF-----KRYGSTGIYKAYLFGKPTIIATAPETCRQVLMDSLQ-FKTGWPKATA  122

Query  1413  DAVGKKSLLCVPHESHKRIRRLLSDPFSMN-SLSIFVQKFDRMLCQRLEEQHRIGKSFTV  1237
             + +G+KS + +P E HKR+R+L + P S + +LS++ +    +    L+E  +  +    
Sbjct  123   ELMGRKSFVTLPEEEHKRLRKLTAAPISGHKALSMYHEYIKHVTVSSLDELAKADRPIEF  182

Query  1236  LDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGR  1057
             L    KITF  +  + +S   G ++  +ER+ + ++  + +  + +PG  ++K +KAR +
Sbjct  183   LSEIRKITFKIIMFIFLSCETGPMMETMEREYAILNHGLRAMAINLPGFAFHKALKARKK  242

Query  1056  LMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAG  877
             + +  + ++D RR R  + N    +R  L ++L        + L++EEI+D +L  + AG
Sbjct  243   MAKIIQDVVDERRAR--KANNLSRERTDLMDLLMEAEDENGKTLDNEEIIDIILMYLNAG  300

Query  876   QTTTAAAMMWSVKLLDENTEIQNRLREEQLSILR--NKPKGALITLEDLNTMTYASKVVK  703
               ++A A +W++  L E+ E   + + EQ+ IL+  + P+  L   ++   M Y SKV+ 
Sbjct  301   HESSAHATLWAILFLHEHPEYYQKAKAEQMEILKRASSPEAGL-DFKETKQMEYLSKVID  359

Query  702   ETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDE  523
             ETLR+ N+ L+  R A  +  + G+ I KGW V +    +H +P  Y DP  FNPSR++E
Sbjct  360   ETLRVVNISLYSYREATTDANVAGYTIPKGWKVMMWYRGVHLNPEYYPDPKDFNPSRWNE  419

Query  522   MQ-RPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAH-IPR  352
              + +  ++IPFG G R C G ++ K+ + V+LH     Y+  + +P   ++   H  PR
Sbjct  420   NKGKAGTFIPFGIGSRLCPGSDLTKLEIYVFLHYFLLYYELELVNPGCGVKYLPHTTPR  478



>ref|XP_003518515.2| PREDICTED: taxadiene 5-alpha hydroxylase-like [Glycine max]
Length=493

 Score =   219 bits (558),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 130/458 (28%), Positives = 238/458 (52%), Gaps = 19/458 (4%)
 Frame = -2

Query  1677  QTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHV  1498
             Q  + K  + PG++G P +GET    +A    +   +FV  R L HGR F+TRI G   V
Sbjct  45    QCYKDKRNLPPGEMGFPLIGETMEFFNAQRRNQLFEEFVHPRILKHGRIFRTRIMGSPTV  104

Query  1497  FVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSL  1318
              V   +  K + +N+F L    +  S  + +G+ S++      H+ +R ++        L
Sbjct  105   VVNGAEANKFLLSNEFKLVKSSWPSSSVELMGRDSIMEKDGGRHRFLRGVIGTSLGYAGL  164

Query  1317  SIFVQK------FDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRR  1156
              + V K      F      + +E+  + +S  VL F+  I F+  C + + +  G +L  
Sbjct  165   ELLVPKLCNSVQFHLATNWKGQEKISLYRSTKVLSFS--IVFE--CLLGIKVEPG-MLDT  219

Query  1155  IERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRD  976
              ER    V + + S  VM PG+++++  KAR  + +    ++  +RR M      ++D  
Sbjct  220   FER----VLEGVFSPAVMFPGSKFWRAKKARVEIEKMLVKVVREKRREMEGSLGREQDGM  275

Query  975   FLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLRE  796
              L +++   S     ++ ++E++DN++ L+ A   TT+ A+  + K+L ++ +   +L +
Sbjct  276   LLSKLV---SGMIQGEISEKEVIDNVVLLVFAAHDTTSFAVAMTFKMLAQHPDCFGKLLQ  332

Query  795   EQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKK  616
             E ++I+ NK +G  +TLED+  M Y  +V +E++R+   +    R A+ + + EGF I +
Sbjct  333   EHVAIMSNKSRGENLTLEDIKKMKYTWQVARESMRLFPPIFGSFRKAITDIEYEGFIIPR  392

Query  615   GWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLV  436
             GW V       HY+   +KDP  FNPSRF+E    Y+++PFG GPR C G  +A++ +L+
Sbjct  393   GWKVLWTTYGTHYNEEYFKDPMSFNPSRFEEGVPQYAFVPFGGGPRVCAGYQLARLNILI  452

Query  435   YLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             ++H + ++Y+W +  PD  +     +P    G PI ++
Sbjct  453   FVHYVVTQYEWFLLHPDEPVAMDP-LPFPSLGMPIRIS  489



>ref|XP_004486504.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X1 [Cicer 
arietinum]
Length=491

 Score =   219 bits (558),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 132/462 (29%), Positives = 245/462 (53%), Gaps = 25/462 (5%)
 Frame = -2

Query  1719  LLVGIGIAVYLLRG------------QTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKG  1576
             +L+ IG+ + +LR             +    +  + PG +G PF+G  +S L A  S + 
Sbjct  11    VLMAIGVTLLVLRSILKNVNWLLYESKLGLKQYSLPPGDMGWPFIGNMWSFLRAFKS-RD  69

Query  1575  CYDFVRT--RRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVG  1402
                F+ +   R  HG  +K  +FG   V V + + ++ +  +D   F  G+ +S  + +G
Sbjct  70    PDSFISSFVSRYGHGGIYKGLMFGNPSVIVTTPEASRKVLIDD-ERFTPGWPQSTIELIG  128

Query  1401  KKSLLCVPHESHKRIRRLLSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFN  1225
             KKS + +P++ HKR+RRL S   + M +LS++++  +  +   LE+   +G+    L   
Sbjct  129   KKSFIAMPYDEHKRLRRLTSSSINGMEALSLYLKYIEENVISSLEKWSNMGQ-IEFLTEI  187

Query  1224  MKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMET  1045
              K+TF  + ++ +S     ++  +E++ +T++  + +  + IPG  YYK +KAR +L+  
Sbjct  188   RKLTFKIIMHIFLSSESEPVMEALEKEYTTLNYGVRAMQINIPGFAYYKALKARKKLVAI  247

Query  1044  FKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTT  865
             F++I+D  RR + +G    +  D +  +++ +      KL DE I+D +L  + AG  ++
Sbjct  248   FQSIVD-ERRSIRKGYSPKKANDMMDSLIDVED-DNGRKLSDEYIIDIMLMYLNAGHESS  305

Query  864   AAAMMWSVKLLDENTEIQNRLREEQLSILRNKP---KGALITLEDLNTMTYASKVVKETL  694
                 MW+   L ++ E   + +EEQ  I++ +P   KG  +TL+++  M +  KV+ ET+
Sbjct  306   GHITMWATYFLQKHPEYLQKAKEEQEEIIKKRPPTQKG--LTLKEIRAMDFLYKVIDETM  363

Query  693   RMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQR  514
             R+    L   R A  +  + G+ I KGW V +    IH DP IY +P  FNP+R+++  +
Sbjct  364   RVITFSLVVFREAKSDVSMNGYTIPKGWKVLVWFRSIHLDPEIYPNPKEFNPNRWNKEHK  423

Query  513   PYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDP  388
                ++PFG+G R C G ++AK+ + V+LH     Y+    +P
Sbjct  424   AGEFLPFGAGTRLCPGNDLAKMEIAVFLHHFILNYQLEQLNP  465



>emb|CDY50827.1| BnaC04g52640D [Brassica napus]
Length=511

 Score =   219 bits (559),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 134/448 (30%), Positives = 229/448 (51%), Gaps = 20/448 (4%)
 Frame = -2

Query  1644  GKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTI  1465
             G++G+P++GET     A  + +   DFV  R + HG  FKT+I G   + V   +  + I
Sbjct  49    GEMGLPWIGETMEFYKAQKNNRVFEDFVNPRIIKHGNLFKTKIMGSPTIVVNGAEANRLI  108

Query  1464  FANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRML  1285
              +N+F+L    +  S    +G   ++    E H+ +R ++++  S N L   +      +
Sbjct  109   LSNEFSLVVSSWPSSSVQLMGMNCIMAKQGEKHRVLRGIVANSLSYNGLESLLPNLCDTV  168

Query  1284  CQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSI-TDGSLLRRIERDCSTVSDAMLSFP  1108
                LE Q R  +  ++       TF  +   L  I  +  +L   ER    V + + + P
Sbjct  169   RSHLETQWRGKEEISLYRSTKAQTFTVVFECLYGIKVELGMLEIFER----VLEGVFALP  224

Query  1107  VMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRD------FLQEMLERDS  946
             V  P +R+ +  KAR  +       +  +RR M +  E DE  +       +Q +++ + 
Sbjct  225   VEFPCSRFARAKKARLEIETLLVEKVREKRREMEQ-EEGDERPNTTLFSRLVQGLIKGE-  282

Query  945   FPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKP  766
                   + +EE++DN++ L+ A   TT+ AM  + K+L ++    + L +E + I  NK 
Sbjct  283   ------ITEEEVVDNMVLLVFAAHDTTSYAMAMTFKMLAQHPTCLDTLLKEHVQIKANKG  336

Query  765   KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATC  586
             +G  +T+ED+  M Y+ +VV+ET+R+S  +    R A+ +    GF I KGW V      
Sbjct  337   EGEYLTVEDVKKMKYSWQVVRETMRLSPPIFGSFRKAVVDINYGGFTIPKGWKVLWTTYG  396

Query  585   IHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYK  406
              HY+P I++DP  FNPSRFD+  + Y+Y+PFG GPR C G  +AKV++LV+LH + + Y 
Sbjct  397   THYNPEIFEDPMSFNPSRFDKAVQAYTYLPFGGGPRLCAGHQLAKVSILVFLHFVVTSYD  456

Query  405   WSVDDPDPSLERKAHIPRLRSGCPITLT  322
             WS+  PD ++     +P    G PI ++
Sbjct  457   WSLVYPDETISMDP-LPFPSLGMPIKIS  483



>ref|XP_011040241.1| PREDICTED: cytochrome P450 716B1-like [Populus euphratica]
Length=472

 Score =   218 bits (556),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 142/477 (30%), Positives = 237/477 (50%), Gaps = 17/477 (4%)
 Frame = -2

Query  1740  YYDVFLGLLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFV  1561
             ++ +FL L     + ++LL  +  +S + + PG LGIP +G +  LL A   T     ++
Sbjct  4     FFTIFLFL-----VPIFLLIVKGRKSSTKLPPGSLGIPIIGHSLQLLKAMR-TNTAEKWL  57

Query  1560  RTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCV  1381
               R   +G   K  +FGK  VF+   +  K +F +D +  +     S+   +G + +  +
Sbjct  58    HERIQKYGSISKLTLFGKPTVFIYGNEANKFVFTSDSSTISYSQTTSLKMILGDRCIAEL  117

Query  1380  PHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAM  1201
               + HKRIR  L       SL  +V K D  +   +E   +  +  TVL    K++FD +
Sbjct  118   CGQDHKRIRDALLSFLKPESLKNYVGKMDEEVRMHMETHWKGKQEITVLPLMKKLSFDVI  177

Query  1200  CNMLMSITDGSLLR-RIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDS  1024
             C++L  I  G   R ++      +   + S P+ +P TR+  G++A  R+    K +I  
Sbjct  178   CSLLFGIEQGGTRRDKLVTWFQQMIGGIWSVPINLPFTRFNLGLRASARVRNFLKDLIAE  237

Query  1023  RRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWS  844
             +R  + +G  +D  +D +  +L        E + ++EI+DN++ ++ AG  T+A  + + 
Sbjct  238   KRMELKKG--ADPHQDLITCLLSTRDENNGEGMTEKEIVDNVILVLTAGHDTSAILITFM  295

Query  843   VKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFP  664
             ++LL     I   +  EQ  I ++KP+G L+T EDL  M Y  KV  ETLRM   +    
Sbjct  296   IRLLAIEPSIYAAVLGEQEGIAKSKPRGELLTWEDLAKMKYTWKVALETLRMFPPIFGGF  355

Query  663   RVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQR--PYSYIPFG  490
             R A+ + +  G+ I +GW +       H D +I+ +P+ F+P+RFD      PYS+I FG
Sbjct  356   RKAVKDIEYNGYIIPEGWQIFWTMNMTHMDDSIFTEPSKFDPTRFDNQASIPPYSFIAFG  415

Query  489   SGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRL--RSGCPITL  325
              GPR C G   AK+  LV +H L +++ W +   D S  R    PRL    G PI +
Sbjct  416   GGPRMCPGYEFAKIEALVTIHYLVTQFTWKL-CADTSFSRN---PRLMPSEGLPIKI  468



>ref|XP_002265630.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Vitis vinifera]
Length=492

 Score =   219 bits (557),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 145/496 (29%), Positives = 247/496 (50%), Gaps = 39/496 (8%)
 Frame = -2

Query  1791  VELGKLRMVFGSMVSHYYYDVFLGLLVGIGIAV-----YLLRGQTVRSKSCIIPGKLGIP  1627
             +ELG + + FG++         LG ++G+   +     ++   +    +  + PG LG P
Sbjct  1     MELGMIWVAFGAI---------LGGVLGVKWVLRRANSWVYEVKLGEKRYSLPPGDLGWP  51

Query  1626  FLGETFSLLSATNSTKGCYDFVRT--RRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFAND  1453
              +G  +S L A  ST     F+ +   R      +K  +FG   + V   +  K +  +D
Sbjct  52    LIGNMWSFLRAFKSTDPD-SFISSFITRFGQTGMYKVLMFGNPSIIVTIPEACKRVLTDD  110

Query  1452  FALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFS-MNSLSIFVQKFDRMLCQR  1276
                F  G+  S  + +G+KS + + +E HKR+RRL + P +   +LSI++Q  +  +   
Sbjct  111   -QNFKPGWPTSTMELIGRKSFIGITNEEHKRLRRLTATPVNGHEALSIYMQYIEDNVISA  169

