BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27177_g1_i1 len=1296 path=[1:0-1295]

Length=1296
                                                                      Score     E

ref|XP_009631999.1|  PREDICTED: purine permease 1-like                  481   3e-165   
ref|XP_009762898.1|  PREDICTED: purine permease 3-like                  460   7e-157   
ref|XP_004252530.1|  PREDICTED: purine permease 1-like                  437   9e-148   
ref|XP_006360267.1|  PREDICTED: purine permease 1-like                  435   4e-147   
ref|XP_006360266.1|  PREDICTED: purine permease 1-like                  431   1e-145   
emb|CDP01096.1|  unnamed protein product                                422   4e-142   
ref|XP_002301070.2|  hypothetical protein POPTR_0002s09980g             396   8e-132   Populus trichocarpa [western balsam poplar]
ref|XP_002513954.1|  purine transporter, putative                       394   5e-131   Ricinus communis
ref|XP_011016754.1|  PREDICTED: purine permease 1-like                  372   2e-122   
emb|CBI19192.3|  unnamed protein product                                332   1e-107   
ref|XP_002285717.1|  PREDICTED: purine permease 1                       326   2e-104   Vitis vinifera
ref|XP_002513994.1|  purine transporter, putative                       323   4e-103   Ricinus communis
gb|EYU21537.1|  hypothetical protein MIMGU_mgv1a018814mg                321   1e-102   
gb|EYU34537.1|  hypothetical protein MIMGU_mgv1a022801mg                320   2e-102   
ref|XP_010939717.1|  PREDICTED: purine permease 3-like isoform X2       321   3e-102   
ref|XP_002285719.1|  PREDICTED: purine permease 1-like                  317   5e-101   Vitis vinifera
ref|XP_004501676.1|  PREDICTED: purine permease 1-like isoform X1       316   2e-100   
ref|XP_002285718.1|  PREDICTED: purine permease 1                       315   3e-100   Vitis vinifera
ref|XP_009373619.1|  PREDICTED: purine permease 3-like                  315   8e-100   
emb|CDP01126.1|  unnamed protein product                                313   2e-99    
ref|XP_006364706.1|  PREDICTED: purine permease 3-like                  313   3e-99    
ref|XP_004152618.1|  PREDICTED: purine permease 3-like                  313   3e-99    
ref|XP_002307351.2|  PURINE PERMEASE 1 family protein                   312   3e-99    Populus trichocarpa [western balsam poplar]
ref|XP_007227615.1|  hypothetical protein PRUPE_ppa022492mg             312   6e-99    
ref|XP_008812221.1|  PREDICTED: purine permease 3-like                  312   7e-99    
ref|XP_011006371.1|  PREDICTED: purine permease 3                       311   1e-98    
ref|XP_008338896.1|  PREDICTED: purine permease 3-like                  311   2e-98    
ref|XP_007223326.1|  hypothetical protein PRUPE_ppa007339mg             310   4e-98    
ref|XP_007018134.1|  Purine permease 3                                  309   5e-98    
ref|XP_010244044.1|  PREDICTED: purine permease 1-like                  309   6e-98    
gb|KDP41439.1|  hypothetical protein JCGZ_15846                         309   9e-98    
ref|XP_009615076.1|  PREDICTED: purine permease 3-like                  308   1e-97    
ref|XP_008219368.1|  PREDICTED: purine permease 3-like                  309   1e-97    
ref|XP_009373503.1|  PREDICTED: purine permease 3-like                  308   4e-97    
ref|XP_008219366.1|  PREDICTED: purine permease 3-like                  307   4e-97    
gb|KHG22236.1|  Purine permease 1 -like protein                         307   5e-97    
ref|XP_010939715.1|  PREDICTED: purine permease 3-like                  306   9e-97    
ref|XP_010942638.1|  PREDICTED: purine permease 3-like isoform X2       305   2e-96    
ref|XP_009765499.1|  PREDICTED: purine permease 1-like                  304   5e-96    
ref|XP_009380886.1|  PREDICTED: purine permease 3-like                  303   1e-95    
ref|XP_010942637.1|  PREDICTED: purine permease 3-like isoform X1       306   1e-95    
ref|XP_004299691.1|  PREDICTED: purine permease 3-like                  304   1e-95    
gb|AES73111.2|  purine permease-like protein                            303   3e-95    
ref|XP_008812219.1|  PREDICTED: purine permease 3-like                  301   5e-95    
gb|KHG13700.1|  Purine permease 3 -like protein                         301   5e-95    
ref|XP_004242795.1|  PREDICTED: purine permease 3-like                  302   5e-95    
gb|KHG06856.1|  Purine permease 1 -like protein                         302   6e-95    
ref|XP_009611006.1|  PREDICTED: purine permease 1-like                  301   1e-94    
ref|XP_006357923.1|  PREDICTED: purine permease 3-like                  300   2e-94    
ref|XP_010266597.1|  PREDICTED: purine permease 3-like                  300   2e-94    
ref|XP_003602860.1|  Purine permease                                    302   3e-94    
ref|XP_010098679.1|  Purine permease 3                                  300   5e-94    
ref|XP_006433898.1|  hypothetical protein CICLE_v10001546mg             298   2e-93    
ref|XP_010538168.1|  PREDICTED: purine permease 1-like                  297   3e-93    
ref|XP_008444875.1|  PREDICTED: purine permease 3-like                  297   3e-93    
ref|XP_004299692.1|  PREDICTED: purine permease 3-like                  298   3e-93    
ref|XP_008806390.1|  PREDICTED: purine permease 3-like                  297   5e-93    
ref|XP_004152619.1|  PREDICTED: purine permease 3-like                  297   5e-93    
ref|XP_009603730.1|  PREDICTED: purine permease 3-like                  296   6e-93    
ref|XP_004164781.1|  PREDICTED: purine permease 3-like                  296   7e-93    
ref|XP_010263028.1|  PREDICTED: purine permease 1-like                  296   7e-93    
ref|XP_006366415.1|  PREDICTED: purine permease 3-like                  296   1e-92    
ref|XP_004252714.1|  PREDICTED: purine permease 3-like                  296   1e-92    
ref|XP_006472532.1|  PREDICTED: purine permease 1-like                  295   2e-92    
gb|KFK44691.1|  hypothetical protein AALP_AA1G290900                    295   2e-92    
ref|XP_006357924.1|  PREDICTED: purine permease 3-like                  295   2e-92    
gb|EPS65699.1|  hypothetical protein M569_09078                         294   2e-92    
ref|XP_010322002.1|  PREDICTED: LOW QUALITY PROTEIN: purine perme...    294   4e-92    
ref|XP_007042880.1|  Purine permease 3                                  296   4e-92    
ref|XP_010247465.1|  PREDICTED: purine permease 3-like                  294   6e-92    
ref|XP_008444876.1|  PREDICTED: purine permease 3-like                  293   7e-92    
emb|CDP19267.1|  unnamed protein product                                293   8e-92    
ref|XP_009605309.1|  PREDICTED: purine permease 1-like                  293   8e-92    
ref|XP_007141230.1|  hypothetical protein PHAVU_008G178300g             292   2e-91    
ref|XP_009769306.1|  PREDICTED: purine permease 1-like                  291   3e-91    
ref|NP_001131978.1|  uncharacterized protein LOC100193377               291   5e-91    Zea mays [maize]
ref|XP_007018133.1|  Purine permease 3, putative                        293   6e-91    
ref|XP_010060063.1|  PREDICTED: purine permease 3-like isoform X1       291   8e-91    
emb|CDY35722.1|  BnaC03g58430D                                          290   3e-90    
ref|XP_004490401.1|  PREDICTED: purine permease 1-like                  290   3e-90    
ref|XP_010060067.1|  PREDICTED: purine permease 1-like                  290   3e-90    
gb|AES73112.2|  purine permease-like protein                            290   4e-90    
ref|XP_009766753.1|  PREDICTED: purine permease 3-like                  289   4e-90    
ref|XP_009783837.1|  PREDICTED: purine permease 3-like                  289   4e-90    
ref|XP_009776518.1|  PREDICTED: purine permease 1-like                  289   4e-90    
ref|XP_008446590.1|  PREDICTED: purine permease 3-like                  289   5e-90    
ref|XP_009609429.1|  PREDICTED: purine permease 3-like                  289   6e-90    
ref|XP_011072345.1|  PREDICTED: LOW QUALITY PROTEIN: purine perme...    288   6e-90    
ref|XP_002893512.1|  ATPUP3                                             288   1e-89    
ref|XP_009109745.1|  PREDICTED: purine permease 1                       287   2e-89    
ref|XP_004957086.1|  PREDICTED: purine permease 3-like                  287   2e-89    
ref|XP_009621473.1|  PREDICTED: purine permease 3-like                  287   2e-89    
ref|XP_003522775.1|  PREDICTED: purine permease 1-like                  287   2e-89    
ref|XP_009598031.1|  PREDICTED: purine permease 1-like                  286   3e-89    
ref|XP_010060066.1|  PREDICTED: purine permease 1-like                  287   3e-89    
ref|XP_002462515.1|  hypothetical protein SORBIDRAFT_02g027100          287   4e-89    Sorghum bicolor [broomcorn]
gb|KCW66598.1|  hypothetical protein EUGRSUZ_F00392                     290   7e-89    
ref|XP_009588639.1|  PREDICTED: purine permease 3-like                  285   9e-89    
gb|ADP30798.1|  nicotine uptake permease 1                              285   1e-88    
ref|XP_009795252.1|  PREDICTED: purine permease 1-like                  285   2e-88    
ref|XP_006357925.1|  PREDICTED: purine permease 3-like                  284   3e-88    
ref|XP_008652812.1|  PREDICTED: purine permease 3-like                  285   3e-88    
ref|XP_004237961.1|  PREDICTED: purine permease 1-like                  285   3e-88    
ref|XP_006305220.1|  hypothetical protein CARUB_v10009586mg             284   3e-88    
gb|KDP40942.1|  hypothetical protein JCGZ_24941                         284   3e-88    
ref|XP_010263027.1|  PREDICTED: purine permease 3-like                  284   4e-88    
ref|XP_007042882.1|  Purine permease 3 isoform 2                        283   5e-88    
ref|XP_008667169.1|  PREDICTED: uncharacterized protein LOC100193...    283   6e-88    
ref|XP_006338103.1|  PREDICTED: purine permease 1-like                  283   7e-88    
gb|KDP40961.1|  hypothetical protein JCGZ_24960                         287   7e-88    
ref|XP_010064227.1|  PREDICTED: purine permease 3-like                  284   7e-88    
emb|CDP08377.1|  unnamed protein product                                283   7e-88    
dbj|BAJ86755.1|  predicted protein                                      283   1e-87    
emb|CDY27947.1|  BnaCnng05320D                                          283   1e-87    
ref|NP_174143.1|  purine permease 3                                     283   1e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010266586.1|  PREDICTED: purine permease 3-like                  283   2e-87    
ref|XP_009763953.1|  PREDICTED: purine permease 3-like                  282   2e-87    
ref|XP_003615204.1|  Purine permease                                    282   2e-87    
ref|XP_002531513.1|  purine transporter, putative                       282   3e-87    Ricinus communis
ref|XP_009102926.1|  PREDICTED: purine permease 3                       281   5e-87    
emb|CDX94595.1|  BnaC07g10630D                                          280   7e-87    
ref|XP_006338102.1|  PREDICTED: purine permease 1-like                  280   1e-86    
ref|XP_009762239.1|  PREDICTED: purine permease 1-like                  280   2e-86    
gb|EEC84724.1|  hypothetical protein OsI_31699                          279   2e-86    Oryza sativa Indica Group [Indian rice]
dbj|BAD19737.1|  putative purine permease                               279   3e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004959525.1|  PREDICTED: purine permease 3-like                  280   4e-86    
ref|XP_004237962.1|  PREDICTED: purine permease 3-like                  278   6e-86    
ref|XP_007042881.1|  Purine permease 3 isoform 1                        278   6e-86    
ref|XP_010549316.1|  PREDICTED: purine permease 3                       277   8e-86    
ref|XP_009770717.1|  PREDICTED: purine permease 1-like                  278   9e-86    
ref|XP_007136297.1|  hypothetical protein PHAVU_009G034400g             278   1e-85    
ref|XP_009143832.1|  PREDICTED: purine permease 2 isoform X1            277   2e-85    
ref|XP_006305203.1|  hypothetical protein CARUB_v10009570mg             276   5e-85    
ref|XP_004959530.1|  PREDICTED: purine permease 1-like                  276   7e-85    
ref|XP_010499329.1|  PREDICTED: purine permease 3-like                  275   1e-84    
gb|KFK44702.1|  hypothetical protein AALP_AA1G292000                    275   1e-84    
ref|XP_006410518.1|  hypothetical protein EUTSA_v10017788mg             275   1e-84    
ref|NP_001063425.1|  Os09g0467400                                       274   3e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003579811.2|  PREDICTED: purine permease 3-like                  274   4e-84    
ref|XP_010460601.1|  PREDICTED: purine permease 1                       273   4e-84    
ref|XP_009109746.1|  PREDICTED: purine permease 1-like                  272   1e-83    
ref|XP_010460596.1|  PREDICTED: purine permease 3                       272   1e-83    
ref|XP_010926344.1|  PREDICTED: purine permease 3-like isoform X1       272   2e-83    
ref|XP_010538169.1|  PREDICTED: purine permease 3-like                  271   3e-83    
ref|XP_010478191.1|  PREDICTED: purine permease 1-like                  271   4e-83    
gb|EYU21538.1|  hypothetical protein MIMGU_mgv1a020196mg                271   4e-83    
ref|XP_010248452.1|  PREDICTED: purine permease 3-like                  270   5e-83    
gb|EPS67422.1|  hypothetical protein M569_07351                         269   7e-83    
ref|XP_009143833.1|  PREDICTED: purine permease 2 isoform X2            270   9e-83    
gb|EYU38177.1|  hypothetical protein MIMGU_mgv1a023817mg                269   2e-82    
ref|XP_003519187.1|  PREDICTED: purine permease 1-like                  268   2e-82    
ref|XP_009599635.1|  PREDICTED: purine permease 1-like                  269   3e-82    
tpg|DAA61854.1|  TPA: hypothetical protein ZEAMMB73_233624              270   3e-82    
ref|XP_008667894.1|  PREDICTED: PUP1 isoform X1                         270   3e-82    
ref|XP_006295883.1|  hypothetical protein CARUB_v10025013mg             267   7e-82    
gb|EAZ09425.1|  hypothetical protein OsI_31698                          268   9e-82    Oryza sativa Indica Group [Indian rice]
ref|NP_001063424.1|  Os09g0467300                                       268   9e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009401279.1|  PREDICTED: purine permease 1-like                  267   1e-81    
dbj|BAJ94351.1|  predicted protein                                      268   1e-81    
gb|KGN64615.1|  hypothetical protein Csa_1G071290                       267   2e-81    
ref|NP_001147096.1|  PUP1                                               267   2e-81    Zea mays [maize]
ref|XP_004146629.1|  PREDICTED: purine permease 3-like                  266   3e-81    
ref|XP_006841261.1|  hypothetical protein AMTR_s00135p00099660          266   6e-81    
ref|XP_010469434.1|  PREDICTED: purine permease 2-like                  265   9e-81    
emb|CDP11456.1|  unnamed protein product                                265   9e-81    
ref|XP_006841259.1|  hypothetical protein AMTR_s00135p00097090          265   1e-80    
ref|XP_010234593.1|  PREDICTED: purine permease 3-like isoform X1       265   2e-80    
ref|NP_174144.1|  purine permease 1                                     263   3e-80    Arabidopsis thaliana [mouse-ear cress]
gb|AAF64547.1|AF078531_1  purine permease                               263   4e-80    Arabidopsis thaliana [mouse-ear cress]
emb|CDY17197.1|  BnaA05g09910D                                          263   4e-80    
ref|XP_010478189.1|  PREDICTED: purine permease 3-like                  263   4e-80    
ref|XP_010413821.1|  PREDICTED: purine permease 2                       262   1e-79    
ref|XP_003578263.2|  PREDICTED: purine permease 3-like                  263   1e-79    
dbj|BAK04933.1|  predicted protein                                      262   1e-79    
ref|XP_010499327.1|  PREDICTED: purine permease 1-like isoform X1       261   2e-79    
ref|XP_006415682.1|  hypothetical protein EUTSA_v10008037mg             261   2e-79    
ref|XP_010509839.1|  PREDICTED: purine permease 2-like                  261   2e-79    
emb|CDP16579.1|  unnamed protein product                                257   6e-79    
emb|CDY16284.1|  BnaC01g23190D                                          261   7e-79    
ref|XP_006661330.1|  PREDICTED: purine permease 3-like                  260   1e-78    
ref|XP_010509840.1|  PREDICTED: purine permease 2-like                  260   1e-78    
emb|CDY12422.1|  BnaC08g09110D                                          259   2e-78    
ref|XP_010413817.1|  PREDICTED: purine permease 2-like                  258   5e-78    
ref|XP_009148632.1|  PREDICTED: purine permease 2-like                  258   6e-78    
ref|XP_010549318.1|  PREDICTED: purine permease 3-like                  257   6e-78    
ref|XP_002893513.1|  hypothetical protein ARALYDRAFT_890360             257   9e-78    
ref|XP_010509841.1|  PREDICTED: purine permease 2-like                  256   1e-77    
ref|XP_002881298.1|  ATPUP2                                             256   3e-77    
emb|CDY29741.1|  BnaA01g19250D                                          256   4e-77    
ref|XP_006841262.1|  hypothetical protein AMTR_s00135p00100890          255   4e-77    
ref|NP_973592.1|  purine permease 2                                     254   9e-77    Arabidopsis thaliana [mouse-ear cress]
gb|EMT19524.1|  Purine permease 3                                       252   4e-76    
ref|XP_006358992.1|  PREDICTED: purine permease 1-like                  251   1e-75    
ref|XP_008795222.1|  PREDICTED: purine permease 3-like                  249   6e-75    
ref|XP_010234594.1|  PREDICTED: purine permease 3-like isoform X2       249   2e-74    
ref|XP_010675382.1|  PREDICTED: purine permease 3-like                  247   2e-73    
dbj|BAJ87663.1|  predicted protein                                      247   2e-73    
ref|NP_180931.2|  purine permease 2                                     246   2e-73    Arabidopsis thaliana [mouse-ear cress]
gb|AAC69140.1|  hypothetical protein                                    245   3e-73    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ88843.1|  predicted protein                                      246   6e-73    
gb|ABR16841.1|  unknown                                                 244   7e-73    Picea sitchensis
gb|KFK31021.1|  hypothetical protein AALP_AA6G057800                    240   7e-72    
ref|XP_002462514.1|  hypothetical protein SORBIDRAFT_02g027090          239   9e-71    Sorghum bicolor [broomcorn]
ref|XP_006661332.1|  PREDICTED: purine permease 3-like                  233   1e-69    
ref|XP_009113691.1|  PREDICTED: purine permease 1-like                  234   5e-69    
gb|EPS58788.1|  hypothetical protein M569_16026                         233   9e-69    
emb|CDY15687.1|  BnaA07g08580D                                          228   3e-67    
ref|XP_004158055.1|  PREDICTED: LOW QUALITY PROTEIN: purine perme...    226   1e-66    
gb|EPS72255.1|  hypothetical protein M569_02503                         222   7e-66    
gb|EEE69873.1|  hypothetical protein OsJ_29687                          224   4e-65    Oryza sativa Japonica Group [Japonica rice]
gb|KCW51603.1|  hypothetical protein EUGRSUZ_J01095                     222   4e-65    
ref|XP_010098677.1|  Purine permease 3                                  221   6e-65    
gb|EPS74474.1|  hypothetical protein M569_00285                         222   9e-65    
ref|XP_008779125.1|  PREDICTED: purine permease 1-like                  219   3e-64    
emb|CDX90135.1|  BnaA08g18490D                                          218   3e-63    
ref|XP_010939716.1|  PREDICTED: purine permease 1-like isoform X1       217   6e-62    
gb|KCW66597.1|  hypothetical protein EUGRSUZ_F00391                     211   2e-61    
ref|XP_006415683.1|  hypothetical protein EUTSA_v10009673mg             211   4e-60    
ref|XP_003602861.1|  Purine permease                                    206   5e-59    
ref|XP_002977419.1|  hypothetical protein SELMODRAFT_417455             207   2e-58    
ref|XP_004985414.1|  PREDICTED: purine permease 3-like                  205   1e-57    
gb|EEC84725.1|  hypothetical protein OsI_31703                          201   2e-57    Oryza sativa Indica Group [Indian rice]
gb|EAZ09428.1|  hypothetical protein OsI_31702                          201   3e-57    Oryza sativa Indica Group [Indian rice]
ref|XP_002993859.1|  hypothetical protein SELMODRAFT_236829             202   4e-57    
gb|EEE69876.1|  hypothetical protein OsJ_29691                          199   7e-57    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063426.2|  Os09g0467500                                       199   1e-56    Oryza sativa Japonica Group [Japonica rice]
emb|CDY35721.1|  BnaC03g58420D                                          201   1e-56    
ref|XP_002991403.1|  hypothetical protein SELMODRAFT_236291             201   2e-56    
gb|ABR16480.1|  unknown                                                 201   5e-56    Picea sitchensis
tpg|DAA40289.1|  TPA: hypothetical protein ZEAMMB73_258363              197   7e-56    
ref|XP_002977418.1|  hypothetical protein SELMODRAFT_417454             200   1e-55    
ref|XP_009789614.1|  PREDICTED: purine permease 1-like                  197   1e-55    
ref|XP_010418647.1|  PREDICTED: purine permease 2-like                  195   2e-55    
ref|XP_002975003.1|  hypothetical protein SELMODRAFT_232471             195   7e-55    
ref|XP_009801739.1|  PREDICTED: purine permease 1-like isoform X2       194   7e-55    
ref|XP_004959528.1|  PREDICTED: purine permease 2-like                  194   1e-54    
ref|XP_009801738.1|  PREDICTED: purine permease 1-like isoform X1       195   2e-54    
dbj|BAG88745.1|  unnamed protein product                                194   3e-54    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009380885.1|  PREDICTED: purine permease 1-like                  192   4e-54    
ref|XP_006661331.1|  PREDICTED: purine permease 3-like                  191   1e-53    
ref|XP_009801740.1|  PREDICTED: purine permease 1-like isoform X3       190   1e-53    
ref|XP_004959524.1|  PREDICTED: purine permease 2-like                  187   3e-52    
ref|XP_006859063.1|  hypothetical protein AMTR_s00068p00197770          190   6e-52    
ref|XP_009759913.1|  PREDICTED: probable purine permease 4              190   8e-52    
gb|EMS63809.1|  Purine permease 3                                       187   8e-52    
ref|XP_004959529.1|  PREDICTED: purine permease 2-like                  184   3e-51    
ref|XP_002465736.1|  hypothetical protein SORBIDRAFT_01g044690          187   4e-51    Sorghum bicolor [broomcorn]
ref|XP_004985415.1|  PREDICTED: purine permease 3-like                  186   2e-50    
ref|XP_008651823.1|  PREDICTED: purine permease 3                       186   2e-50    
ref|XP_008776064.1|  PREDICTED: probable purine permease 5              184   6e-50    
gb|KHN26582.1|  Putative purine permease 4                              184   1e-49    
gb|KEH37326.1|  triose-phosphate transporter family protein             185   1e-49    
ref|NP_001049213.1|  Os03g0187800                                       184   1e-49    Oryza sativa Japonica Group [Japonica rice]
gb|EAY88839.1|  hypothetical protein OsI_10311                          184   1e-49    Oryza sativa Indica Group [Indian rice]
ref|XP_010908241.1|  PREDICTED: probable purine permease 5              182   3e-49    
gb|KHN08969.1|  Purine permease 1                                       177   3e-49    
ref|XP_006826553.1|  hypothetical protein AMTR_s02825p00003100          178   5e-49    
ref|XP_003534853.1|  PREDICTED: probable purine permease 4-like         183   6e-49    
dbj|BAJ96346.1|  predicted protein                                      182   8e-49    
gb|EMS56378.1|  hypothetical protein TRIUR3_06439                       181   1e-48    
ref|NP_001136854.1|  hypothetical protein                               181   2e-48    Zea mays [maize]
ref|XP_004985416.1|  PREDICTED: purine permease 3-like                  181   2e-48    
emb|CDP10228.1|  unnamed protein product                                180   3e-48    
ref|XP_004248514.2|  PREDICTED: probable purine permease 4              177   2e-47    
dbj|BAJ95836.1|  predicted protein                                      178   2e-47    
ref|XP_010265596.1|  PREDICTED: probable purine permease 5              175   2e-46    
ref|XP_008652813.1|  PREDICTED: purine permease 2-like                  172   2e-46    
ref|XP_002462517.1|  hypothetical protein SORBIDRAFT_02g027120          172   3e-46    Sorghum bicolor [broomcorn]
gb|EMT19334.1|  Purine permease 3                                       172   4e-46    
ref|XP_002266479.1|  PREDICTED: probable purine permease 5 isofor...    172   2e-45    Vitis vinifera
gb|EYU35321.1|  hypothetical protein MIMGU_mgv1a008781mg                172   2e-45    
ref|XP_002462516.1|  hypothetical protein SORBIDRAFT_02g027110          170   3e-45    Sorghum bicolor [broomcorn]
gb|KDP38675.1|  hypothetical protein JCGZ_04028                         171   3e-45    
gb|KDO59449.1|  hypothetical protein CISIN_1g017963mg                   171   3e-45    
ref|XP_006453625.1|  hypothetical protein CICLE_v10008754mg             171   3e-45    
ref|XP_002973993.1|  hypothetical protein SELMODRAFT_232165             170   4e-45    
ref|XP_003558629.1|  PREDICTED: purine permease 3-like                  172   4e-45    
ref|XP_011083977.1|  PREDICTED: probable purine permease 5              171   4e-45    
ref|XP_010645373.1|  PREDICTED: probable purine permease 5 isofor...    171   4e-45    
ref|XP_003561966.2|  PREDICTED: purine permease 3-like                  171   5e-45    
ref|XP_004242601.1|  PREDICTED: probable purine permease 5 isofor...    170   1e-44    
ref|XP_002983502.1|  hypothetical protein SELMODRAFT_118529             169   2e-44    
ref|XP_006473996.1|  PREDICTED: probable purine permease 5-like         169   2e-44    
ref|XP_004242599.1|  PREDICTED: probable purine permease 5 isofor...    169   2e-44    
ref|XP_010478523.1|  PREDICTED: probable purine permease 4 isofor...    170   2e-44    
ref|XP_010460900.1|  PREDICTED: probable purine permease 4              170   2e-44    
gb|EPS58881.1|  hypothetical protein M569_15932                         168   2e-44    
emb|CDP05635.1|  unnamed protein product                                163   2e-44    
ref|XP_006343643.1|  PREDICTED: probable purine permease 5-like         169   4e-44    
ref|XP_007138274.1|  hypothetical protein PHAVU_009G194800g             168   5e-44    
ref|XP_007138880.1|  hypothetical protein PHAVU_009G245400g             169   6e-44    
ref|XP_009594913.1|  PREDICTED: probable purine permease 5 isofor...    167   9e-44    
gb|AFK38153.1|  unknown                                                 167   1e-43    
ref|XP_002971312.1|  hypothetical protein SELMODRAFT_95266              166   1e-43    
ref|XP_009622283.1|  PREDICTED: probable purine permease 4 isofor...    168   1e-43    
ref|XP_002961495.1|  hypothetical protein SELMODRAFT_76932              166   1e-43    
ref|XP_009594912.1|  PREDICTED: probable purine permease 5 isofor...    167   2e-43    
ref|XP_006857228.1|  hypothetical protein AMTR_s00065p00208130          165   2e-43    
emb|CDY72169.1|  BnaCnng76300D                                          163   3e-43    
gb|KHN42588.1|  Putative purine permease 5                              166   4e-43    
ref|XP_010941200.1|  PREDICTED: probable purine permease 11             166   5e-43    
ref|XP_009799236.1|  PREDICTED: probable purine permease 4              166   5e-43    
ref|XP_006592598.1|  PREDICTED: probable purine permease 5-like i...    165   7e-43    
ref|XP_002309345.2|  purine permease-related family protein             165   7e-43    
ref|XP_003547402.1|  PREDICTED: probable purine permease 4-like         165   7e-43    
ref|XP_003541140.1|  PREDICTED: probable purine permease 5-like i...    165   1e-42    
ref|XP_007138881.1|  hypothetical protein PHAVU_009G245500g             165   1e-42    
gb|KFK41670.1|  hypothetical protein AALP_AA2G157700                    165   2e-42    
ref|XP_004248513.1|  PREDICTED: probable purine permease 4              165   2e-42    
gb|AGV54805.1|  purine permease 4-like protein                          164   2e-42    
emb|CDP06315.1|  unnamed protein product                                164   3e-42    
ref|XP_006487528.1|  PREDICTED: probable purine permease 5-like         162   3e-42    
tpg|DAA43787.1|  TPA: hypothetical protein ZEAMMB73_057798              162   3e-42    
ref|XP_009622284.1|  PREDICTED: probable purine permease 4 isofor...    164   4e-42    
ref|XP_008232299.1|  PREDICTED: probable purine permease 11 isofo...    163   5e-42    
ref|XP_004488889.1|  PREDICTED: probable purine permease 5-like         163   5e-42    
ref|XP_010499636.1|  PREDICTED: probable purine permease 4 isofor...    163   6e-42    
ref|XP_007202258.1|  hypothetical protein PRUPE_ppa007711mg             162   9e-42    
ref|XP_007218138.1|  hypothetical protein PRUPE_ppa007245mg             162   1e-41    
ref|XP_007218139.1|  hypothetical protein PRUPE_ppa007245mg             162   1e-41    
ref|XP_008232298.1|  PREDICTED: probable purine permease 11 isofo...    162   1e-41    
ref|XP_004961267.1|  PREDICTED: probable purine permease 4-like         162   1e-41    
ref|XP_009400212.1|  PREDICTED: probable purine permease 11             162   2e-41    
gb|KHN28447.1|  Putative purine permease 5                              161   2e-41    
ref|XP_006582088.1|  PREDICTED: probable purine permease 5-like i...    161   2e-41    
ref|NP_001043870.1|  Os01g0680200                                       162   2e-41    
ref|XP_003527168.1|  PREDICTED: probable purine permease 5-like i...    160   3e-41    
ref|XP_002529375.1|  purine transporter, putative                       160   4e-41    
gb|AFK45074.1|  unknown                                                 160   5e-41    
ref|XP_004287127.1|  PREDICTED: probable purine permease 5-like i...    160   5e-41    
gb|KHN47749.1|  Putative purine permease 4                              159   5e-41    
ref|XP_004979831.1|  PREDICTED: purine permease 3-like                  160   6e-41    
ref|XP_009790359.1|  PREDICTED: probable purine permease 5              159   9e-41    
gb|EEE55178.1|  hypothetical protein OsJ_03013                          160   1e-40    
ref|XP_008242984.1|  PREDICTED: probable purine permease 5 isofor...    159   2e-40    
ref|XP_008677756.1|  PREDICTED: uncharacterized protein LOC100502...    159   2e-40    
ref|XP_008242983.1|  PREDICTED: probable purine permease 5 isofor...    158   2e-40    
gb|EEC85041.1|  hypothetical protein OsI_32358                          158   4e-40    
ref|XP_004953494.1|  PREDICTED: probable purine permease 11-like        158   4e-40    
dbj|BAK04769.1|  predicted protein                                      158   5e-40    
gb|KEH18591.1|  purine transporter, putative                            157   6e-40    
gb|KEH18590.1|  purine transporter, putative                            157   7e-40    
gb|KEH18592.1|  purine transporter, putative                            157   7e-40    
ref|XP_010926345.1|  PREDICTED: purine permease 1-like isoform X2       154   8e-40    
ref|XP_006647707.1|  PREDICTED: probable purine permease 11-like        157   9e-40    
ref|XP_003551696.2|  PREDICTED: probable purine permease 11-like ...    157   1e-39    
ref|XP_006602851.1|  PREDICTED: probable purine permease 11-like ...    156   1e-39    
gb|KDO85409.1|  hypothetical protein CISIN_1g0170172mg                  156   1e-39    
ref|XP_006464375.1|  PREDICTED: probable purine permease 11-like ...    156   1e-39    
dbj|BAG92399.1|  unnamed protein product                                157   1e-39    
ref|XP_010680002.1|  PREDICTED: probable purine permease 11             156   2e-39    
ref|XP_006445484.1|  hypothetical protein CICLE_v10020615mg             156   2e-39    
ref|XP_002320858.2|  purine permease family protein                     156   2e-39    
ref|XP_004144732.1|  PREDICTED: probable purine permease 5-like         155   2e-39    
ref|XP_004229705.1|  PREDICTED: probable purine permease 11             155   2e-39    
ref|XP_002454455.1|  hypothetical protein SORBIDRAFT_04g031400          156   2e-39    
ref|XP_006464373.1|  PREDICTED: probable purine permease 11-like ...    156   2e-39    
ref|XP_004488230.1|  PREDICTED: probable purine permease 4-like         155   3e-39    
ref|XP_009418739.1|  PREDICTED: probable purine permease 5 isofor...    155   3e-39    
ref|XP_010098678.1|  Purine permease 1                                  156   3e-39    
ref|XP_006354634.1|  PREDICTED: probable purine permease 11-like        155   3e-39    
gb|EPS62038.1|  hypothetical protein M569_12755                         154   4e-39    
ref|XP_009418731.1|  PREDICTED: probable purine permease 5 isofor...    155   4e-39    
ref|XP_002440227.1|  hypothetical protein SORBIDRAFT_09g028030          154   4e-39    
dbj|BAG93087.1|  unnamed protein product                                154   5e-39    
ref|XP_010519027.1|  PREDICTED: probable purine permease 4              155   5e-39    
ref|XP_008677755.1|  PREDICTED: uncharacterized protein LOC100502...    157   5e-39    
ref|XP_004488231.1|  PREDICTED: probable purine permease 4-like         155   6e-39    
ref|XP_006436828.1|  hypothetical protein CICLE_v10031810mg             155   7e-39    
ref|XP_010058075.1|  PREDICTED: probable purine permease 4              154   8e-39    
dbj|BAJ95311.1|  predicted protein                                      154   9e-39    
gb|EEC73811.1|  hypothetical protein OsI_08525                          154   1e-38    
dbj|BAD07671.1|  putative purine permease                               154   1e-38    
ref|NP_001047783.1|  Os02g0689200                                       154   1e-38    
ref|XP_006662363.1|  PREDICTED: probable purine permease 11-like        154   2e-38    
ref|XP_010677220.1|  PREDICTED: probable purine permease 11             154   2e-38    
ref|XP_008452890.1|  PREDICTED: probable purine permease 5              153   2e-38    
ref|XP_010260818.1|  PREDICTED: probable purine permease 4              154   2e-38    
ref|XP_003550935.1|  PREDICTED: probable purine permease 11-like        153   2e-38    
ref|XP_007034137.1|  Purine permease 4                                  153   3e-38    
gb|EMT19164.1|  hypothetical protein F775_05921                         153   3e-38    
ref|XP_002441494.1|  hypothetical protein SORBIDRAFT_09g028020          152   3e-38    
ref|XP_010247689.1|  PREDICTED: probable purine permease 11             153   3e-38    
gb|EAZ24234.1|  hypothetical protein OsJ_07985                          154   3e-38    
ref|XP_008460053.1|  PREDICTED: probable purine permease 11             152   3e-38    
ref|XP_008355645.1|  PREDICTED: probable purine permease 11             152   3e-38    
gb|ADN34099.1|  purine transmembrane transporter                        152   4e-38    
ref|XP_009608565.1|  PREDICTED: probable purine permease 9 isofor...    152   4e-38    
ref|XP_009608566.1|  PREDICTED: probable purine permease 10 isofo...    152   4e-38    
dbj|BAK02444.1|  predicted protein                                      153   5e-38    
gb|KDO38040.1|  hypothetical protein CISIN_1g0167861mg                  152   6e-38    
ref|XP_010677223.1|  PREDICTED: probable purine permease 11             152   6e-38    
gb|KEH37325.1|  triose-phosphate transporter family protein             152   6e-38    
ref|XP_007211409.1|  hypothetical protein PRUPE_ppa006967mg             152   6e-38    
ref|XP_002462820.1|  hypothetical protein SORBIDRAFT_02g032510          151   7e-38    
ref|XP_009782582.1|  PREDICTED: probable purine permease 10 isofo...    152   7e-38    
ref|XP_009782581.1|  PREDICTED: probable purine permease 10 isofo...    152   7e-38    
ref|XP_004307271.1|  PREDICTED: probable purine permease 11-like        153   8e-38    
gb|KDP28910.1|  hypothetical protein JCGZ_14681                         151   1e-37    
ref|XP_006358606.1|  PREDICTED: probable purine permease 11-like        151   1e-37    
ref|XP_004232602.1|  PREDICTED: probable purine permease 4              152   1e-37    
ref|XP_011018650.1|  PREDICTED: probable purine permease 11 isofo...    152   1e-37    
ref|XP_009614957.1|  PREDICTED: probable purine permease 4              150   1e-37    
emb|CBI40933.3|  unnamed protein product                                150   1e-37    
gb|EYU40318.1|  hypothetical protein MIMGU_mgv1a008679mg                151   1e-37    
ref|XP_004957612.1|  PREDICTED: probable purine permease 5-like         151   1e-37    
ref|XP_011018648.1|  PREDICTED: probable purine permease 11 isofo...    151   1e-37    
ref|XP_008225353.1|  PREDICTED: probable purine permease 9              151   1e-37    
ref|NP_001151039.1|  ATPUP5                                             150   2e-37    
ref|XP_009115035.1|  PREDICTED: probable purine permease 4              151   2e-37    
ref|XP_009115032.1|  PREDICTED: probable purine permease 4              151   2e-37    
ref|XP_002533991.1|  purine transporter, putative                       150   2e-37    
ref|XP_009407088.1|  PREDICTED: probable purine permease 4              151   2e-37    
ref|XP_008450620.1|  PREDICTED: probable purine permease 11 isofo...    150   2e-37    
ref|XP_004245857.1|  PREDICTED: probable purine permease 11             150   2e-37    
ref|XP_008371579.1|  PREDICTED: probable purine permease 10             150   2e-37    
ref|XP_007025157.1|  Purine permease 10, putative                       150   2e-37    
ref|XP_010091784.1|  hypothetical protein L484_003844                   151   3e-37    
ref|XP_007039598.1|  Drug/metabolite transporter superfamily protein    149   3e-37    
gb|KHN21034.1|  Putative purine permease 9                              150   3e-37    
ref|XP_010056479.1|  PREDICTED: probable purine permease 11 isofo...    149   3e-37    
gb|KHN26580.1|  Putative purine permease 4                              150   4e-37    
ref|XP_004248515.2|  PREDICTED: probable purine permease 4              149   4e-37    
ref|XP_008394323.1|  PREDICTED: probable purine permease 5              149   5e-37    
ref|XP_008352089.1|  PREDICTED: probable purine permease 5              149   5e-37    
gb|KGN66057.1|  hypothetical protein Csa_1G569340                       149   5e-37    
ref|XP_010110511.1|  hypothetical protein L484_023343                   150   5e-37    
ref|XP_006352648.1|  PREDICTED: probable purine permease 4-like         150   5e-37    
ref|XP_009339630.1|  PREDICTED: probable purine permease 11 isofo...    149   5e-37    
ref|XP_007052418.1|  Purine permease 11 isoform 2                       149   5e-37    
ref|XP_004144733.1|  PREDICTED: probable purine permease 5-like         149   6e-37    
gb|KDP37934.1|  hypothetical protein JCGZ_04577                         149   6e-37    
ref|XP_002890908.1|  hypothetical protein ARALYDRAFT_473325             149   6e-37    
ref|XP_010047110.1|  PREDICTED: probable purine permease 5 isofor...    149   6e-37    
ref|XP_003593723.1|  hypothetical protein MTR_2g015470                  149   7e-37    
ref|XP_010047109.1|  PREDICTED: probable purine permease 5 isofor...    149   7e-37    
ref|XP_003570128.1|  PREDICTED: probable purine permease 11 isofo...    149   8e-37    
ref|XP_003534852.1|  PREDICTED: probable purine permease 4-like         149   8e-37    
ref|XP_009339629.1|  PREDICTED: probable purine permease 11 isofo...    149   8e-37    
ref|NP_001241384.1|  uncharacterized protein LOC100819409               149   8e-37    
ref|XP_010235835.1|  PREDICTED: probable purine permease 11 isofo...    149   8e-37    
ref|XP_007052417.1|  Purine permease 11 isoform 1                       149   9e-37    
ref|XP_010056477.1|  PREDICTED: probable purine permease 11 isofo...    149   9e-37    
ref|XP_010056475.1|  PREDICTED: probable purine permease 11 isofo...    149   1e-36    
ref|XP_010526296.1|  PREDICTED: probable purine permease 5              148   1e-36    
ref|XP_007212398.1|  hypothetical protein PRUPE_ppa016371mg             147   1e-36    
gb|KDP45955.1|  hypothetical protein JCGZ_11858                         148   1e-36    
ref|XP_008225422.1|  PREDICTED: probable purine permease 9              149   1e-36    
ref|XP_004293485.1|  PREDICTED: probable purine permease 9-like i...    149   1e-36    
ref|XP_009358445.1|  PREDICTED: LOW QUALITY PROTEIN: probable pur...    148   1e-36    
ref|XP_008452946.1|  PREDICTED: probable purine permease 5 isofor...    147   2e-36    
ref|XP_008452930.1|  PREDICTED: probable purine permease 5 isofor...    148   2e-36    
ref|XP_010055380.1|  PREDICTED: probable purine permease 11             147   2e-36    
tpg|DAA58126.1|  TPA: hypothetical protein ZEAMMB73_217515              148   2e-36    
ref|XP_008452939.1|  PREDICTED: probable purine permease 5 isofor...    147   2e-36    
ref|XP_010092275.1|  hypothetical protein L484_021136                   148   2e-36    
ref|XP_004969543.1|  PREDICTED: probable purine permease 4-like         148   2e-36    
ref|XP_004293484.1|  PREDICTED: probable purine permease 9-like i...    148   2e-36    
ref|XP_008452904.1|  PREDICTED: probable purine permease 5 isofor...    147   2e-36    
ref|XP_006445485.1|  hypothetical protein CICLE_v10020615mg             146   2e-36    
ref|XP_006355608.1|  PREDICTED: probable purine permease 6-like i...    147   3e-36    
ref|XP_006355607.1|  PREDICTED: probable purine permease 6-like i...    147   3e-36    
gb|KGN46286.1|  hypothetical protein Csa_6G079800                       147   3e-36    
ref|XP_006445483.1|  hypothetical protein CICLE_v10020615mg             146   5e-36    
ref|XP_010941192.1|  PREDICTED: probable purine permease 11             147   5e-36    
ref|XP_006368464.1|  hypothetical protein POPTR_0001s03050g             147   5e-36    
ref|XP_006307602.1|  hypothetical protein CARUB_v10009226mg             147   5e-36    
ref|XP_008799578.1|  PREDICTED: LOW QUALITY PROTEIN: probable pur...    146   6e-36    
ref|XP_004145022.1|  PREDICTED: probable purine permease 11-like        146   6e-36    
ref|XP_006467517.1|  PREDICTED: probable purine permease 9-like         147   6e-36    
ref|XP_004160684.1|  PREDICTED: probable purine permease 11-like        146   6e-36    
ref|XP_010247691.1|  PREDICTED: probable purine permease 11 isofo...    146   6e-36    
ref|XP_009363284.1|  PREDICTED: probable purine permease 4              147   6e-36    
ref|XP_008371936.1|  PREDICTED: probable purine permease 4              147   6e-36    
ref|XP_008656754.1|  PREDICTED: probable purine permease 4              146   6e-36    
ref|XP_010244043.1|  PREDICTED: purine permease 1-like                  139   6e-36    
ref|XP_010240325.1|  PREDICTED: probable purine permease 11             146   7e-36    
ref|XP_006644522.1|  PREDICTED: probable purine permease 4-like         147   7e-36    
ref|XP_007025158.1|  Purine permease 10                                 147   7e-36    
emb|CDY46618.1|  BnaA09g27450D                                          142   7e-36    
ref|XP_002263453.2|  PREDICTED: probable purine permease 4              146   7e-36    
emb|CBH32558.1|  Triose-phosphate Transporter family domain conta...    146   7e-36    
ref|XP_010439889.1|  PREDICTED: probable purine permease 9              146   8e-36    
ref|XP_006841264.1|  hypothetical protein AMTR_s00135p00104240          144   8e-36    
ref|XP_010661433.1|  PREDICTED: probable purine permease 11 isofo...    146   9e-36    
ref|XP_010674210.1|  PREDICTED: probable purine permease 11 isofo...    145   9e-36    
ref|XP_008226761.1|  PREDICTED: probable purine permease 10             146   1e-35    
gb|EPS68883.1|  hypothetical protein M569_05883                         145   1e-35    
ref|XP_002266773.1|  PREDICTED: probable purine permease 11 isofo...    145   1e-35    
ref|XP_007213488.1|  hypothetical protein PRUPE_ppa022736mg             145   1e-35    
ref|XP_004233085.1|  PREDICTED: probable purine permease 10             145   1e-35    
ref|XP_004151103.1|  PREDICTED: probable purine permease 9-like i...    145   1e-35    
ref|XP_010674209.1|  PREDICTED: probable purine permease 11 isofo...    145   1e-35    
ref|XP_008226019.1|  PREDICTED: probable purine permease 4              145   2e-35    
gb|KDO85410.1|  hypothetical protein CISIN_1g0170172mg                  144   2e-35    
ref|XP_006449636.1|  hypothetical protein CICLE_v10015531mg             145   2e-35    
ref|XP_004287128.1|  PREDICTED: probable purine permease 5-like i...    142   2e-35    
ref|XP_010052098.1|  PREDICTED: probable purine permease 9              145   2e-35    
ref|XP_009353822.1|  PREDICTED: probable purine permease 10             145   2e-35    
emb|CDX76826.1|  BnaC08g34120D                                          145   2e-35    



