BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27225_g1_i1 len=982 path=[960:0-981]

Length=982
                                                                      Score     E

gb|KCW79326.1|  hypothetical protein EUGRSUZ_C00747                   55.5    9e-06   



>gb|KCW79326.1| hypothetical protein EUGRSUZ_C00747 [Eucalyptus grandis]
Length=196

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 65/126 (52%), Gaps = 4/126 (3%)
 Frame = +3

Query  324  SATLLAHDAIAMSIEETKVVKRFVNRMVRLRSLQQL-SENASGLGYCSDGVAQHLGKLTG  500
            +  L+A D I +SI   K  K+FV  + +L+S+QQ  + + S L  C DG+   L  L  
Sbjct  57   TQVLVARDIITLSIGGVKNTKKFVEMIPKLKSVQQTPNSDPSNLLNCVDGLFDSLSNLES  116

Query  501  SLYRLKHLQKAATLMASSPPLKGHIDGAMVSVE-ACRIAIGDVDTAFADILTRKLNDLSF  677
             L RL+HL K   +   +  L+  ++G ++ +   CR A+ D D     +L   L D++ 
Sbjct  117  VLKRLRHL-KDPYVAYDTRELR-RVEGRIMGISGTCRYALKDTDGVVTQMLNSNLADVAM  174

Query  678  MLEDVQ  695
            ++  V+
Sbjct  175  LINSVE  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2208260157854