Query  1275  LEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIP  1096
             L +   +G+ F  L    K+TF  +  + +S     ++  +ER+ ++++  + S  + +P
Sbjct  170   LNKWAAMGE-FEFLTALRKLTFKIIMYIFLSSESEHVMEALEREYTSLNYGVRSMAINLP  228

Query  1095  GTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDE  916
             G  Y+K +KAR  L+  F++I++ RR R  +GN     +D +  +L+ +      KL DE
Sbjct  229   GFAYHKALKARKNLVNIFQSIVNERRDR-KKGNSQTMKKDMMDALLDIED-ENGRKLSDE  286

Query  915   EIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGAL-ITLED  739
             EI+D L+  + AG  ++A   MW+   L EN E   R + EQ  I+R +P     +TL++
Sbjct  287   EIIDILVMYLNAGHESSAHVTMWATVKLQENPEFFQRAKAEQEEIIRKRPPNQKRLTLKE  346

Query  738   LNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYK  559
             +  M Y  KV+ ETLR         R A  +  I G+ I KGW V +    +H+DP  Y 
Sbjct  347   IREMEYLPKVIDETLRWITFSFVVFREAKADINICGYTIPKGWKVLVWFRSLHFDPETYP  406

Query  558   DPTHFNPSRFDE-MQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDP  382
             DP  FNP R+D+   +P +++PFG G R C G ++AK+ + V+LH     Y+        
Sbjct  407   DPKEFNPCRWDDYTAKPGTFLPFGLGSRLCPGNDLAKLEISVFLHHFLLNYQ--------  458

Query  381   SLERKAHIPRLRSGCP  334
                    + RL  GCP
Sbjct  459   -------LERLNPGCP  467



>ref|NP_001267981.1| hypodontia, autosomal recessive (2) [Vitis vinifera]
 emb|CBI29200.3| unnamed protein product [Vitis vinifera]
 gb|AGH68823.1| ABA 8' hydroxylase 2 [Vitis vinifera]
Length=470

 Score =   218 bits (556),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 142/450 (32%), Positives = 231/450 (51%), Gaps = 31/450 (7%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKT  1468
             PG LG P++GETF L S   +      F  +++  +G  FKT I G   V + S + AK 
Sbjct  41    PGSLGWPYIGETFQLYSQNPNV-----FFASKQERYGTIFKTHILGCPCVMISSPEAAKL  95

Query  1467  IFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRM  1288
             +      LF   +  S    +GK+++     + H ++R+L+   F   ++   V   D +
Sbjct  96    VLVTKAPLFKPTFPASKERMLGKQAIFFHQGDYHAKLRKLVLRAFMPGAIKNIVSNIDSI  155

Query  1287  LCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSI--TDGSLLRRIERDCSTV-SDAML  1117
               Q L+     G+S          TF+     L+SI   D  L R   + C  +      
Sbjct  156   ATQTLQSWE--GRSINTFQEMKTYTFNVA---LLSIFGKDEILYREELKKCYYILEKGYN  210

Query  1116  SFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPE  937
             S P+ IPGT + K +KAR  L +    I+ +RR+  G  N      D L   +      +
Sbjct  211   SMPINIPGTLFNKSMKARKELAQILAKILSTRRQANGDHN------DLLGSFMG-----D  259

Query  936   SEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKP---  766
              E L DE+I DN++ +I A + TTA+ + W +K L EN  +   + EEQ SI+R+K    
Sbjct  260   KEGLTDEQIADNIIGVIFAARDTTASVLTWILKYLGENPSVLQAVTEEQESIMRSKEDKC  319

Query  765   -KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDAT  589
              +   +T ED   M   S+V++ETLR++++L +  R A+++ + EG+ I KGW V     
Sbjct  320   GEEKSLTWEDAKKMPITSRVIQETLRIASILSFTFREAVEDVEFEGYLIPKGWKVLPLFR  379

Query  588   CIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRY  409
              IH+ P IY +P  F+PSRF+   +P +++PFG+G  +C G  +AK+ +LV LH LT++Y
Sbjct  380   NIHHSPDIYPEPEKFDPSRFEVAPKPNTFMPFGNGVHSCPGNELAKLEILVLLHHLTTKY  439

Query  408   KWSVDDPDPSLERKAH-IPRLRSGCPITLT  322
             +WS+      ++     +P  ++G PIT++
Sbjct  440   RWSMVGTQNGIQYGPFALP--QNGLPITIS  467



>gb|KDP26990.1| hypothetical protein JCGZ_22182 [Jatropha curcas]
Length=498

 Score =   219 bits (557),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 137/423 (32%), Positives = 232/423 (55%), Gaps = 15/423 (4%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVR--TRRLWHGRWFKTRIFGKIHVFVPSVDGA  1474
             PG LG PF+G  +S L A  ST     F+R    R   G  +K  +FG   V V + +  
Sbjct  48    PGDLGWPFIGNMWSFLKAFKSTDPD-SFMRNFVARYGGGGVYKALMFGNPSVLVTTPETC  106

Query  1473  KTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFS-MNSLSIFVQKF  1297
             + +  +D A F  G+ KS AD +GKKS + + +E HKR+RRL S P +   +LS ++   
Sbjct  107   RKVLTDDEA-FQPGWPKSTADLIGKKSFVSISYEEHKRLRRLTSAPVNGHEALSQYILYI  165

Query  1296  DRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAML  1117
             +  +   L+E   +G+    L    K+TF  + ++ +     S++  +E++ ++++  + 
Sbjct  166   EENVISALDEWASMGE-IEFLTQLRKLTFKIIVHIFLGSESVSVMEALEKEYTSLNYGVR  224

Query  1116  SFPVMIPGTRYYKGIKARGRLMETFKTIIDSRR-RRM-GRGNESDEDRDFLQEMLERDSF  943
             S  + +PG  Y+K +KAR  L+  F+++++ RR +RM GR   S + +D +  +L+ +  
Sbjct  225   SMAINLPGFAYHKALKARKNLVAVFQSVVNERRNQRMDGRRLVSSKKKDMMDALLDVED-  283

Query  942   PESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKP-  766
              + +KL DEEI+D LL  + AG  ++    MW+   L  + E   + ++EQ  IL+ +P 
Sbjct  284   EKGQKLSDEEIIDILLMYLNAGHESSGHITMWATIFLQAHPEYLKKAKKEQEEILKRRPP  343

Query  765   --KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDA  592
               KG  +TL++   M Y S+V+ ETLR+    L   R A  +  ++G+ I KGW V    
Sbjct  344   TQKG--LTLKETREMIYLSQVIDETLRLVTFSLTVFREAKADINLDGYIIPKGWKVLTWF  401

Query  591   TCIHYDPAIYKDPTHFNPSRFD-EMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTS  415
               +H DP IY +PT F PSR+D    +  +++PFG+G R C G ++AK+ + ++LH    
Sbjct  402   RSVHLDPEIYPNPTEFYPSRWDNHTAKAGTFLPFGAGSRLCPGNDLAKLEISIFLHHFLL  461

Query  414   RYK  406
              Y+
Sbjct  462   NYQ  464



>ref|XP_010058307.1| PREDICTED: taxadiene 5-alpha hydroxylase-like [Eucalyptus grandis]
Length=483

 Score =   218 bits (556),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 124/446 (28%), Positives = 219/446 (49%), Gaps = 21/446 (5%)
 Frame = -2

Query  1689  LLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFG  1510
             +L+ +   +K  + PG++G+P+LGET     A  + +   DFVR R   HG+ FKTR+ G
Sbjct  26    ILKQKCANTKHKLPPGQMGLPWLGETMDFYRAQQANRLFEDFVRPRIARHGKIFKTRLMG  85

Query  1509  KIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFS  1330
                V V   +  +   +N+F L    +  S    +GK S++    E H+ +  L++    
Sbjct  86    SPTVIVSGAEANRFFLSNEFKLVMSSWPSSSVRLMGKNSIMEKHGEQHRHVHGLIASSLG  145

Query  1329  MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIE  1150
              +S    V K  +++ + L+      +   + +F   +TF  +   L+ I     ++ I 
Sbjct  146   SSSAESLVPKLSKLVQRHLDAHWSGQERIYLYNFTKNLTFHIVFECLLGIDVELGMKEI-  204

Query  1149  RDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRD--  976
                  + + + + PV +PGTR+ + ++AR  +      I+  ++  M R N         
Sbjct  205   --FERILEGVFAPPVTVPGTRFSRAMRARKEIERMLVRIVRKKKEEMERKNSGGGGGGSE  262

Query  975   ---------FLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDEN  823
                      ++  ML  +       + +EE++DN++ L+ A   TT+ A+  + ++L  +
Sbjct  263   EGGVVLLPRYVAAMLRGE-------MSEEEVIDNIVLLVFAAYDTTSFAIAMTFRMLAHH  315

Query  822   TEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNC  643
                   L +E + +   K +G  I+ ED+  M+Y  KV +E++R+   +    R A+ + 
Sbjct  316   PNCYQLLLKEHMDVKSRKGEGEDISGEDIKKMSYTWKVARESIRLFPPIFGSFRKAIVDI  375

Query  642   KIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGI  463
             + EGF I KGW V       HYDP  ++DP  FNP RF+E   PY Y+PFG GPR C G 
Sbjct  376   EYEGFTIPKGWKVLWTTYGTHYDPEHFQDPMSFNPDRFEEAMPPYVYVPFGGGPRVCAGS  435

Query  462   NMAKVTMLVYLHRLTSRYKWSVDDPD  385
              + ++ +LV +H + +RY WS+  PD
Sbjct  436   QLTRMNILVLVHHVVTRYDWSLIHPD  461



>ref|XP_010517830.1| PREDICTED: taxadiene 5-alpha hydroxylase-like [Camelina sativa]
Length=485

 Score =   219 bits (557),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 133/479 (28%), Positives = 238/479 (50%), Gaps = 16/479 (3%)
 Frame = -2

Query  1731  VFLGLLVGIGIAVYLLR-------GQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGC  1573
             VFL +   +   ++  R        + ++    + PG++G+P++GET     A  S +  
Sbjct  12    VFLCIAATVSSTLFFFRKKHHRFISKKIQKTKKLPPGEMGLPWIGETMEFYKAQKSNRVF  71

Query  1572  YDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKS  1393
              DFV  R + HG   KT+I G   + V   +  + I +N+F+L    +  S    +G   
Sbjct  72    EDFVNPRIIKHGNILKTKIMGSPTIVVNGAEANRLILSNEFSLVVSSWPSSSVQLMGMNC  131

Query  1392  LLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKIT  1213
             ++    E H+ +R ++++  S N L   V K    +   LE + R  K  ++      +T
Sbjct  132   IMAKQGEKHRVLRGIVANSLSYNGLESIVPKLCDTVKFYLETEWRGKKEISLYRSAKALT  191

Query  1212  FDAMCNMLMSI-TDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKT  1036
             F  +   L  I  +  +L   E+    V D + + PV  P +++ +  KAR  +      
Sbjct  192   FTVVFECLYGIKVELGMLEIFEK----VLDGVFAMPVEFPYSKFARAKKARLEIETFLVA  247

Query  1035  IIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAA  856
              +  +RR M    E          ++E         + +EE++DN++ L+ A   TT+ A
Sbjct  248   KVRDKRREMEEEAEKPNTTTLFSRLIEELI---KGLITEEEVVDNMVLLVFAAHDTTSYA  304

Query  855   MMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVL  676
             M  + K+L ++   ++ L +E + I  NK +G  +T++D+  M Y+ +VV+ET+R+S  +
Sbjct  305   MAMTFKMLAQHPTCRDTLLQEHVRIKANKGEGEHLTVDDVKRMKYSWQVVRETMRLSPPI  364

Query  675   LWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIP  496
                 R A+ +    GF I KGW +       HY+P I++DP  F+P+RFD+  + Y+Y+P
Sbjct  365   FGSFRKAVADIDYGGFTIPKGWKILWTTYGTHYNPEIFQDPMSFDPTRFDKPIQAYTYLP  424

Query  495   FGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTA  319
             FG GPR C G  +AK+++LV+LH + + Y WS+  PD ++     +P    G PI +++
Sbjct  425   FGGGPRLCAGHQLAKISILVFLHFVMTNYDWSLVYPDETISMDP-LPFPTLGMPIKISS  482



>ref|XP_010691953.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Beta vulgaris subsp. 
vulgaris]
Length=488

 Score =   219 bits (557),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 134/466 (29%), Positives = 241/466 (52%), Gaps = 12/466 (3%)
 Frame = -2

Query  1701  IAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSA---TNSTKGCYDFVRTRRLWHGRW  1531
             + +++   +    +  + PG  G+PF+G  +S L A   +N       FV   R      
Sbjct  27    VNIWVYESKLGEKRHSLPPGDFGLPFVGNMWSFLRAFKSSNPDSFLNSFVS--RFGKTGL  84

Query  1530  FKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRR  1351
             +K  +FG   + V + +  + +  ND   F  G+  S  + +G+KS + +P+E HKR+RR
Sbjct  85    YKAFMFGSPSIIVTTPEMCRKVL-NDDEHFKPGWPLSTTELIGRKSFVAIPYEEHKRLRR  143

Query  1350  LLSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITD  1174
             L S P +   +LS +++  + +    L +   +G+    L    K+TF  +  + +S   
Sbjct  144   LTSTPINGHEALSNYIEYIEDISKTTLHKMSIMGE-IEFLTQLRKLTFRIIMYIFLSSES  202

Query  1173  GSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNE  994
               ++  +ER+ +T++  + +  + IPG  Y+K +KAR +L+  F+++ID RR     G  
Sbjct  203   EPVMEALEREYTTLNHGVRAMAINIPGFAYHKALKARKKLVAVFQSVIDERRALKRNGVA  262

Query  993   SDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEI  814
                 +D +  +LE +      KL DEEI+D L+  + AG  ++A  +MW+  LL ++ E 
Sbjct  263   VKAKKDMMDALLEVED-DNGRKLTDEEIIDLLVMYLNAGHESSAHTIMWATVLLQQHPEF  321