>ref|XP_009631999.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=358

 Score =   481 bits (1238),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 236/339 (70%), Positives = 283/339 (83%), Gaps = 0/339 (0%)
 Frame = +1

Query  10    KNLEDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFP  189
             KN +  K   F+S K L+I+INC+FLAVGQI GV+L+R+YFLHGGKRKWL +  LTAGFP
Sbjct  11    KNCKPRKLKNFMSIKTLLIVINCIFLAVGQIAGVMLVRIYFLHGGKRKWLQAFWLTAGFP  70

Query  190   CLLVPIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSIS  369
              LL+PI IS+A+ +        RVL+TP L ++SA LGLLLGV SYLYTFGMSYLPVSIS
Sbjct  71    ILLLPIAISFAKRRKANKTETNRVLLTPKLILASAILGLLLGVCSYLYTFGMSYLPVSIS  130

Query  370   SLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTL  549
             SLL+ST LAFTA+FAYFIVKHK THYSVNAVVLMTFGS++LGLHM GDRP+GES+R Y L
Sbjct  131   SLLASTSLAFTAIFAYFIVKHKFTHYSVNAVVLMTFGSIILGLHMNGDRPKGESNRQYVL  190

Query  550   GFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDF  729
             GF MTI GAALHGF+ AGVEY+H+ AGV VT  L+MQ+QF+ISMFS LFC VAMIINKDF
Sbjct  191   GFVMTIVGAALHGFLNAGVEYSHIKAGVAVTFDLVMQMQFLISMFSTLFCVVAMIINKDF  250

Query  730   QAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQV  909
             Q I +EA  F LG  KYYMI+  +AIALQ+M++G+LG+IFSSSALL GIF SLLV VQQ+
Sbjct  251   QTIHREAEAFGLGQNKYYMILALSAIALQIMIIGNLGLIFSSSALLSGIFNSLLVPVQQI  310

Query  910   FSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
             F+V+FLPESF+A+K ++LA+C+WGFASYFYG+YK + KK
Sbjct  311   FAVMFLPESFNAEKWMALAMCLWGFASYFYGEYKASLKK  349



>ref|XP_009762898.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
Length=359

 Score =   460 bits (1183),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 228/345 (66%), Positives = 282/345 (82%), Gaps = 2/345 (1%)
 Frame = +1

Query  28    KKMK-FLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVP  204
             +K+K F+S K L++ INC+F+AVGQI GV+L+R+YFLHGGKRKWL + LLTAGFP L++P
Sbjct  15    RKLKNFMSIKTLLVFINCIFMAVGQIAGVMLVRIYFLHGGKRKWLQAFLLTAGFPILVLP  74

Query  205   IFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSS  384
             I ISYA+ +       R V++TP L ++SA LGLL  V SYLYTFGMSYLPVSISSLL+S
Sbjct  75    IAISYAKRRKAKTETNR-VILTPKLILASAILGLLFCVCSYLYTFGMSYLPVSISSLLAS  133

Query  385   TQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMT  564
             T LAFTA+FAYF VKHK THYS+NAVVLMTFGS++LGLHM GDRP+GES+R Y LGF MT
Sbjct  134   TSLAFTAIFAYFFVKHKFTHYSINAVVLMTFGSIILGLHMNGDRPKGESNRQYVLGFVMT  193

Query  565   IAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISK  744
             I GAALHGF+ AGVEY+H+ AGV VT  L+MQ+QF+I +FS LFC VAMIIN+DFQAI +
Sbjct  194   IVGAALHGFVNAGVEYSHIKAGVVVTFDLVMQMQFLICIFSTLFCVVAMIINEDFQAIHR  253

Query  745   EAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIF  924
             EA EF LG  KYYMI+  +AIALQ+M++G+LG+IFSSSALL GI  SLLV VQQ+F+V+F
Sbjct  254   EAGEFRLGQNKYYMILALSAIALQIMIIGNLGLIFSSSALLSGIVNSLLVPVQQIFAVMF  313

Query  925   LPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDE  1059
             LPESF+A+K ++LA+C+WGFASYFYG+YK + K       T  D+
Sbjct  314   LPESFNAEKWMALAMCLWGFASYFYGEYKASLKVTKTKHATQPDQ  358



>ref|XP_004252530.1| PREDICTED: purine permease 1-like [Solanum lycopersicum]
Length=364

 Score =   437 bits (1123),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 228/338 (67%), Positives = 279/338 (83%), Gaps = 3/338 (1%)
 Frame = +1

Query  13    NLEDMKKMK-FLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFP  189
             N +  KK+K F+S K L+I IN +F++VGQI GV+L+R+Y+LHGGKRKWL + LLTAGFP
Sbjct  10    NYDKPKKLKNFMSIKTLLIFINFIFISVGQISGVLLVRIYYLHGGKRKWLQAFLLTAGFP  69

Query  190   CLLVPIFISYarnqakaaanrrrV--LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVS  363
              L++PI ISY + + K       +   VTP L M SA LGLLLG+ SYLYTFGMSYLPVS
Sbjct  70    ILILPISISYLKKRKKITNINNNIRFFVTPKLAMFSAILGLLLGICSYLYTFGMSYLPVS  129

Query  364   ISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSY  543
             ISSLLSST LAFTA+FAYF+VKHK T YSVNAVVLM  GS++LGLHM GDRP GES+RSY
Sbjct  130   ISSLLSSTSLAFTAIFAYFMVKHKFTDYSVNAVVLMMLGSIILGLHMNGDRPIGESNRSY  189

Query  544   TLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINK  723
              LGF MT+ GAALHGF+ AGVEY+HV AGV VT  L+MQ+QF+ISMFSALFC VAMIINK
Sbjct  190   ALGFVMTLVGAALHGFVNAGVEYSHVKAGVVVTFDLVMQMQFLISMFSALFCIVAMIINK  249

Query  724   DFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQ  903
             DFQAI++EA EF LG  KYYMI+G  AI+LQ+M++G+LG+IF SSALLLGI  +LLV +Q
Sbjct  250   DFQAITREAEEFGLGQRKYYMILGLTAISLQIMIIGNLGMIFCSSALLLGIVNALLVPIQ  309

Query  904   QVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTA  1017
             Q+F+V+FLPESF++DK ++LA+C+WGFASYFYG+YK +
Sbjct  310   QIFAVMFLPESFNSDKWMALAMCLWGFASYFYGEYKES  347



>ref|XP_006360267.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=361

 Score =   435 bits (1119),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 226/337 (67%), Positives = 278/337 (82%), Gaps = 2/337 (1%)
 Frame = +1

Query  13    NLEDMKKMK-FLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFP  189
             N +  KK+K F+S K L+I+INC+F++VGQI GV+L+R+Y+LHGGKRKWL + LLTAGFP
Sbjct  8     NYDKRKKIKNFMSIKTLLILINCIFISVGQISGVLLVRIYYLHGGKRKWLQAFLLTAGFP  67

Query  190   CLLVPIFISYarnqakaaanrrrVL-VTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSI  366
              L++PI ISY + + K   N    L VTP L + SA LG+LLG+ SYLYTFGMSYLPVSI
Sbjct  68    ILILPISISYVKKRKKITNNNNIRLFVTPKLAIFSAILGILLGICSYLYTFGMSYLPVSI  127

Query  367   SSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYT  546
             SSLLSST LAFTA+FAYF+VKHK T YSVNAVVLM  GS++LGLHM GDRP GES+R YT
Sbjct  128   SSLLSSTSLAFTAIFAYFMVKHKFTDYSVNAVVLMMLGSIILGLHMNGDRPIGESNRRYT  187

Query  547   LGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKD  726
             LGF MT+ GAALHGF+ AGVEY+HV AGV VT  L+MQ+QF+ISMFSALFC VAMIINKD
Sbjct  188   LGFVMTLVGAALHGFVNAGVEYSHVKAGVVVTFDLVMQMQFLISMFSALFCIVAMIINKD  247

Query  727   FQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQ  906
             FQAI++EA EF LG  KYYMI+   AI+LQ M++G+LG+IF SSALL GI  +LLV +QQ
Sbjct  248   FQAITREAEEFGLGQRKYYMILALTAISLQTMIIGNLGMIFCSSALLSGIVNALLVPIQQ  307

Query  907   VFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTA  1017
             +F+V+FLPE F++DK ++LA+C+WGFASYFYG+YK +
Sbjct  308   IFAVMFLPERFNSDKWMALAMCLWGFASYFYGEYKDS  344



>ref|XP_006360266.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=364

 Score =   431 bits (1109),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 225/338 (67%), Positives = 275/338 (81%), Gaps = 3/338 (1%)
 Frame = +1

Query  13    NLEDMKKMK-FLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFP  189
             N    KK+K F+S K L+I+I C+FL VGQI GV+L+R+Y+LHGGKRKWL S LLTAGFP
Sbjct  10    NYNKPKKLKNFMSIKTLLILIYCIFLLVGQISGVLLVRIYYLHGGKRKWLQSLLLTAGFP  69

Query  190   CLLVPIFISYarnqakaaanrrrV--LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVS  363
              L++PI ISY +   K   N   +   VTP L + SA LG+L G+ SYLYT GMSYLPVS
Sbjct  70    ILILPISISYMKKMKKITINNNNIRLFVTPKLAIFSAILGILFGICSYLYTIGMSYLPVS  129

Query  364   ISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSY  543
             ISSLLSST LAFTA+FAYF+VKHK THYSVNAVVLM  GS++LGLHM GDRP GES+R Y
Sbjct  130   ISSLLSSTSLAFTAIFAYFMVKHKFTHYSVNAVVLMMLGSIILGLHMNGDRPIGESNRQY  189

Query  544   TLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINK  723
             TLGF MTI GAALHGF+ AGVEY+HV AGV VT  L+MQ+QF+ISMFS+LFC VA+IIN+
Sbjct  190   TLGFVMTIIGAALHGFLNAGVEYSHVKAGVVVTFDLVMQIQFLISMFSSLFCIVAIIINR  249

Query  724   DFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQ  903
             DFQAI++EA EF LG +KYYMI+   AI+LQ M++GSLG+IF SSALL GI  +LL+ +Q
Sbjct  250   DFQAITREAEEFGLGQKKYYMILALTAISLQTMMIGSLGMIFCSSALLFGIVNALLIPIQ  309

Query  904   QVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTA  1017
             Q+F+VIFLPESF++DK ++LA+C+WGFASYFYG+YK +
Sbjct  310   QIFAVIFLPESFNSDKWMALAMCLWGFASYFYGEYKDS  347



>emb|CDP01096.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   422 bits (1086),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 221/344 (64%), Positives = 275/344 (80%), Gaps = 6/344 (2%)
 Frame = +1

Query  43    LSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYa  222
             +S K L+++ NC+ LA+GQ+GG +L+R+YFLHGGKRKWL++ LLTAGFP L++PI ISY 
Sbjct  22    ISMKTLMVLFNCILLAIGQVGGPLLVRIYFLHGGKRKWLTAWLLTAGFPLLILPISISYF  81

Query  223   rnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFT  402
             +N++KA++ +   LV P L  +SAFLG LLG+DSYLYTFGMSYLPVS+SSLL S+QLAFT
Sbjct  82    KNRSKASSPK--FLVPPRLVAASAFLGFLLGIDSYLYTFGMSYLPVSVSSLLGSSQLAFT  139

Query  403   AVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAAL  582
             A+FAYF+VKHK THYS+NAVVLMTFGS +LGLHM GDRP GES+ +YTLGFFMT+  AAL
Sbjct  140   AIFAYFVVKHKFTHYSINAVVLMTFGSAILGLHMNGDRPSGESNANYTLGFFMTLGAAAL  199

Query  583   HGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFD  762
             HGFIM   EYA   A V VT  L +QVQF++SMF+ LFCT+ MIINKDFQAI +EA EF+
Sbjct  200   HGFIMPAFEYAQKKAEVTVTFDLFLQVQFLVSMFATLFCTIPMIINKDFQAIPQEAAEFE  259

Query  763   LGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFS  942
             LG  KYY I+  A IALQ M++GS GVIFSSS+L  GI TSLLV VQQ+F+V  L ESFS
Sbjct  260   LGPMKYYTILVMAGIALQCMMIGSTGVIFSSSSLFGGIVTSLLVPVQQIFAVFCLAESFS  319

Query  943   ADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQEV  1074
              +K ++LA+C+WGFASYFYG+YK  +K+P        + EH+EV
Sbjct  320   GEKGMALAMCLWGFASYFYGEYKVNQKQPD----VKHEPEHEEV  359



>ref|XP_002301070.2| hypothetical protein POPTR_0002s09980g [Populus trichocarpa]
 gb|EEE80343.2| hypothetical protein POPTR_0002s09980g [Populus trichocarpa]
Length=349

 Score =   396 bits (1017),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 211/351 (60%), Positives = 269/351 (77%), Gaps = 10/351 (3%)
 Frame = +1

Query  13    NLEDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPC  192
             N  D  + K    KA ++ +NC+ +AVGQ+ G +L+R+Y+LHGGK  WL + LLTAGFP 
Sbjct  9     NEPDQHQNK-KHMKAFLVFLNCMLMAVGQVAGPLLVRIYYLHGGKSNWLGAWLLTAGFPI  67

Query  193   LLVPIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISS  372
             L++PI ISY R +A+A A R  +LVTPWLF +S  LGLLLG+DSYLY+FGMSYLPVS+SS
Sbjct  68    LIIPIAISYIRARARAQAGR--LLVTPWLFSASVILGLLLGLDSYLYSFGMSYLPVSVSS  125

Query  373   LLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLG  552
             +L S+QLAFTA+FAY IVKHK THYS+NAV LMTFGSV+LG HM GDRP GES   Y LG
Sbjct  126   ILGSSQLAFTAIFAYIIVKHKFTHYSINAVALMTFGSVILGFHMNGDRPSGESKGKYILG  185

Query  553   FFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQ  732
             FFMTI GAALHGF+M  +E+ ++ AG  +T  L++QVQF+ISMF+ LFC++ MIINKDF+
Sbjct  186   FFMTIGGAALHGFLMPALEFTYLKAGKAITFDLVLQVQFLISMFATLFCSIPMIINKDFK  245

Query  733   AISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVF  912
             AISKEA EF LG  KYY I+  AAI LQL+V+GSLGVIF+SS+LL G+ +SLLV VQQ F
Sbjct  246   AISKEAAEFGLGKTKYYTILLIAAIVLQLLVIGSLGVIFNSSSLLGGLVSSLLVPVQQAF  305

Query  913   SVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEH  1065
             +V+ L E F+A+K ++LA+C+WGFASY YG+Y+        P    ++  H
Sbjct  306   AVMILKEVFNAEKGMALAMCLWGFASYLYGEYQK-------PEANKEESTH  349



>ref|XP_002513954.1| purine transporter, putative [Ricinus communis]
 gb|EEF48537.1| purine transporter, putative [Ricinus communis]
Length=358

 Score =   394 bits (1012),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 212/355 (60%), Positives = 278/355 (78%), Gaps = 9/355 (3%)
 Frame = +1

Query  10    KNLEDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFP  189
             K  E+ K +K L     ++++NC+ +++GQ+GG +LIRLY+LHGGKRKWL+S LLTAGFP
Sbjct  12    KQQENSKHIKIL-----LVVLNCLLMSIGQVGGPLLIRLYYLHGGKRKWLTSWLLTAGFP  66

Query  190   CLLVPIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSIS  369
              L++PI  SY   +A++ A   R+L+T WLF +SAF+GLLLG+D YLY+FG+SYLPVS+S
Sbjct  67    ILILPISSSYMIARARSRAPTSRLLLTRWLFAASAFIGLLLGLDGYLYSFGLSYLPVSVS  126

Query  370   SLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTL  549
             SLL STQLAFTA+FAY +VKH+ THYS+NAVVLMTFGS++LG HM GD P GES+  Y L
Sbjct  127   SLLGSTQLAFTAIFAYIVVKHRFTHYSINAVVLMTFGSIILGFHMNGDVPNGESNGKYVL  186

Query  550   GFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDF  729
             GFFM +  AALHGFIM  VEY H++AG+P+T  L+MQVQF+ISMF+ LFCT+ MIINKDF
Sbjct  187   GFFMAVGAAALHGFIMPAVEYTHMNAGMPITFDLVMQVQFLISMFATLFCTIPMIINKDF  246

Query  730   QAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQV  909
             QAI KEA +F LG  KYY I+  AA+ +QL+++GSLGVIF+S++LL G+ +SLLV VQQV
Sbjct  247   QAIPKEAEKFGLGQAKYYTILVVAAVIMQLLIIGSLGVIFASTSLLGGLVSSLLVPVQQV  306

Query  910   FSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQEV  1074
             F+VIFL E F+A+K ++LA+C+WGFAS+ YG Y  + KK         +E + EV
Sbjct  307   FAVIFLHEVFNAEKGMALAMCLWGFASHLYGAYVESSKK----QAKKKEESNCEV  357



>ref|XP_011016754.1| PREDICTED: purine permease 1-like [Populus euphratica]
Length=349

 Score =   372 bits (954),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 205/352 (58%), Positives = 263/352 (75%), Gaps = 10/352 (3%)
 Frame = +1

Query  10    KNLEDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFP  189
             KN  D  + K    KA ++ +NC+ +AVGQ+ G +L+R+Y+LHGGK  WL + LLTAGF 
Sbjct  8     KNEPDQHQNK-KHMKAFLVFLNCMLMAVGQVAGPLLVRMYYLHGGKSNWLGAWLLTAGF-  65

Query  190   CLLVPIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSIS  369
               ++ I IS +  +A+A A   R+LVTPWLF +S  LGL+LG+DSYLY+FGMSYLPVS+S
Sbjct  66    -PILIIPISISYIRARARAQAGRLLVTPWLFSASVILGLVLGLDSYLYSFGMSYLPVSVS  124

Query  370   SLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTL  549
             S+L S+QL FTA FAY IVKHK THYS+NAV LMTFGS++LG HM GDRP GES   Y L
Sbjct  125   SILGSSQLTFTAFFAYIIVKHKFTHYSINAVALMTFGSLILGFHMNGDRPSGESKGKYIL  184

Query  550   GFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDF  729
             GFFMTI GAALHGF+M  +E+ ++ AG  +T  L++QVQF+ISMF+ LFC++ MIINKDF
Sbjct  185   GFFMTIGGAALHGFLMPALEFTYLKAGKAITFDLVLQVQFLISMFATLFCSIPMIINKDF  244

Query  730   QAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQV  909
             +AISKEA EF LG  KYY I+  AAI LQL+V+GSLGVIF+SS+LL G+ +SLLV VQQ 
Sbjct  245   KAISKEAAEFGLGETKYYTILLIAAIVLQLLVIGSLGVIFNSSSLLGGLVSSLLVPVQQA  304

Query  910   FSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEH  1065
             F+VI L E F+A K ++LA+C+WGFASY YG+Y+        P    ++  H
Sbjct  305   FAVIILKEVFNAVKGMALAMCLWGFASYLYGEYQK-------PEANKEESTH  349



>emb|CBI19192.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   332 bits (852),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/258 (62%), Positives = 208/258 (81%), Gaps = 3/258 (1%)
 Frame = +1

Query  19   EDMKKMKFLSFKAL-VIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCL  195
            E  ++ +  S KA+ ++++NCV + +GQ+GG +L+R+Y+LHGGKRKWL++ LLT+GFP L
Sbjct  10   EATQRQRRKSLKAMFLVLVNCVLMTIGQVGGPLLLRIYYLHGGKRKWLNAWLLTSGFPIL  69

Query  196  LVPIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSL  375
            ++P+  SY R QAK  A    +LVTP L  +SAFLG+LLG+D YLY+FG+SYLP+S+SSL
Sbjct  70   ILPMAFSYLRAQAKGQATV--LLVTPRLVAASAFLGILLGLDGYLYSFGLSYLPISVSSL  127

Query  376  LSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGF  555
            L STQLAFTA+FA+ +VKHK THYSVNAVVLMTFGS+VLGLHM GDRP G SD  Y LGF
Sbjct  128  LGSTQLAFTAIFAFIVVKHKFTHYSVNAVVLMTFGSIVLGLHMNGDRPSGVSDGKYLLGF  187

Query  556  FMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQA  735
             MT+  AALHGFIM  +EY H+ AG+P+T  L+MQ+QF+ISMF+ LFCT+ M+INKDFQA
Sbjct  188  LMTLGAAALHGFIMPALEYTHLKAGMPITFDLVMQIQFLISMFATLFCTIPMVINKDFQA  247

Query  736  ISKEAREFDLGTEKYYMI  789
            +SKEA E+ LG  KYYM+
Sbjct  248  VSKEAAEYGLGETKYYMV  265



>ref|XP_002285717.1| PREDICTED: purine permease 1 [Vitis vinifera]
 emb|CAN64392.1| hypothetical protein VITISV_015235 [Vitis vinifera]
Length=349

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 237/334 (71%), Gaps = 0/334 (0%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
             + +  ++++NCV L++G  GG +++RLYF+ GG+R W SS L TAG+P +LVP+ I+Y  
Sbjct  8     NMRKALLVLNCVILSIGNCGGPMVMRLYFVRGGERIWFSSWLETAGWPLILVPLIITYIH  67

Query  226   nqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
              + K  ++ +   + P LF++SA +G+L G D YLY +G++ LPVS S+L+ ++QLAFTA
Sbjct  68    RRTKQGSHAKLFFMKPPLFVASAVIGVLTGFDDYLYAYGVAKLPVSTSALIIASQLAFTA  127

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
              FA+ +VK K T YSVNA+ L++ G+ VL LH + DRP  ES++ Y LGF MT+A AAL+
Sbjct  128   AFAFLLVKQKFTSYSVNAIFLLSIGAGVLALHTSSDRPANESNKEYYLGFVMTLAAAALY  187

Query  586   GFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDL  765
             GFI+  VE  +  A   +T  L+M++Q ++  F+ +FCTV M++N DFQAIS+EA+E++L
Sbjct  188   GFILPLVELTYKKAKQAITYSLVMEIQMVMCFFATVFCTVGMLVNNDFQAISREAKEYEL  247

Query  766   GTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSA  945
             G  KYY++V +  I  Q   +G++GVIFS+S+L+ GI  ++L+ V ++ +VIF  E F A
Sbjct  248   GEAKYYLVVVWNGIIWQCFFLGAIGVIFSASSLVCGIVIAVLLPVTEILAVIFFQEKFQA  307

Query  946   DKLLSLAICIWGFASYFYGDYKTARKKPPPPPVT  1047
             +K +SLA+ +WGF SYFYG+ K ++KK  P P T
Sbjct  308   EKGVSLALSLWGFVSYFYGEIKDSKKKKNPTPET  341



>ref|XP_002513994.1| purine transporter, putative [Ricinus communis]
 gb|EEF48577.1| purine transporter, putative [Ricinus communis]
Length=356

 Score =   323 bits (827),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 156/329 (47%), Positives = 234/329 (71%), Gaps = 1/329 (0%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K  ++I+NC+ L++G  GG +++RLYF+HGGKR WLSS L T G+P LL+P+FISY   +
Sbjct  15    KRALLILNCILLSIGNCGGPLIMRLYFIHGGKRVWLSSWLETGGWPILLIPLFISYLHRR  74

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
             +     +   +  P LF+++ F+G+L G+D YLY +G++ LPVS SSL+ +TQLAFTA F
Sbjct  75    STNPPTKLFYM-KPRLFLAATFIGVLTGLDDYLYAYGVARLPVSTSSLIIATQLAFTAAF  133

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A+ +VK K T +S+NAVVL+T G+ VL LH + DRP  ES + Y LGF MT+  AAL+GF
Sbjct  134   AFLLVKQKFTSFSINAVVLLTAGAGVLALHTSSDRPGHESTKQYALGFVMTLVAAALYGF  193

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             I+  VE  +  +   ++  L+M++Q ++ +F+ +FCT+ M++NKDF  I +EAREF LG 
Sbjct  194   ILPLVELTYKKSKQEISYTLVMEIQMVMCLFATIFCTIGMLVNKDFNVIPREAREFGLGE  253

Query  772   EKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADK  951
              KYY+I+ ++AI  Q   +G++GVIF +S+LL GI  ++L+ V +V +VIF  E+F A+K
Sbjct  254   TKYYVILVWSAIIWQCFFLGAIGVIFCASSLLSGILIAVLLPVTEVLAVIFYQENFQAEK  313

Query  952   LLSLAICIWGFASYFYGDYKTARKKPPPP  1038
              ++LA+ +WGF SYFYG+ K ++KK   P
Sbjct  314   GVALALSLWGFVSYFYGEVKESKKKNLAP  342



>gb|EYU21537.1| hypothetical protein MIMGU_mgv1a018814mg [Erythranthe guttata]
Length=354

 Score =   321 bits (823),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/319 (50%), Positives = 234/319 (73%), Gaps = 1/319 (0%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K + +IINC+ LAVG  GG +++RLYF+HGGKR W SS L T G+P +L P+ +SY R +
Sbjct  2     KRVFLIINCIILAVGNCGGPLIMRLYFVHGGKRIWFSSWLETGGWPIILAPLIVSYTRRR  61

Query  232   akaaanrrrV-LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAV  408
               AAA +  + L+ P +F+++A +G+L G D YLY +G++ LPVS S+L+ ++QLAFTAV
Sbjct  62    RTAAAGKAELYLMKPRVFVAAAVIGVLTGFDDYLYAYGVAKLPVSTSALIVASQLAFTAV  121

Query  409   FAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHG  588
             FA+ +VK + T YSVNAVVL+T G+VVLGLH +GDRPEGES + Y +GF +T+A AAL+G
Sbjct  122   FAFLMVKQEFTAYSVNAVVLLTLGAVVLGLHTSGDRPEGESSKEYMVGFLLTVAAAALYG  181

Query  589   FIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG  768
             FI+  VE  +  A   V+  L++++Q ++ +F+  FCTV M++N DFQAI++EAR ++LG
Sbjct  182   FILPAVELTYKKAKQAVSYTLVLEMQLVMCVFATSFCTVGMLVNNDFQAIAREARAYELG  241

Query  769   TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
               KYY++V ++AI  Q   +G++GVIF SS+LL GI  ++L+   ++ ++IF  E F A+
Sbjct  242   ETKYYIVVLWSAIVWQCFFLGAIGVIFYSSSLLSGIVITVLLPATEILAIIFYHEKFQAE  301

Query  949   KLLSLAICIWGFASYFYGD  1005
             K LSL + +WGF SYFYG+
Sbjct  302   KGLSLFLSLWGFISYFYGE  320



>gb|EYU34537.1| hypothetical protein MIMGU_mgv1a022801mg, partial [Erythranthe 
guttata]
Length=349

 Score =   320 bits (821),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/319 (50%), Positives = 234/319 (73%), Gaps = 1/319 (0%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K +++IINC+ LAVG  GG +++RLYF+HGGKR W SS L T G+P LLVP+ +SY R +
Sbjct  2     KRVLLIINCIILAVGNCGGPLIMRLYFVHGGKRIWFSSWLETGGWPILLVPLLVSYNRRR  61

Query  232   akaaanrrrV-LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAV  408
               AA+ +  + L+ P +F+++A +G+L G D YLY +G++ LPVS S+L+ ++QLAFTA 
Sbjct  62    RTAASGKAELYLMKPRVFLAAAVIGVLTGFDDYLYAYGVAKLPVSTSALIIASQLAFTAA  121

Query  409   FAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHG  588
             FA+ +VK + T YSVN+VVL+T G+VVLGLH  GDRPEGES + Y +GFF+T+A AAL G
Sbjct  122   FAFLMVKQEFTAYSVNSVVLLTLGAVVLGLHTNGDRPEGESSKEYMVGFFLTVAAAALCG  181

Query  589   FIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG  768
             FI+  VE  +  A   V+  L++++Q ++ +F+  FCT+ M++N DFQAI++EAR ++LG
Sbjct  182   FILPAVELTYKKAKQAVSYTLVLEMQLVMCVFATSFCTLGMLVNNDFQAIAREARAYELG  241

Query  769   TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
               KYY++V ++AI  Q   +G++GVIF SS+LL GI  ++L+   ++ ++IF  E F A+
Sbjct  242   ETKYYIVVLWSAIVWQCFFLGAIGVIFYSSSLLSGIVITVLLPATEILAIIFYHEKFQAE  301

Query  949   KLLSLAICIWGFASYFYGD  1005
             K LSL + +WGF SYFYG+
Sbjct  302   KGLSLFLSLWGFISYFYGE  320



>ref|XP_010939717.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
Length=362

 Score =   321 bits (822),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 164/340 (48%), Positives = 239/340 (70%), Gaps = 5/340 (1%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             +  ++ +N   + +G   G +L+RLYFL GG RKWLSS L T G+P L +P+ ISYA   
Sbjct  23    RWFLMALNFTIMVIGTAVGPLLLRLYFLKGGTRKWLSSWLQTGGWPLLFIPLAISYAHRC  82

Query  232   akaaanrrrV-LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAV  408
                     ++ L+TP LF++   LGLL+G+D +LY +G+SYLPVS SS+L S+QL FTA+
Sbjct  83    RCGGGRPIKLYLMTPPLFLACTVLGLLVGLDDFLYAYGLSYLPVSTSSILISSQLGFTAL  142

Query  409   FAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHG  588
             FA+F+VK K T +SVNAVVL++ G+V+LGLH +GDRP+GES+  Y LGFFMT+A A L+G
Sbjct  143   FAFFMVKQKFTSFSVNAVVLLSIGAVILGLHASGDRPKGESNTQYYLGFFMTLAAAVLYG  202

Query  589   FIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG  768
             FI+  VE  +  A   V+  L++++Q  +  F+ +FCTV M++N DF  I +EAREF+LG
Sbjct  203   FILPLVELTYAKAKQVVSYTLVIEMQLAMGFFATVFCTVGMLVNGDFHVIPREAREFELG  262

Query  769   TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
                YY+++ ++AI  Q + +G++G IF  SALL GI  ++LV V QV +V+F  E FSA+
Sbjct  263   EATYYVLLVWSAILWQFVFLGTVGAIFYGSALLAGIIMAVLVPVSQVLAVVFFHEPFSAE  322

Query  949   KLLSLAICIWGFASYFYGDY-KTARKKP---PPPPVTGDD  1056
             K ++LA+ +WGFASYFYG++ K+ +K P   P PP +G++
Sbjct  323   KGVALALALWGFASYFYGEFLKSKKKNPVVDPGPPASGNN  362



>ref|XP_002285719.1| PREDICTED: purine permease 1-like [Vitis vinifera]
Length=351

 Score =   317 bits (812),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 155/343 (45%), Positives = 237/343 (69%), Gaps = 3/343 (1%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
             + +  ++++NCV L++G  GG +++RLYF+ GG+R W SS L T G+P +LVP+ I+Y  
Sbjct  10    NMRKALLVLNCVILSIGNCGGPLVMRLYFVLGGERIWFSSWLETVGWPLILVPLIITYMH  69

Query  226   nqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
              + K  ++ +   + P LF++SA +G+L G D YLY +G++ LPVS S+L+ ++QLAFTA
Sbjct  70    RRTKQDSHAKLFFMKPPLFVASAVIGVLTGFDDYLYAYGVAKLPVSTSALIVASQLAFTA  129

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
              FA+ +VK K T YSVNA+ L++ G+ VL LH + DRP  ES++ Y LGF MT+A AAL+
Sbjct  130   AFAFLLVKQKFTSYSVNAIFLLSIGAGVLALHTSSDRPTNESNKEYYLGFVMTLAAAALY  189

Query  586   GFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDL  765
             GFI+  VE  +      +T  L+M++Q ++  F+ +FCTV M++N DFQAIS+EA+E++L
Sbjct  190   GFILPLVELTYKKTKQAITYSLVMEIQMVMCFFATVFCTVGMLVNNDFQAISREAKEYEL  249

Query  766   GTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSA  945
             G  KYY++V +  I  Q   + S+GVIFS+S+L+ GI  ++L+ V ++ +VIF  E F A
Sbjct  250   GEAKYYLVVVWNGIIWQCFFLVSIGVIFSASSLVCGIVITVLLPVTEILAVIFFREKFQA  309

Query  946   DKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQEV  1074
             +K +SLA+ +WGF SYFYG+ K ++KK  P   T + E  Q V
Sbjct  310   EKGVSLALSLWGFVSYFYGEIKDSKKKKNP---TSETELPQTV  349



>ref|XP_004501676.1| PREDICTED: purine permease 1-like isoform X1 [Cicer arietinum]
 ref|XP_004501677.1| PREDICTED: purine permease 1-like isoform X2 [Cicer arietinum]
Length=367

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/349 (44%), Positives = 237/349 (68%), Gaps = 11/349 (3%)
 Frame = +1

Query  19    EDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLL  198
             E +++ K    K +++IINC  LA+G  GG +++RLYF+HGG R WLSS L TAGFP +L
Sbjct  3     ERIEEEKQRKMKRILLIINCFILALGNSGGPLIMRLYFIHGGNRVWLSSFLETAGFPLML  62

Query  199   VPIFISYarnqakaaanrrr--------VLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYL  354
             +P+ +SY + +     N           + + P LF++ AF+G++ G+D YLY +G++ L
Sbjct  63    LPLTVSYIKRRRLHRRNAATTESGKLNLISMKPPLFLAVAFIGIITGLDDYLYAYGVARL  122

Query  355   PVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESD  534
             PVS S+L+ ++QL FTAVFA+ +VK K T +S+NAVVL+T G+ VL +H +GDRP GES 
Sbjct  123   PVSTSALIIASQLGFTAVFAFLLVKQKFTAFSINAVVLLTIGAGVLAMHTSGDRPNGEST  182

Query  535   RSYTLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMI  714
             + Y +GF  T+A AAL+GF++  +E  +     P+T  L+M++QF++ MF+ LFC V MI
Sbjct  183   KQYVIGFITTVAAAALYGFVLPLIELVYKKTKQPLTYSLVMEIQFVMCMFATLFCAVGMI  242

Query  715   INKDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLV  894
             +N DF+ I +EA+ F LG + YY ++  +AI  Q   +G++GVIF +S+LL GI  ++L+
Sbjct  243   VNNDFKVIPREAKIFGLGEKTYYFVLVVSAIMWQAFFLGAVGVIFCASSLLSGILIAVLL  302

Query  895   AVQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTA---RKKPP  1032
              + +V +VIF  E F A+K +SL + +WGF SYFYG++K +   +KK P
Sbjct  303   PLTEVLAVIFYKEHFQAEKAVSLILSLWGFVSYFYGEFKESKELKKKNP  351



>ref|XP_002285718.1| PREDICTED: purine permease 1 [Vitis vinifera]
Length=351

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 150/332 (45%), Positives = 233/332 (70%), Gaps = 0/332 (0%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             +  +++++CV L++G  GG +++RLYF+ GG+R W SS L TAG+P +LVP+ I+Y   +
Sbjct  12    RKALLVLSCVILSIGHCGGPLVMRLYFVRGGERIWFSSWLETAGWPLILVPLIITYMHRR  71

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
              K  ++ +   + P LF++SA +G+L  +D YLY +G++ LPVS  +L+ ++QLAFTA F
Sbjct  72    TKQGSHAKLFFMKPPLFVASAVIGVLTALDDYLYAYGVAKLPVSTIALIIASQLAFTAAF  131

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A+ +VK K T YSVNA+ L++ G+ VL LH + DRP  ES++ Y LGFFMT+A AAL+GF
Sbjct  132   AFLLVKQKFTSYSVNAIFLLSIGAGVLALHTSSDRPANESNKEYYLGFFMTLAAAALYGF  191

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             I+  VE  +  A   +T  L+M++Q ++  F+  FCTV M++N DFQAI +EA+E++LG 
Sbjct  192   ILPLVELTYKKAKQAITYSLVMEIQMVMCFFATFFCTVGMLVNNDFQAIPREAKEYELGE  251

Query  772   EKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADK  951
              KYY++V +  I  Q   +G++GVIF +S+L+ GI  ++L+ V ++ +VIF  + F A+K
Sbjct  252   AKYYLVVVWNGIMWQCFYLGAIGVIFCASSLVAGIVLAVLLPVTEILAVIFFHDKFQAEK  311

Query  952   LLSLAICIWGFASYFYGDYKTARKKPPPPPVT  1047
              +SLA+ +WGF SYFYG+ K ++KK  P P T
Sbjct  312   GVSLALSLWGFVSYFYGEIKDSKKKKNPTPET  343



>ref|XP_009373619.1| PREDICTED: purine permease 3-like [Pyrus x bretschneideri]
Length=380

 Score =   315 bits (806),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 151/328 (46%), Positives = 234/328 (71%), Gaps = 0/328 (0%)
 Frame = +1

Query  22    DMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLV  201
             D  + +  + K +++II+C  L+VG  GG +++RLYF+HGGKR WLSS L T G+P + +
Sbjct  6     DHVEKRNAAMKNVLLIISCALLSVGTCGGPLVMRLYFIHGGKRVWLSSWLETGGWPIIFI  65

Query  202   PIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLS  381
             PI ++Y   +     + +  L+   LF +SA +G+L G+D YLY +G++ LP+S S+L+ 
Sbjct  66    PIAMAYCYRRKTEGPSTKLFLMKLPLFTASAVIGILTGLDDYLYAYGVARLPISTSALIL  125

Query  382   STQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFM  561
             ++ LAFTA+FA+ +VK K T +S+NA+VL+T G+VVLGL+ + DRPEGES++ Y  GFFM
Sbjct  126   ASHLAFTALFAFILVKQKFTLFSINAIVLLTIGAVVLGLNTSSDRPEGESNKEYIAGFFM  185

Query  562   TIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAIS  741
             T+A AAL+GF++  +E  +  A   +T  L+++VQ ++ +F+ LFCTV MII+ DF+ I 
Sbjct  186   TVAAAALYGFVLPLIELTYKKAKQTITYALVLEVQLVMCLFATLFCTVGMIIDNDFKVIP  245

Query  742   KEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVI  921
             +EAR+FDLG  +YY+++ F+AI  Q   +G++G+IF +S+LL GI  + L+ V Q+ +VI
Sbjct  246   REARKFDLGETRYYVVLVFSAILWQGFFLGAIGIIFCASSLLSGIVIASLIPVTQILAVI  305

Query  922   FLPESFSADKLLSLAICIWGFASYFYGD  1005
             F  E F A+K +SLA+ +WGF SYFYG+
Sbjct  306   FYHEKFQAEKGVSLALSLWGFISYFYGE  333



>emb|CDP01126.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/339 (46%), Positives = 233/339 (69%), Gaps = 4/339 (1%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             KAL +++NC+ LA+G  GG I++RLYF+ GGKR WLSS L T GFP + +P+ ISY   +
Sbjct  11    KAL-LVVNCLILAIGNCGGPIIMRLYFVKGGKRIWLSSWLQTVGFPIIAIPLLISYFHRR  69

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
                  N + VL+   LF+++A +GL+ G+D YLY +GM+ LPVS SS++ ++QLAFTAVF
Sbjct  70    KTEGPNTKLVLMKYPLFIAAAAVGLVTGIDDYLYAYGMARLPVSTSSIIIASQLAFTAVF  129

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A+ +VK K T YSVNAVVL+T G+ VL +H + DRP+GES + Y LGF MT+A A L+GF
Sbjct  130   AFLLVKQKFTAYSVNAVVLLTVGAGVLAMHSSSDRPKGESTKMYVLGFLMTVAAAVLYGF  189