Query  813   QNRLREEQLSILRNKPKGAL-ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKI  637
               + + EQ  I++N+P G   +TL++   MTY S+V+ ETLR         R A+ +  I
Sbjct  322   LQKAKAEQEEIVKNRPVGQKGLTLKETRKMTYLSEVIDETLRWVTFSFVVFREAISDVNI  381

Query  636   EGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEM-QRPYSYIPFGSGPRTCLGIN  460
              G+ I KGW V       H DP ++ +P  FNPSR+  +  +  +++PFG+G R C G +
Sbjct  382   NGYTIPKGWKVLTWFRTCHLDPEVWPEPMKFNPSRWKNLVPKAGTFLPFGAGSRLCPGND  441

Query  459   MAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             +AK+ + ++LH     Y+    +P+ +++   H  R +  C  T+T
Sbjct  442   LAKLEISIFLHYFLLNYRLERVNPECTMQFLPH-RRPKDNCLATIT  486



>dbj|BAQ20602.1| ent-kaurenoic acid oxidase 1 [Lygodium japonicum]
Length=524

 Score =   219 bits (559),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 145/509 (28%), Positives = 247/509 (49%), Gaps = 40/509 (8%)
 Frame = -2

Query  1728  FLGLLVGIGIAVYLLRGQTV---------------------RSKSCIIPGKLGIPFLGET  1612
             + G+L G   AV L+ G  V                      S++ + PG +G P  G  
Sbjct  23    YFGVLAGGSYAVTLVIGSAVIPLLALVLCRFNSWYYEPSLRPSQAPLPPGDMGWPIFGNM  82

Query  1611  FSLLSA-----TNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFA  1447
                L A       S  G Y   R +R+     +K  +FG+  V   + +  K +   D  
Sbjct  83    LQFLFAFKWGDPQSFIGNY-IKRYKRI---GVYKAYMFGQPTVLATTPEACKFVLMGD-E  137

Query  1446  LFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFS-MNSLSIFVQKFDRM----LC  1282
             +F  G+ KS    +G+KS   +P   H+R+RRL S   +   +LS F+ +   +    + 
Sbjct  138   VFASGWPKSTEALMGRKSFTSIPPHEHRRLRRLTSATVNGPAALSKFMPRLQALATATMA  197

Query  1281  QRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVM  1102
             Q   +    G+   +L    K+TF+ +  M M  + G     +ER    ++D + + P+ 
Sbjct  198   QWAAQCAATGRPLPLLIELRKLTFNIIAEMFMGYSPGPKCDTVERYYRHLNDGVRAMPID  257

Query  1101  IPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLE  922
             +PGT Y+  +K+R RL+E  +  ID RR  M +     ++      ML +D   +  +L 
Sbjct  258   LPGTAYHTALKSRRRLVELLQEAIDERREAMEKEAGLRKEDMLETLMLTQDE--DGSRLT  315

Query  921   DEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLE  742
             DEE++D LL  + AG  ++A  +MW + LL  + +   +++EEQL I +NK    ++  E
Sbjct  316   DEEVIDLLLMYLNAGHESSAHTIMWILILLRAHPQYLAKVKEEQLEIRKNKKPNEILNWE  375

Query  741   DLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIY  562
             D   MTY S+VV ETLR+ N+     R +L++ +  G+ I KGWHV      +H DP +Y
Sbjct  376   DYRKMTYLSQVVDETLRLINISPMVFRKSLEDVEFNGYTIPKGWHVQTWMRQVHLDPQVY  435

Query  561   KDPTHFNPSRFD-EMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPD  385
              DP  F+P R++ E+ +  ++IPFG+G   C G + AK+ + +++H     Y+++   P+
Sbjct  436   PDPLKFDPDRWEREIPKAGAFIPFGAGAHMCPGNDFAKLEIALFIHYAALFYEFTPVSPN  495

Query  384   PSLERKAHIPRLRSGCPITLTAFNQGDYT  298
              ++    H PR +   P+ +      +YT
Sbjct  496   ATVIYLPH-PRPKDWYPVRVQKIGHFEYT  523



>gb|EYU19246.1| hypothetical protein MIMGU_mgv1a005723mg [Erythranthe guttata]
Length=473

 Score =   218 bits (555),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 137/447 (31%), Positives = 231/447 (52%), Gaps = 8/447 (2%)
 Frame = -2

Query  1653  IIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGA  1474
             + PG LGIPF+G++  LL A  +      ++  R   +G   K  +FGK  VF+      
Sbjct  30    VPPGSLGIPFIGQSLDLLWAMRANT-AEKWMSDRAKKYGPVSKMSLFGKPTVFIHGQAAN  88

Query  1473  KTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFD  1294
             K +FA+D  L N    +S+   +G + LL +  E HKRIR+ L+     +SL  ++ K +
Sbjct  89    KLVFASDGKLSNH-QTESVRMILGDRCLLELNGEDHKRIRKALALFLKPDSLKNYIGKIE  147

Query  1293  RMLCQRLEEQHRIGKS-FTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAML  1117
               +   LE  H +GK+   VL    K+TFD +C++L  +  G+    + +    + + M 
Sbjct  148   EEISIHLE-MHWVGKTEVKVLPLMKKLTFDIICSLLFGLERGARRDELVQYFQEMIEGMW  206

Query  1116  SFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPE  937
             S P  IP TR+ + +KA  R+ +  K +I  +R ++ +G ES  ++D +  +L       
Sbjct  207   SIPFNIPFTRFNRSLKASLRVQKMLKKLISEKRTQLAKGGESS-NQDLITCLLGIRGAHG  265

Query  936   SEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGA  757
              E + ++EI+ N++ +++AG  T++  + + V++L   + +   + +EQ  I +    G 
Sbjct  266   EEVISEDEIIHNVMLIMVAGYDTSSVLITFIVRVLANYSNVHEAVLKEQEEIKKGISYGC  325

Query  756   LITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHY  577
              +T EDL  M Y  +V  ETLRM   +    R  L+  + +G+ I KGW V    +  H 
Sbjct  326   FLTWEDLGKMKYTWEVAMETLRMVPPIFGGFRETLEEIEYQGYIIPKGWQVFWVTSMTHM  385

Query  576   DPAIYKDPTHFNPSRFDEMQR--PYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKW  403
             D  I+ +P+ F+P+RF+      PY Y+PFG G R C G   AK+  LV +H L +R+ W
Sbjct  386   DDNIFLEPSKFDPARFENPASIPPYVYVPFGGGARICPGYEFAKIETLVTIHYLVTRFNW  445

Query  402   SVDDPDPSLERKAHIPRLRSGCPITLT  322
              +   + S +R   +P    G PI +T
Sbjct  446   KLCCSNNSFKRDP-MPEPTHGLPIKIT  471



>ref|XP_010510015.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010510016.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X1 [Camelina 
sativa]
Length=489

 Score =   218 bits (556),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 136/468 (29%), Positives = 243/468 (52%), Gaps = 24/468 (5%)
 Frame = -2

Query  1701  IAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGR--WF  1528
             + V++   +    K  + PG LG P +G  +S L A   T     F+R+    +GR   +
Sbjct  28    VNVWIYESKLGEKKHYLPPGDLGWPVIGNMWSFLRAFK-TSDPESFIRSYNTRYGRTGIY  86

Query  1527  KTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRL  1348
             K  +FG   V V + +  + +  +D A F+ G+ KS    +G+KS + +  E HKR+RRL
Sbjct  87    KAHMFGYPCVLVTTAETCRRVLTDDDA-FHIGWPKSTMKLIGRKSFIGISFEEHKRLRRL  145

Query  1347  LSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDG  1171
              S P +   +LS+++Q  +  +   LE+  ++G+    L    K+TF  + ++ +S    
Sbjct  146   TSAPVNGPEALSVYLQYIEETVITDLEKWSKMGE-IEFLSHVRKLTFKIIMHIFLSSESE  204

Query  1170  SLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNES  991
              ++  +ER+ + ++  + +  + +PG  Y++ +KAR +L+  F++I+ +RR +  +G  S
Sbjct  205   HVMDALEREYTNLNYGVRAMGINLPGFAYHRALKARKKLVAVFQSIVTNRRNQREQG-VS  263

Query  990   DEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQ  811
                +D L  +++ +       L+DEEI+D LL  + AG  ++   +MWS  LL E+ EI 
Sbjct  264   SRRKDMLDNLIDVED-ENGRTLDDEEIIDILLMYLNAGHESSGHLIMWSTILLQEHPEIL  322

Query  810   NRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEG  631
              + ++EQ  I+R +  G  +TL++   M + S+V+ ETLR+    L   R A  + +I G
Sbjct  323   QKAKDEQERIVRKRAPGQKLTLKETREMEFLSQVIDETLRVITFSLTAFREAKSDVQING  382

Query  630   FDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQ-RPYSYIPFGSGPRTCLGINMA  454
             + I KGW V      +H DP IY DP  F+PSR+     +  +++PFG G   C G ++A
Sbjct  383   YIIPKGWKVLTWFRDVHLDPEIYPDPKKFDPSRWKGYTPKAGTFLPFGLGSHLCPGNDLA  442

Query  453   KVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLTAFNQ  310
             K+ + ++LH    +Y+               + R   GCP+     N+
Sbjct  443   KLEISIFLHHFLLKYR---------------VERSNPGCPVMFLPHNR  475



>ref|XP_008644980.1| PREDICTED: cytochrome P450 716B1-like [Zea mays]
 gb|AFW69200.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=483

 Score =   218 bits (555),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 130/435 (30%), Positives = 221/435 (51%), Gaps = 13/435 (3%)
 Frame = -2

Query  1695  VYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRI  1516
             +Y   G     K+ + PG  G+PF+G+T SL+ A  +     D++R     +G   + R+
Sbjct  31    LYASAGGKTNPKAPLPPGSFGLPFIGQTLSLVRALRANT-ADDWLRRWLAMYGPVSRLRL  89

Query  1515  FGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDP  1336
             FG    F+      K IFA+  A       +S A  VG++++  V  + H+R+R ++   
Sbjct  90    FGCPTAFLVGTSANKFIFAS--AAVTAKTPESFARMVGRRTIRDVVGDEHRRVRAMMMQF  147

Query  1335  FSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRR  1156
               ++++   V   D  + + L+ + R   +  V+     +TFD MC  +  +  G++ R 
Sbjct  148   LRVDAVKRHVASMDGEVRRHLDAEWRGRGTVAVMPSMKSLTFDVMCTAIFGLGTGAVRRD  207

Query  1155  IERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRD  976
             +  +   +   + + PV +P T Y + + A  R       +I  RR ++ RG ES    D
Sbjct  208   LWTEFQELVRGIWAVPVNLPFTAYSRCLAASQRGRRAVAGVIQERRAKLERG-ESSLASD  266

Query  975   FLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLRE  796
              +  ML       +E L DEEI+DN++ L++A   TTAA + + ++ LD + E  +R+ +
Sbjct  267   VVTLML-------TEGLPDEEIIDNVMFLMVAAHDTTAALLTFLIRQLDADKEAYDRVVQ  319

Query  795   EQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKK  616
             EQ  I R+K  G  ++ EDL  M Y      ETLRM   +    R  +D+ +  G+ I K
Sbjct  320   EQEEIARSKVAGEALSWEDLGRMRYTWLAAMETLRMVPPVFTMTRKTVDDVEYGGYLIPK  379

Query  615   GWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQR--PYSYIPFGSGPRTCLGINMAKVTM  442
             GW V   A   H+DPAI+ +P  F+P+RF+      P++++PFG G R C G   A+V  
Sbjct  380   GWQVIHAANMTHWDPAIFPEPGRFDPARFENPSAVPPFAFVPFGGGARVCPGNEFARVET  439

Query  441   LVYLHRLTSRYKWSV  397
             LV +H + +R++W +
Sbjct  440   LVTVHHIVTRFRWKL  454



>ref|XP_008375674.1| PREDICTED: ent-kaurenoic acid oxidase 1-like, partial [Malus 
domestica]
Length=422

 Score =   216 bits (551),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 127/405 (31%), Positives = 220/405 (54%), Gaps = 25/405 (6%)
 Frame = -2

Query  1530  FKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRR  1351
             +K  +FG   V V + + +K +  +D A F  G+  S  + +GKKS + + +E HKR+R+
Sbjct  14    YKAFMFGFPSVIVTTPETSKRVLTDDDA-FKPGWPVSTVELIGKKSFIGISYEEHKRLRK  72

Query  1350  LLSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITD  1174
             L + P +   +LS++++  + ++ + LE+  ++G+    L    K+TF  +  + +S   
Sbjct  73    LTAAPVNGHEALSVYMKYIEEIVVRSLEKWSKMGQ-IEFLTQLRKLTFKIIMYIFLSSES  131

Query  1173  GSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNE  994
              S++  +ER+ + ++  + +  + +PG  Y+K +KAR  L+  F++I+D RR +   GN 
Sbjct  132   ESVMEALEREYTVLNYGVRAMAINLPGFAYHKALKARKNLVAIFQSIVDDRRAQRKAGNY  191

Query  993   SDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEI  814
               + +D +  +L+ +   +  KL DEEI+D LL  + AG  ++   +MW+   L  N E 
Sbjct  192   YXKKKDMMDALLDVEE-DBGRKLTDEEIIDVLLMYLNAGHESSGHTIMWATVFLQANPEA  250

Query  813   QNRLREEQLSILRNKP---KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNC  643
               R + EQ  IL+ +P   KG  +TL++   M Y SKV+ ETLR+    L   R A  + 
Sbjct  251   FQRAKAEQEEILKRRPPTQKG--MTLKEYREMDYLSKVIDETLRVITFSLTVFREAKKDV  308

Query  642   KIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQ-RPYSYIPFGSGPRTCLG  466
             KI G+ I KGW V +    IHYD  +Y +P  FNPSR+D +  +  S++PFG+G   C G
Sbjct  309   KINGYSIPKGWKVLVWFRSIHYDSELYPNPMEFNPSRWDNLTPKALSFLPFGAGSHLCPG  368