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             I+  VE  ++ A   +T  L++++Q ++ +F+ +FCTV MI  KDFQA+++EAR + LG 
Sbjct  190   ILPVVELMYLKAKQAITYTLVLEIQLVMCLFATVFCTVGMIAKKDFQAMAREARAYALGE  249

Query  772   EKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADK  951
              +YY++V ++A+  Q   +G +GVIF +S+LL  I  ++L+ V +V +VI   E F A+K
Sbjct  250   AEYYLVVTWSAVIWQFFFLGVIGVIFCASSLLSAIMIAVLLPVTEVIAVIVFQEKFQAEK  309

Query  952   LLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQ  1068
              ++L + +WGF SYFYG+ K  + K     + G   + Q
Sbjct  310   GVALFLSLWGFVSYFYGEIKNKKSK---EEIEGQKNDSQ  345



>ref|XP_006364706.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=362

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/350 (44%), Positives = 233/350 (67%), Gaps = 15/350 (4%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISY----  219
             K  ++IINC+ LA+G  GG ++ RLYFL GG+R WLSS L T G+P +L+P+  SY    
Sbjct  11    KNFLLIINCIILAIGNCGGPLITRLYFLKGGERIWLSSWLETVGWPIVLIPLSFSYFNRR  70

Query  220   -----arnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSS  384
                           N + +L+TP +F++S  +G+L G D+YLY +G++ LPVS S+LL +
Sbjct  71    REFQGKMLSTIDNNNTKLILMTPRIFVASIGIGVLTGFDNYLYAYGVAKLPVSTSALLIA  130

Query  385   TQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMT  564
             +QLAFTA FA+ +VK K T YS+N++ L+TFG+VVL LH  GDRP GES + Y LGF MT
Sbjct  131   SQLAFTAAFAFLLVKQKFTSYSINSIFLLTFGAVVLALHAKGDRPNGESKKEYVLGFIMT  190

Query  565   IAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISK  744
             +  AAL+G I+   E  +  A   +T  L+M++Q +  +FS + CT+ MIINKDFQA+S+
Sbjct  191   LGAAALYGLILPLFELMYKKAKQGITYTLVMEIQAVSCIFSTVVCTIGMIINKDFQAMSR  250

Query  745   EAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIF  924
             EA+ F+LG  +YY+++ ++AI  Q   +G++GVI+SSS+L+ GI  ++L+ + ++  V+F
Sbjct  251   EAKSFELGEARYYIVIIWSAIIWQCFFLGAIGVIYSSSSLVSGILITVLLPITEILGVVF  310

Query  925   LPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQEV  1074
               E F+ +K +SL + IWGF SY YGD K ++KK        +  + QE+
Sbjct  311   YGEKFTPEKGVSLVLSIWGFISYLYGDIKASKKKKE------NQSQEQEM  354



>ref|XP_004152618.1| PREDICTED: purine permease 3-like [Cucumis sativus]
 ref|XP_004174047.1| PREDICTED: purine permease 3-like [Cucumis sativus]
 gb|KGN62722.1| hypothetical protein Csa_2G369730 [Cucumis sativus]
Length=363

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/343 (45%), Positives = 230/343 (67%), Gaps = 7/343 (2%)
 Frame = +1

Query  19    EDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLL  198
             ++ ++    S K  ++I NC  LAVG  GG +++RLYF+HGGKR WLSSCL T G+P + 
Sbjct  3     KEQQQQNTPSVKRTLLIFNCCLLAVGNCGGPLIMRLYFVHGGKRVWLSSCLETGGWPIIF  62

Query  199   VPIFISYarnqakaa-------anrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLP  357
             +P+ ISY   +  AA        + + + + P LF++SAF+G+L G D YLY +G++ LP
Sbjct  63    IPLLISYIHRRRLAALDPSGSPNSAQFIFMKPRLFLASAFIGILTGFDDYLYAYGVARLP  122

Query  358   VSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDR  537
             VS S+L+ + QLAFTA FA+ +VK K T YS+NAVVL+T G  VL LH +GDRP GES++
Sbjct  123   VSTSALIIACQLAFTAGFAFLLVKQKFTSYSINAVVLLTIGGAVLALHTSGDRPAGESNK  182

Query  538   SYTLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMII  717
              Y  GF MT+A A ++GF++  VE  +  A   +T  L+++ Q I+S+F+ + C + M+I
Sbjct  183   DYIAGFLMTVAAAVVYGFVLPLVELTYKKARQQITYTLVLEFQLIMSLFATIVCAIGMLI  242

Query  718   NKDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVA  897
             N DFQ I +EA  F LG  +YY+++  +AI  Q   +G++GVIFSSS+L  GI  ++L+ 
Sbjct  243   NNDFQVIPREAEAFGLGKFRYYLVLVLSAILWQGFFLGAIGVIFSSSSLFSGIVIAVLLP  302

Query  898   VQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
             V ++ +VI   E F A+K +SLA+ +WGF SYFYG+ K  ++K
Sbjct  303   VTEILAVIIFNERFQAEKGVSLALNLWGFLSYFYGEIKHNKRK  345



>ref|XP_002307351.2| PURINE PERMEASE 1 family protein [Populus trichocarpa]
 gb|EEE94347.2| PURINE PERMEASE 1 family protein [Populus trichocarpa]
Length=356

 Score =   312 bits (800),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/334 (46%), Positives = 229/334 (69%), Gaps = 1/334 (0%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
             + K  ++I NC+ L++G  GG +++RLYF+HGGKR WLS+ L T G+P +L+P+ ISY  
Sbjct  12    TMKKTLLIFNCLILSIGNCGGPLIMRLYFIHGGKRIWLSAWLETGGWPIILIPLAISYFH  71

Query  226   nqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
              +A     +   +  P LF+++A +G+L G+D YLY +G++ LPVS S+L+ +TQLAFTA
Sbjct  72    RRATDPTTKLFYMKPP-LFIAAAIIGVLTGLDDYLYAYGVARLPVSTSALIIATQLAFTA  130

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
              FA+ +VK K T YS+NAVVL+T G+ VL +H   D+P  ES R Y LGF +T+  AAL+
Sbjct  131   GFAFLLVKQKFTSYSINAVVLLTVGAGVLAMHTGSDKPAHESSREYILGFILTLVAAALY  190

Query  586   GFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDL  765
             GFIM  VE  +  +   +   L+M++Q I+ + + +FCTV M+INKDFQAI +EAR ++L
Sbjct  191   GFIMPLVELTYKKSRQEMNYTLVMEIQMIMCLLATVFCTVGMLINKDFQAIPREARNYEL  250

Query  766   GTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSA  945
             G  KYY+++ ++AI  Q   +G++GVIF +S+LL GI  ++L+   ++ +VIF  E F  
Sbjct  251   GEVKYYVVMVWSAIIWQCFFLGAIGVIFCASSLLSGIIITVLLPATEILAVIFFQEKFQV  310

Query  946   DKLLSLAICIWGFASYFYGDYKTARKKPPPPPVT  1047
             +K ++L + +WGF SYFYG+ K  +KK P  P T
Sbjct  311   EKGVALGLSLWGFVSYFYGEMKENKKKKPAAPET  344



>ref|XP_007227615.1| hypothetical protein PRUPE_ppa022492mg [Prunus persica]
 gb|EMJ28814.1| hypothetical protein PRUPE_ppa022492mg [Prunus persica]
Length=368

 Score =   312 bits (800),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 147/351 (42%), Positives = 241/351 (69%), Gaps = 4/351 (1%)
 Frame = +1

Query  22    DMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLV  201
             + ++ +  + K  ++I++CVFL++G  GG +++RLYF+HGGKR WLSS L T G+P + +
Sbjct  4     NHEEKRNAALKRALLILSCVFLSIGACGGPLIMRLYFIHGGKRVWLSSWLETGGWPIIFI  63

Query  202   PIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLS  381
             PI ++Y   +     + +   +   LF++SA +GLL G+D YLY +G++ LPVS ++L++
Sbjct  64    PIALAYYHRRTTEGPSTKLFFMKLPLFIASAVIGLLTGLDDYLYAYGVARLPVSTAALIT  123

Query  382   STQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFM  561
             +  L FTA+FA+ +VK K T YS+N V L+T G+ VLGL+ + DRP+GESD+ Y  GF M
Sbjct  124   AAHLVFTALFAFLLVKQKFTSYSINCVFLLTIGAAVLGLNTSADRPKGESDKQYIAGFMM  183

Query  562   TIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAIS  741
             T++ AAL+GF++  VE  +  A   +T  L++++Q ++ +F+ +FCTV M+IN DF+ I 
Sbjct  184   TLSSAALYGFVLPLVELTYKKAKQTITYALVLEIQLVMCLFATIFCTVGMLINNDFKVIP  243

Query  742   KEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVI  921
             +EAR F+LG  +YY+++ F+AI  Q   +G++G+IF +S+LL GI  ++L+ V ++ +VI
Sbjct  244   REARNFELGERRYYVVLVFSAIVWQGFFLGAIGIIFCASSLLSGIVIAVLLPVTEILAVI  303

Query  922   FLPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQEV  1074
             F  E F A+K ++LA+ +WGF SYFYG+ K +++K         +E  +EV
Sbjct  304   FYHEKFQAEKGVALALSLWGFVSYFYGERKYSKQKES----EMKNEREKEV  350



>ref|XP_008812221.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=361

 Score =   312 bits (799),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 159/328 (48%), Positives = 229/328 (70%), Gaps = 1/328 (0%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             +  ++ +N   + +G     +L+RLYFL GG RKWLS  L T G+P + +P+ ISYA  +
Sbjct  22    RWFLMALNFAIMVIGSTVSPLLLRLYFLKGGSRKWLSGWLQTGGWPLIFIPLAISYAHRR  81

Query  232   akaaanrrrV-LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAV  408
                     ++ L+TP LF++   LGLL+G+D YLY +GMSYLPVS SS+L STQL FTA+
Sbjct  82    GGGGGGGTKLYLMTPPLFLACTVLGLLIGLDDYLYAYGMSYLPVSTSSILISTQLGFTAL  141

Query  409   FAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHG  588
             FA+FIVK K T +S NAVVL++ G+V+LGLH +GDRPEGES+  Y LGF MT+A A L+ 
Sbjct  142   FAFFIVKQKFTSFSTNAVVLLSIGAVMLGLHASGDRPEGESNTLYYLGFAMTLAAAVLYA  201

Query  589   FIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG  768
             FI+  VE  +  A   V+  L+M++Q ++  F+ +FCTV M+++KDFQAIS+EAR+F LG
Sbjct  202   FILPLVELTYAKAKQVVSYTLVMEMQLVMGFFATVFCTVGMLVSKDFQAISREARDFVLG  261

Query  769   TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
               +YY+++ ++AI  Q   +G++G IF  SALL GI  ++L+ V +V +VIF  ESFS  
Sbjct  262   EVRYYVLLVWSAILWQFFFLGTVGAIFYGSALLAGIIIAVLIPVAEVLAVIFFHESFSGG  321

Query  949   KLLSLAICIWGFASYFYGDYKTARKKPP  1032
             K ++L + +WG ASYFYG++  ++KK P
Sbjct  322   KGVALVLALWGLASYFYGEFLESKKKKP  349



>ref|XP_011006371.1| PREDICTED: purine permease 3 [Populus euphratica]
Length=356

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 228/334 (68%), Gaps = 1/334 (0%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
             + K  ++I NC+ L++G  GG +++RLYF+HGGKR WLS+ L T G+P +L+PI +SY  
Sbjct  12    TMKKALLIFNCLVLSIGNCGGPLIMRLYFIHGGKRVWLSAWLETGGWPIILIPIALSYFH  71

Query  226   nqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
              +A     R   +  P LF+++A +G+L G+D YLY +G++ LPVS S+L+ +TQLAFTA
Sbjct  72    RRATDPTTRLFYMKPP-LFIAAATIGVLTGLDDYLYAYGVARLPVSTSALIIATQLAFTA  130

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
              FA+ +VK K T YS+NAVVL+T G+ VL +H   D+P  ES R Y LGF MT+  AAL+
Sbjct  131   GFAFLLVKQKFTSYSINAVVLLTVGAGVLAMHTGSDKPAHESSREYILGFIMTLVAAALY  190

Query  586   GFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDL  765
             G I+  VE  +  +   +   L+M++Q ++ + + +FCTV M+INKDFQAI +EAR F+L
Sbjct  191   GLILPLVELTYKKSRQEMNYTLVMEIQMVMCLLATVFCTVGMLINKDFQAIPREARNFEL  250

Query  766   GTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSA  945
             G  KYY+++ ++AI  Q   +G++GVIFS+S+LL GI  S L+   ++ SVIF  E F A
Sbjct  251   GEVKYYVVLVWSAIIWQCFFLGAIGVIFSASSLLSGILISALLPATEILSVIFFQEKFQA  310

Query  946   DKLLSLAICIWGFASYFYGDYKTARKKPPPPPVT  1047
             +K ++L + +WGF SYFYG+ K  +KK    P T
Sbjct  311   EKGVALGLSLWGFVSYFYGEMKENKKKKLAAPET  344



>ref|XP_008338896.1| PREDICTED: purine permease 3-like [Malus domestica]
Length=378

 Score =   311 bits (797),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/330 (45%), Positives = 233/330 (71%), Gaps = 0/330 (0%)
 Frame = +1

Query  22    DMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLV  201
             D  + +  + K +++II+C  L++G  GG +++RLYF+HGGKR WLSS L T G+P + +
Sbjct  6     DHVEKRNAAMKNVLLIISCALLSIGTCGGPLVMRLYFIHGGKRVWLSSWLETGGWPIIFI  65

Query  202   PIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLS  381
             PI ++Y   +     + +   +   LF +SA +G+L G+D YLY +G++ LP+S S+L+ 
Sbjct  66    PIAMAYCYRRKTEGPSTKLFFMKLPLFTASAVIGVLTGLDDYLYAYGVARLPISTSALIL  125

Query  382   STQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFM  561
             ++ LAFTA+FA+ +VK K T +S+NA+VL+T G+VVLGL+ + DRPEGES++ Y  GFFM
Sbjct  126   ASHLAFTALFAFILVKQKFTSFSINAIVLLTIGAVVLGLNTSSDRPEGESNKEYIAGFFM  185

Query  562   TIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAIS  741
             T+A AAL+GF++  +E  +  A   +T  L+++VQ ++ +F+ LFCTV M+I+ DF+ I 
Sbjct  186   TVAAAALYGFVLPLIELTYKKAKQTITYALVLEVQLVMCLFATLFCTVGMLIDNDFKVIP  245

Query  742   KEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVI  921
             KEAR+FDLG  +YY+++ F+AI  Q   +G++G+IF +S+LL GI  + L+ V Q+ +VI
Sbjct  246   KEARKFDLGETRYYVVLVFSAILWQGFFLGAIGIIFCASSLLSGIVIASLIPVTQILAVI  305

Query  922   FLPESFSADKLLSLAICIWGFASYFYGDYK  1011
             F  E F A+K +SLA+ +WGF  YFYG+ K
Sbjct  306   FYHEKFQAEKGVSLALSLWGFIFYFYGERK  335



>ref|XP_007223326.1| hypothetical protein PRUPE_ppa007339mg [Prunus persica]
 gb|EMJ24525.1| hypothetical protein PRUPE_ppa007339mg [Prunus persica]
Length=372

 Score =   310 bits (795),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/333 (44%), Positives = 232/333 (70%), Gaps = 0/333 (0%)
 Frame = +1

Query  28    KKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPI  207
             ++ +  S K  ++I++CV L++G  GG +++RLYF+HGGKR WLSS L T G+P + +PI
Sbjct  6     EEKRNASLKRALLILSCVLLSIGTCGGPLIMRLYFIHGGKRVWLSSWLETGGWPIIFIPI  65

Query  208   FISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSST  387
              ++Y   +     + +   +   LF++SA +GL+ G+D YLY +G++ LPVS SSL+ + 
Sbjct  66    ALAYYHRRTTEGPSTKLFFIKLPLFIASAVIGLITGLDDYLYAYGVARLPVSTSSLIIAA  125

Query  388   QLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTI  567
             QLAFTA+FA+ +VK K T YS NAVVL+T G+ VLGL+   DRP+GESD+ Y  GF MT+
Sbjct  126   QLAFTALFAFLLVKQKFTSYSTNAVVLLTIGAAVLGLNTNADRPKGESDKEYIAGFLMTV  185

Query  568   AGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKE  747
             A AAL+GF++  VE  +  A   +T  L++++Q ++ +F+ +FCTV M+IN DF+ I +E
Sbjct  186   AAAALYGFVLPLVELTYKKAKQTITYALVLEIQMVMCLFATIFCTVGMLINNDFKVILRE  245

Query  748   AREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFL  927
             AR F LG   YY+++  +AI  Q   +G++G+IF +S+LL GI  ++L+ + ++ +VIF 
Sbjct  246   ARNFGLGKGTYYVVLVLSAIVWQTFFLGAIGIIFCASSLLSGIVIAVLLPITEILAVIFY  305

Query  928   PESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
              E F A+K ++LA+ +WGF SYFYG+ K ++++
Sbjct  306   HEKFQAEKGVALALSLWGFVSYFYGEIKYSKQR  338



>ref|XP_007018134.1| Purine permease 3 [Theobroma cacao]
 gb|EOY15359.1| Purine permease 3 [Theobroma cacao]
Length=356

 Score =   309 bits (792),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/344 (45%), Positives = 231/344 (67%), Gaps = 8/344 (2%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
             S +  +++INC  LA+G  GG +++RLYF+HGGKR W SS L T G+P +L PI  +Y  
Sbjct  11    SMRRALLVINCFVLAIGNCGGPLMMRLYFIHGGKRVWFSSWLETGGWPIILFPIAWAYLH  70

Query  226   nqakaaanrrrVL-VTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFT  402
              +     +R +   + P LF++SA +G+L G D YLY +G++ LPVS SSL+ + QLAFT
Sbjct  71    RRRTQPTSRNKFFFMKPPLFIASAVIGILTGFDDYLYAYGVARLPVSTSSLIIAAQLAFT  130

Query  403   AVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAAL  582
             A FA+ +VK K T YS+NAV L+T G+ VL L+ + DRPE ES++ Y +GF MTIA A L
Sbjct  131   AGFAFLLVKQKFTSYSINAVFLLTIGAGVLALNTSSDRPENESNKEYVMGFLMTIAAAVL  190

Query  583   HGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFD  762
             +GFI+  VE  +  A   ++  L+M++Q ++ +F+ + CTV M++N DF+ IS+EAREF 
Sbjct  191   YGFILPLVELMYKKAKQEISYALVMEIQMVMCLFATVLCTVGMLVNNDFKVISREAREFG  250

Query  763   LGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFS  942
             LG  KYY++   +AI  Q   +G++GVIF +S+L+ GI  ++L+ V ++ +VIFL E F 
Sbjct  251   LGETKYYVVAISSAIIWQGFFLGAIGVIFCASSLVSGIMIAVLLPVTEILAVIFLKEKFQ  310

Query  943   ADKLLSLAICIWGFASYFYGDYKTARKKP-------PPPPVTGD  1053
             A+K ++LA+ +WGF SYFYG+ K  +KK        PP P + +
Sbjct  311   AEKGVALALSLWGFVSYFYGEIKQTKKKKRALETEMPPVPTSPE  354



>ref|XP_010244044.1| PREDICTED: purine permease 1-like [Nelumbo nucifera]
Length=357

 Score =   309 bits (792),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 154/332 (46%), Positives = 232/332 (70%), Gaps = 3/332 (1%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             +  +I +N   LA+G  GG +L+R YF+ GG+R WLSS L T G+P  L P+F+ Y + +
Sbjct  19    QKTLIFLNFTLLALGFCGGPLLLRQYFVXGGRRIWLSSWLETGGWPLFLFPLFVFYLQRR  78

Query  232   akaaanrrrVL-VTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAV  408
              +      R+L + P LF++SAFLG+L G+  Y Y +GMS LP S ++L+ STQLAF AV
Sbjct  79    RRKGNQEARLLSMKPLLFVASAFLGILTGMIDYCYAYGMSRLPASTTALIGSTQLAFNAV  138

Query  409   FAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHG  588
             F++ IV+ + T YS+NAVVL+T G++VLGLH + DRPE ES   Y +G FMT+  AAL+G
Sbjct  139   FSFIIVRQRFTSYSINAVVLLTIGAIVLGLHASKDRPEKESSHQYYVGLFMTLGEAALYG  198

Query  589   FIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG  768
             F++  VE  +  A   +T  L+M++Q ++S+F+ LFCTV MI+NKDFQAIS+EARE++LG
Sbjct  199   FLLPXVELTYKKAKQAITYPLVMEIQMVMSIFATLFCTVGMIVNKDFQAISREAREYELG  258

Query  769   TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
               KYY+++ + AI  Q   +G++GV+F +S+L+ GI +++L+ V ++ +V+   E F+A+
Sbjct  259   AVKYYVVLVWCAIFWQFYYLGAIGVVFVASSLVGGITSAVLLPVLEILAVVLFREKFTAE  318

Query  949   KLLSLAICIWGFASYFYGDYKTARK--KPPPP  1038
             K ++L + +WGF SYFYG YK  +K  + P P
Sbjct  319   KGIALVLSLWGFTSYFYGQYKRKKKMSQTPQP  350



>gb|KDP41439.1| hypothetical protein JCGZ_15846 [Jatropha curcas]
Length=359

 Score =   309 bits (791),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 150/339 (44%), Positives = 233/339 (69%), Gaps = 2/339 (1%)
 Frame = +1

Query  10    KNLEDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFP  189
             +N E  +  K    +AL +++NCV L++G  GG +++RLYF+HGGKR WLSS L TAG+P
Sbjct  3     ENKEKPQPAKATMRRAL-LVLNCVILSIGNCGGPLIMRLYFIHGGKRVWLSSWLETAGWP  61

Query  190   CLLVPIFISYarnqakaaanrrrVL-VTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSI  366
              + +P+ ISY   ++       ++  + P LF+++  +G+L G D YLY +G++ LPVS 
Sbjct  62    IIFIPLLISYFHRRSTTDPTTAKLFYMKPSLFLAATGIGILTGFDDYLYAYGVARLPVST  121

Query  367   SSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYT  546
             SSL+ +TQLAFTA FA+ +VK K T YS+NAVVL+T G+ VL LH + DRPE ES + Y 
Sbjct  122   SSLIIATQLAFTAGFAFLLVKQKFTSYSINAVVLLTVGAGVLALHTSSDRPEHESKKEYN  181

Query  547   LGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKD  726
             LGF MT+  A L+G I+  VE  +  A   ++  L+M++Q I+ +F+ + CTV M++N D
Sbjct  182   LGFVMTLGAAVLYGLILPLVELTYRKAKQEISYTLVMEIQMIMCLFATVVCTVGMLVNND  241

Query  727   FQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQ  906
             F+ I +EA+EF+LG  KYY+I+ ++AI  Q   +G++G++F +S+L  G+  ++L+ V +
Sbjct  242   FKVIPREAKEFELGETKYYVIMVWSAIIWQCFFLGAIGIVFCASSLASGVVIAVLLPVTE  301

Query  907   VFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARK  1023
             + +VIF  E F A+K ++LA+ +WGF SYFYG+ K ++K
Sbjct  302   ILAVIFYQEKFQAEKGVALALSLWGFLSYFYGEIKQSKK  340



>ref|XP_009615076.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=353

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/325 (47%), Positives = 226/325 (70%), Gaps = 2/325 (1%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             + ++++INC+ LA+G   G +++RLYFLHGG R W SS L T G+P +L+P+ I+Y + +
Sbjct  10    RKILLVINCILLAIGNCCGPLIMRLYFLHGGNRIWFSSWLQTVGWPLILIPLAIAYFQRR  69

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
                       L+TP +F++S+  G+L GVD+YLY +G S LPVS S+L+ +TQLAFTAVF
Sbjct  70    ENNIKKLF--LITPRIFLASSVFGILTGVDNYLYAYGNSKLPVSTSTLILATQLAFTAVF  127

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A+F+VK K T +S+NA+VL+T G+VVL L    DRP+GES + Y LGF +T+  AAL+GF
Sbjct  128   AFFLVKQKFTAHSINAIVLLTVGAVVLALRSGSDRPKGESSKEYILGFVLTLLAAALYGF  187

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             +M  VE  ++ A   +T  L+++VQ +I  F++ F TV MIIN DF+AIS EAR+F LG 
Sbjct  188   VMPMVELTYIKATQTITYALVLEVQMVICCFASAFATVGMIINNDFKAISSEARQFGLGE  247

Query  772   EKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADK  951
              KYY ++ ++AI  Q   +G++GVI  SS+LL G+  ++L+ V +V +VI   E F  +K
Sbjct  248   GKYYNVLVWSAIIWQFFFVGAIGVISYSSSLLSGVIIAVLLPVTEVLAVIIFHEKFQPEK  307

Query  952   LLSLAICIWGFASYFYGDYKTARKK  1026
              ++L + IWGF SYFYG+ K  +K+
Sbjct  308   GVALFLSIWGFISYFYGEMKQHKKE  332



>ref|XP_008219368.1| PREDICTED: purine permease 3-like [Prunus mume]
Length=370

 Score =   309 bits (791),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/351 (42%), Positives = 240/351 (68%), Gaps = 4/351 (1%)
 Frame = +1

Query  22    DMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLV  201
             + ++ +  + K  ++I++CV L++G  GG +++RLYF+HGGKR WLSS L T G+P + +
Sbjct  6     NHEEKRNAALKRALLILSCVILSIGACGGPLIMRLYFIHGGKRVWLSSWLETGGWPIIFI  65

Query  202   PIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLS  381
             PI ++Y   +     + +   +   LF++SA +GLL G+D YLY +G++ LPVS ++L++
Sbjct  66    PIALAYYHRRTTEGPSTKLFFMKLPLFIASAVIGLLTGLDDYLYAYGVARLPVSTAALIT  125

Query  382   STQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFM  561
             +  L FTA+FA+ +VK K T YS+N V L+T G+ VLGL+ + DRP+GESD+ Y  GF M
Sbjct  126   AAHLVFTALFAFLLVKQKFTSYSINGVFLLTIGAAVLGLNTSADRPKGESDKQYIAGFMM  185

Query  562   TIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAIS  741
             T + AAL+GF++  VE  +  A   +T  L++++Q ++ +F+ +FCTV M+IN DF+ I 
Sbjct  186   TFSSAALYGFVLPLVELTYKKAKQTITYALVLEIQLVMCLFATIFCTVGMLINNDFKVIP  245

Query  742   KEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVI  921
             +EAR F+LG  +YY+++ F+AI  Q   +G++G+IF +S+LL GI  ++L+ V ++ +VI
Sbjct  246   REARNFELGESRYYVVLVFSAIVWQGFFLGAIGIIFCASSLLSGIVIAVLLPVTEILAVI  305

Query  922   FLPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQEV  1074
             F  E F A+K ++LA+ +WGF SYFYG+ K +++K         +E+ +EV
Sbjct  306   FYHEKFQAEKGVALALSLWGFVSYFYGERKYSKQKES----EMKNEKEKEV  352



>ref|XP_009373503.1| PREDICTED: purine permease 3-like [Pyrus x bretschneideri]
Length=378

 Score =   308 bits (788),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/324 (45%), Positives = 227/324 (70%), Gaps = 0/324 (0%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K L+++I+C  L++G  GG +++RLYF+HGGK  WLSS L T G+P + +PI I Y   +
Sbjct  14    KKLLLVISCTLLSIGTCGGPLVMRLYFIHGGKHIWLSSWLQTGGWPIIFIPIAIGYYHRR  73

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
                  + +   +   LFM+SA +G+L G+D YLY +G++ LPVS S+L+ + QLAFTA+F
Sbjct  74    KTEGPSTKLFFMKLPLFMASAVIGVLTGLDDYLYAYGVARLPVSTSALIIAGQLAFTALF  133

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A+ +VK K T +S+NAVVL+T GS VLGL ++ DRPEGES++ Y  GFFM +A A+L+GF
Sbjct  134   AFILVKQKFTSFSMNAVVLLTMGSAVLGLTISSDRPEGESNKEYIAGFFMMVAAASLYGF  193

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             ++  +E  +  A   VT  L++++Q ++ +F+ LFCTV M+IN DF+ I +EAR+FDLG 
Sbjct  194   VLPLIELTYKRAKQTVTYALVLEIQSVMCLFATLFCTVGMLINNDFKVIPREARKFDLGE  253

Query  772   EKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADK  951
              +YY+++  +A   Q   +G++G+IF +S+LL GI  ++L+ + ++ +VIF  E F  +K
Sbjct  254   TRYYLVLVLSATVWQAFFLGAIGIIFCASSLLSGIVIAVLLPITEILAVIFYHEKFQPEK  313