Query  465   INMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPI  331
              ++AK+ + ++LH     YK               + R  +GCP+
Sbjct  369   NDLAKLEIAIFLHHFLLNYK---------------MERANAGCPL  398



>ref|XP_009414347.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Musa acuminata 
subsp. malaccensis]
Length=449

 Score =   217 bits (552),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 136/446 (30%), Positives = 228/446 (51%), Gaps = 22/446 (5%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKT  1468
             PG +G P++GET  L S   +      F  TR   +G  FKTR+ G   V + S + A+ 
Sbjct  16    PGSMGWPYVGETLQLYSQDPNA-----FFDTREKRYGEIFKTRLLGCPCVMLASPEAARF  70

Query  1467  IFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRM  1288
             +      LF   Y KS    +G  +L     + H R+R+L+    +  +L   V   +RM
Sbjct  71    VLVTRAHLFKPTYPKSKEQMIGPWALFFHQGDYHMRLRKLVQSSVAPVALRGLVTSVERM  130

Query  1287  LCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRR----IERDCSTVSDAM  1120
             +   LE    +G+         + +FD     ++++  G L  R    ++++ S V    
Sbjct  131   VVSMLESW--VGREVAAFHALKEFSFDVG---ILAVFGGRLDERSKAELKKNYSDVDKGY  185

Query  1119  LSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFP  940
              SFP  IPGT Y K I+AR RL      I++ RRR+ G       + D L  +++     
Sbjct  186   NSFPTCIPGTPYQKAIQARKRLGRIVGDIMNERRRKKGVW-----ENDLLGHLMDSKD-D  239

Query  939   ESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKG  760
             + E L D++I DN++ ++ A Q TTA+A+ W +K L ++ ++ + +R EQ+ I  +   G
Sbjct  240   KGELLTDDQIADNIVGVLFAAQDTTASALTWILKFLHDDPKLLDSVRAEQMVIQESNQLG  299

Query  759   AL-ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCI  583
             A  +T     +M    KV+ E+LRM++++ +  R A+ + + +GF I KGW V      I
Sbjct  300   ARPLTWSQTRSMVLTHKVILESLRMASIISFPFREAVADVEYKGFLIPKGWKVMPLFRNI  359

Query  582   HYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKW  403
             H++P  ++DP  F+PSRF+   +P +++PFGSG   C G  +AK+ ML+ +H L ++Y+W
Sbjct  360   HHNPEFFRDPWVFDPSRFEVAPKPNTFLPFGSGAHACPGNELAKLEMLILIHHLVTKYRW  419

Query  402   SVDDPDPSLERKAHIPRLRSGCPITL  325
              +      +E +   P  + G P  L
Sbjct  420   EIVGSQGEIEYRP-FPVPKHGLPAKL  444



>ref|XP_006484839.1| PREDICTED: taxadiene 5-alpha hydroxylase-like [Citrus sinensis]
Length=473

 Score =   217 bits (553),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 129/471 (27%), Positives = 233/471 (49%), Gaps = 17/471 (4%)
 Frame = -2

Query  1719  LLVGIGIAVYLL--RGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRL  1546
             LL  +   +  L  +    +++  + PG +G PF+GET     A  + +   DFV+ R  
Sbjct  12    LLAAVAAFIIFLTHKASCHKTRKQLPPGDMGHPFIGETIEFFKAQRNNRLFDDFVQPRVT  71

Query  1545  WHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESH  1366
              +G+ FKTR+ G   V V   +  +   +N+F L    +  S    +G +S++    E H
Sbjct  72    KYGKIFKTRLLGSPTVVVNGAEANRFFLSNEFKLVISSWPSSSVQLMGNESIMQKQGEQH  131

Query  1365  KRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLM  1186
             + IR +L+       L   V K    +   L+       S ++      +TF  +   L+
Sbjct  132   RCIRGILASCLHNAGLDALVPKICNSVQLHLDAHWHGQDSLSLYRSTKILTFTIVFECLL  191

Query  1185  SI-TDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRM  1009
              I  +  +L   ER    V + + +  +  PG+R+ +  KAR  + +    ++  +R  M
Sbjct  192   GIRVEPGMLNTFER----VLEGVFAPAIKFPGSRFSRAKKARQEIEKMLVKVVREKRNEM  247

Query  1008  GRGNESDED--RDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKL  835
               GNE +       +  M+  D       + + E+ DN++ L+ A   TT+ A+  + K+
Sbjct  248   EFGNEQEGMLLSQLVAGMIRGD-------ITEAEVTDNVVLLVFAAHDTTSFAIAMTFKM  300

Query  834   LDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVA  655
             L ++ +  + L +E ++I+ NK  G ++TLED+  + Y  +V +E++R+   +    R A
Sbjct  301   LAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKA  360

Query  654   LDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRT  475
             + + + EGF I KGW V   A   H +P  ++DP  F+P RF+E   PY Y+PFG GPR 
Sbjct  361   VSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRL  420

Query  474   CLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             C G  +AK+ +++++H + +RY WS+ +P+ S+     +P    G PI ++
Sbjct  421   CAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDP-LPFPSQGMPIKIS  470



>ref|XP_002879389.1| ent-kaurenoic acid hydroxylase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55648.1| ent-kaurenoic acid hydroxylase [Arabidopsis lyrata subsp. lyrata]
Length=489

 Score =   218 bits (554),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 145/498 (29%), Positives = 256/498 (51%), Gaps = 30/498 (6%)
 Frame = -2

Query  1788  ELGKLRMVFGSMVSHYYYDVFLGLLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETF  1609
             E G + M F  MV      +F+   V   + V++   +    K  + PG LG P +G  +
Sbjct  3     EPGLILMWFPLMV----LGLFVLKWVLKSVNVWIYESKLGEKKHYLPPGDLGWPIIGNMW  58

Query  1608  SLLSATNSTKGCYDFVRTRRLWHGR--WFKTRIFGKIHVFVPSVDGAKTIFANDFALFNK  1435
             S L A   T     F+++    +GR   +K  +FG   V V + +  + +  +D A F+ 
Sbjct  59    SFLRAFK-TSDPESFIQSYITRYGRTGIYKAHMFGYPCVLVTTPETCRRVLTDDDA-FHI  116

Query  1434  GYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFS-MNSLSIFVQKFDRMLCQRLEEQHR  1258
             G+ KS    +G+KS + +  E HKR+RRL S P +   +LS+++Q  +  +   LE+  +
Sbjct  117   GWPKSTMKLIGRKSFVGISFEEHKRLRRLTSAPVNGPEALSVYIQFIEETVITDLEKWSK  176

Query  1257  IGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYK  1078
             +G+    L    K+TF  +  + +S     ++  +ER+ + ++  + +  + +PG  Y++
Sbjct  177   MGE-IEFLSHLRKLTFKVIMYIFLSSESEHVMDALEREYTNLNYGVRAMGINLPGFAYHR  235

Query  1077  GIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLE-RDSFPESEKLEDEEIMDN  901
              +KAR +L+  F++I+ +RR +  + N S   +D L  +++ +D       L+DEEI+D 
Sbjct  236   ALKARKKLVAAFQSIVTNRRNQR-KQNISSNRKDMLDNLIDVKDE--NGRVLDDEEIIDL  292

Query  900   LLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTY  721
             LL  + AG  ++    MW+  L+ E+ EI  + +EEQ  I++N+  G  +TL++   M Y
Sbjct  293   LLMYLNAGHESSGHLTMWATILMQEHPEILQKAKEEQERIVKNRALGQKLTLKETREMEY  352

Query  720   ASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFN  541
              S+V+ ETLR+    L   R A  + +I+G+ I KGW V      +H DP IY DP  F+
Sbjct  353   LSQVIDETLRVITFSLTAFREAKSDVQIDGYIIPKGWKVLTWFRNVHLDPEIYPDPKKFD  412

Query  540   PSRFDEMQ-RPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKA  364
             PSR++    +  +++PFG G   C G ++AK+ + ++LH    RY+              
Sbjct  413   PSRWEGYTPKAGTFLPFGLGSHLCPGNDLAKLEISIFLHHFLLRYR--------------  458

Query  363   HIPRLRSGCPITLTAFNQ  310
              + R   GCP+     N+
Sbjct  459   -VERSNPGCPVMFLPHNR  475



>ref|XP_004510263.1| PREDICTED: beta-amyrin 11-oxidase-like [Cicer arietinum]
Length=492

 Score =   218 bits (554),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 131/446 (29%), Positives = 228/446 (51%), Gaps = 25/446 (6%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGR--WFKTRIFGKIHVFVPSVDGA  1474
             PG +G P +G  F+ +   +S +    F+    L +GR   +KT + G   + +   +  
Sbjct  45    PGHMGWPLIGNLFTFIQDFSSGQP-DSFITNLILKYGRNGIYKTHLLGNPSIIICEPEMC  103

Query  1473  KTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPF-SMNSLSIFVQKF  1297
             + +  +D   FN GY KS+      + ++ V +E  K  RR++  P      L+I++++ 
Sbjct  104   RRVLLDDVN-FNLGYPKSIKKLARCRPMVDVSNEERKHFRRVIIAPIVGHKELAIYIERL  162

Query  1296  DRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAML  1117
             + ++   LEE   +      L    K++F A+ ++ M  ++ ++++ I    + +   M 
Sbjct  163   EDIVVNSLEELSSMKHPIEFLKEMKKVSFKAIVHVFMGCSNENIIKNIGSSLNDLYKGMF  222

Query  1116  SFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLE-RDSFP  940
             S P+  PG  ++K +KAR ++ +  ++++D RR R+  G +  E +D +  +LE +D   
Sbjct  223   SIPINAPGFTFHKALKARKKIGKIVQSVVDERRLRIKNGEQVGEKKDLMDILLEVKDE--  280

Query  939   ESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKG  760
                KLEDE+I D LL L+ AG  +TA  +MWSV  L ++  I  + +EEQ  ILR +P  
Sbjct  281   NGRKLEDEDISDLLLGLLFAGHESTATGLMWSVTYLTQHPHILKKAKEEQEEILRTRPTS  340

Query  759   -ALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCI  583
                ++L ++  M Y S V+ E LR +N+     R A+ +  I G+ I KGW V I A  I
Sbjct  341   LKRLSLNEVKQMVYLSHVINEMLRCANIAFSTFREAICDVNINGYLIPKGWKVLIWARAI  400

Query  582   HYDPAIYKDPTHFNPSRFDEMQ-RPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYK  406
             H     Y +P  FNPSR+D    +  +++PFG+G R C G ++AK+ + ++LH     Y+
Sbjct  401   HMSDEYYPNPQEFNPSRWDNYTPKAGTFLPFGAGSRRCPGGDLAKLEISIFLHYFLLNYR  460

Query  405   WSVDDPDPSLERKAHIPRLRSGCPIT  328
                            + R+   CPIT
Sbjct  461   ---------------LERINPECPIT  471



>ref|XP_004229509.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X1 [Solanum 
lycopersicum]
Length=497

 Score =   218 bits (554),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 138/429 (32%), Positives = 233/429 (54%), Gaps = 18/429 (4%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGR--WFKTRIFGKIHVFVPSVDGA  1474
             PG LG PF+G  +S L A  S      F+ +     GR   +K  +FG   V + + +G 
Sbjct  48    PGDLGWPFIGTMWSFLRAFKSNNPD-SFINSFISRFGRTGIYKAFMFGSPCVIITTPEGC  106

Query  1473  KTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFS-MNSLSIFVQKF  1297
             + +  +D A F  G+ KS  + +GKKS + + +E HK +R+L + P +   +LS+++Q  
Sbjct  107   RKVLNDDEA-FKPGWPKSTMELIGKKSFIGISYEEHKWLRKLTAAPVNGHEALSMYIQYI  165

Query  1296  DRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAML  1117
             +  +   L++   + +    L    K+TF  +  + +S     ++  +E++ +T++  + 
Sbjct  166   EERVISALDKWSSM-EEVEFLTHMRKLTFRIIMYIFLSTESEQVMDDLEKEYTTLNYGVR  224

Query  1116  SFPVMIPGTRYYKGIKARGRLMETFKTIIDSRR-RRMGRGNESDEDR-DFLQEMLERDSF  943
             +  V +PG  YYK +KAR  L+  F++I+D RR R+  RG E  +D  D L E+ + +  
Sbjct  225   AMAVNLPGFAYYKALKARKNLVAIFQSIVDERRARKEKRGLEDKKDMMDILLEVQDENG-  283

Query  942   PESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKP-  766
                 KL DEEI+D L+  + AG  ++    MW    L ++ +   + +EEQ SI++N+P 
Sbjct  284   ---RKLNDEEIIDVLVMYLNAGHESSGHITMWVTYFLQKHPDFFKKAKEEQESIVKNRPA  340

Query  765   --KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDA  592
               KG  +TL+++  M Y SKV+ ETLR+        R A ++  I G+ I KGW V +  
Sbjct  341   EQKG--LTLKEIRNMDYLSKVIDETLRLITFSFVVFREAKEDVAIHGYTIPKGWKVLVWF  398

Query  591   TCIHYDPAIYKDPTHFNPSRFDEMQ-RPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTS  415
               +H DP IYKDP  FNPSR+D +  +  +++PFG G R C G ++AK+ + ++LH    
Sbjct  399   RSVHLDPEIYKDPLEFNPSRWDGLTPKVGTFLPFGGGGRLCPGNDLAKLEISIFLHYFLL  458

Query  414   RYKWSVDDP  388
              Y+    +P
Sbjct  459   DYELERKNP  467



>ref|XP_002278616.2| PREDICTED: cytochrome P450 716B1-like [Vitis vinifera]
Length=474

 Score =   217 bits (552),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 128/449 (29%), Positives = 223/449 (50%), Gaps = 6/449 (1%)
 Frame = -2

Query  1653  IIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGA  1474
             + PG LG+P +G++  LL A  +      ++  R   +G   K  +FG+  VF+      
Sbjct  28    VPPGSLGLPLIGQSIGLLRAMRANT-AEKWLEERIKKYGPISKLSLFGQSAVFIYGQAAN  86

Query  1473  KTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFD  1294
             K +FA+D +  +    KS    +G ++LL +  E HKR+R  +       SL  +V K D
Sbjct  87    KLVFASDGSTISNQQAKSNQMIMGDRNLLELSGEDHKRVRGAIVSFLKPESLKQYVGKMD  146

Query  1293  RMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLS  1114
               + + LE   +  +  TV+     +TF+ +C +L  +  G    ++      + + + S
Sbjct  147   AEVRKHLEMHWQGKQRVTVMPLMKTLTFNIICGLLFGVERGIRREKLVGRFQEMIEGIWS  206

Query  1113  FPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPES  934
              PV +P TRY + ++A  ++    K ++  +   + +G  +   +D +  +L        
Sbjct  207   VPVNLPFTRYNRSLQASTKIQNMIKELMREKEVELEKG--ASPHQDLITCLLSIHGKNNE  264

Query  933   EKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGAL  754
             E + ++EI+DN++ +++AG  T+A  + + V+LL  + ++   + +E   I + KP G  
Sbjct  265   EVITEKEIVDNVMLVMVAGHDTSAVLITFLVRLLANDPDVYAAVLKEHEEIAKGKPSGEF  324

Query  753   ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYD  574
             +T EDL  M Y  +V  ETLRM   +    R  L + +  G+ I +GW +       H D
Sbjct  325   LTWEDLAKMKYTWRVALETLRMVPPVFAGFRTVLKDIEFGGYLIPEGWKIFWATNMTHMD  384

Query  573   PAIYKDPTHFNPSRFDEMQR--PYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWS  400
              +I+ +PT F+P+RF+      PY +IPFG GPR C GI  A++  LV +H L +R+KW 
Sbjct  385   NSIFPEPTKFDPTRFENQASIPPYCFIPFGGGPRICPGIEFARIETLVTVHHLVTRFKWK  444

Query  399   VDDPDPSLERKAHIPRLRSGCPITLTAFN  313
             +   D    R    P    G PI +T+ N
Sbjct  445   LCHTDNFFGRNP-TPAPTGGLPIEITSMN  472



>ref|XP_004486505.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X2 [Cicer 
arietinum]
Length=490

 Score =   217 bits (553),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 132/462 (29%), Positives = 246/462 (53%), Gaps = 26/462 (6%)
 Frame = -2

Query  1719  LLVGIGIAVYLLRG------------QTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKG  1576
             +L+ IG+ + +LR             +    +  + PG +G PF+G  +S L A  S + 
Sbjct  11    VLMAIGVTLLVLRSILKNVNWLLYESKLGLKQYSLPPGDMGWPFIGNMWSFLRAFKS-RD  69

Query  1575  CYDFVRT--RRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVG  1402
                F+ +   R  HG  +K  +FG   V V + + ++ +  +D   F  G+ +S  + +G
Sbjct  70    PDSFISSFVSRYGHGGIYKGLMFGNPSVIVTTPEASRKVLIDD-ERFTPGWPQSTIELIG  128

Query  1401  KKSLLCVPHESHKRIRRLLSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFN  1225
             KKS + +P++ HKR+RRL S   + M +LS++++  +  +   LE+   +G+   + +  
Sbjct  129   KKSFIAMPYDEHKRLRRLTSSSINGMEALSLYLKYIEENVISSLEKWSNMGQIEFLTEIR  188

Query  1224  MKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMET  1045
              K+TF  + ++ +S     ++  +E++ +T++  + +  + IPG  YYK +KAR +L+  
Sbjct  189   -KLTFKIIMHIFLSSESEPVMEALEKEYTTLNYGVRAMQINIPGFAYYKALKARKKLVAI  247

Query  1044  FKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTT  865
             F++I+D  RR + +G    +  D +  +++ +      KL DE I+D +L  + AG  ++
Sbjct  248   FQSIVD-ERRSIRKGYSPKKANDMMDSLIDVED-DNGRKLSDEYIIDIMLMYLNAGHESS  305

Query  864   AAAMMWSVKLLDENTEIQNRLREEQLSILRNKP---KGALITLEDLNTMTYASKVVKETL  694
                 MW+   L ++ E   + +EEQ  I++ +P   KG  +TL+++  M +  KV+ ET+
Sbjct  306   GHITMWATYFLQKHPEYLQKAKEEQEEIIKKRPPTQKG--LTLKEIRAMDFLYKVIDETM  363

Query  693   RMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQR  514
             R+    L   R A  +  + G+ I KGW V +    IH DP IY +P  FNP+R++E  +
Sbjct  364   RVITFSLVVFREAKSDVSMNGYTIPKGWKVLVWFRSIHLDPEIYPNPKEFNPNRWNE-HK  422

Query  513   PYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDP  388
                ++PFG+G R C G ++AK+ + V+LH     Y+    +P
Sbjct  423   AGEFLPFGAGTRLCPGNDLAKMEIAVFLHHFILNYQLEQLNP  464



>ref|XP_007039941.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 
1 [Theobroma cacao]
 gb|EOY24442.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 
1 [Theobroma cacao]
Length=499

 Score =   217 bits (553),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 145/486 (30%), Positives = 254/486 (52%), Gaps = 29/486 (6%)
 Frame = -2

Query  1770  MVFGSMVSHYYYDVFLGLLVGIG--------IAVYLLRGQTVRSKSCIIPGKLGIPFLGE  1615
             M  GSM     + V L +L G+         +  +L   Q    +  + PG LG PF+G 
Sbjct  1     MEIGSM-----WMVLLAILAGLASVKWVLERVNWWLYESQLGDKQFSLPPGDLGWPFIGN  55

Query  1614  TFSLLSATNSTKGCYDFVRT--RRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALF  1441
              +S L A  S      F+R+   R  H   +K  +FG   V V   +  K +  +D A F
Sbjct  56    MWSFLRAFKSDDPD-SFIRSFVSRFGHIGIYKAFMFGNPSVIVTMPETCKRVLNDDDA-F  113

Query  1440  NKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFS-MNSLSIFVQKFDRMLCQRLEEQ  1264
               G+  +  + +GKKS + + +E HKR+RRL + P +   +LS+++Q  +  +   L++ 
Sbjct  114   KPGWPTATVELIGKKSFIGISYEEHKRLRRLTAAPVNGHEALSLYIQYIEENVISALDKW  173

Query  1263  HRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRY  1084
               +G+   + +   K+TF  +  + +S      +  +ER+ +T++  + +  + IPG  Y
Sbjct  174   SNMGEIEFLTELR-KLTFRIIMYIFLSSESEEEMEALEREYTTLNYGVRAMAINIPGFAY  232

Query  1083  YKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLE-RDSFPESEKLEDEEIM  907
             YK +KAR  L+  F++I++ +RR+  + N S + +D L  +++ +D   + E L+DEEI+
Sbjct  233   YKALKARKNLVAVFQSIVN-KRRKQKKINNSTKKKDMLDALIDVKDE--KGETLDDEEII  289

Query  906   DNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKP---KGALITLEDL  736
             D +L  + AG  ++   +MW+   L  + E   + + EQ  I++ +P   KG  ++L+D+
Sbjct  290   DIMLMYLNAGHESSGHTIMWATIFLQRHPEFLEKAKAEQERIIKKRPPTQKG--LSLKDI  347

Query  735   NTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKD  556
               M Y SKV+ ETLR+    L   R A+ +  I G+ I KGW V      +H DP IY +
Sbjct  348   REMDYLSKVIDETLRLVTFSLMVFREAITDVNISGYTIPKGWKVLTWFRSVHLDPEIYTN  407

Query  555   PTHFNPSRFDE-MQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPS  379
             P  FNPSR+D+   +  +++PFG+G R C G ++AK+ + ++LH     Y+    +P+  
Sbjct  408   PKEFNPSRWDDYAAKAGTFLPFGAGSRLCPGNDLAKLEIAIFLHHFLLNYQLERLNPESK  467

Query  378   LERKAH  361
             +    H
Sbjct  468   IRYLPH  473



>ref|XP_011098383.1| PREDICTED: taxadiene 5-alpha hydroxylase [Sesamum indicum]
Length=481

 Score =   217 bits (552),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 131/451 (29%), Positives = 232/451 (51%), Gaps = 9/451 (2%)
 Frame = -2

Query  1668  RSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVP  1489
             +SK  + PG++G+P++GET     A    +   DF++ R   HG+ FKTR+ G   V V 
Sbjct  34    KSKKRLPPGQMGLPWIGETIDFCKAQKKNRLYEDFIQARIQKHGKTFKTRLMGSPTVVVN  93

Query  1488  SVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIF  1309
               D  K   +N+F L    +  S    +G+ S++    E+H+ +R +++   S   + I 
Sbjct  94    GADANKFFLSNEFKLVVSSWPSSSVQLMGENSIMEKQGEAHRCLRAIVATSLSSAGMEIL  153

Query  1308  VQKFDRMLCQRLEEQHRIG-KSFTVLDFNMKITFDAMCNMLMSI-TDGSLLRRIERDCST  1135
             V +  R +   +E+    G K+ ++      +TF  +   L+ I     LL   ER    
Sbjct  154   VPRMCRTIQMHMEKYWNGGEKTISLYRLTKVLTFTIVLECLLGIEVKPGLLETFER----  209

Query  1134  VSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLE  955
             V + + + PV  PG+++ +   AR  +      II ++R  M +  E  E+   L   L 
Sbjct  210   VLEGVFAAPVNFPGSKFSRAKSARNEIANMLVEIIRTKRNDMEKQQEKGEEEGILLSRLV  269

Query  954   RDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILR  775
                     ++ + E++DN++ L+ A   TT+ A+  + ++L  + +  + L +E  +I+ 
Sbjct  270   AALI--RGEISEVEVVDNVVLLVFAAHDTTSFAIAMTFRMLAHHPDCYSTLFKEHNNIMS  327

Query  774   NKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNID  595
             +K  G  +T ED   MTY  +V +E++R+   +    R A+++ + +G+ I KGW V   
Sbjct  328   SKSPGETLTYEDTKKMTYTWQVARESIRVFPPIFGSFRKAIEDIEYDGYIIPKGWKVLWT  387

Query  594   ATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTS  415
             A   HY+   ++DP  F PSRF+E  +PY+Y+PFG GPR C G  +AK+ +L++LH + +
Sbjct  388   AYGTHYNQEYFEDPLRFKPSRFEEPIQPYAYVPFGGGPRLCAGYQLAKLNILIFLHYVVT  447

Query  414   RYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             RY+WS+  PD  +     +P    G PI ++
Sbjct  448   RYEWSLACPDEPITMDP-LPFPSQGMPIRVS  477



>ref|XP_002319447.1| ent-kaurenoic acid oxidase family protein [Populus trichocarpa]
 gb|EEE95370.1| ent-kaurenoic acid oxidase family protein [Populus trichocarpa]
Length=490

 Score =   217 bits (552),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 135/451 (30%), Positives = 238/451 (53%), Gaps = 13/451 (3%)
 Frame = -2

Query  1731  VFLGLLVGIGI----AVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDF  1564
             +F GL VG  I      +L   +    K  + PG LG PF+G  +S L+A  S+     F
Sbjct  13    IFCGLGVGQWILKRVNWWLYEAKLGAKKDSLPPGDLGWPFIGNMWSFLTAFKSSDPD-SF  71

Query  1563  VRT--RRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSL  1390
             +R+   R  H   +K  +FG   V V + +G + +  +D A F  G+  +    +G+KS 
Sbjct  72    IRSFVNRYGHTGIYKAFMFGNPSVLVTTPEGCRRLLTDDNA-FKPGWPLATLKLIGEKSF  130

Query  1389  LCVPHESHKRIRRLLSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKIT  1213
             + +P+E HKR+RRL S   +   +LS ++   ++ +   LE+   +G+    L    K+T
Sbjct  131   IDIPYEEHKRLRRLTSASVNGHEALSTYIPYIEQNVIAELEKWTTMGQ-IEFLTKMRKLT  189

Query  1212  FDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTI  1033
             F  +  + +S T   ++  +E++ +T++  + +  + +PG  YY+ +KAR +L+  F++I
Sbjct  190   FRIIIYIFLSKTSERVMEALEKEYTTLNYGIRAMAINLPGFAYYEALKARKKLVAIFQSI  249

Query  1032  IDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAM  853
             +D RR        + + +D +  +L+ +      KL DEE++D +L  + AG  ++    
Sbjct  250   VDGRRNLKKDDVTNTKKKDMMDSLLDVED-ENGRKLTDEEVIDIMLMYLNAGHESSGHIT  308

Query  852   MWSVKLLDENTEIQNRLREEQLSILRNKP-KGALITLEDLNTMTYASKVVKETLRMSNVL  676
              W+   L ++ E   + +EEQ  I++ +P     ++L+++  M Y SKV+ ETLRM    
Sbjct  309   TWATIFLQDHPEYFQKAKEEQEQIIKRRPLTQKRLSLKEVREMKYLSKVIDETLRMVTFS  368

Query  675   LWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQ-RPYSYI  499
             L   R A  +  + G+ I KGW V      IH DP +Y +P  FNPSR+D+   +  +++
Sbjct  369   LTVFREAKTDFCMNGYTIPKGWKVLAWFRTIHLDPEVYPNPKEFNPSRWDDYTPKAGTFL  428

Query  498   PFGSGPRTCLGINMAKVTMLVYLHRLTSRYK  406
             PFG+G R C G N+AK+ + ++LH     Y+
Sbjct  429   PFGAGSRLCPGNNLAKLEISIFLHYFLLDYR  459



>gb|EMT01609.1| Ent-kaurenoic acid oxidase 1 [Aegilops tauschii]
Length=491

 Score =   217 bits (552),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 136/450 (30%), Positives = 232/450 (52%), Gaps = 26/450 (6%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRW---FKTRIFGKIHVFVPSVDG  1477
             PG +G+PFLGET S +      +   DF+  +R  HG     ++T +FG   V   S   
Sbjct  54    PGHMGLPFLGETLSFVWHFKLARRPDDFIAAKRRAHGSGAGIYRTHLFGSPAVIACSPAA  113