Query  952   LLSLAICIWGFASYFYGDYKTARK  1023
              +SLA+ +WGF SYFYG+ K  ++
Sbjct  314   GVSLALSVWGFVSYFYGEIKHNKQ  337



>ref|XP_008219366.1| PREDICTED: purine permease 3-like [Prunus mume]
Length=368

 Score =   307 bits (787),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/333 (44%), Positives = 232/333 (70%), Gaps = 0/333 (0%)
 Frame = +1

Query  28    KKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPI  207
             ++ +  S K  ++I++CV L++G  GG +++RLYF+HGG R WLSS L T G+P + +PI
Sbjct  6     EEKRNASLKRALLILSCVLLSIGTCGGPLIMRLYFIHGGNRVWLSSWLETGGWPIIFIPI  65

Query  208   FISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSST  387
              ++Y   +     + +   +   LF++SA +GL+ G+D YLY +G++ LPVS S+L+ + 
Sbjct  66    ALAYYHRRTTEGPSTKLFFMKLPLFIASAVIGLITGLDDYLYAYGVARLPVSTSALIIAA  125

Query  388   QLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTI  567
             QLAFTA+FA+ +VK K T YS NAVVL+T G+ VLGL+ + DRP+GESD+ Y  GF MT+
Sbjct  126   QLAFTALFAFLLVKQKFTSYSTNAVVLLTIGAAVLGLNTSADRPKGESDKQYIAGFLMTV  185

Query  568   AGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKE  747
             A AAL+GF++  VE  +  A   +T  L++++Q ++ +F+ +FCTV M+I+ DF+ I +E
Sbjct  186   AAAALYGFVLPLVELTYKKAKQTITYALVLEIQMVMCLFATIFCTVGMLIDNDFKVIPRE  245

Query  748   AREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFL  927
             AR F LG   YY+++  +AI  Q   +G++GVIF +S+LL GI  ++L+ + ++ +VIF 
Sbjct  246   ARNFGLGEGTYYVVLVLSAIVWQTFFLGAIGVIFCASSLLSGIVIAVLLPITEILAVIFY  305

Query  928   PESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
              E F A+K ++LA+ +WGF SYFYG+ K ++++
Sbjct  306   HEKFQAEKGVALALSLWGFVSYFYGEIKYSKQR  338



>gb|KHG22236.1| Purine permease 1 -like protein [Gossypium arboreum]
Length=357

 Score =   307 bits (786),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/334 (45%), Positives = 224/334 (67%), Gaps = 4/334 (1%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
             + +  +++INC+ L++G  GG ++ RLYF+HGG R W SS L TAG P +L+PI  +Y  
Sbjct  8     TIRKALLVINCIILSIGNCGGPLITRLYFIHGGNRIWFSSWLQTAGCPIILLPIACAYVH  67

Query  226   nqakaaanrrr---VLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLA  396
                 A          +  P LF+++  LG+L G+D+Y Y++G+S LPVS SSL+ ++QLA
Sbjct  68    RSRTADPTSENKVFCMERP-LFIAAIVLGILSGLDNYFYSYGLSRLPVSTSSLIIASQLA  126

Query  397   FTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGA  576
             FTA FA+ +VK K T YS+NAV L+T G+ VL LH + DRP  ES++ Y LGF MT+A A
Sbjct  127   FTAGFAFLLVKQKFTAYSINAVFLLTIGAGVLALHSSSDRPANESNKEYILGFVMTLAAA  186

Query  577   ALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEARE  756
             AL+GFI+  VE  +  A   ++  L+M++Q ++ + +  FCTV M++N DF+ I +EARE
Sbjct  187   ALYGFILPLVELTYKKAKQEISYALVMEIQLVMCLVATAFCTVGMLVNNDFKVIGREARE  246

Query  757   FDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPES  936
             F+LG  KYY++  F+AI  Q   +G++GV+F +S+LL G+  S+L+ V ++ +V F  E 
Sbjct  247   FELGETKYYIVAIFSAIIWQFFFLGAIGVVFCASSLLSGVVISVLLPVTEILAVFFFNEK  306

Query  937   FSADKLLSLAICIWGFASYFYGDYKTARKKPPPP  1038
             F A+K +SLA+ +WGF SYFYGD K  + K P P
Sbjct  307   FQAEKGVSLALSLWGFLSYFYGDIKRIKTKKPTP  340



>ref|XP_010939715.1| PREDICTED: purine permease 3-like [Elaeis guineensis]
Length=362

 Score =   306 bits (785),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 156/328 (48%), Positives = 227/328 (69%), Gaps = 1/328 (0%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             +  ++ +N   + +G     +L+RLYFL GG RKWLSS L T G+P L +P+ ISYA  +
Sbjct  23    RWFLMALNFTIMVIGTAVSPLLLRLYFLKGGTRKWLSSWLQTGGWPLLFIPLVISYAHRR  82

Query  232   akaaanrrrV-LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAV  408
                     ++ L+TP LF+S   LG L+G+D +LY +GMSYLPVS SS+L STQL FTA+
Sbjct  83    RCGGGRPTKLYLITPPLFLSCTVLGFLVGLDDFLYAYGMSYLPVSTSSILISTQLGFTAL  142

Query  409   FAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHG  588
             FA+FIVK K T +SVNAVVL++ G+V+LGLH +GDRP+GES+  Y  GFFMT+A A L+G
Sbjct  143   FAFFIVKQKFTSFSVNAVVLLSIGAVILGLHASGDRPKGESNTLYYWGFFMTLAAAVLYG  202

Query  589   FIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG  768
             FI+  VE  +  A   V+  L++++Q ++  F+ +FCTV M++N DF AI +EA+E +LG
Sbjct  203   FILPLVELTYAKAKQVVSYTLVIEMQLVMGFFATVFCTVGMLVNNDFHAIPREAQECELG  262

Query  769   TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
               +YY ++ ++AI  Q   +G++G IF  SALL GI  ++L+ V +V +V+F  E FS  
Sbjct  263   ELRYYELLIWSAILWQFFFLGTVGAIFYGSALLAGIIMAVLIPVTEVLAVVFFHEPFSGG  322

Query  949   KLLSLAICIWGFASYFYGDYKTARKKPP  1032
             K ++LA+ +WGF SYFYG++  ++KK P
Sbjct  323   KGVALALALWGFVSYFYGEFLESKKKKP  350



>ref|XP_010942638.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
 ref|XP_010942639.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
Length=365

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/325 (46%), Positives = 226/325 (70%), Gaps = 3/325 (1%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
             + K  ++++NC+ L VG  GG +L RLYF HGG R+WL+S L T G+P +L+P+FISY  
Sbjct  20    ALKRALVVLNCLLLFVGDTGGPLLSRLYFRHGGHRQWLASWLETGGWPLILLPLFISYLY  79

Query  226   nqakaaanrrrV---LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLA  396
              +  A+ +        +TP LF++ A LGLL G D +LY +G+S+LPVS S++L STQLA
Sbjct  80    RRRLASDHHHPTKLFFLTPRLFLACAVLGLLTGTDDFLYAYGLSFLPVSTSAILISTQLA  139

Query  397   FTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGA  576
             FTA FA+ IVK K T YS+N++ L++ G+V+LGLH + DRP+  S   Y +GFF+T+  A
Sbjct  140   FTAFFAFLIVKQKFTPYSINSIALLSVGAVILGLHTSSDRPDNVSQGQYLMGFFLTLGTA  199

Query  577   ALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEARE  756
             AL+G ++  VE  +  A   +T  L+M++Q ++  F+  FCT+ M++NKDF+AI +EAR+
Sbjct  200   ALYGLVLPLVELTYRKASQVITYTLVMEMQLVMGFFATAFCTIGMLVNKDFEAIQREARQ  259

Query  757   FDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPES  936
             + LG  KYY+++ + AI  Q   +G++GVIF  + LL GI  ++L+ V ++F  IFL E 
Sbjct  260   YGLGEVKYYVVLVWCAILWQCFFLGTVGVIFCVNTLLAGIIIAVLIPVIELFGAIFLHEK  319

Query  937   FSADKLLSLAICIWGFASYFYGDYK  1011
             F+++K +SLA+C+WG ASY YG+Y+
Sbjct  320   FTSEKGVSLALCLWGLASYSYGEYR  344



>ref|XP_009765499.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   304 bits (779),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/342 (43%), Positives = 234/342 (68%), Gaps = 0/342 (0%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
             + + ++++INC+ LAVG  GG +++RLY++ GG R W SS L TAG+P  L+P+ I Y  
Sbjct  9     TMRKILLLINCLVLAVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTLIPLAILYFY  68

Query  226   nqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
              +   +++ +   +TP +F++S  +G++ GVD +LY++G S LPVS SSLL + QLAFTA
Sbjct  69    RRKTESSSAKLYFITPRIFIASFIIGIVTGVDDFLYSWGGSKLPVSTSSLLLAAQLAFTA  128

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
             + A+FIVK K T YS+NAVVL+T G+V+LG+   GDRPEG + ++Y LGF MT+  AAL+
Sbjct  129   IGAFFIVKLKFTPYSINAVVLLTVGAVLLGVRSNGDRPEGVTSKAYILGFMMTLLAAALY  188

Query  586   GFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDL  765
             G I+  +E  ++ A   +T  L++++Q ++   + +FCTV MI N DFQAIS+EA++F+L
Sbjct  189   GVILPCIELIYLKAKQAITATLVLEIQMVMCFAATVFCTVGMIANNDFQAISREAKQFNL  248

Query  766   GTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSA  945
             G  +YY ++ +  I  Q   +G +GVI+ SS+L+ G+  ++L+ V +V +V+F  E+FS 
Sbjct  249   GEARYYTVIIWTTIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRENFSG  308

Query  946   DKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
             +K L+L + +WGF SYFYG+++  +K+    P T     H E
Sbjct  309   EKGLALFLSLWGFVSYFYGEFRQTKKQKNKSPKTEMTMMHTE  350



>ref|XP_009380886.1| PREDICTED: purine permease 3-like [Musa acuminata subsp. malaccensis]
Length=365

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/342 (43%), Positives = 227/342 (66%), Gaps = 6/342 (2%)
 Frame = +1

Query  19    EDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLL  198
             +D         +  +I++NCV +A+G  G  +L+RLY+  GGKR+WLSS L TAG+P + 
Sbjct  13    QDAAPQMSKGLRRALIVLNCVLMALGNTGSPLLLRLYYRSGGKRQWLSSWLETAGWPFIF  72

Query  199   VPIFISYarnqakaaan------rrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPV  360
             VP+ I+Y   + +           +   +TP LF++ AF+GL+ G D +LY +G+S+LPV
Sbjct  73    VPLLITYLHRRRRCQLRPGNCHPTKLFFITPRLFLACAFIGLITGFDDFLYAYGLSFLPV  132

Query  361   SISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRS  540
             S SSLL STQLAFTA FA+ IVK K T YS+N+V L+T G+VVLGLH++ DRP+  +   
Sbjct  133   STSSLLISTQLAFTAFFAFLIVKQKFTPYSINSVALLTVGAVVLGLHVSSDRPDNVTRGQ  192

Query  541   YTLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIIN  720
             Y LGF +T+  AAL+G I+  VE  +  +   +T  L+M++Q ++  F+  FCTV M++N
Sbjct  193   YHLGFILTLGAAALYGLILPLVELMYSKSKQAITYTLVMEMQLVMGFFATAFCTVGMLVN  252

Query  721   KDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAV  900
             KDFQAI +EAR F+LG  +YY+++ ++A+  Q   +G++G+IF  + LL GI  +L + V
Sbjct  253   KDFQAIPREARHFELGEFRYYVVLVWSAVFWQFFFLGTVGIIFCVNTLLAGILIALFIPV  312

Query  901   QQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
              +V  V+F  E+FS++K ++L + +WG ASY YG+Y+  + K
Sbjct  313   TEVLGVVFFKENFSSEKGIALVLSLWGLASYSYGEYRQEKDK  354



>ref|XP_010942637.1| PREDICTED: purine permease 3-like isoform X1 [Elaeis guineensis]
Length=448

 Score =   306 bits (784),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/325 (46%), Positives = 226/325 (70%), Gaps = 3/325 (1%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
             + K  ++++NC+ L VG  GG +L RLYF HGG R+WL+S L T G+P +L+P+FISY  
Sbjct  103   ALKRALVVLNCLLLFVGDTGGPLLSRLYFRHGGHRQWLASWLETGGWPLILLPLFISYLY  162

Query  226   nqakaaanrrrV---LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLA  396
              +  A+ +        +TP LF++ A LGLL G D +LY +G+S+LPVS S++L STQLA
Sbjct  163   RRRLASDHHHPTKLFFLTPRLFLACAVLGLLTGTDDFLYAYGLSFLPVSTSAILISTQLA  222

Query  397   FTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGA  576
             FTA FA+ IVK K T YS+N++ L++ G+V+LGLH + DRP+  S   Y +GFF+T+  A
Sbjct  223   FTAFFAFLIVKQKFTPYSINSIALLSVGAVILGLHTSSDRPDNVSQGQYLMGFFLTLGTA  282

Query  577   ALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEARE  756
             AL+G ++  VE  +  A   +T  L+M++Q ++  F+  FCT+ M++NKDF+AI +EAR+
Sbjct  283   ALYGLVLPLVELTYRKASQVITYTLVMEMQLVMGFFATAFCTIGMLVNKDFEAIQREARQ  342

Query  757   FDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPES  936
             + LG  KYY+++ + AI  Q   +G++GVIF  + LL GI  ++L+ V ++F  IFL E 
Sbjct  343   YGLGEVKYYVVLVWCAILWQCFFLGTVGVIFCVNTLLAGIIIAVLIPVIELFGAIFLHEK  402

Query  937   FSADKLLSLAICIWGFASYFYGDYK  1011
             F+++K +SLA+C+WG ASY YG+Y+
Sbjct  403   FTSEKGVSLALCLWGLASYSYGEYR  427



>ref|XP_004299691.1| PREDICTED: purine permease 3-like [Fragaria vesca subsp. vesca]
Length=373

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 159/354 (45%), Positives = 245/354 (69%), Gaps = 6/354 (2%)
 Frame = +1

Query  22    DMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLV  201
             D ++ K  + K L++I++ V L++G  GG +++RLYF+HGGKR WLSS L T G+P +LV
Sbjct  7     DNEQRKAAALKRLLLILSSVLLSIGTCGGPLIMRLYFIHGGKRVWLSSMLETGGWPVILV  66

Query  202   PIFISYarnqakaaanrrrV----LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSIS  369
             PI I+Y   +   A          +  P LF++SA +G+L G+D YLY +G++ LPVS S
Sbjct  67    PIAIAYYHRRKNQAPTDPPTKLFFMKLP-LFVASAVIGVLTGLDDYLYAYGVARLPVSTS  125

Query  370   SLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTL  549
             +L+ + QLAFTA+FA+ +VK K T YS+NAVVL+T G+ VLGL+ + DRP+GES+  Y L
Sbjct  126   ALIIAAQLAFTALFAFILVKQKFTSYSINAVVLLTVGAAVLGLNTSSDRPKGESNAQYML  185

Query  550   GFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDF  729
             GF MT+A AAL+GF++  VE  +  A   +T  L++++Q ++S+F+ +FCTV M++N DF
Sbjct  186   GFVMTVAAAALYGFVLPLVELMYKKAKQNITYALVLEIQMVMSLFATIFCTVGMLVNNDF  245

Query  730   QAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQV  909
             + I +EAR+F+LG   YY+++  +AI  Q   +G++G+IF +S+LL GI  ++L+ V ++
Sbjct  246   KVIPREARKFELGETTYYVVLVVSAIVWQTFFLGAIGLIFCASSLLSGIVIAVLLPVTEI  305

Query  910   FSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
             F+VIF  E F A+K +SLA+ +WGF SYFYG+ K  ++K     V  + E ++E
Sbjct  306   FAVIFYHEKFQAEKGVSLALSLWGFVSYFYGEIKHNKQKKQADAVK-EKENNKE  358



>gb|AES73111.2| purine permease-like protein [Medicago truncatula]
Length=371

 Score =   303 bits (775),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/351 (42%), Positives = 234/351 (67%), Gaps = 14/351 (4%)
 Frame = +1

Query  16    LEDMKKMKFLSFK--ALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFP  189
             +E+ K+ +    K    ++I+NC+ LA+G  GG +++RLYF+HGG+R WLS+CL TAGFP
Sbjct  1     MEEGKEQQVAKKKMNKFLLIVNCLILALGNSGGPLIMRLYFIHGGQRVWLSACLETAGFP  60

Query  190   CLLVPIFISY------------arnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLY  333
              +L+P+ ISY            +   + A+  +  + + P +F ++AF+G+L G+D YLY
Sbjct  61    LMLIPLTISYIQRFRHRHKPLPSNTISIASEKQNIISMKPPIFFAAAFVGILTGLDDYLY  120

Query  334   TFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGD  513
              +G++ LPVS SSL+ ++QL FTA FA+ +VK K T ++VNAV L+T G+ VL +H + D
Sbjct  121   AYGVARLPVSTSSLIIASQLGFTAFFAFLLVKQKFTAFTVNAVFLLTVGAGVLAMHTSSD  180

Query  514   RPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSAL  693
             RP G S + Y +GF  T+A +AL+GF++  VE  +     P+T  L+M+ QF++ MF+ +
Sbjct  181   RPAGVSAKQYAIGFSTTVAASALYGFVLPAVELVYKKIKQPITYSLVMEFQFVMCMFATI  240

Query  694   FCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLG  873
             FCT+ MIIN DF+ I +EAR F LG   YY+++   AI  Q   +G++GV+F +S+LL G
Sbjct  241   FCTIGMIINNDFKMIPREARNFGLGESIYYVVLVLNAIMWQAFFLGAIGVVFCASSLLSG  300

Query  874   IFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
             I  ++L+ + +V +V+F  E F A+K +SL + +WGF SYFYG+ K A+ +
Sbjct  301   ILIAVLLPLTEVLAVVFYKEKFQAEKGVSLVLSLWGFVSYFYGEIKHAKAE  351



>ref|XP_008812219.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
 ref|XP_008812222.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=357

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 225/327 (69%), Gaps = 3/327 (1%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             +  ++ +N   + +G  GG +L+RLYFL GG RKWLSS L T G+P L +P+ ISYA  +
Sbjct  22    RWFLMALNFAIMVIGTTGGPLLLRLYFLKGGSRKWLSSWLETGGWPLLFIPLAISYAHRR  81

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
                   +   L+TP LF++   LGLL+G+D +LY +GMS LPVS +S+L ST L FTA+F
Sbjct  82    GGGGPTKLY-LMTPPLFLACTVLGLLVGLDDFLYAYGMSCLPVSTASILVSTHLGFTALF  140

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A+ IVK K T +S NAVVL++ G+V+LGLH +GDRP+GES+  Y LGF MT+A A L+G 
Sbjct  141   AFLIVKQKFTSFSTNAVVLLSIGAVILGLHASGDRPKGESNTLYYLGFAMTLAAAMLYGV  200

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             ++  VE  +  A   V+  L+M++Q ++  F+ +FCTV M++NKDFQAI KEAR+F LG 
Sbjct  201   VLPLVELTYAKAKQVVSYTLVMEMQLVMGFFATVFCTVGMLVNKDFQAIPKEARDFGLGE  260

Query  772   EKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADK  951
              +YY+++ ++A+  Q   +G++G IF  SALL GI  + ++ V +V +VI   E FS  K
Sbjct  261   VRYYVLLVWSALMWQFFYLGTVGAIFYGSALLAGIIIAAMIPVTEVLAVILFHEPFSGGK  320

Query  952   LLSLAICIWGFASYFYGDYKTARKKPP  1032
                +A+ +WGFASYFYG+++ ++KK P
Sbjct  321   --GVALALWGFASYFYGEFQESKKKKP  345



>gb|KHG13700.1| Purine permease 3 -like protein [Gossypium arboreum]
 gb|KHG19122.1| Purine permease 3 -like protein [Gossypium arboreum]
Length=358

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/330 (43%), Positives = 230/330 (70%), Gaps = 1/330 (0%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPI-FISYa  222
             + +  +++INC+ L++G   G +++RLYF+HGGKR W SS L T G+P +L PI  + + 
Sbjct  13    TMRKALLVINCIILSIGNCAGPLMMRLYFIHGGKRVWFSSWLETGGWPIILFPIACVHFY  72

Query  223   rnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFT  402
             R++ + ++  +   + P LF+++A +G+L G+D YLY +G++ LPVS SSL+ ++QLAFT
Sbjct  73    RSRTQPSSENKLFFMKPHLFIAAAVIGILTGLDDYLYAYGVARLPVSTSSLIIASQLAFT  132

Query  403   AVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAAL  582
             A FA+ +VK K T YS+NAV L+T GS VL +H + DRP  ES+R Y LGF MT+  +AL
Sbjct  133   AGFAFVLVKQKFTSYSINAVFLLTIGSGVLAMHTSSDRPANESNREYVLGFLMTVGASAL  192

Query  583   HGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFD  762
             +GFI+  VE  +  A   ++  L+M++Q ++ +F+   CT+ M++N DF+ I +EARE++
Sbjct  193   YGFILPLVELTYKKAKQEISYALVMEIQMVMCLFATGVCTIGMLVNNDFKVIRREAREYE  252

Query  763   LGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFS  942
             LG  KYY++   +A+  Q   +G++GVIF +S+LL GI  ++L+ V ++ +VIF  ESF 
Sbjct  253   LGETKYYIVAICSAMIWQCFFLGAIGVIFCASSLLSGIIIAVLLPVTEILAVIFYNESFH  312

Query  943   ADKLLSLAICIWGFASYFYGDYKTARKKPP  1032
             A+K ++LA+ +WGF SYFYG+ K +++  P
Sbjct  313   AEKGVALALSLWGFLSYFYGEIKQSKENKP  342



>ref|XP_004242795.1| PREDICTED: purine permease 3-like [Solanum lycopersicum]
Length=367

 Score =   302 bits (773),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 153/355 (43%), Positives = 230/355 (65%), Gaps = 20/355 (6%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISY----  219
             K  ++ INC+ LA+G  GG ++ RLYFL GG+R WLSS L T G+P +L+P+  SY    
Sbjct  11    KKFLLAINCILLAIGNCGGPLITRLYFLKGGERIWLSSWLETVGWPIVLIPLSFSYFNRR  70

Query  220   ----------arnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSIS  369
                                N + +L+TP +F++S  +G+L G D+YLY +G++ LPVS S
Sbjct  71    REFRGKMILSTSTDNDNDNNAKFILMTPRIFVASIGIGILTGFDNYLYAYGVAKLPVSTS  130

Query  370   SLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTL  549
             +LL ++QLAFTA FA+ +VK K T YS+N++ L+T G+VVL LH  GDRP GES + Y L
Sbjct  131   ALLIASQLAFTAGFAFLLVKQKFTSYSINSIFLLTLGAVVLALHANGDRPNGESRKEYIL  190

Query  550   GFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDF  729
             GF MT+  AAL+G I+   E  +  A   +T  L+M++Q +  +FS + CT+ MIINKDF
Sbjct  191   GFIMTLGAAALYGLILPLFELLYKKAKQGITYTLVMEIQAVYCIFSTVVCTIGMIINKDF  250

Query  730   QAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQV  909
             QA+S+EA+ F+LG  +YY+++ ++AI  Q   +G++GVI+ SS+L+ GI  ++L+ V ++
Sbjct  251   QAMSREAKSFELGEARYYIVIIWSAILWQCFFLGAIGVIYFSSSLVSGILITVLLPVTEI  310

Query  910   FSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQEV  1074
               V+F  E F+ +K +SL + IWGF SY YGD K ++KK        +  + QE+
Sbjct  311   LGVVFYGEKFTPEKGVSLVLSIWGFISYLYGDIKASKKKKE------NQSKEQEM  359



>gb|KHG06856.1| Purine permease 1 -like protein [Gossypium arboreum]
Length=374

 Score =   302 bits (773),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 150/350 (43%), Positives = 233/350 (67%), Gaps = 6/350 (2%)
 Frame = +1

Query  13    NLEDMK----KMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTA  180
             N E M+    K    + +  +++INC+ L++G  G  +++RLYF+HGG R W  S L TA
Sbjct  10    NTEQMEVKEPKHDGTTMRKALLVINCIILSIGNCGSPLIMRLYFIHGGNRIWFLSWLETA  69

Query  181   GFPCLLVPIFISYarnqaka--aanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYL  354
             G P  L+PI  +Y      A   + ++R  +   LF+++  LG++ G+D+Y Y++G+S L
Sbjct  70    GCPITLLPIACAYMHRSRTADPTSGKKRFYMERPLFLAAIVLGIITGLDNYFYSYGLSRL  129

Query  355   PVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESD  534
             PVS SSL+ ++QLAFTA FA+ +VK K T YS+NAV L+T G+ VL LH + DRPE ES+
Sbjct  130   PVSTSSLIIASQLAFTAGFAFLLVKQKFTAYSINAVFLLTIGAGVLALHSSSDRPENESN  189

Query  535   RSYTLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMI  714
             + Y LGF MT+A AAL+GF++  VE  +  A   ++  L+M++Q ++ + +  FCTV M+
Sbjct  190   KEYILGFVMTLAAAALYGFVLPLVELTYKKAKQEISYALVMEIQLVMCLVATGFCTVGML  249

Query  715   INKDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLV  894
             +N DF+ I KEAREF+LG  KYY++V F AI  Q   +G++GV+F +S++L G+  ++L+
Sbjct  250   VNNDFKVIGKEAREFELGETKYYVVVIFTAIINQCFFLGAIGVVFCASSMLSGVVIAVLL  309

Query  895   AVQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPV  1044
              V ++ ++    E F A+K +SLA+ +WGF SYFYG+ K ++KK P P +
Sbjct  310   PVTEILAIFSFNEKFQAEKGVSLALSLWGFVSYFYGEIKQSKKKKPDPEI  359



>ref|XP_009611006.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=352

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/342 (43%), Positives = 233/342 (68%), Gaps = 0/342 (0%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
             + + ++++INC+ LAVG  GG +++RLY++ GG R WLSS L TAG+P  L+P+ I Y  
Sbjct  9     NMRRILLVINCLILAVGICGGPLMMRLYYVEGGSRVWLSSWLQTAGWPLTLIPLAILYFY  68

Query  226   nqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
              +    +N +   +TP +F++S  +G++ G+D +LY++G S LPVS SSLL + QLAFT+
Sbjct  69    RRKVEGSNAKFYFITPRIFIASFVIGVVTGLDDFLYSWGGSKLPVSTSSLLLAAQLAFTS  128

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
             V A+FIVK K T YS+NAV+L+T G+V+LG+   GDRPEG + ++Y LGF MT+  AAL+
Sbjct  129   VGAFFIVKLKFTPYSINAVILLTVGAVLLGVRSNGDRPEGVTSKAYILGFMMTLLAAALY  188

Query  586   GFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDL  765
             G I+  +E  ++ A   +T  L++++Q ++   +  FCTV MI N DFQA+S+EA++F+L
Sbjct  189   GVILPCIELIYLKAKQVITATLVLEIQMVMCFAATAFCTVGMIANNDFQAMSREAKQFNL  248

Query  766   GTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSA  945
             G  +YY ++ + +I  Q   +G +GVI+ SS+L+ G+  ++L+ V +V +V+F  E+FS 
Sbjct  249   GEARYYTVIVWTSIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRENFSG  308

Query  946   DKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
             +K L+L + +WGF SYFYG+++  +K+    P       H E
Sbjct  309   EKGLALFLSLWGFVSYFYGEFRQTKKQKNKSPQIEMKTTHTE  350



>ref|XP_006357923.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=341

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/338 (46%), Positives = 224/338 (66%), Gaps = 1/338 (0%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K ++++INC+ LAVG  GG +++RLYF+ GGKR WLSS L TA +P   +P+ ISY   +
Sbjct  2     KKVLLVINCIILAVGTCGGPLVMRLYFIKGGKRIWLSSWLQTAAWPINFIPLVISYFYRR  61

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
                +  +  +L+TP +FM++  +G+L G  +Y Y +G+  LPVS S LL +TQLAFTA F
Sbjct  62    KNNSTTKL-ILMTPRIFMATIGIGILQGFTNYFYAYGIGKLPVSTSGLLFATQLAFTAFF  120

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A+ IVK K T YSVN+V L+T G+VVL L   GD+PEGE  + Y LGF MT+A AAL G 
Sbjct  121   AFLIVKLKFTPYSVNSVFLLTTGAVVLALRSGGDQPEGEPRKEYILGFVMTLASAALTGL  180