Query  1476  AKTIF--ANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLL----SDPFSMNSLS  1315
              K +F  A++F     G    + + +G KS++ V   SH R+R ++    + P S+ +++
Sbjct  114   NKFVFQSADNF-----GIRWPVPELIGHKSMVNVEGASHARLRGIILTAINRPSSLRTIA  168

Query  1314  IFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCST  1135
               VQ     +   L     +G      +   K+TF  +  M +S+    L  +I++   +
Sbjct  169   AVVQP---RVVAALAAWADMGTIVASTEIK-KVTFANIFKMFISMEPSPLTEQIDQWFGS  224

Query  1134  VSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLE  955
             +   + +FP+  PGT ++   K R +L   F+  +++R++        D+  D L   L 
Sbjct  225   LMAGLRAFPLDFPGTTFHHARKCRRKLNAVFRHELEARKK-------VDKKCDDLMSGLM  277

Query  954   RDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILR  775
                  + ++L DEE++DN++ L++AG  +TA+A+MW+   L ++     +LREE +++  
Sbjct  278   CTEDEQGKRLSDEEVVDNMVNLVVAGYESTASAIMWATYHLAKSPAALAKLREENVAVSE  337

Query  774   NKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNID  595
             +K    +IT +DL  M Y +KVV+ET+RM+NV     RVA  + +  G+ I  GW V + 
Sbjct  338   SKGGSLMITHDDLPRMKYTAKVVEETIRMANVAPMVHRVANRDVEYGGYTIPAGWPVLVW  397

Query  594   ATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTS  415
                +H DP  Y+DP  FNP R+D+  +P +Y  FG G R C G  +AK+ + + LH L+ 
Sbjct  398   VRSLHTDPVYYQDPLTFNPDRWDKPVKPGTYQAFGGGYRICAGNMLAKLQITIMLHHLSI  457

Query  414   RYKWSVDDPDPSLERKAHIPRLRSGCPITL  325
              Y+W + +PD  +    H PR   G  +T 
Sbjct  458   GYEWELLNPDAKINYLPH-PRPLDGAAMTF  486



>sp|B5BSX1.1|BAMO_GLYUR RecName: Full=Beta-amyrin 11-oxidase; AltName: Full=Cytochrome 
P450 88D6 [Glycyrrhiza uralensis]
 dbj|BAG68929.1| cytochrome P450 88D6 [Glycyrrhiza uralensis]
Length=493

 Score =   217 bits (552),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 125/434 (29%), Positives = 230/434 (53%), Gaps = 9/434 (2%)
 Frame = -2

Query  1668  RSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYD-FVRTRRLWHGR--WFKTRIFGKIHV  1498
             R +  + PG +G P +G+  S +   +S  G  D F+    L +GR   +KT +FG   +
Sbjct  38    RKEHPLPPGDMGWPLIGDLLSFIKDFSS--GHPDSFINNLVLKYGRSGIYKTHLFGNPSI  95

Query  1497  FVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPF-SMNS  1321
              V      + +  +D   F  GY KS+ +    + ++ V +  H+  RRL++ P     +
Sbjct  96    IVCEPQMCRRVLTDDVN-FKLGYPKSIKELARCRPMIDVSNAEHRLFRRLITSPIVGHKA  154

Query  1320  LSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDC  1141
             L++++++ + ++   LEE   +     +L    K++F A+ ++ M  ++  ++++I    
Sbjct  155   LAMYLERLEEIVINSLEELSSMKHPVELLKEMKKVSFKAIVHVFMGSSNQDIIKKIGSSF  214

Query  1140  STVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEM  961
             + + + M S P+ +PG  ++K ++AR +L +  + ++D RR  +  G +    R  L ++
Sbjct  215   TDLYNGMFSIPINVPGFTFHKALEARKKLAKIVQPVVDERRLMIENGPQEGSQRKDLIDI  274

Query  960   LERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSI  781
             L         KLEDE+I D L+ L+ AG  +TA ++MWS+  L ++  I  + +EEQ  I
Sbjct  275   LLEVKDENGRKLEDEDISDLLIGLLFAGHESTATSLMWSITYLTQHPHILKKAKEEQEEI  334

Query  780   LRNK-PKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHV  604
              R +      ++L+++  M Y S+V+ ETLR +N+     R A  +  I G+ I KGW V
Sbjct  335   TRTRFSSQKQLSLKEIKQMVYLSQVIDETLRCANIAFATFREATADVNINGYIIPKGWRV  394

Query  603   NIDATCIHYDPAIYKDPTHFNPSRFDEMQ-RPYSYIPFGSGPRTCLGINMAKVTMLVYLH  427
              I A  IH D   Y +P  FNPSR+D+   +  +++PFG+G R C G ++AK+ + ++LH
Sbjct  395   LIWARAIHMDSEYYPNPEEFNPSRWDDYNAKAGTFLPFGAGSRLCPGADLAKLEISIFLH  454

Query  426   RLTSRYKWSVDDPD  385
                  Y+    +P+
Sbjct  455   YFLRNYRLERINPE  468



>ref|XP_010556999.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Tarenaya hassleriana]
 ref|XP_010557000.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Tarenaya hassleriana]
Length=491

 Score =   217 bits (552),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 135/432 (31%), Positives = 230/432 (53%), Gaps = 13/432 (3%)
 Frame = -2

Query  1662  KSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRW--FKTRIFGKIHVFVP  1489
             K  + PG LG+PF+G     L A   +     F R+    +G    +KT +FG   V V 
Sbjct  41    KHYLPPGDLGLPFIGNMRPFLKAFKGSDPD-SFTRSLITKYGNTGVYKTHLFGNPSVLVT  99

Query  1488  SVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFS-MNSLSI  1312
             + D  + + A+D + F  G+ KS  + +GKKS + +  E HKR+RRL + P +   +LS+
Sbjct  100   TPDTCRRVLADDES-FGPGWPKSTMELIGKKSFIGISFEEHKRLRRLTAAPVNGHEALSV  158

Query  1311  FVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTV  1132
             +++  +  +   LE+  ++G+ F  L    K+TF  +  + +S     ++  +ER  + +
Sbjct  159   YIEYIEENVISALEKWSKMGE-FEFLTHLRKLTFRIIMYIFLSSESEHIMEAMERVYTDL  217

Query  1131  SDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRR-RRMGRGNESDEDRDFLQEMLE  955
             +  + +  + +PG  Y+KG+KAR +L+   ++ +D RR +RM   N + + +D L  +++
Sbjct  218   NYGVRAMAINLPGFAYHKGLKARKKLVAILQSAVDERRNKRMQ--NITSKRKDMLDNLMD  275

Query  954   RDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILR  775
              +       L+DEEI+D LL  + AG  ++   +MW+   L EN E   + +EEQ  IL+
Sbjct  276   VED-ENGRHLDDEEIIDVLLMYLNAGHESSGHTIMWATIFLQENPEYLQKAKEEQERILK  334

Query  774   NKPKGAL-ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNI  598
              +P G   +TL++   M Y S+VV ETLR+    L   R A  +  + G+ I KGW V  
Sbjct  335   KRPAGQKGLTLKETREMEYLSQVVDETLRVITFSLTVFREAKTDVNVNGYLIPKGWKVLT  394

Query  597   DATCIHYDPAIYKDPTHFNPSRFDEMQRPY--SYIPFGSGPRTCLGINMAKVTMLVYLHR  424
                 +H DP IY +P  FNP R+D+   P   +++PFG G   C G ++AK+ + ++LH 
Sbjct  395   WFRNVHLDPEIYPNPKKFNPDRWDDGFTPKAGAFLPFGGGRHLCPGNDLAKLEVSIFLHH  454

Query  423   LTSRYKWSVDDP  388
                 Y+    +P
Sbjct  455   FLLNYRVERSNP  466



>ref|XP_002437500.1| hypothetical protein SORBIDRAFT_10g028220 [Sorghum bicolor]
 gb|EER88867.1| hypothetical protein SORBIDRAFT_10g028220 [Sorghum bicolor]
Length=482

 Score =   216 bits (551),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 128/430 (30%), Positives = 218/430 (51%), Gaps = 13/430 (3%)
 Frame = -2

Query  1680  GQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIH  1501
             G+    K+ + PG  G+PF+G+T SLL A  +     D++R     +G   + R+FG   
Sbjct  35    GKKTNPKAPLPPGSFGLPFIGQTLSLLRALRANT-ADDWLRRCVATYGPVSRLRLFGCPT  93

Query  1500  VFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNS  1321
              F+      K IFA+  A       +S A  VG++++  V  + H+R+R ++     +++
Sbjct  94    AFLVGTSANKFIFAS--AAVTAKAPESFARMVGRRTIRDVVGDEHRRVRAMMVQFLRVDA  151

Query  1320  LSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDC  1141
             +   V   D  + + L+ + R   +  V+     +TFD MC  +  +  G++ R +  + 
Sbjct  152   VKRHVASMDGEVRRHLDAEWRGRGTVAVMPSMKSLTFDVMCTAIFGLGTGAVRRELWTEF  211

Query  1140  STVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEM  961
               +   +   PV +P T Y + + A  R       +I  RR ++ RG ES    D +  M
Sbjct  212   QELVRGIWEVPVDLPFTTYSRCLAASQRGRRAVAGVIQERRTKLERG-ESSPASDVVTLM  270

Query  960   LERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSI  781
             L       +E L DEEI+DN++ L++A   TTAA + + ++ LD + +  +++ +EQ  I
Sbjct  271   L-------AEGLPDEEIIDNVMFLMVAAHDTTAALLTFLIRQLDADKDAYDKVVQEQEEI  323

Query  780   LRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVN  601
              R+K  G  +T EDL  M Y      ETLRM   +    R  +D+ +  G+ I KGW V 
Sbjct  324   ARSKAAGEALTWEDLGRMRYTWAAALETLRMVPPVFTMMRKTVDDVEYGGYLIPKGWQVI  383

Query  600   IDATCIHYDPAIYKDPTHFNPSRFDEMQR--PYSYIPFGSGPRTCLGINMAKVTMLVYLH  427
               A    +DPAI+ +P  F+P+RF+      P++++PFG G R C G   A+V  LV +H
Sbjct  384   HAANMTQWDPAIFPEPGRFDPARFENASAVPPFAFVPFGGGARVCPGNEFARVETLVAMH  443

Query  426   RLTSRYKWSV  397
              + +R++W +
Sbjct  444   HIVTRFRWKL  453



>gb|AEH41592.1| abscisic acid 8'-hydroxylase [Ipomoea nil]
Length=466

 Score =   216 bits (550),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 137/444 (31%), Positives = 232/444 (52%), Gaps = 21/444 (5%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKT  1468
             PG LG P++GETF L S   +      F  ++   +G  FKT I G   V + S + AK 
Sbjct  32    PGTLGWPYIGETFQLYSQDPNV-----FFASKVKKYGSIFKTHILGCPCVMISSPEAAKV  86

Query  1467  IFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRM  1288
             +      LF   +  S    +GK+++     + H ++R+L+   F  ++L   VQ  D +
Sbjct  87    VLVTKAHLFKPTFPASKERMLGKQAIFFHQGDYHFKLRKLVLRAFMPDALKNAVQDIDSI  146

Query  1287  LCQRLEE-QHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSF  1111
                 ++  + R+  +F  +      TF+     ++   +      ++R   T+     S 
Sbjct  147   AKHTVQSWEGRLINTFQEMK---TYTFNVALLSILGKDEVIYREDLKRCYYTLEKGYNSM  203

Query  1110  PVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESE  931
             PV IPGT ++K +KAR  L +    I+  RR  M + N+S  D       L      ++E
Sbjct  204   PVNIPGTLFHKAMKARKELAQILGEILSIRRSTM-KNNDSPND-------LVGSFMGDNE  255

Query  930   KLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALI  751
              L DE+I DN++ +I A + TTA+ + W +K L EN  +   + EEQ +IL+ K +G ++
Sbjct  256   GLTDEQIADNIIGVIFAARDTTASVLTWVLKYLAENPSVLEAVTEEQEAILKGK-EGQVL  314

Query  750   TLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDP  571
               E    M   S+V++ETLR++++L +  R A+++ + EG+ I KGW V      IH+ P
Sbjct  315   CWEHTKKMPLTSRVIQETLRVASILSFTFREAVEDVEFEGYLIPKGWKVLPLFRNIHHSP  374

Query  570   AIYKDPTHFNPSRFDEMQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDD  391
               + DP  F+PSRF+E  +P +++PFGSG   C G  +AK+ +L+ +H LT++Y+WS+  
Sbjct  375   ENFPDPEKFDPSRFEEAPKPNTFMPFGSGIHACPGNELAKLEILILVHHLTTKYRWSMVG  434

Query  390   PDPSLERKAH-IPRLRSGCPITLT  322
             P   ++     +P  ++G PI L+
Sbjct  435   PQNGIQYGPFALP--QNGLPIRLS  456



>ref|XP_007209946.1| hypothetical protein PRUPE_ppa004753mg [Prunus persica]
 gb|EMJ11145.1| hypothetical protein PRUPE_ppa004753mg [Prunus persica]
Length=493

 Score =   216 bits (551),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 134/461 (29%), Positives = 235/461 (51%), Gaps = 17/461 (4%)
 Frame = -2

Query  1731  VFLGLLVGIGIAVYLLR--------GQTVRSKSCIIPGKLGIPFLGETFSLLSATNST-K  1579
             VF   + G G  V +LR         +    +  + PG +G PFLG T S L A  S   
Sbjct  9     VFTASIGGFGALVLILRRANEWYFVSRLGERQKTLPPGDMGWPFLGNTLSFLKALKSDDP  68

Query  1578  GCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGK  1399
               +     +R      +K  +FGK  + V + +  + +  +    F  G+ KS +D +G+
Sbjct  69    DSFISNYVKRYGSTGIYKAYLFGKPTIIVTAPETCRQVLMDSLQ-FKTGWPKSTSDLMGR  127

Query  1398  KSLLCVPHESHKRIRRLLSDPFSMN-SLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNM  1222
             KS + +    HKR+RRL + P S + +LS++ +     +   L+E  +  +    L    
Sbjct  128   KSFMSLSEGEHKRLRRLTAAPISGHKALSMYHEYIKDAIVSSLDELAKAERPIEFLTEIR  187

Query  1221  KITFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETF  1042
             KITF  +  + +S   G ++  +E++ + ++  + +  + +PG  ++K +KAR ++    
Sbjct  188   KITFKIIMFIFLSCETGPMMETMEKEYAILNHGLRAMAINLPGFAFHKALKARKKMAMII  247

Query  1041  KTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTA  862
             + ++D RR R  +GN   ++R  L ++L        + L+DEEI+D +L  + AG  +TA
Sbjct  248   QDVVDGRRAR--KGNNLSQERTDLMDLLMEVEDENGKTLDDEEIIDIILMYLNAGYESTA  305

Query  861   AAMMWSVKLLDENTEIQNRLREEQLSILR--NKPKGALITLEDLNTMTYASKVVKETLRM  688
              A +W+   L+E+ E   + + EQ+ IL+  + P+  L   +    M Y SKV+ ETLR+
Sbjct  306   HATLWATLFLNEHPEYYQKAKAEQVEILKRESSPEEGL-NFKGTKQMEYLSKVINETLRV  364

Query  687   SNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQ-RP  511
              NV L+  R A  +  + G+ I KGW V +    +H +P  Y DP  FNPSR++E + + 
Sbjct  365   VNVSLYGYREAATDANVSGYTIPKGWKVMMWYRGVHLNPEYYPDPKEFNPSRWNENKGKA  424

Query  510   YSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDP  388
              ++IPFG G R C G ++ K+ + ++LH     Y+    +P
Sbjct  425   GTFIPFGIGSRLCPGSDLTKLEISIFLHYFLLHYELERLNP  465



>ref|XP_006398206.1| hypothetical protein EUTSA_v10000876mg [Eutrema salsugineum]
 gb|ESQ39659.1| hypothetical protein EUTSA_v10000876mg [Eutrema salsugineum]
Length=467

 Score =   216 bits (549),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 137/478 (29%), Positives = 242/478 (51%), Gaps = 27/478 (6%)
 Frame = -2

Query  1740  YYDVFLGLLVGIGIAVYLLR-----GQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKG  1576
             +  VFL +L  + + + LLR      ++  SK  + PG +G P++GETF L S   +   
Sbjct  3     FSGVFL-ILFTVALFLCLLRFAAGFRRSSSSKLPLPPGTMGYPYIGETFQLYSQDPNV--  59

Query  1575  CYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKK  1396
                F  +++  +G  FKT + G   V + S + AK +      LF   +  S    +GK+
Sbjct  60    ---FFASKQRRYGSVFKTHVLGCPCVMISSPEAAKFVLVTKSHLFKPTFPASKERMLGKQ  116

Query  1395  SLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKI  1216
             ++     + H ++R+L+   F  +S+   V   + +  + L      G            
Sbjct  117   AIFFHQGDYHSKLRKLVLRAFMPDSIRNMVPNIESIAQESLNSWD--GTQLNTYQEMKTY  174

Query  1215  TFDAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKT  1036
             TF+     ++   +      ++R    +     S P+ +PGT ++K +KAR  L +    
Sbjct  175   TFNVALISILGKDEVFYREDLKRCYYILEKGYNSMPINLPGTLFHKAMKARKELAQILAK  234

Query  1035  IIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAA  856
             I+  RR+  G        +D L   +E     + E L DE+I DN++ +I A + TTA+ 
Sbjct  235   ILSKRRQNSG------SYKDLLGSFME-----DKEGLSDEQIADNIIGVIFAARDTTASV  283

Query  855   MMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVL  676
             + W +K L +N  +   + EEQ++I + K +G  +T ED   MT  S+VV+ET+R++ +L
Sbjct  284   LTWILKYLADNPTVLEAVTEEQMAIRKTKKEGESLTWEDTKKMTLTSRVVQETMRVATIL  343

Query  675   LWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIP  496
              +  R A+++ + EG+ I KGW V      IH++   + DP  F+PSRF+  Q+P +++P
Sbjct  344   SFTFREAVEDVEYEGYLIPKGWKVLPLFRNIHHNADFFSDPGKFDPSRFEVAQKPNTFMP  403

Query  495   FGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAH-IPRLRSGCPITL  325
             FGSG  +C G  +AK+ + + +H LT++Y+WS+  P   ++     +P  ++G PI L
Sbjct  404   FGSGIHSCPGNELAKLEISILIHHLTTKYRWSIVGPSDGIQYGPFALP--QNGLPIAL  459



>ref|XP_006294074.1| hypothetical protein CARUB_v10023069mg [Capsella rubella]
 ref|XP_006294075.1| hypothetical protein CARUB_v10023069mg [Capsella rubella]
 gb|EOA26972.1| hypothetical protein CARUB_v10023069mg [Capsella rubella]
 gb|EOA26973.1| hypothetical protein CARUB_v10023069mg [Capsella rubella]
Length=498

 Score =   216 bits (551),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 131/443 (30%), Positives = 236/443 (53%), Gaps = 9/443 (2%)
 Frame = -2

Query  1701  IAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRW--F  1528
             + V++   +    K  + PG LG P +G  +S L A   T     F+R+    +GR   +
Sbjct  37    VNVWIYECKLGEEKHYLPPGDLGWPVIGNMWSFLRAFK-TSDPESFIRSYNTRYGRTGIY  95

Query  1527  KTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRL  1348
             K  +FG   V V + +  + +  +D A F  G+ KS    +G+KS + + +E HKR+RRL
Sbjct  96    KAHMFGYPCVIVTTPETCRRVLTDDDA-FQIGWPKSTMKLIGRKSFIGISYEEHKRLRRL  154

Query  1347  LSDPFS-MNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDG  1171
              S P +   +LS+++Q  +  +   LE+  ++G+    L    K+TF  +  + +S    
Sbjct  155   TSAPVNGPEALSVYIQYIEETVITDLEKWSKMGE-IEFLSHLRKLTFKVIMYIFLSSESE  213

Query  1170  SLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNES  991
              ++  +ER+ + ++  + +  + +PG  Y++ +KAR +L+  F++I+ +RR +  + N S
Sbjct  214   HVMDALEREYTNLNYGVRAMGINLPGFAYHRALKARKKLVAVFQSIVTNRRNQR-KQNVS  272

Query  990   DEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQ  811
                +D L  +++ +       L+DEEI+D LL  + AG  ++    MWS  L+ E+ EI 
Sbjct  273   SNRKDMLDNLIDVED-ENGRTLDDEEIIDVLLMYLNAGHESSGHLTMWSTILMHEHPEIL  331

Query  810   NRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEG  631
              + +EEQ  I++ +  G  +TL++   M Y S+V+ ET R+    L   R A  + +I G
Sbjct  332   QKAKEEQERIVKKRAPGQKLTLKETREMEYLSQVIDETFRIITFSLTAFREAKSDVQING  391

Query  630   FDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQ-RPYSYIPFGSGPRTCLGINMA  454
             + I KGW V      +H DP IY DP  F+PSR++    +  +++PFG G   C G ++A
Sbjct  392   YIIPKGWKVLTWFRDVHLDPEIYPDPKKFDPSRWEGYTPKAGTFLPFGLGSHLCPGNDLA  451

Query  453   KVTMLVYLHRLTSRYKWSVDDPD  385
             K+ + ++LH    +Y+    +P+
Sbjct  452   KLEISIFLHHFLLKYRVERSNPE  474



>ref|XP_008232239.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Prunus mume]
Length=499

 Score =   216 bits (551),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 138/444 (31%), Positives = 235/444 (53%), Gaps = 14/444 (3%)
 Frame = -2

Query  1647  PGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRW--FKTRIFGKIHVFVPSVDGA  1474
             PG LG PF+G  +S L A  S+     FV +     GR   +K  +FG   V V + + +
Sbjct  53    PGDLGWPFIGNMWSFLKAFKSS-NPETFVNSLVSRFGRTGIYKAFMFGSPSVIVTTPESS  111

Query  1473  KTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMN-SLSIFVQKF  1297
             K +  +D A F  G+  S  + +GK S + + +E HKR+RRL + P + + +LS++++  
Sbjct  112   KRVLTDDDA-FKPGWPLSTLELIGKNSFIGISYEEHKRLRRLTAAPVNGHEALSMYMKYI  170

Query  1296  DRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTVSDAML  1117
             + M+   LE+  ++G+    L    K+TF  +  + +S     ++  +ER+ + ++  + 
Sbjct  171   EDMVVTSLEKWSKMGE-IEFLTQLRKLTFRIIMYIFLSSESEPVMDALEREYTILNYGVR  229

Query  1116  SFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPE  937
             +  + +PG  Y+K +KAR  L+ TF++I+D RR +   GN   + +D +  +L+     +
Sbjct  230   AMAINLPGFAYHKALKARKNLVSTFQSIVDERRTQRKSGNYMPKKKDMMDALLDVVDD-D  288

Query  936   SEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKP---  766
               KL D EI+D LL  + AG  ++   +MW+   L ++ E   + + EQ  IL+ +P   
Sbjct  289   GRKLTDSEIIDVLLMYLNAGHESSGHIIMWATIFLQKHPEYFQKAKVEQEEILKRRPPTQ  348

Query  765   KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATC  586
             KG  + L++   M + S V+ ETLR+    L   R A  +  I G+ + KGW V +    
Sbjct  349   KG--LMLKEYREMVFLSNVIDETLRVVTFSLTVFREAKKDVNINGYSVPKGWKVLVWFRS  406

Query  585   IHYDPAIYKDPTHFNPSRFDEMQ-RPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRY  409
             IHYD  IY +P  FNP R+D    +P +++PFG+G R C G ++AK+ + ++LH     Y
Sbjct  407   IHYDSEIYPNPLEFNPDRWDNYTPKPLTFLPFGAGSRLCPGNDLAKLEIAIFLHHFLLNY  466

Query  408   KWSVDDPDPSLERKAHIPRLRSGC  337
             K    +PD  L    H  R +  C
Sbjct  467   KMERTNPDGPLMYLPHT-RPKDNC  489



>emb|CDP09339.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   216 bits (550),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 127/441 (29%), Positives = 236/441 (54%), Gaps = 12/441 (3%)
 Frame = -2

Query  1692  YLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSA---TNSTKGCYDFVRTRRLWHGRWFKT  1522
             +L   +    +  + PG LG PF+G  ++ L A   +N       FV   R      +KT
Sbjct  31    WLFEAKLGDRRFSLPPGDLGWPFIGTMWAFLRAFKSSNPDSFISSFVN--RFGPVGLYKT  88

Query  1521  RIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLS  1342
              +FG   + V + +  K +  +D A F  G+  S    +G+KS + +  + HKR+R+L +
Sbjct  89    MMFGSPSIIVTTPEACKRVLTDDEA-FMPGWPSSTLTLMGRKSFIGISAQEHKRLRKLTA  147

Query  1341  DPFSMN-SLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSL  1165
              P + + +LSI+++  +  + + LE+   +G+    L    K+TF  + ++ +      +
Sbjct  148   APVNGHEALSIYLKYIEDNVIEALEKWAGMGQ-IEFLTQLRKLTFRIITHIFLGSESEQV  206

Query  1164  LRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDE  985
             +  +ER+ + ++  + +  + +PG  YY  +KAR RL+  F++++  RR R  + N + E
Sbjct  207   MEALEREYTVLNHGVRAMSINVPGFAYYNALKARKRLVAIFQSVVTERRARR-KENSTAE  265

Query  984   DRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNR  805
              RD +  +++     +  KL+DEEI+D L+  + AG  ++    MW+   L +N E+  +
Sbjct  266   KRDMMDALMDAVD-DKGRKLDDEEIIDVLVMYLNAGHESSGHVSMWATLFLQKNPEVLQK  324

Query  804   LREEQLSILRNKPKGAL-ITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGF  628
              + EQ +I++N+P G + +TL+++  M Y SKV+ ETLR+        R A  +  I GF
Sbjct  325   AKAEQEAIVKNRPPGQVGLTLKEIRQMDYLSKVIDETLRVVTFSFVVFREAQKDINISGF  384

Query  627   DIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEM-QRPYSYIPFGSGPRTCLGINMAK  451
              I KGW   +    +H+DP +Y +P  F+P R+D +  +  +++PFG+G RTC G ++AK
Sbjct  385   TIPKGWKALVWFRNVHFDPELYPEPKKFDPDRWDGLTAKAGTFLPFGAGARTCPGNDLAK  444

Query  450   VTMLVYLHRLTSRYKWSVDDP  388
             + + ++LH     Y+    +P
Sbjct  445   LEISIFLHYFLLDYELERQNP  465



>ref|XP_010547851.1| PREDICTED: abscisic acid 8'-hydroxylase 4-like isoform X1 [Tarenaya 
hassleriana]
Length=473

 Score =   215 bits (548),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 135/447 (30%), Positives = 225/447 (50%), Gaps = 19/447 (4%)
 Frame = -2

Query  1719  LLVGIGIAVYLLRGQTVRSK-----SCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRT  1555
              +V +  AV   R  T  +K     + + PG +G+P++GET  L S   +      F   
Sbjct  11    FMVIVATAVCTRRNTTREAKQRKRRAELPPGSMGLPYIGETLQLYSQDPNV-----FFAA  65

Query  1554  RRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPH  1375
             ++  +G  FK  I G   V + S + A+ +   +  LF   Y KS    +G  +L     
Sbjct  66    KQKRYGEIFKMHILGCPCVMLASPEAARFVLVTEAHLFRPTYPKSKEHLIGPSALFFHQG  125

Query  1374  ESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCN  1195
             + H R+R+L+    S++++   V   D +    L+      ++ TV     K +F+    
Sbjct  126   DYHLRVRKLVQGSLSLDTVRRLVGDIDHLATXLLDSWGE-REAVTVFSELKKFSFEVGIL  184

Query  1194  MLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRR  1015
              +    +      ++++ STV     SFP ++PGT Y K + AR RL +    II  R+ 
Sbjct  185   AIFGNIESHYREELKKNYSTVDKGYNSFPTVLPGTSYRKAVLARKRLNQILAEIICERKE  244