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             I   VE  +      +T   +++ Q +    + +  T+ MIINKDFQAIS+EA+ F+LG 
Sbjct  181   IFPLVELIYKKTQQTITYTFVLEFQTLYCFVATVLATIGMIINKDFQAISREAKTFELGE  240

Query  772   EKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADK  951
             +KYY+++ ++AI LQ   +GS+GVI+S+S+L+ GI  S+L+ + +V +V    E F+A+K
Sbjct  241   DKYYIVIIWSAIILQFYFLGSIGVIYSASSLVCGILLSVLLPLTEVLAVFLYGEKFNAEK  300

Query  952   LLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEH  1065
              +SLA+ +WGFASYFYGDY         P +   D+ +
Sbjct  301   GVSLALSLWGFASYFYGDYNKTENSNQSPAIEMIDKTN  338



>ref|XP_010266597.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=369

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/325 (45%), Positives = 223/325 (69%), Gaps = 7/325 (2%)
 Frame = +1

Query  94    GQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqak----aaanrrrV  261
             G  GG +LIRLYFLHGGKR W SS L TAG+P LL+P+  SY+  +++       + R  
Sbjct  42    GNCGGPLLIRLYFLHGGKRIWFSSWLETAGWPILLLPLLFSYSYRRSQDQGEERGSTRLF  101

Query  262   LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLT  441
             L+ P LF +SA LG++ G+D YLY +G+S LPVS S+L++STQL FTA+FA+F+V+   T
Sbjct  102   LIKPRLFAASAILGIITGLDDYLYAYGLSRLPVSTSALIASTQLIFTAIFAFFLVRQTFT  161

Query  442   HYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHV  621
              YS+N++V++T G++V+ LH   DRP  ES+  Y  GFFMTI  +AL+G ++  VE  + 
Sbjct  162   SYSINSIVMLTIGALVMALHTGSDRPSNESNTQYYTGFFMTIGASALYGLVLPLVELTYK  221

Query  622   HAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFA  801
              +   +T  L++++Q +IS+F+  FC++ M++N DF++I K+A E+++G  KYY+++ ++
Sbjct  222   KSNQLITYSLVIEMQLVISIFATAFCSLGMLVNNDFKSIPKDASEYEIGEAKYYLVIVWS  281

Query  802   AIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWG  981
             AI  QL  +G +GVIF  S++L GI  + ++ V ++ +VIF  E F A+K +SLA+C+WG
Sbjct  282   AILWQLFFLGLVGVIFCGSSMLGGIIIAAVIPVTEILAVIFCREKFKAEKGISLALCLWG  341

Query  982   FASYFYGDYKTARKK---PPPPPVT  1047
             F SYFYG+ K   KK    P P  T
Sbjct  342   FTSYFYGEIKGPSKKNSETPQPDTT  366



>ref|XP_003602860.1| Purine permease [Medicago truncatula]
Length=440

 Score =   302 bits (774),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/349 (43%), Positives = 233/349 (67%), Gaps = 14/349 (4%)
 Frame = +1

Query  16    LEDMKKMKFLSFK--ALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFP  189
             +E+ K+ +    K    ++I+NC+ LA+G  GG +++RLYF+HGG+R WLS+CL TAGFP
Sbjct  1     MEEGKEQQVAKKKMNKFLLIVNCLILALGNSGGPLIMRLYFIHGGQRVWLSACLETAGFP  60

Query  190   CLLVPIFISY------------arnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLY  333
              +L+P+ ISY            +   + A+  +  + + P +F ++AF+G+L G+D YLY
Sbjct  61    LMLIPLTISYIQRFRHRHKPLPSNTISIASEKQNIISMKPPIFFAAAFVGILTGLDDYLY  120

Query  334   TFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGD  513
              +G++ LPVS SSL+ ++QL FTA FA+ +VK K T ++VNAV L+T G+ VL +H + D
Sbjct  121   AYGVARLPVSTSSLIIASQLGFTAFFAFLLVKQKFTAFTVNAVFLLTVGAGVLAMHTSSD  180

Query  514   RPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSAL  693
             RP G S + Y +GF  T+A +AL+GF++  VE  +     P+T  L+M+ QF++ MF+ +
Sbjct  181   RPAGVSAKQYAIGFSTTVAASALYGFVLPAVELVYKKIKQPITYSLVMEFQFVMCMFATI  240

Query  694   FCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLG  873
             FCT+ MIIN DF+ I +EAR F LG   YY+++   AI  Q   +G++GV+F +S+LL G
Sbjct  241   FCTIGMIINNDFKMIPREARNFGLGESIYYVVLVLNAIMWQAFFLGAIGVVFCASSLLSG  300

Query  874   IFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTAR  1020
             I  ++L+ + +V +V+F  E F A+K +SL + +WGF SYFYG+ K A+
Sbjct  301   ILIAVLLPLTEVLAVVFYKEKFQAEKGVSLVLSLWGFVSYFYGEIKHAK  349



>ref|XP_010098679.1| Purine permease 3 [Morus notabilis]
 gb|EXB75582.1| Purine permease 3 [Morus notabilis]
Length=377

 Score =   300 bits (768),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 149/319 (47%), Positives = 229/319 (72%), Gaps = 2/319 (1%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             KAL +++N + L +G  GG +++RLYF++GGKR WLSSCL T G+P +L+P   S+ R +
Sbjct  29    KAL-LVLNIIILGIGNCGGPLIMRLYFINGGKRVWLSSCLQTVGWPIILLPAAFSFYRRR  87

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
              +  A +    + P+L ++ A +G+L G+++Y YT+G++ LPVS ++L++++QLAFTA F
Sbjct  88    RQNPAAKFFE-IKPFLILAFAVVGILTGLNAYSYTYGVARLPVSTAALITASQLAFTAAF  146

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             AY +VK K T YS+NAV L+T G  VL LH +GDRPEGES + Y +GF M++  A ++GF
Sbjct  147   AYLLVKQKFTAYSLNAVALLTAGGAVLALHTSGDRPEGESSKEYLMGFLMSVGAALIYGF  206

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             I+  +E A+  A   +T  L+++VQ ++  F+  FC V MIINKDFQA+ +EA++F+LG 
Sbjct  207   ILPLMELAYKKAKQELTYSLVLEVQMVMCFFATAFCIVGMIINKDFQAVPREAKKFELGE  266

Query  772   EKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADK  951
              KYY+++  +AI  Q   +G++GV++ +S+LL GI  ++L+ V +VF VIF  ESF A+K
Sbjct  267   TKYYVVLVCSAIIWQGFFLGAVGVVYCASSLLSGIVIAVLLPVTEVFGVIFYKESFPAEK  326

Query  952   LLSLAICIWGFASYFYGDY  1008
              LSL + +WGFASYFYG++
Sbjct  327   GLSLVLSLWGFASYFYGEF  345



>ref|XP_006433898.1| hypothetical protein CICLE_v10001546mg [Citrus clementina]
 gb|ESR47138.1| hypothetical protein CICLE_v10001546mg [Citrus clementina]
Length=371

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/325 (46%), Positives = 216/325 (66%), Gaps = 15/325 (5%)
 Frame = +1

Query  94    GQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaan--------  249
             G   G +++RLYFLHGGKR W SS L  AG P +L+PI +SY + +  +           
Sbjct  30    GNCAGPLIMRLYFLHGGKRIWFSSWLEAAGCPVILIPITVSYLQRRRSSTTTDHESSTSS  89

Query  250   -------rrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAV  408
                     + +L+ P +F +SA +G+L G+D+YLY +G++ LPVS SSL+ ++QLAFTA 
Sbjct  90    QPSNNDNNKLILMRPPVFFASAIIGILTGLDNYLYAYGVARLPVSTSSLIIASQLAFTAA  149

Query  409   FAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHG  588
             FA+ +VK KLT YS+NAV L+T G+VVLGLH  GDRP  ES R Y +GF MT+  A L+G
Sbjct  150   FAFLLVKQKLTSYSLNAVFLLTLGAVVLGLHTNGDRPHNESARQYLVGFLMTVGAAVLYG  209

Query  589   FIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG  768
             F++  +E  +  A   +T  L++++Q ++ +F+ L CTV M++NKDFQAI KEAR + LG
Sbjct  210   FVLPLMELTYKRARQEITYALVLEIQMVMCLFATLVCTVGMVVNKDFQAIGKEARAYTLG  269

Query  769   TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
               KYY +V  +A+  Q   +G++GVI+  S+LL  I  ++L+ V ++ +VIF  E F A+
Sbjct  270   EGKYYAVVVASALIWQCFFLGAIGVIYCGSSLLSAIIIAVLLPVTEILAVIFYKEKFQAE  329

Query  949   KLLSLAICIWGFASYFYGDYKTARK  1023
             K +SLA+ +WGFASYFYG+ K  +K
Sbjct  330   KGVSLALSLWGFASYFYGEIKNNKK  354



>ref|XP_010538168.1| PREDICTED: purine permease 1-like [Tarenaya hassleriana]
Length=359

 Score =   297 bits (761),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 149/335 (44%), Positives = 227/335 (68%), Gaps = 13/335 (4%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             KALVII NC+FLA+G  GG +++RLYF +GGKR WLSS L TAGFP + +P+F S+ +  
Sbjct  3     KALVII-NCIFLAIGNCGGPLMMRLYFNNGGKRVWLSSFLETAGFPIIFIPLFSSFLKRN  61

Query  232   akaaanrrrV------------LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSL  375
                 +                 L+ P LF +S F+G++ G+D+YLY +G+++LPVS SSL
Sbjct  62    RNRTSCIITSSSSSSDEKTRFFLMRPRLFAASGFIGIITGLDNYLYAYGLAFLPVSTSSL  121

Query  376   LSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGF  555
             + ++QLAFTA+FA+ +VK K T +SVNAVVL+T G+ VL LH  GD+P  ES + Y LGF
Sbjct  122   IIASQLAFTALFAFLLVKQKFTPFSVNAVVLLTVGAGVLALHTGGDKPSNESQKDYMLGF  181

Query  556   FMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQA  735
              +T+A A L+ FI+  +E  +  A   ++  L+++VQ ++ +F+++FC V M+I+ DF+A
Sbjct  182   VLTVAAAVLYAFILPFIELTYKKARQEMSFTLVLEVQMVMCLFASVFCLVGMLISDDFKA  241

Query  736   ISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFS  915
             I +EAR F LG   YY+++ F AI  Q   +G++GVIF +S+L+ G+  S+L+ + +V +
Sbjct  242   IPREARSFGLGERVYYVVIAFTAIIWQGFFLGAIGVIFCASSLVSGVLISVLLPLTEVLA  301

Query  916   VIFLPESFSADKLLSLAICIWGFASYFYGDYKTAR  1020
             V+   E F A+K +SL + +WGF SYFYG+ K ++
Sbjct  302   VVCFKERFQAEKGVSLVLSLWGFVSYFYGEAKHSK  336



>ref|XP_008444875.1| PREDICTED: purine permease 3-like [Cucumis melo]
Length=365

 Score =   297 bits (761),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 151/336 (45%), Positives = 222/336 (66%), Gaps = 7/336 (2%)
 Frame = +1

Query  19    EDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLL  198
             +   +    + K  ++I NC  LAVG  GG +++RLYF+HGG R WLSS L T G+P + 
Sbjct  5     QQQHQQNTSAVKRTLLIFNCFLLAVGNCGGPLVMRLYFVHGGNRVWLSSFLETGGWPIIF  64

Query  199   VPIFISYarnqakaaa-------nrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLP  357
             +P+ ISY R +  AA        + + + + P LF++SA +G+L G D YLY +G++ LP
Sbjct  65    IPLLISYIRRRRLAALDPSGSADSSQIIFMKPRLFLASAVIGILTGFDDYLYAYGVARLP  124

Query  358   VSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDR  537
             VS S+L+ + QLAFTA FA+ +VK K T YS+NAVVL+T G  VL LH +GDRP GES++
Sbjct  125   VSTSALIIACQLAFTAGFAFLLVKQKFTSYSINAVVLLTIGGAVLALHTSGDRPAGESNK  184

Query  538   SYTLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMII  717
              Y  GF MT+A A ++GFI+  VE  +  A   +T  L+++ Q I+S+F+ + C + M+I
Sbjct  185   DYIAGFLMTVAAAVVYGFILPLVELTYKKARQQITYTLVLEYQLIMSLFATIVCVIGMLI  244

Query  718   NKDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVA  897
             N DFQ I +EA  F LG  +YY+++  +AI  Q   +G++GVIFSSS+L  GI  ++L+ 
Sbjct  245   NNDFQVIPREAETFGLGKFRYYLVLVLSAILWQGFFLGAIGVIFSSSSLFSGIVIAVLLP  304

Query  898   VQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGD  1005
             V ++ +VI   E F A+K +SLA+ +WGF SYFYG+
Sbjct  305   VTEILAVIIFNEKFQAEKAVSLALNLWGFVSYFYGE  340



>ref|XP_004299692.1| PREDICTED: purine permease 3-like [Fragaria vesca subsp. vesca]
Length=373

 Score =   298 bits (762),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 156/354 (44%), Positives = 244/354 (69%), Gaps = 6/354 (2%)
 Frame = +1

Query  22    DMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLV  201
             D +++K  + K L++I++CV L++G  GG +++RLYF+HGGKR WLSS L T G+P +LV
Sbjct  7     DNEQLKAAALKRLLLILSCVLLSIGTCGGPLIMRLYFIHGGKRLWLSSMLETGGWPVILV  66

Query  202   PIFISYarnqakaaanrrrV----LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSIS  369
             PI I+Y   +   A          +  P LF++SA +G+L G+D YLY +G++ LP+S  
Sbjct  67    PIAIAYYHRRKNQAPTDPPTKLFFMKLP-LFVASAVIGVLTGLDDYLYAYGVARLPLSTL  125

Query  370   SLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTL  549
             SL+ ++ L FTA+FA+ +VK K T YS+NAVVL+T G+ VLGL+ + DRP+GES+  Y L
Sbjct  126   SLIIASHLVFTALFAFILVKQKFTSYSINAVVLLTVGAAVLGLNTSSDRPKGESNAQYML  185

Query  550   GFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDF  729
             GF MT+A AAL+GF++  VE  +  A   +T  L++++Q ++S+F+ +FCTV M++N DF
Sbjct  186   GFVMTVAAAALYGFVLPLVELMYKKAKQNITYALVLEIQMVMSLFATIFCTVGMLVNNDF  245

Query  730   QAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQV  909
             + I +EAR+F+LG   YY+++  +AI  Q   +G++G+IF +S+LL GI  ++L+ V ++
Sbjct  246   KVIPREARKFELGETTYYVVLVVSAIVWQAFFLGAIGLIFCASSLLSGIVIAVLLPVTEI  305

Query  910   FSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
             F+VIF  E F A+K +SLA+ +WGF SYFYG+ K  ++      V  + E ++E
Sbjct  306   FAVIFYHEKFQAEKGVSLALSLWGFVSYFYGEMKHNKQSKQADAVK-EKENNKE  358



>ref|XP_008806390.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=367

 Score =   297 bits (760),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 149/326 (46%), Positives = 225/326 (69%), Gaps = 6/326 (2%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K  ++++NC+ L+VG  GG +L R+YF HGG R+WLSS L T G+P +L+P+ ISY   +
Sbjct  22    KRALVVLNCLLLSVGNTGGPLLSRVYFRHGGHRQWLSSWLETGGWPLILLPLSISYLYRR  81

Query  232   akaaan------rrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQL  393
              +  A        +   +TP LF++ A LGLL+GVD +LY +G+S+LPVS S+LL S+QL
Sbjct  82    RRRLAPDNHHHPTKLFFLTPRLFLACAVLGLLIGVDDFLYAYGLSFLPVSTSALLISSQL  141

Query  394   AFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAG  573
             AFTA FA+ IVK K T YS+N+V L+T G+V+LGLH + DRP+  S+  Y  GFF+T+  
Sbjct  142   AFTASFAFLIVKQKFTPYSINSVALLTVGAVMLGLHTSSDRPDNVSEGQYLTGFFLTLGT  201

Query  574   AALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAR  753
             AAL+G I+  VE  +  A   +T  L+M++Q ++  F+   CT+ M++NKDF+ I +EAR
Sbjct  202   AALYGLILPLVELTYRKARQVITYTLVMEMQLVMGFFATALCTIGMLVNKDFEVIPREAR  261

Query  754   EFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPE  933
             ++ LG  KYYM++ ++AI  Q   +G++GVIF  + LL GI  ++ + V ++F+ I L E
Sbjct  262   QYGLGEVKYYMVLVWSAILWQCFFLGTVGVIFCVNTLLAGIIIAVFIPVIELFAAILLHE  321

Query  934   SFSADKLLSLAICIWGFASYFYGDYK  1011
              F+++K +SLA+C+WG ASY YG+Y+
Sbjct  322   KFTSEKGVSLALCLWGLASYSYGEYR  347



>ref|XP_004152619.1| PREDICTED: purine permease 3-like [Cucumis sativus]
 gb|KGN62723.1| hypothetical protein Csa_2G369740 [Cucumis sativus]
Length=371

 Score =   297 bits (760),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/329 (44%), Positives = 221/329 (67%), Gaps = 3/329 (1%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
             + + +++  N + +++G  GG +++RLYF+HGG R WLSS L T G+P +L+P+ ISY  
Sbjct  22    TLQRVLLAFNSILMSIGNCGGPLILRLYFIHGGNRVWLSSWLFTGGWPIILLPLAISYIH  81

Query  226   nqakaaanrrrVLV---TPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLA  396
              +  A    +  L+    P L + SA +G+L GVD+YL+ +GM+ LPVS SSL+ ++QLA
Sbjct  82    RRRTATDGTKTKLIFMREPLLLLGSAVVGVLTGVDNYLFAYGMARLPVSTSSLIIASQLA  141

Query  397   FTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGA  576
             FTA FAY +VK K T Y+VNAVVL+T G  +L LH +GDRPEGE++  Y  GF MT+  A
Sbjct  142   FTAGFAYLLVKQKFTSYTVNAVVLLTMGGAILALHSSGDRPEGETNGEYIAGFLMTLGAA  201

Query  577   ALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEARE  756
              L+G I+  +E  +      +T  L++++Q ++++   L CT+ M+IN DFQAI++E RE
Sbjct  202   VLYGLILPLIELMYKKTKQRLTYTLILEIQLVMAISGTLVCTIGMLINNDFQAIAREGRE  261

Query  757   FDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPES  936
             F LG+ KYY+++  + I  Q   +G++GVIF SS+L  GI  +LL+   ++ +V+F  E 
Sbjct  262   FGLGSTKYYVVLVMSCIIWQCFFIGAVGVIFYSSSLFSGIVIALLLPAVEILAVVFFREK  321

Query  937   FSADKLLSLAICIWGFASYFYGDYKTARK  1023
             F  +K +SLA+ +WGF SYFYG++K  +K
Sbjct  322   FQVEKGVSLALNLWGFVSYFYGEFKQTKK  350



>ref|XP_009603730.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=352

 Score =   296 bits (758),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 149/328 (45%), Positives = 223/328 (68%), Gaps = 0/328 (0%)
 Frame = +1

Query  88    AVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLV  267
             AVG  GG +++RLY++ GG R WLSS L TAG+P  L+P+ I Y   +    +N +   +
Sbjct  23    AVGICGGPLMMRLYYVEGGSRVWLSSWLQTAGWPLTLIPLAILYFYRRKIEGSNAKFYFI  82

Query  268   TPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHY  447
             TP +F++S  +GL+ G+D +LY++G S LPVS SSLL + QLAFTAV A+FIVK K T Y
Sbjct  83    TPRIFIASFIIGLVTGLDDFLYSWGGSKLPVSTSSLLLAAQLAFTAVGAFFIVKLKFTPY  142

Query  448   SVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHA  627
             S+NAVVL+T G+V+LG+   GDRPEG + ++Y LGF MT+  AAL+G I+  +E  ++ A
Sbjct  143   SINAVVLLTVGAVLLGVRSNGDRPEGVTSKAYILGFMMTLLAAALYGVILPCIELIYLKA  202

Query  628   GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAI  807
                +T  L++++Q ++   +  FCTV MIIN DFQAIS+EA++F+LG  +YY +V + AI
Sbjct  203   KQAITATLVLEIQMVMCFAATAFCTVGMIINNDFQAISREAKQFNLGEARYYTVVIWTAI  262

Query  808   ALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFA  987
               Q   +G +GVI+ SS+L+ G+  ++L+ V +V +V+F  E+FS +K L+L + +WGF 
Sbjct  263   IWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFYRENFSGEKGLALFLSLWGFV  322

Query  988   SYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
             SYFYG+++  +K+    P       H E
Sbjct  323   SYFYGEFRQTKKQKNKSPEIETTTMHTE  350



>ref|XP_004164781.1| PREDICTED: purine permease 3-like [Cucumis sativus]
Length=371

 Score =   296 bits (759),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 144/329 (44%), Positives = 221/329 (67%), Gaps = 3/329 (1%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
             + + +++  N + +++G  GG +++RLYF+HGG R WLSS L T G+P +L+P+ ISY  
Sbjct  22    TLQRVLLAFNSILMSIGNCGGPLILRLYFIHGGNRVWLSSWLFTGGWPIILLPLAISYIH  81

Query  226   nqakaaanrrrVLV---TPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLA  396
              +  A    +  L+    P L + SA +G+L GVD+YL+ +GM+ LPVS SSL+ ++QLA
Sbjct  82    RRRTATDGSKTKLIFMREPLLLLGSAVVGVLTGVDNYLFAYGMARLPVSTSSLIIASQLA  141

Query  397   FTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGA  576
             FTA FAY +VK K T Y+VNAVVL+T G  +L LH +GDRPEGE++  Y  GF MT+  A
Sbjct  142   FTAGFAYLLVKQKFTSYTVNAVVLLTMGGAILALHSSGDRPEGETNGEYIAGFLMTLGAA  201

Query  577   ALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEARE  756
              L+G I+  +E  +      +T  L++++Q ++++   L CT+ M+IN DFQAI++E RE
Sbjct  202   VLYGLILPLIELMYKKTKQRLTYTLILEIQLVMAISGTLVCTIGMLINNDFQAIAREGRE  261

Query  757   FDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPES  936
             F LG+ KYY+++  + I  Q   +G++GVIF SS+L  GI  +LL+   ++ +V+F  E 
Sbjct  262   FGLGSTKYYVVLVMSCIIWQCFFIGAVGVIFYSSSLFSGIVIALLLPAVEILAVVFFREK  321

Query  937   FSADKLLSLAICIWGFASYFYGDYKTARK  1023
             F  +K +SLA+ +WGF SYFYG++K  +K
Sbjct  322   FQVEKGVSLALNLWGFVSYFYGEFKQTKK  350



>ref|XP_010263028.1| PREDICTED: purine permease 1-like [Nelumbo nucifera]
Length=365

 Score =   296 bits (759),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 153/319 (48%), Positives = 215/319 (67%), Gaps = 4/319 (1%)
 Frame = +1

Query  70    INCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaan  249
             INCV   +G I G +L+RLYFLHGG RKW+ S L TAG P LL P+ + Y R +A     
Sbjct  42    INCVCTVLGTIAGPLLLRLYFLHGGNRKWIPSWLETAGVPALLGPLTVLYLRERASGVR-  100

Query  250   rrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVK  429
                 L    L + SA +GLL G+++++Y+ G+S+LPVS SSLL STQLAFTA FA+ I K
Sbjct  101   ---FLAPTKLLLLSAGIGLLAGLNNFMYSLGLSFLPVSTSSLLLSTQLAFTAFFAFLIAK  157

Query  430   HKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVE  609
              K T YS NAVVLMT G+V+LGL  +GDRP G S++ Y LGF +T+  A L GFI+   E
Sbjct  158   QKFTPYSTNAVVLMTLGAVLLGLTKSGDRPPGVSNKDYLLGFILTLGAAGLLGFILPCCE  217

Query  610   YAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMI  789
              ++  A   +T  +++Q QF ++ F+ +FCT+ M+INKDFQAI +EA  F+LG  KYYM+
Sbjct  218   VSYATARKTITYSVVLQFQFGVNFFATVFCTIGMLINKDFQAIPREANAFELGAVKYYMV  277

Query  790   VGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAI  969
             +   AI  Q+ V+G LGV+F +++L  G+  + L+ + ++ +VI   E F+ +K ++LA+
Sbjct  278   LVSIAIVWQMAVVGLLGVVFCTTSLFAGVLNATLLPLTEIAAVIVYHEKFTGEKGMALAL  337

Query  970   CIWGFASYFYGDYKTARKK  1026
             C WGF SYFYG YK  +K+
Sbjct  338   CSWGFISYFYGSYKENKKQ  356



>ref|XP_006366415.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=355

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/322 (45%), Positives = 225/322 (70%), Gaps = 0/322 (0%)
 Frame = +1

Query  43    LSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYa  222
             ++ +  ++IINC+ L+VG  GG +++RLYF+ GG R W +S L T G+P  ++P+ I Y 
Sbjct  9     INMRRFLLIINCLLLSVGVCGGPLMMRLYFVEGGLRLWFNSWLQTGGWPLTIIPLVILYF  68

Query  223   rnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFT  402
               +    ++ +   +TP +F++S  +G+  GVD+YLY++G S LPVS SSLL + QLAFT
Sbjct  69    YRRKTKGSDTKFYYITPRIFIASFIIGVFTGVDAYLYSWGGSKLPVSTSSLLIAAQLAFT  128

Query  403   AVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAAL  582
             A+ +YFI K K T YS+NAVVL+T G+V+LG+   GDRPEG + + Y +GF MT+  AAL
Sbjct  129   AIGSYFIAKIKFTSYSINAVVLLTLGAVLLGMRSNGDRPEGVTSKEYVIGFIMTLLAAAL  188

Query  583   HGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFD  762
             +G I+  +E  ++ A   +T  L++++Q +++  +  FCT+ MI NKDFQAIS+EA+ F+
Sbjct  189   YGLILPCIELIYLKAKQAITATLVLEIQMVMAFAATAFCTIGMIANKDFQAISREAKHFN  248

Query  763   LGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFS  942
             LG  +YY++V ++AI  Q   +G++GVI+ SS+L+ G+  ++L+ + +V  VIF  E FS
Sbjct  249   LGEGRYYIVVIWSAIIWQCFFVGAVGVIYLSSSLMSGVMIAVLLPITEVLGVIFFDEKFS  308

Query  943   ADKLLSLAICIWGFASYFYGDY  1008
             A+K LSL + +WGF SYFYG++
Sbjct  309   AEKGLSLFLSLWGFVSYFYGEF  330



>ref|XP_004252714.1| PREDICTED: purine permease 3-like [Solanum lycopersicum]
Length=356

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/331 (44%), Positives = 226/331 (68%), Gaps = 0/331 (0%)
 Frame = +1

Query  16    LEDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCL  195
             +E+      ++ K  ++IINC+ L+VG  GG +++RLYF+ GG R W +S L T G+P  
Sbjct  1     MEEEANFLSINMKRFLLIINCLLLSVGVCGGPLMMRLYFVEGGLRIWFNSWLQTGGWPLT  60

Query  196   LVPIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSL  375
             ++P+ I Y   +    ++ +    TP +F++S  +G+  G D+YLY++G S LPVS SSL
Sbjct  61    IIPLVILYFYRRKIEGSDTKLYYTTPRIFIASFVIGIFTGFDAYLYSWGGSKLPVSTSSL  120

Query  376   LSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGF  555
             L + QLAFTA+ AYFIVK K T YS+NAVVL+T G+V+LG+   GDRPEG + + Y +GF
Sbjct  121   LIAAQLAFTAIGAYFIVKIKFTSYSINAVVLLTLGAVLLGIRSNGDRPEGVTSKEYVIGF  180

Query  556   FMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQA  735
              MT+  AAL+G I+  +E  ++ A   +T  L++++Q ++   S  FCT+ MI NKDFQA
Sbjct  181   IMTLLAAALYGLILPCIELMYLKAKQAITATLVLEIQMVMCFASTAFCTIGMIANKDFQA  240

Query  736   ISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFS  915
             IS+E ++F+LG  +YY++V ++AI  Q   +G++GVI+ SS+L+ G+  ++L+ + ++  
Sbjct  241   ISRETKKFNLGEARYYIVVIWSAIIWQCFFVGAVGVIYLSSSLMSGVLIAVLLPITEILG  300

Query  916   VIFLPESFSADKLLSLAICIWGFASYFYGDY  1008
             VIF  E FS++K LSL + +WGF SYFYG++
Sbjct  301   VIFFDEKFSSEKGLSLFLSLWGFVSYFYGEF  331



>ref|XP_006472532.1| PREDICTED: purine permease 1-like [Citrus sinensis]
 gb|KDO81081.1| hypothetical protein CISIN_1g017456mg [Citrus sinensis]
Length=371

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/319 (46%), Positives = 214/319 (67%), Gaps = 15/319 (5%)
 Frame = +1

Query  94    GQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaan--------  249
             G   G +++RLYFLHGGKR W SS L TAG P +L+PI +SY + +              
Sbjct  30    GNCAGPLIMRLYFLHGGKRIWFSSWLETAGCPVILIPITVSYLQRRRSGTTTDHESSTSS  89

Query  250   -------rrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAV  408
                     + +L+ P +F +SA +G+L G+D+YLY +G++ LPVS SSL+ ++QLAFTA 
Sbjct  90    QPSNNDDNKLILMRPPVFFASAIIGILTGLDNYLYAYGVARLPVSTSSLIIASQLAFTAA  149

Query  409   FAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHG  588
             FA+ +VK KLT YS+NAV L+T G+VVLGLH  GDRP+ ES R Y +GF MTI  A L+G
Sbjct  150   FAFLLVKQKLTSYSLNAVFLLTLGAVVLGLHTNGDRPDNESARQYLVGFLMTIGAAVLYG  209

Query  589   FIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG  768
             F++  +E  +  A   +T  L++++Q ++ +F+ L CTV M++NKDFQAI KEAR + LG
Sbjct  210   FVLPLMELTYKRARQEITYALVLEIQMVMCLFATLVCTVGMVVNKDFQAIGKEARAYTLG  269

Query  769   TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
               KYY +V  +A+  Q   +G++GVI+  S+LL  I  ++L+ V ++ +VIF  E F A+
Sbjct  270   EGKYYAVVVASALIWQCFFLGAIGVIYCGSSLLSAIIIAVLLPVTEILAVIFYKEKFQAE  329

Query  949   KLLSLAICIWGFASYFYGD  1005
             K +SLA+ +WGFASYFYG+
Sbjct  330   KGVSLALSLWGFASYFYGE  348



>gb|KFK44691.1| hypothetical protein AALP_AA1G290900 [Arabis alpina]
Length=351

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/330 (45%), Positives = 227/330 (69%), Gaps = 6/330 (2%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             KALVII NC+ LA+G  GG +++RLYF +GGKR W SS L TAGFP +L+P+F SY    
Sbjct  4     KALVII-NCIILAIGNCGGPLIMRLYFNNGGKRIWFSSFLETAGFPVILIPLFFSYLNRL  62

Query  232   ak-----aaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLA  396
              +      + N    L+ P L  ++  +G+L G D+YLY +G++YLPVS ++L+ ++QLA
Sbjct  63    RRNNNNGTSENISFFLIKPRLLFAAVLVGVLSGFDNYLYAYGIAYLPVSTAALIIASQLA  122

Query  397   FTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGA  576
             F A+F+YF+V HK T Y++NAVVL+T G+ VLG+H   D+P  E+ + Y +GF MT+A A
Sbjct  123   FIAIFSYFMVNHKFTPYTINAVVLLTVGAAVLGMHTETDKPVHETHKQYVIGFLMTVAAA  182

Query  577   ALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEARE  756
              ++ FI+  VE A+  A  P++  L+++VQ ++ +F++L   + M I  DF+A+  EARE
Sbjct  183   VMYAFILPLVELAYQKAKQPMSYTLVLEVQLVLCLFASLVSLIGMFIAGDFKALPIEARE  242

Query  757   FDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPES  936
             F LG   +Y++V F+AI  Q   +G++G+IF +S+L+ GI  S+L+ + +V +VIF  E 
Sbjct  243   FKLGEALFYVVVVFSAIIWQGFFLGAIGLIFCASSLVSGIMISVLLPITEVLAVIFYHEK  302

Query  937   FSADKLLSLAICIWGFASYFYGDYKTARKK  1026
             F A+K LSLA+ +WGF SYFYG+ K+ ++K
Sbjct  303   FQAEKGLSLALSLWGFVSYFYGEIKSDKEK  332



>ref|XP_006357924.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=355

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 160/341 (47%), Positives = 228/341 (67%), Gaps = 3/341 (1%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K +++IIN +FLAVG  G  ++IRLYF+ GGKR WLS  L T  +P  L+P+ ISY   +
Sbjct  14    KKILLIINSIFLAVGICGAPLIIRLYFIKGGKRIWLSCWLQTVAWPINLIPLAISYLYRR  73

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
                 +++  +L+TP +FM++  +G+L G  +Y Y +G++ LPVS S LL STQLAFTA F
Sbjct  74    NNNNSSKL-ILMTPHIFMATIGIGILQGFSNYSYAYGVAELPVSTSGLLCSTQLAFTAFF  132

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A+ IV+ K T YSVN+V L+T G+V+L LH  GDRPEGES + Y LGF MT+A AAL G 
Sbjct  133   AFIIVRLKFTSYSVNSVFLLTIGAVILALHSGGDRPEGESKKLYILGFIMTLAAAALAGL  192

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             I   VE  +  A   +T   +++ Q +    + LF T+ MIIN DFQAIS EA+ F+LG 
Sbjct  193   IFPLVELIYKKAQQAITYTFVLEFQIVYCFVATLFSTIGMIINNDFQAISGEAKTFELGE  252

Query  772   EKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADK  951
              +YY+++  +AI  Q   +GS+GVI+S+S+L+ GI  S+L+ + +V +VI   E+FSA+K
Sbjct  253   GRYYVVIILSAIIWQFYSLGSIGVIYSASSLVCGILISVLLPLTEVLAVILYRENFSAEK  312

Query  952   LLSLAICIWGFASYFYGDYK--TARKKPPPPPVTGDDEEHQ  1068
              +SLA+ +WGF SYFYGDYK    RK    P +   D+ ++
Sbjct  313   GISLALSLWGFVSYFYGDYKANNKRKNNQSPEIETIDKINR  353



>gb|EPS65699.1| hypothetical protein M569_09078, partial [Genlisea aurea]
Length=327

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/333 (45%), Positives = 220/333 (66%), Gaps = 7/333 (2%)
 Frame = +1

Query  64    IIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaa  243
             +++NC+ LAVG   G +++RLYF+HGG   W SS   T G+P + VP+ ISY R     A
Sbjct  1     LVLNCLLLAVGGCAGPMVMRLYFIHGGSLVWFSSWQETGGWPVIFVPLVISYLRRLTAEA  60

Query  244   anrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFI  423
                  VL+   LF+++A +G+L GVD+Y+Y FG+  LPVS SSL+ +TQLAFTA+F + I
Sbjct  61    NAAP-VLINLRLFLAAAVIGVLTGVDNYIYAFGLEKLPVSTSSLVIATQLAFTALFGFLI  119

Query  424   VKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAG  603
             VK + T YS+NAVVL+T G+ VL +  +GDRP GES  +Y LGFF+T+  AAL+GF++  
Sbjct  120   VKLRFTAYSINAVVLLTVGAAVLAISASGDRPAGESRGAYWLGFFLTLGAAALYGFVLPL  179

Query  604   VEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYY  783
             VE A+  A + +T  L+M+VQ ++  F+  FCTV M  NK+FQ I +E RE+ LG+  YY
Sbjct  180   VELAYRKANLEMTYTLVMEVQLVMCFFATAFCTVGMFFNKEFQKIRREEREYKLGSATYY  239

Query  784   MIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSL  963
             ++V  + +A Q   +G++GVI  SS+L+ GI  ++ + V ++  VIF  E F + K +SL
Sbjct  240   VVVVLSCLAWQGFFLGAIGVIHYSSSLVSGIIIAITIPVNELLGVIFYGEKFGSQKGVSL  299

Query  964   AICIWGFASYFYGDYKTARKKPPPPPVTGDDEE  1062
              + +WGF SYFYG+YK+ +K         D EE
Sbjct  300   GLSLWGFLSYFYGEYKSRKK------ANNDGEE  326



>ref|XP_010322002.1| PREDICTED: LOW QUALITY PROTEIN: purine permease 3-like [Solanum 
lycopersicum]
Length=346

 Score =   294 bits (752),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 152/321 (47%), Positives = 222/321 (69%), Gaps = 1/321 (0%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISY-arn  228
             K ++++INC+ LAVG  GG +++RLYF+ GGKR WLSS L TA +P   +P+ ISY  R 
Sbjct  2     KKVLLVINCIILAVGTCGGPLIMRLYFIKGGKRIWLSSWLQTAAWPINFIPLVISYFYRR  61

Query  229   qakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAV  408
             +     + + +L+TP +FM++  +G+L G  +Y Y +G++ LPVS S LL +TQLAFTA 
Sbjct  62    KNNNNNSSKLILMTPRVFMATIGIGILQGFTNYFYAYGVAKLPVSTSGLLFATQLAFTAF  121

Query  409   FAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHG  588
             FA+ IVK K T YSVN+V L+T G+VVL L   GD+PEGE  + Y LGF MT+A AAL G
Sbjct  122   FAFLIVKLKFTPYSVNSVFLLTIGAVVLALRSGGDQPEGEXKKKYVLGFGMTLASAALTG  181

Query  589   FIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG  768
              I   VE  +  A   +T   +++ Q +    + +  T+ MIIN+DFQAIS+E + F+LG
Sbjct  182   LIFPLVELIYKKAQQTITYTFVLEFQTLYCFVATVLATIGMIINEDFQAISREVKTFELG  241

Query  769   TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
              +KYY+++ ++AI LQ   +GS+GVI+S+S+L+ GI  S+L+ + +V +V    E F+A+
Sbjct  242   EDKYYIVIIWSAIILQFYFLGSIGVIYSASSLVSGILISVLLPITEVLAVFLYGEKFNAE  301

Query  949   KLLSLAICIWGFASYFYGDYK  1011
             K +SLA+ +WGFASYFYGDY+
Sbjct  302   KGVSLALSLWGFASYFYGDYR  322



>ref|XP_007042880.1| Purine permease 3 [Theobroma cacao]
 gb|EOX98711.1| Purine permease 3 [Theobroma cacao]
Length=419

 Score =   296 bits (758),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 145/336 (43%), Positives = 222/336 (66%), Gaps = 4/336 (1%)
 Frame = +1

Query  19    EDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLL  198
             E M K      K  ++++NC  LA+G +GG +++RLYFL GGK  W SSCL TAG+P ++
Sbjct  80    EKMSK----GLKRSLLVLNCALLALGNVGGPLIMRLYFLKGGKGVWTSSCLETAGWPFMV  135

Query  199   VPIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLL  378
             +P+  SY   + K         + P LF+ SA +GLL GVD +LY +G++ LPVS S+L+
Sbjct  136   MPLTFSYLYRRRKEGPATELFFIKPPLFLVSAVVGLLTGVDDFLYAYGVARLPVSTSALI  195

Query  379   SSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFF  558
              STQLAFTA FA+ +VK K T +++N+V L+T G+VVL L  + DRP  ES+R Y LGFF
Sbjct  196   ISTQLAFTAAFAFLLVKQKFTSFTINSVFLLTVGAVVLALQTSSDRPANESNRQYYLGFF  255

Query  559   MTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAI  738
             MT+A + L+GF++  +E  +  A   +T  L+M++Q ++S  + +FCT+ M+ +K+F+AI
Sbjct  256   MTLAASMLYGFVLPAIELTYKKAKQTITYSLVMEMQMVMSFSATVFCTIGMLFHKEFEAI  315

Query  739   SKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSV  918
              +EA +F+LG   YY+++  +AI  Q   MG++GVIFS S+LL GI  + L+ V +  +V
Sbjct  316   PREASKFELGQSTYYLVILLSAILWQFFFMGAVGVIFSGSSLLSGIIIAALLPVTESLAV  375

Query  919   IFLPESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
             +F  E F  +K +S+ + +WG  SYFYG+ +  +K 
Sbjct  376   LFFHEKFQVEKAISVVLSLWGSLSYFYGELQKNKKN  411



>ref|XP_010247465.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=364

 Score =   294 bits (752),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 159/355 (45%), Positives = 236/355 (66%), Gaps = 6/355 (2%)
 Frame = +1

Query  13    NLEDMKKMKFLSFKAL---VIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAG  183
             N++    +   + KA+   ++I+NC  +A+G IGG +L+RLY+LHGG R+WLSS L +AG
Sbjct  12    NVDQTTPLTRKNSKAIKWSLLILNCTIMAIGTIGGPLLMRLYYLHGGNRRWLSSLLQSAG  71

Query  184   FPCLLVPIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVS  363
             FP LL+P+ + Y R++     +     + P L +SSA LGLLLG+D+++Y  G+SY+PVS
Sbjct  72    FPILLIPLSLLYLRHRRHRGVSPSEFFIEPKLLVSSAVLGLLLGLDNFMYALGLSYIPVS  131

Query  364   ISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSY  543
              S++L ++QLAF A FA  IVK + T YS+N+VVLMT GS+ LG+H  GDRP G SD  Y
Sbjct  132   TSAILFASQLAFIAGFARLIVKQRFTPYSINSVVLMTIGSITLGIHSDGDRPAGVSDGEY  191

Query  544   TLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINK  723
               GF +T+  A L GFI+  +E+A+  A   V    +MQ QF + +FS++     M+INK
Sbjct  192   LSGFLLTLGSALLIGFILPSIEFAYSKASRAVDLTAVMQFQFNVGLFSSILSATGMLINK  251

Query  724   DFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQ  903
             DFQ I +EARE++LG   YY ++  +AIA QL  +G LG+IF +++L  GI++++L+   
Sbjct  252   DFQEIPREAREYELGHGMYYFVLSASAIAWQLSFVGLLGLIFCTTSLFTGIYSAVLLPFA  311

Query  904   QVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQ  1068
             +V +VI   E F+ +K ++LA+C+WGF SYFYG+Y   RK      +T DD+  Q
Sbjct  312   EVGAVIAYHEKFTGEKGIALALCLWGFTSYFYGEY---RKSKVETSMTIDDQSPQ  363



>ref|XP_008444876.1| PREDICTED: purine permease 3-like [Cucumis melo]
Length=359

 Score =   293 bits (751),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 145/327 (44%), Positives = 217/327 (66%), Gaps = 3/327 (1%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K +++  N + ++VG  GG +++RLYF+HGG R WLSS L + G+P +L+P+ ISY   +
Sbjct  11    KKVLLAFNSILMSVGNCGGPLILRLYFIHGGNRVWLSSWLFSGGWPIILIPLAISYIHRR  70

Query  232   akaaanrrrVLV---TPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFT  402
               A A  +  L+    P L   SA +G L G+D+YL+ +GM+ LPVS SSL+ ++QLAFT
Sbjct  71    RTATAGSKTKLIFMREPLLLFGSAVIGALTGLDNYLFAYGMARLPVSTSSLIIASQLAFT  130

Query  403   AVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAAL  582
             A FAY +VK K T Y+VN+VVL+T G  +L LH +GDRP GES+  Y  GF MT+  A L
Sbjct  131   AGFAYLLVKQKFTSYTVNSVVLLTMGGAILALHSSGDRPAGESNGEYIAGFLMTLGAAVL  190

Query  583   HGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFD  762
             +G I+  +E  +      +T  L++++Q ++++   + CT+ M+IN DFQAI +E REF 
Sbjct  191   YGLILPLIELMYKKTKQSLTYTLILEIQLVMAISGTVLCTIGMLINNDFQAIPREGREFG  250

Query  763   LGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFS  942
             LG  KYY+++  + +  Q   +G++GVIF SS+L  GI  +LL+   ++ +VIF  E F 
Sbjct  251   LGNTKYYVVLVMSCVIWQCFFIGAVGVIFYSSSLFSGIVIALLLPAVEILAVIFFREKFQ  310

Query  943   ADKLLSLAICIWGFASYFYGDYKTARK  1023
             A+K +SLA+ +WGF SYFYG+YK  +K
Sbjct  311   AEKGVSLALNLWGFVSYFYGEYKQTKK  337



>emb|CDP19267.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   293 bits (750),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 146/319 (46%), Positives = 223/319 (70%), Gaps = 4/319 (1%)
 Frame = +1

Query  58    LVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqak  237
             ++++INC+ LA+G  G  +LIRLYF+ GG+R WL S + TA +P + +P+ ISY   Q  
Sbjct  4     ILLVINCIILAIGNCGTPLLIRLYFVKGGQRIWLPSWIQTAAWPIIFIPLLISYFHRQKT  63

Query  238   aaanrrrVLVT---PWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAV  408
                     L+    P +F+++A +GLL G+D+YLY +G++ LPVS ++++ + QL F A 
Sbjct  64    DPRAEDSKLIIMKYP-VFIATAVIGLLTGLDNYLYAYGIARLPVSTAAIIIAAQLVFVAF  122

Query  409   FAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHG  588
             FA+ +VK K T YSVNAV+L+T GS VLGLH + DRP+GES++ Y LGF MT+A AAL+G
Sbjct  123   FAFLLVKQKFTAYSVNAVILLTVGSGVLGLHTSSDRPKGESNKLYVLGFIMTLAAAALYG  182

Query  589   FIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG  768
              I+  VE  ++ A   +T  L++++Q I+  F+ +FCTV M+INKDFQAI++EAR ++LG
Sbjct  183   LILPMVELMYMKAKQVITYSLVLEIQLIMCFFATVFCTVGMLINKDFQAIAREARAYELG  242

Query  769   TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
               KYY+++  +AI  Q   +G++GVIF +S+L+ GI  ++ + V ++ +VIF  E F A+
Sbjct  243   EMKYYVVLVSSAIVSQCFFLGAIGVIFCASSLVSGIIIAVSLPVTELLAVIFFNEKFQAE  302

Query  949   KLLSLAICIWGFASYFYGD  1005
             K ++L + +WGF SYFYGD
Sbjct  303   KGVALFLSLWGFISYFYGD  321



>ref|XP_009605309.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=352

 Score =   293 bits (750),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 143/325 (44%), Positives = 226/325 (70%), Gaps = 0/325 (0%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             + +++++NC+ LAVG  GG +++RLY++ GG R WLSS L T G+P  L+P+ I Y   +
Sbjct  11    RRILLLVNCLILAVGVCGGPLMMRLYYVGGGSRVWLSSWLQTGGWPLTLIPLAILYFYRR  70

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
                 AN +  L+TP +F+ S  +G+  G+D++LY++G S LPVS SSLL + QL FTAV 
Sbjct  71    KSEGANAKFCLITPQIFIVSFVIGVGTGIDNFLYSWGGSKLPVSTSSLLLAAQLGFTAVG  130

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A+FIVK K T YS+NAV+L+T G+V+LG+   GD+PEG + ++Y LGF MT+  AAL+G 
Sbjct  131   AFFIVKLKFTPYSINAVILLTVGAVLLGIRSNGDKPEGVTSKAYVLGFIMTLLAAALYGV  190

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             I+  +E  ++ A   +T  L++++Q ++   +  FCT+ M+ NKDFQAIS+EA +F+L  
Sbjct  191   ILPSIELIYLKAKQAITVTLVLEIQIVMCFAATAFCTIGMVANKDFQAISREANQFNLEE  250

Query  772   EKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADK  951
              +YY ++ + AI  Q   +G++GVI+ SSAL+ G+  ++L+ V +V +++F  E FS +K
Sbjct  251   ARYYTVIVWTAIIWQCFFVGAVGVIYCSSALMSGVIIAVLLPVTEVLAIVFFSEKFSGEK  310

Query  952   LLSLAICIWGFASYFYGDYKTARKK  1026
              +SL + +WGF SYFYG++K  +K+
Sbjct  311   GVSLFLSLWGFVSYFYGEFKQMKKQ  335



>ref|XP_007141230.1| hypothetical protein PHAVU_008G178300g [Phaseolus vulgaris]
 gb|ESW13224.1| hypothetical protein PHAVU_008G178300g [Phaseolus vulgaris]
Length=344

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 214/313 (68%), Gaps = 0/313 (0%)
 Frame = +1

Query  88    AVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLV  267
             A+G  GG +++RLYF+HGG R WLSS L TA FP +L+P+ IS+    +  +   + V +
Sbjct  14    AMGTSGGPLVMRLYFIHGGNRIWLSSFLETAAFPLILIPLTISHLHRTSHHSPKPKLVSI  73

Query  268   TPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHY  447
                LF++SA +G+L G+D YLY  G++ LPVS SSL+ ++ LAFTAVFA+ +VKH+ T Y
Sbjct  74    KLPLFLASAVIGILTGLDDYLYACGIARLPVSTSSLIQASHLAFTAVFAFLLVKHRFTAY  133

Query  448   SVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHA  627
             SVNA+VL+T  +VVL L   GDRP GES R Y +GF M +A AAL+GF++  +E  +  +
Sbjct  134   SVNAIVLLTVAAVVLALRSGGDRPSGESTRQYVIGFVMILAAAALYGFVLPLMELVYKRS  193

Query  628   GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAI  807
                VT  L+M++QF++  F+ LFCT+ M+IN DF+ I +EA+++ LG  KYY+++  +AI
Sbjct  194   KQRVTYSLVMEIQFVMCFFATLFCTIGMLINNDFKVIWREAKDYKLGETKYYVVLVGSAI  253

Query  808   ALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFA  987
               Q   +G++GVIF SS+L  GI  +  + V +V  VI   E+F A+K ++L + +WGF 
Sbjct  254   MWQFFFLGAIGVIFCSSSLFSGIIIAAFLPVTEVLGVIVYKENFEAEKGVALLLSLWGFV  313

Query  988   SYFYGDYKTARKK  1026
             SYFYG+ K  R+K
Sbjct  314   SYFYGEIKQEREK  326



>ref|XP_009769306.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/328 (44%), Positives = 222/328 (68%), Gaps = 0/328 (0%)
 Frame = +1

Query  88    AVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLV  267
             AVG  GG +++RLY++ GG R W SS L TAG+P  L+P+ I Y   +    +N +   +
Sbjct  23    AVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTLIPLAILYFYRRKTEGSNAKLYFI  82

Query  268   TPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHY  447
             TP +F++S  +G++ GVD +LY++G S LPVS SSLL + QLAFTA+ A+FIVK K T Y
Sbjct  83    TPRIFIASFVIGVVTGVDDFLYSWGGSKLPVSTSSLLLAAQLAFTAIGAFFIVKLKFTPY  142

Query  448   SVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHA  627
             S+NAVVL+T G+V+LG+   GDRPEG + ++Y LGF MT+  AAL+G I+  +E  ++ A
Sbjct  143   SINAVVLLTVGAVLLGVRSNGDRPEGVTSKAYILGFMMTLLAAALYGVILPCIELIYLKA  202

Query  628   GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAI  807
                +T  L++++Q ++   + +FCT+ MI N DFQAISKEA++F+LG  +YY ++ +  I
Sbjct  203   KQAITATLVLEIQMVMCFAATVFCTIGMIANNDFQAISKEAKQFNLGEARYYTVIVWTTI  262

Query  808   ALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFA  987
               Q   +G +GVI+ SS+L+ G+  ++L+ V +V +V+F  E+FS +K L+L + +WGF 
Sbjct  263   IWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRENFSGEKGLALFLSLWGFV  322

Query  988   SYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
             SYFYG+++  +K+    P T     H E
Sbjct  323   SYFYGEFRQTKKQKNKSPKTEMTMMHTE  350



>ref|NP_001131978.1| uncharacterized protein LOC100193377 [Zea mays]
 gb|ACF80629.1| unknown [Zea mays]
 gb|ACG41442.1| ATPUP3 [Zea mays]
 tpg|DAA40288.1| TPA: ATPUP3 [Zea mays]
Length=361

 Score =   291 bits (746),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 153/355 (43%), Positives = 232/355 (65%), Gaps = 4/355 (1%)
 Frame = +1

Query  19    EDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLL  198
             +D    +  + +  ++ +NC  LA+G IGG +L RLYF  GG R+WLS+ L T G+P LL
Sbjct  7     KDAAPARGKAVRRFLVALNCGMLALGAIGGPLLSRLYFSKGGHRQWLSAWLETGGWPLLL  66

Query  199   VPIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLL  378
             VP+  S+   +A+       +L  P + +++A LG+  GVD ++Y +G++YLPVS S++L
Sbjct  67    VPVAASFGARRARDRGAPV-LLTPPRILLAAAGLGVATGVDDFVYAYGLAYLPVSTSAIL  125

Query  379   SSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFF  558
              STQLAFT  FA+ +V+ +LT  SVNAV L+T G+VVLGLH++ DRP G +   Y LGF 
Sbjct  126   ISTQLAFTVFFAFLVVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGVTRGRYWLGFS  185

Query  559   MTIAGAALHGFIMAGVEYAHVHA---GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDF  729
             +T+  AAL+G ++  VE A+  A   G  VT  L++++Q ++  F+  FCTV M++NKDF
Sbjct  186   LTLCAAALYGLVLPLVELAYRRAAGGGRAVTYALVVEMQLVMGFFATAFCTVGMVVNKDF  245

Query  730   QAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQV  909
             QAI +EAR+++LG  +YYM++ +AA+  Q   +G++GVIF    LL GI  ++ + V +V
Sbjct  246   QAIPREARQYELGEARYYMVLAWAAVLWQCFFLGAVGVIFCVHTLLAGILIAVFIPVTEV  305

Query  910   FSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQEV  1074
              +VIFL E FS++K ++LA+ +WG ASY YG++  A+ K        D E  Q V
Sbjct  306   AAVIFLHEKFSSEKGVALALSLWGLASYSYGEWSQAKAKKEKKSEEDDGEVAQAV  360



>ref|XP_007018133.1| Purine permease 3, putative [Theobroma cacao]
 gb|EOY15358.1| Purine permease 3, putative [Theobroma cacao]
Length=410

 Score =   293 bits (750),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 144/319 (45%), Positives = 223/319 (70%), Gaps = 1/319 (0%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             +  +++IN + LA+G+ GG +L+R YF+HGGKR W SS L T G+P +L PI  +Y   +
Sbjct  2     RKALLVINGIVLAIGKCGGPLLMRAYFIHGGKRFWFSSWLTTGGWPIILFPIACAYMYRR  61

Query  232   akaaanrrrV-LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAV  408
                  ++ ++ L+ P LF++SA +G+L GVD YLY++G++ LPVS  S++ ++QLAFTA 
Sbjct  62    RTEPTSKNKLFLMRPPLFVASAVIGILTGVDDYLYSYGVALLPVSTCSIVIASQLAFTAA  121

Query  409   FAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHG  588
             FA+ +VK K T YSVNAV L+T G+ VL L  + DRP+ ES+R Y LGF MT+A AAL+G
Sbjct  122   FAFILVKQKFTSYSVNAVFLLTVGAGVLALRASSDRPDTESNRKYALGFIMTLAAAALYG  181

Query  589   FIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG  768
             F++  VE  +      ++  L+M+++ +  +F+  FCTV M++N DF+ I +EAREFDLG
Sbjct  182   FVLPLVELMYKKTKQEMSYALVMEIEMVNCLFATGFCTVGMLVNNDFKVIPREAREFDLG  241

Query  769   TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
               KYY++  ++AI  Q   +G+ GVIF +S+L+ GI  ++++ V ++ +VIF  E+F A+
Sbjct  242   ETKYYVVAIWSAIMWQFFFLGATGVIFCASSLVSGIIIAVVLPVIEILAVIFYKENFQAE  301

Query  949   KLLSLAICIWGFASYFYGD  1005
             K ++LA+ +WGF SYFYG+
Sbjct  302   KGVALALSVWGFISYFYGN  320


 Score = 80.9 bits (198),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 59/91 (65%), Gaps = 1/91 (1%)
 Frame = +1

Query  94   GQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrV-LVT  270
            G  GG  L+R YF+HGGKR W SS L T G+P +L PI  +Y         ++ ++ L+ 
Sbjct  319  GNCGGPFLMRAYFIHGGKRFWFSSWLTTGGWPIILFPIACAYMYRCRTEPTSKNKLFLMK  378

Query  271  PWLFMSSAFLGLLLGVDSYLYTFGMSYLPVS  363
            P LF++SA +G+L GVD YLY +G++ LPVS
Sbjct  379  PPLFIASAVIGILTGVDDYLYAYGVALLPVS  409



>ref|XP_010060063.1| PREDICTED: purine permease 3-like isoform X1 [Eucalyptus grandis]
 ref|XP_010060064.1| PREDICTED: purine permease 3-like isoform X2 [Eucalyptus grandis]
 ref|XP_010060065.1| PREDICTED: purine permease 3-like isoform X1 [Eucalyptus grandis]
 gb|KCW66595.1| hypothetical protein EUGRSUZ_F00389 [Eucalyptus grandis]
Length=360