Query  1014  RMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKL  835
             +  R  E+D     L    ER      E L +++I DN++ ++ A Q TTA+AM W VK 
Sbjct  245   K--RLEENDLLGSLLNSKDER-----GEALREDQIADNIIGVLFAAQDTTASAMTWIVKY  297

Query  834   LDENTEIQNRLREEQLSILRNKPKG-ALITLEDLNTMTYASKVVKETLRMSNVLLWFPRV  658
             L +N ++   ++ EQ +I      G   +T      M+   KVV E+LRM++++ +  R 
Sbjct  298   LHDNQKVLAAVKAEQKAIQEMNGYGRQPLTWSQTRNMSVTYKVVLESLRMASIISFTFRE  357

Query  657   ALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIPFGSGPR  478
             A+ + + +G+ I KGW V      IH++P  + DP  F+PSRF+E  +PY+++PFG+G  
Sbjct  358   AVADVEYKGYLIPKGWKVMPLFRNIHHNPGFFADPEKFDPSRFEETPKPYTFMPFGNGVH  417

Query  477   TCLGINMAKVTMLVYLHRLTSRYKWSV  397
             +C G  +AK+ ML+  H LTSR++W V
Sbjct  418   SCPGNELAKLEMLIITHHLTSRFRWEV  444



>emb|CDY39421.1| BnaAnng05520D [Brassica napus]
Length=470

 Score =   215 bits (548),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 147/487 (30%), Positives = 247/487 (51%), Gaps = 30/487 (6%)
 Frame = -2

Query  1770  MVFGSM-VSHYYYDVFLGLLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSA  1594
             M F SM ++ +   +FL LL  I       R  +  S+  + PG +G P++GETF L S 
Sbjct  1     MDFSSMFLTLFVAALFLCLLRLIASVAGFRRSSS--SQLPLPPGTMGYPYVGETFQLYSQ  58

Query  1593  TNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMA  1414
               +      F  +++  +G  FKT I G   V + S + AK +      LF   +  S  
Sbjct  59    DPNV-----FFASKQRRYGSVFKTHILGCPCVMISSPEAAKFVLVTKSHLFKPTFPASKE  113

Query  1413  DAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEEQHRIGKSFTVL  1234
               +GK+++     + H ++R+L    F  +S+   V   + +  + L      G      
Sbjct  114   RMLGKQAIFFHQGDYHAQLRKLFLRAFMPDSVRNMVANIESIARESLSSWD--GTQLNTY  171

Query  1233  DFNMKITFDAMCNMLMSI--TDGSLLRRIERDCSTV-SDAMLSFPVMIPGTRYYKGIKAR  1063
                   TF+     L+SI   D  L R   + C  +      S P+ +PGT ++K +KAR
Sbjct  172   QEMKTYTFNVA---LISILGEDAVLYREDLKRCYYILEKGYNSMPINLPGTLFHKAMKAR  228

Query  1062  GRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLERDSFPESEKLEDEEIMDNLLTLII  883
               L +    I+  RR+     N+S   +D L   +E     + E L DE+I DN++ +I 
Sbjct  229   KELAQILANILSKRRQ-----NQSTH-KDLLGSFME-----DKEGLTDEQISDNIIGVIF  277

Query  882   AGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVK  703
             A + TTA+ + W +K L +N  +   + EEQ+SI + K +G  +T ED   MT  S+VV+
Sbjct  278   AARDTTASVLTWILKYLADNPTVLEAVTEEQMSIRKGKKEGEGLTWEDTRKMTLTSRVVQ  337

Query  702   ETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDE  523
             ET+R++ +L +  R A+++ + EG+ I KGW V      IH++   + DP  F+PSRF+ 
Sbjct  338   ETMRVATILSFTFREAVEDVEYEGYLIPKGWKVLPLFRNIHHNADFFSDPGKFDPSRFEV  397

Query  522   MQRPYSYIPFGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAH-IPRLR  346
               +P ++IPFG+G  +C G  +AK+ + + +H LT++Y+WS++ P   ++     +P  +
Sbjct  398   APKPNTFIPFGNGIHSCPGNELAKLEISILIHHLTTKYRWSIEGPSDGIQYGPFALP--Q  455

Query  345   SGCPITL  325
             +G PI L
Sbjct  456   NGLPIAL  462



>ref|XP_009602928.1| PREDICTED: taxadiene 5-alpha hydroxylase [Nicotiana tomentosiformis]
Length=485

 Score =   216 bits (549),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 135/478 (28%), Positives = 245/478 (51%), Gaps = 20/478 (4%)
 Frame = -2

Query  1734  DVFLGLLVGIGIAVYLLRGQTVRSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRT  1555
              +F  ++  I +  Y  +G    +K  + PG++G+P++GET     A    K   +FV+ 
Sbjct  18    SIFFIIVFSILLKHY--KGYKHITKKKLPPGEMGLPWIGETIEFYKAQKKNKLFEEFVQP  75

Query  1554  RRLWHGRWFKTRIFGKIHVFVPSVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPH  1375
             R   +G+ FKTR+ G   V V   +      +N+F L    +  S  + +GK  ++    
Sbjct  76    RIEKYGKTFKTRLMGSPTVVVCGAEANMFFLSNEFKLVISSWPTSSVELMGKNCIMEKQG  135

Query  1374  ESHKRIRRLLSDPFSMNSLSIFVQKFDRMLCQRLEE----QHRIGKSFTVLDF-NMKITF  1210
             ++H+ +R ++S   +  SL   V K    +   L++    Q +I K + +  +   KI F
Sbjct  136   DAHRCLRGIISSSLASFSLDAMVPKICNTIQSHLDKNCNGQDQIIKLYHLTKYLTFKIVF  195

Query  1209  DAMCNMLMSITDGSLLRRIERDCSTVSDAMLSFPVMIPGTRYYKGIKARGRLMETFKTII  1030
             +  C + + +  G LL   ER    V +   S P   PG+++ +   AR ++ +    +I
Sbjct  196   E--CFLGIVVKPG-LLETFER----VLEGAFSPPFKFPGSKFSRAKNARLKIEKILVEVI  248

Query  1029  DSRRRRMGRGNESDEDRDFLQEMLER--DSFPESEKLEDEEIMDNLLTLIIAGQTTTAAA  856
               +RR +  G E +   D  + +L R   +    E + +EE++DN++ L+ A   TT+ A
Sbjct  249   REKRREIELGEEKEGKLD--EALLSRLVKALIRGE-VSEEEVVDNVVLLVFAAHDTTSFA  305

Query  855   MMWSVKLLDENTEIQNRLREEQLSILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVL  676
             +  + ++L  +    + L +E  +I+ NK    +++LED   M Y  +V +E++R+   +
Sbjct  306   IAMTFRMLAHHPTCYSLLLQEHANIMSNKGPDEILSLEDTKRMKYTWQVARESMRLFPPI  365

Query  675   LWFPRVALDNCKIEGFDIKKGWHVNIDATCIHYDPAIYKDPTHFNPSRFDEMQRPYSYIP  496
                 R A+ + + EGF I KGW V       HY P  +K+P +F+PSRF+E  +PY+++P
Sbjct  366   FGSFRKAIADIEFEGFTIPKGWKVLWTTYGTHYSPDYFKEPQNFDPSRFEEPVQPYAFVP  425

Query  495   FGSGPRTCLGINMAKVTMLVYLHRLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITLT  322
             FG GPR C G  +AK+ +L+++H + +RY WS+ +PD  +     +P    G PI ++
Sbjct  426   FGGGPRLCAGYQLAKLNILIFVHYVVTRYDWSLINPDEPIVMDP-LPFPSKGMPIKIS  482



>ref|XP_007217929.1| hypothetical protein PRUPE_ppa004901mg [Prunus persica]
 gb|EMJ19128.1| hypothetical protein PRUPE_ppa004901mg [Prunus persica]
Length=486

 Score =   216 bits (549),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 135/449 (30%), Positives = 233/449 (52%), Gaps = 14/449 (3%)
 Frame = -2

Query  1662  KSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRW--FKTRIFGKIHVFVP  1489
             K  + PG LG PF+G  +S L A  S+     F+ +     GR   +KT +FG   + V 
Sbjct  35    KHSLPPGDLGWPFIGNMWSFLKAFKSS-NPEAFLNSMVSRFGRTGIYKTFMFGSPSIIVT  93

Query  1488  SVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFS-MNSLSI  1312
             + + +K +  +D A F  G+  S  + +GK S   +  E HKR+R+L + P +   +LS+
Sbjct  94    TPEASKKVLTDDDA-FKPGWPISTEELIGKNSFTSISFEEHKRLRKLTAAPVNGYEALSV  152

Query  1311  FVQKFDRMLCQRLEEQHRIGKSFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTV  1132
             +    +  +   LE+  ++G+    L    K+TF  +  + +S     ++  +E++ + +
Sbjct  153   YTTYIEERVISSLEKWSKMGE-IEFLTQLRKLTFRIIMYIFLSSESEPVMEALEKEYTIL  211

Query  1131  SDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEMLER  952
             +  + +  + +PG  Y+K +KAR  L+ TF++I+D RR +   GN   + +D +  +L+ 
Sbjct  212   NYGVRAMAINLPGFAYHKALKARKNLVSTFQSIVDDRRAQRKAGNYVAKKKDMMDALLDV  271

Query  951   DSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLSILRN  772
                 +  KL D EI+D LL  + AG  ++   MMW+   L ++ +I  + + EQ  I++ 
Sbjct  272   VDD-DGRKLTDAEIIDVLLMYLNAGHESSGHTMMWAAVFLQKHPKIFQKAKAEQEEIVKR  330

Query  771   KP---KGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHVN  601
             +P   KG  +  ++   M Y S+V+ ETLR+    L   R A  +  I G+ + KGW V 
Sbjct  331   RPPTQKG--MAFKEYREMEYLSQVIDETLRVVTFSLTVFREAKKDVNINGYSVPKGWKVL  388

Query  600   IDATCIHYDPAIYKDPTHFNPSRFDEMQ-RPYSYIPFGSGPRTCLGINMAKVTMLVYLHR  424
             +    IHYD  IY +P  FNP R+D    +P +++PFG+G R C G ++AK+ + ++LH 
Sbjct  389   VWFRSIHYDSEIYPNPMEFNPDRWDNYTPKPLTFLPFGAGSRLCPGNDLAKLEIAIFLHH  448

Query  423   LTSRYKWSVDDPDPSLERKAHIPRLRSGC  337
                 YK    +PD  L    H  R +  C
Sbjct  449   FLLNYKMERTNPDGPLMYLPHT-RPKDNC  476



>gb|ABR16707.1| unknown [Picea sitchensis]
Length=490

 Score =   216 bits (549),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 143/454 (31%), Positives = 219/454 (48%), Gaps = 16/454 (4%)
 Frame = -2

Query  1668  RSKSCIIPGKLGIPFLGETFSLLSATNSTKGCYDFVRTRRLWHGRWFKTRIFGKIHVFVP  1489
             R    I PG  G P +GET   L         + F  +R   +G  F T + G   V   
Sbjct  44    RVSRGIPPGTFGWPLIGETVEFLRCQKRGSP-HQFFDSRTQRYGNVFTTFLLGHPTVVFC  102

Query  1488  SVDGAKTIFANDFALFNKGYVKSMADAVGKKSLLCVPHESHKRIRRLLSDPFSMNSLSIF  1309
               +G + +FAN+  L       S+A   G   L   P ++ KR+RR+L       +L  F
Sbjct  103   GPEGNRFLFANENKLVVNSCPTSLAKLFGSSLLTGTPDDA-KRLRRMLMTFLRPEALQKF  161

Query  1308  VQKFDRMLCQRLEEQHRIGK-SFTVLDFNMKITFDAMCNMLMSITDGSLLRRIERDCSTV  1132
             V + D M    L E H IGK   TVL    + TF+ +C++ +SI D   + R+    + +
Sbjct  162   VGRVDSMTKHHLAE-HWIGKDEVTVLPLVKRYTFNLVCDLFVSINDQDKVARLSHHFAVL  220

Query  1131  SDAMLSFPVMIPGTRYYKGIKARGRLMETFKTIIDSRRRRMGRGNESDEDRDFLQEML--  958
                ++  P+ +PGTRY K   A   + E    IID R+  +  G    E +D L  +L  
Sbjct  221   MKGVMQIPIDLPGTRYNKAKHAANAIREQLGGIIDERKIALEEGKACRE-QDLLSFLLCN  279

Query  957   --ERDSFPESEKLEDEEIMDNLLTLIIAGQTTTAAAMMWSVKLLDENTEIQNRLREEQLS  784
               E+D F     L D+EI D +L L+ AG  T++  +   +K L EN +   ++  EQL 
Sbjct  280   VDEQDEF-----LTDDEIKDTILLLLSAGHDTSSCTLTVLLKFLAENPQCYQQVLREQLE  334

Query  783   ILRNKPKGALITLEDLNTMTYASKVVKETLRMSNVLLWFPRVALDNCKIEGFDIKKGWHV  604
             I R+K  G L+   DL  M Y+ +  +E LR+   +    R A+ +    GF I K W +
Sbjct  335   IARSKESGRLLEWLDLQKMKYSWRAAQEALRLLPPVQGAFRKAIKDFTYGGFTIVKEWKI  394

Query  603   NIDATCIHYDPAIYKDPTHFNPSRFDEM-QRPYSYIPFGSGPRTCLGINMAKVTMLVYLH  427
             +      H     +++P  F+PSRF+     PY+++PFG GPR C GI  A++ +LV+LH
Sbjct  395   HWTVNTTHKKAEYFENPEEFDPSRFEGAGPPPYTFVPFGGGPRMCPGIEFARIGILVFLH  454

Query  426   RLTSRYKWSVDDPDPSLERKAHIPRLRSGCPITL  325
              +   +KW++ DP   +     +P   +G PITL
Sbjct  455   HVVKNFKWNLVDPSEKVIMDP-MPDPVNGLPITL  487



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5599171671122