 Score =   291 bits (744),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 146/331 (44%), Positives = 222/331 (67%), Gaps = 0/331 (0%)
 Frame = +1

Query  19    EDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLL  198
             E  +  +  + K +++ INC  LA+G  GG +++RLYFLHGGKR WLSS L T G+P + 
Sbjct  3     ETAEAPQGKTLKLVLLAINCAMLALGTCGGPLIMRLYFLHGGKRVWLSSWLETGGWPIIF  62

Query  199   VPIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLL  378
             +P+ ++Y R +A    + R +L+ P+LF ++A +G+L G+D YLY +G++ LPVS S+LL
Sbjct  63    IPLAVAYFRRRAAEGPSARLILMDPFLFAAAAVIGVLTGLDDYLYAYGVARLPVSTSALL  122

Query  379   SSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFF  558
              +TQLAFTA FA+ +V+   T YSVN+V L+T G+ VL +H + DRP GES   Y  GFF
Sbjct  123   IATQLAFTAGFAFLLVRQLFTSYSVNSVFLLTMGAGVLAMHTSSDRPAGESKGEYYAGFF  182

Query  559   MTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAI  738
             MT+  AAL+GF++  VE  +  A   VT  L+++ Q ++  F+  F TV M++NKDFQAI
Sbjct  183   MTLGAAALYGFVLPLVELTYKKAKQTVTYSLVLEFQLVMCFFATAFNTVGMLVNKDFQAI  242

Query  739   SKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSV  918
              +EAR F LG  +YY+++ ++ I  Q   +G++GVI  +S+L  GI  ++L+ + ++  V
Sbjct  243   PEEARNFTLGETRYYVVLVWSGIIWQFFFLGAIGVIHYASSLFSGIMIAVLLPITEILGV  302

Query  919   IFLPESFSADKLLSLAICIWGFASYFYGDYK  1011
             I   E F  +K +SL + +WGF SYFYG++K
Sbjct  303   ICFHEKFQVEKAVSLVLSLWGFVSYFYGEFK  333



>emb|CDY35722.1| BnaC03g58430D [Brassica napus]
Length=354

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 154/339 (45%), Positives = 224/339 (66%), Gaps = 10/339 (3%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISY----  219
             K  +IIINCV L +G  GG +L RLY+ +GGKR W  S L TAGFP +L+P+F S+    
Sbjct  2     KNGLIIINCVILTIGTCGGPLLTRLYYTNGGKRIWFMSFLSTAGFPVILIPLFFSFLSRR  61

Query  220   --arnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQL  393
                RN ++ A   + +L+   LF++S  +GLL G+D+YLY +G++YLPVS SSL+  TQL
Sbjct  62    NHNRNNSETAEKTKLILMETPLFIASIVIGLLTGLDNYLYAYGLAYLPVSTSSLIIGTQL  121

Query  394   AFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAG  573
             AF A+FA+F+VK K T +S+NAVVL+T G VVL LH  GD+P  E+ + Y +GF MT+  
Sbjct  122   AFNALFAFFMVKQKFTPFSINAVVLLTVGIVVLALHSNGDKPANETHKEYVVGFLMTVIA  181

Query  574   AALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAR  753
             A L+ FI+  VE+ +  A   +T  L++++Q ++ + +  FC V MII+ DF+ IS+EAR
Sbjct  182   AVLYAFILPLVEFTYKKARQEITFPLVLEIQMVMCIAATCFCVVGMIIDGDFKVISREAR  241

Query  754   EFDLGTEK-YYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLP  930
             EF +G    YY ++    I  Q   +G++GV+F +S+L  G+  S+L+ V +V +VI   
Sbjct  242   EFKIGGSAFYYTLIVITGIVWQGFFLGAIGVVFCASSLASGVLISVLLPVTEVLAVICFR  301

Query  931   ESFSADKLLSLAICIWGFASYFYGDYKTARK---KPPPP  1038
             E F A+K +SL + IWGF SYFYG+YK+ +K   K  PP
Sbjct  302   EKFQAEKGVSLFLSIWGFVSYFYGEYKSGKKVLEKHQPP  340



>ref|XP_004490401.1| PREDICTED: purine permease 1-like [Cicer arietinum]
Length=361

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 153/332 (46%), Positives = 228/332 (69%), Gaps = 3/332 (1%)
 Frame = +1

Query  37    KFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFIS  216
             K  + K L+++IN + LA+G  GG +++RLYF+HGGKR WLSS L T+GFP +L+P+ IS
Sbjct  14    KRRNMKKLLLVINSILLAIGTCGGPLVMRLYFIHGGKRAWLSSFLETSGFPIILLPLTIS  73

Query  217   Yarnq---akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSST  387
             +  ++       +NR  + + P LF+ SA +G+L G+D YLY  G++ LPVS SSL+ S+
Sbjct  74    HIHHRYHNRNCNSNRNFISMKPPLFLFSAIIGILTGLDDYLYACGIARLPVSTSSLIQSS  133

Query  388   QLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTI  567
              LAFTAVFA+ +V+HK T YSVN +VL+T GSVVL +   G   +GES   Y +GF M +
Sbjct  134   HLAFTAVFAFILVRHKFTAYSVNCIVLLTLGSVVLAVRSNGGGGDGESRGEYVIGFVMIL  193

Query  568   AGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKE  747
             + AAL+GF++  +E  +      VT  L+M++QF++  F+ LFC + MII+KDF+ I +E
Sbjct  194   SSAALYGFVLPLMELVYKKTKQVVTYSLVMEIQFVMCFFATLFCILGMIIDKDFKVIPRE  253

Query  748   AREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFL  927
             AREF+LG  KYY+++  +AI  Q   +G++GVIF +S+LL GI  +  + V ++ +VI  
Sbjct  254   AREFNLGETKYYVVLVCSAIMWQFFFLGAIGVIFYASSLLSGIIIAAFLPVTEIMAVIVY  313

Query  928   PESFSADKLLSLAICIWGFASYFYGDYKTARK  1023
              E+F A+K ++L + +WGF SYFYG+ K ARK
Sbjct  314   KENFHAEKGVALVLSLWGFVSYFYGEIKEARK  345



>ref|XP_010060067.1| PREDICTED: purine permease 1-like [Eucalyptus grandis]
Length=360

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/355 (41%), Positives = 231/355 (65%), Gaps = 4/355 (1%)
 Frame = +1

Query  19    EDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLL  198
             E +   +    K L +++NC+ L+VG  G  +++RLYF+ GG R WL S L    +P LL
Sbjct  3     ETVADPRRKGLKRLFLVLNCIMLSVGTCGSPLIMRLYFVRGGARMWLVSWLEMGAWPMLL  62

Query  199   VPIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLL  378
             VP+  +Y+R ++      R VL+  +LF ++A +G+LLG+D+Y Y +G+  LPVS S+LL
Sbjct  63    VPLGAAYSRRRSAEGPTARLVLMDRFLFAAAAGIGVLLGLDNYFYAYGVGRLPVSTSALL  122

Query  379   SSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFF  558
              +TQLAFTA FA+ +V+ + T  S+N++ L+T G+ VL +H + DRP GES  +Y  GFF
Sbjct  123   IATQLAFTAGFAFLLVRQRFTSCSINSIFLLTIGAGVLSMHTSSDRPAGESKGAYFTGFF  182

Query  559   MTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAI  738
             MT+  AAL+G ++  VE  +  A   VT  L++++Q ++  F+  FCTVAM++NKDFQAI
Sbjct  183   MTLGAAALYGLVLPLVELMYKKAKQAVTYSLVLEIQLVMCFFATAFCTVAMLVNKDFQAI  242

Query  739   SKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSV  918
              +EAR ++LG  +YY+++ + AI  Q   +G++GVIF +S+L   +  + L+   ++ +V
Sbjct  243   PREARNYELGEARYYVVLVWTAIINQFFFLGAIGVIFYASSLFSAVIIATLLPFTEILAV  302

Query  919   IFLPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVT----GDDEEHQE  1071
             I   E F A+K ++LA+ +WGFASYFYG++K A+K+      T     + E HQ+
Sbjct  303   ICFQEKFQAEKGVALALSLWGFASYFYGEFKLAKKEKEATAGTVIKPAETEMHQQ  357



>gb|AES73112.2| purine permease-like protein [Medicago truncatula]
Length=370

 Score =   290 bits (741),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 147/350 (42%), Positives = 225/350 (64%), Gaps = 13/350 (4%)
 Frame = +1

Query  16    LEDMKK-MKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPC  192
             +ED KK +     K  ++++NC+ L++G     +++RLYF+HGG+R WLS+ L TAGFP 
Sbjct  1     MEDGKKQVAEKKMKRFLLVVNCLILSLGTCSAPLIMRLYFIHGGQRVWLSAFLQTAGFPL  60

Query  193   LLVPIFISYa------------rnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYT  336
             +L+P+ ISY                + A      + + P +F ++AF+G+L G+D YL+ 
Sbjct  61    MLIPLAISYIKRHRLHHHPPPLTTISIAPEKLNIISMKPPIFFAAAFIGILTGLDDYLFA  120

Query  337   FGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDR  516
             +G++ LPVS S+L+ ++QL FTA FA+ IVK K T ++VNAVVL+T G+ VL +H + DR
Sbjct  121   YGVARLPVSTSALIIASQLGFTAFFAFLIVKEKFTAFTVNAVVLLTVGAGVLAMHTSSDR  180

Query  517   PEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALF  696
             P G S + Y + F  T+A +AL+GFI+  VE  +     PVT   +M+ QF+  MF+ LF
Sbjct  181   PAGVSAKQYWISFSTTVAASALYGFILPSVELVYKKIKQPVTYSFVMEFQFVTCMFATLF  240

Query  697   CTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGI  876
             C + MI N DF+ I KEAR F LG   YY+++  +AI  Q   +G++GVIF +S+LL GI
Sbjct  241   CAIGMIANNDFKVIPKEARNFGLGESTYYVVLVVSAIMWQAFFLGAIGVIFCASSLLSGI  300

Query  877   FTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
               ++L+ + +V +V+F  E F A+K +SL + +WGF SYFYG+ K A+ +
Sbjct  301   LIAVLLPLTEVLAVVFYKEKFQAEKGVSLVLSLWGFVSYFYGEIKHAKAE  350



>ref|XP_009766753.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
Length=358

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 155/339 (46%), Positives = 221/339 (65%), Gaps = 7/339 (2%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISY----  219
             K ++++INC+ LAVG  G  +L+RLYF+ GG R WLS+ L T  +P   +P+ ISY    
Sbjct  10    KKVLLVINCIILAVGTCGTPLLMRLYFIKGGNRIWLSTWLQTVAWPINFIPLAISYFYRR  69

Query  220   ---arnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQ  390
                  N      N + +L+TP +F+++  +G+L G  +Y Y +G + LPVS S LL +TQ
Sbjct  70    KININNDINNNNNMKVILMTPRIFVATIGIGVLQGFANYFYAYGTAKLPVSTSGLLFATQ  129

Query  391   LAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIA  570
             LAFTA FA+ IVK K T YSVNAV L+T G+V+L LH  GD+PEGE  + Y LGF MT+A
Sbjct  130   LAFTAGFAFLIVKLKFTSYSVNAVFLLTVGAVLLALHSGGDQPEGEPKKEYILGFIMTLA  189

Query  571   GAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEA  750
              AAL G I   VE  +  A   +T  L+++ Q +    + +  T+ MIINKDFQAIS EA
Sbjct  190   AAALSGLIFPLVELIYKKAHQAITYTLVLEFQTVYCFVATIVATIGMIINKDFQAISTEA  249

Query  751   REFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLP  930
             + F+LG  +YY ++ ++AI LQ   +G++GVI+S+S+L+ GI  S+L+ + +V +V    
Sbjct  250   KAFELGEGRYYNLIIWSAIILQFYFLGTIGVIYSASSLVSGILISVLLPITEVLAVFIYG  309

Query  931   ESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVT  1047
             E FSA+K +SLA+ +WGF SYFYGD K ++KK    P T
Sbjct  310   EKFSAEKGVSLALSLWGFLSYFYGDIKESKKKEEQSPET  348



>ref|XP_009783837.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
Length=353

 Score =   289 bits (739),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 145/334 (43%), Positives = 222/334 (66%), Gaps = 7/334 (2%)
 Frame = +1

Query  88    AVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLV  267
             AVG  GG +++RLY++ GG R WLSS L T G+P  +VP+ I Y   +     + +   +
Sbjct  23    AVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTIVPLAILYLYRRKIEGPDAKFYFI  82

Query  268   TPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHY  447
             TP +F++S  +G+  GVD +LY++G S LPVS SSLL + QLAFTA+ A+FIVK KLT Y
Sbjct  83    TPRIFVASFIIGIATGVDDFLYSWGGSKLPVSTSSLLLAAQLAFTAIGAFFIVKLKLTPY  142

Query  448   SVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHA  627
             S NAVVL+T G+V+LG+   GDRPEG + ++Y LGF MT+  AAL+G I+  +E  ++ A
Sbjct  143   STNAVVLLTVGAVLLGIRANGDRPEGVTSKAYILGFIMTLLAAALYGIILPCIELMYLKA  202

Query  628   GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAI  807
                +T  L++++Q ++   +  FCTV MI NKDFQA+S+EA++F+LG  +YY ++ + AI
Sbjct  203   KQSITATLVLEIQMVMCFAATAFCTVGMIANKDFQAMSREAKQFNLGEARYYTVIVWTAI  262

Query  808   ALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFA  987
               Q   +G +GVI+ SS+L+ G+  ++L+ V +V +V+F  E FS +K L+L + +WGF 
Sbjct  263   IWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFNEKFSGEKGLALFLSLWGFV  322

Query  988   SYFYGDYKTARKKPPPPPVTGDDEEHQEV*STYH  1089
             SYFYG+++  +K+        +     E+ +T H
Sbjct  323   SYFYGEFRQTKKQK-------NKSSETEIMATTH  349



>ref|XP_009776518.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   289 bits (739),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 142/318 (45%), Positives = 219/318 (69%), Gaps = 0/318 (0%)
 Frame = +1

Query  88    AVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLV  267
             AVG  GG +++RLY++ GG R W SS L TAG+P  L+P+ I Y   +    +N +   +
Sbjct  23    AVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTLIPLAILYFYRRKTEDSNAKLYFI  82

Query  268   TPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHY  447
             TP +F++S  +G++ GVD +LY++G S LPVS SSLL + QLAFTA+ A+FIVK K T Y
Sbjct  83    TPRIFIASFVIGVVTGVDDFLYSWGGSKLPVSTSSLLLAAQLAFTAIGAFFIVKLKFTPY  142

Query  448   SVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHA  627
             S+NAVVL+T G+V+LG+   GDRPEG + +SY LGF MT+  AAL+G I+  +E  ++ A
Sbjct  143   SINAVVLLTVGAVLLGVRSNGDRPEGVTSKSYILGFMMTLLAAALYGVILPCIELIYLKA  202

Query  628   GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAI  807
                +T  L++++Q ++   + +FCT+ MI N DFQAIS+EA++F+LG  +YY ++ +  I
Sbjct  203   KQAITATLVLEIQMVMCFAATVFCTIGMIANNDFQAISREAKQFNLGEARYYTVIVWTTI  262

Query  808   ALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFA  987
               Q   +G +GVI+ SS+L+ G+  ++L+ V +V +V+F  E+FS +K L+L + +WGF 
Sbjct  263   IWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRENFSGEKGLALFLSLWGFV  322

Query  988   SYFYGDYKTARKKPPPPP  1041
             SYFYG+++  +K+    P
Sbjct  323   SYFYGEFRQTKKQKNKSP  340



>ref|XP_008446590.1| PREDICTED: purine permease 3-like [Cucumis melo]
Length=366

 Score =   289 bits (739),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 147/346 (42%), Positives = 219/346 (63%), Gaps = 11/346 (3%)
 Frame = +1

Query  22    DMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLV  201
             D ++    + +  +++ NC  LAVG  GG +++RLYFLHGG R WLSS L T G P + +
Sbjct  2     DQQQQNTTAMRRPLLVFNCFLLAVGTCGGPLIMRLYFLHGGNRVWLSSFLQTGGCPIIFI  61

Query  202   PIFISYarnqakaaan-----------rrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMS  348
             P+ ISY   + +  A               + + P LF++S+ +G++ G   +LY +G++
Sbjct  62    PLLISYIHRRRRPRAQYSLNPSEPTNSTEMIFMKPRLFLASSVIGIITGFVDFLYAYGVA  121

Query  349   YLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGE  528
              LPVS S+L+ + QLAFTA FA+++VK K T YS+NAVVL+T G  +L LH +GDR  GE
Sbjct  122   QLPVSTSALIRACQLAFTAGFAFWLVKQKFTPYSINAVVLVTAGGAILALHTSGDRRAGE  181

Query  529   SDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVA  708
             ++R Y  GF  T+A A ++GFI+  VE ++  A   +T  L+++VQF +S+F+ L CT+A
Sbjct  182   ANRDYIAGFLTTVAAAVVYGFILPLVELSYKRARQQITYTLVLEVQFFMSLFATLVCTIA  241

Query  709   MIINKDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSL  888
             M+IN DFQ I  EA  F LG  KYY+I+  +AI  Q   +G +GVIF SS+    I  ++
Sbjct  242   MVINNDFQVIPTEAEAFGLGKAKYYVILVLSAIIWQSFFLGVVGVIFCSSSFFSEIVIAV  301

Query  889   LVAVQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
             L+ V ++ +VI   E F A+K +SL + +WGF SYFYG+ K  +KK
Sbjct  302   LLPVTEILAVIIFNEKFQAEKTISLILNLWGFVSYFYGEIKHNKKK  347



>ref|XP_009609429.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=359

 Score =   289 bits (739),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 154/340 (45%), Positives = 221/340 (65%), Gaps = 8/340 (2%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISY----  219
             K ++++INC+ LAVG  G  +L+RLYF+ GG R WLS+ L T  +P   +P+ ISY    
Sbjct  10    KKVLLVINCIILAVGTCGTPLLLRLYFIKGGNRIWLSTWLQTVAWPINFIPLAISYFYRR  69

Query  220   ----arnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSST  387
                   +      N + +L+TP +F ++  +G+L G  +Y Y++G + +PVS S LL +T
Sbjct  70    KININNDINNNNDNIKVILMTPRIFAATIGIGVLQGFANYFYSYGSAKVPVSTSGLLFAT  129

Query  388   QLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTI  567
             QLAFTA FA+ IVK K T YSVNAV L+T G+V+L LH  GD+PEGE  + Y LGF M +
Sbjct  130   QLAFTAGFAFLIVKLKFTSYSVNAVFLLTVGAVLLALHSGGDQPEGEPKKEYILGFIMIL  189

Query  568   AGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKE  747
             A AAL G I   VE  +  A   +T  L+++ Q +    + +  T+ MIINKDFQAIS E
Sbjct  190   AAAALTGLIFPLVELIYKKAHQAITYTLVLEFQTVYCFVATIVATIGMIINKDFQAISTE  249

Query  748   AREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFL  927
             A+EF+LG  +YY ++ + AI LQ   +G++GVI+S+S+L+ GI  S+L+ + +V +V F 
Sbjct  250   AKEFELGEGRYYNLIIWGAIILQFYFLGTIGVIYSASSLVSGILISVLLPITEVLAVFFY  309

Query  928   PESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVT  1047
              E FSA+K +SLA+ +WGF SYFYGD K ++KK    P T
Sbjct  310   GEKFSAEKGVSLALSLWGFLSYFYGDMKKSKKKENQSPET  349



>ref|XP_011072345.1| PREDICTED: LOW QUALITY PROTEIN: purine permease 3-like [Sesamum 
indicum]
Length=341

 Score =   288 bits (737),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 153/327 (47%), Positives = 220/327 (67%), Gaps = 19/327 (6%)
 Frame = +1

Query  25    MKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVP  204
             M+  K  + K + +IINC+ LA+G  GG +++RLYF+HGGKR W SS L T G+P +L+P
Sbjct  1     MEVEKPTAEKRIFLIINCIILAIGNCGGPLIMRLYFIHGGKRIWFSSWLETGGWPVILIP  60

Query  205   IFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSS  384
             + +SY R +      +  +L+ P LF+++A +G+L G D YLY +G++ LPVS SSL+ +
Sbjct  61    LIVSYTRRRRPNPGAKL-ILMKPRLFVAAAVIGILTGFDDYLYAYGVAKLPVSTSSLIIA  119

Query  385   TQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMT  564
             +QLAFTAVFAYF+VK K T YS+NAVVL+T G+ V                   +GFF T
Sbjct  120   SQLAFTAVFAYFLVKQKFTAYSINAVVLLTVGAAV------------------XVGFFRT  161

Query  565   IAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISK  744
              A AAL+G I+  VEY +  A  PVT  L+M++Q ++  F+ + CTV MIINKDFQAI +
Sbjct  162   GAAAALYGLILPVVEYTYKKAKQPVTYTLVMEIQLVMCFFATVVCTVGMIINKDFQAIGR  221

Query  745   EAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIF  924
             EA+ F LG  +YY++VG++AI  Q   +G++GVIF +S+LL GI  S+L+   +V +VIF
Sbjct  222   EAKGFGLGEARYYIVVGWSAIIWQCFFLGAIGVIFYASSLLSGILISVLLPATEVLAVIF  281

Query  925   LPESFSADKLLSLAICIWGFASYFYGD  1005
               E F A+K +SL + +WGF SYF+G+
Sbjct  282   YHEKFQAEKGVSLFLSLWGFISYFFGE  308



>ref|XP_002893512.1| ATPUP3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69771.1| ATPUP3 [Arabidopsis lyrata subsp. lyrata]
Length=348

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/325 (43%), Positives = 221/325 (68%), Gaps = 2/325 (1%)
 Frame = +1

Query  58    LVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqak  237
             +++IINC+ LA+G  GG +++RLYF +GGKR W S+ L TAGFP + +P+  SY   +  
Sbjct  4     VLVIINCIILAIGNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYIARRRS  63

Query  238   aaa--nrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
                  +    L+ P L + + F+G+L G D+YLY +G++YLPVS ++L+ ++QLAF A+F
Sbjct  64    NNVGDDTSFFLIKPRLLIVAVFIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAIF  123

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             ++F+VKHK T +++NAVVL+T G+ VLG+H   D+P  E+ + Y +GF MT+A A ++ F
Sbjct  124   SFFMVKHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYIIGFLMTVAAAVMYAF  183

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             I+  VE A+  A  P++  L+++ Q I+   +++   + M I  DF+A+ KEAREF LG 
Sbjct  184   ILPLVELAYQKARQPMSYTLVLEFQLILCFLASIVSVIGMFIAGDFKALPKEAREFKLGE  243

Query  772   EKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADK  951
               +Y++  F+AI  Q   +G++G+IF +S+L+ GI  S+L+ + +V +VIF  E F A+K
Sbjct  244   ALFYVVAVFSAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKFQAEK  303

Query  952   LLSLAICIWGFASYFYGDYKTARKK  1026
              LSLA+ +WGF SYFYG+ K+ + K
Sbjct  304   GLSLALSLWGFVSYFYGEIKSGKDK  328



>ref|XP_009109745.1| PREDICTED: purine permease 1 [Brassica rapa]
 emb|CDX90136.1| BnaA08g18480D [Brassica napus]
Length=352

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 152/348 (44%), Positives = 224/348 (64%), Gaps = 13/348 (4%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K  +III+CV L +G  GG +L RLY+ +GGKR W  S L TAGFP +LVP+F S+   +
Sbjct  2     KNGLIIISCVILTIGTCGGPLLTRLYYTNGGKRIWFMSFLSTAGFPVILVPLFFSFLSRR  61

Query  232   akaaanrrr----VLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAF  399
              +  +        +L+   LF++S  +GLL G+D+YLY +G++YLPVS SSL+  TQLAF
Sbjct  62    NRNNSETAEKPKLILMETPLFIASIVIGLLTGLDNYLYAYGLAYLPVSTSSLIIGTQLAF  121

Query  400   TAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAA  579
              A+FA+F+VK K T +S+NAVVL+T G VVL LH +GD+P  E+ + Y +GF MT+  A 
Sbjct  122   NALFAFFMVKQKFTPFSINAVVLLTVGIVVLALHSSGDKPANETHKEYVVGFLMTVIAAV  181

Query  580   LHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREF  759
             L+ FI+  VE  +  A   +T  L++++Q ++ + +  FC V MII+ DF+ IS+EAREF
Sbjct  182   LYAFILPLVELTYKKARQEITFPLVLEIQMVMCLAATCFCVVGMIIDGDFKVISREAREF  241

Query  760   DLGTEK-YYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPES  936
              +G    YY ++    I  Q   +G++GV+F +S+L   +  S+L+ V +V +VI   E 
Sbjct  242   KIGGSAFYYTLIMITGIVWQGFFLGAIGVVFCASSLASAVLISVLLPVTEVLAVICFREK  301

Query  937   FSADKLLSLAICIWGFASYFYGDYKTARK-----KPPP---PPVTGDD  1056
             F A+K +SL + IWGF SYFYG+YK+ +K     +PP    PP+   D
Sbjct  302   FQAEKGVSLFLSIWGFVSYFYGEYKSGKKVLEKHQPPETELPPLQVSD  349



>ref|XP_004957086.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=356

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/337 (44%), Positives = 223/337 (66%), Gaps = 4/337 (1%)
 Frame = +1

Query  19    EDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLL  198
             +D    +  + + L++ +NC  LA+G IGG +L RLYF  GG R+WLS+ L TAG+P LL
Sbjct  7     KDAAPARGKAMRRLLVALNCGMLALGAIGGPLLSRLYFSKGGHRQWLSAWLETAGWPLLL  66

Query  199   VPIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLL  378
             VP+  +    +         +L  P + +++  LG+  GVD ++Y +G+SYLPVS S++L
Sbjct  67    VPVVAA-YVARRARDRAAPALLTPPRILLAAVGLGVATGVDDFIYAYGLSYLPVSTSAIL  125

Query  379   SSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFF  558
              STQLAFT +FA+ IV+ +LT  SVNAV L+T G+VVLGLH++ DRP G +   Y LGF 
Sbjct  126   ISTQLAFTVLFAFLIVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGVTRGQYWLGFI  185

Query  559   MTIAGAALHGFIMAGVEYAHVHA---GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDF  729
             +T+  AAL+G ++  VE A+  A   G  VT  L++++Q ++  F+  FCTV MI+NKDF
Sbjct  186   LTLGAAALYGLVLPLVELAYRRAAGGGRAVTYALVIEMQLVMGFFATAFCTVGMIVNKDF  245

Query  730   QAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQV  909
             QAI +EA+ F+LG  +YY ++ ++A+  Q   +G++GVIF    LL GI  ++ + V +V
Sbjct  246   QAIPREAKHFELGEARYYTVLVWSAVLWQCFFLGAVGVIFCVHTLLAGILIAVFIPVTEV  305

Query  910   FSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTAR  1020
              +VIFL E FS++K ++L + +WG ASY YG++  +R
Sbjct  306   AAVIFLHEKFSSEKGVALVLSLWGLASYSYGEWSDSR  342



>ref|XP_009621473.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=353

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/334 (43%), Positives = 221/334 (66%), Gaps = 7/334 (2%)
 Frame = +1

Query  88    AVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLV  267
             AVG  GG +++RLY++ GG R WLSS L T G+P  LVP+ + Y   +     + +   +
Sbjct  23    AVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTLVPLALLYLYRRKIKGPDAKFYFI  82

Query  268   TPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHY  447
             TP +F++S  +G+  GVD +LY++G S LPVS SSLL + QLAFTA+ A+FIVK K T Y
Sbjct  83    TPRIFIASFIIGIATGVDDFLYSWGGSKLPVSTSSLLLAAQLAFTAIGAFFIVKLKFTPY  142

Query  448   SVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHA  627
             S NAVVL+T G+++LG+   GDRPEG + ++Y LGF MT+  AAL+G I+  +E  ++ A
Sbjct  143   STNAVVLLTVGAILLGIRANGDRPEGVTSKAYILGFIMTLLAAALYGVILPCIELMYLKA  202

Query  628   GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAI  807
                +T  L++++Q ++   +  FCTV MI NKDFQA+S+EA++F+LG  +YY ++ + AI
Sbjct  203   KQAITATLVLEIQMVMCFAATAFCTVGMIANKDFQAMSREAKQFNLGEARYYTVIVWTAI  262

Query  808   ALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFA  987
               Q   +G +GVI+ SS+L+ G+  ++L+ V +V +VIF  E FS +K L+L + +WGF 
Sbjct  263   IWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVIFFNEKFSGEKGLALFLSLWGFV  322

Query  988   SYFYGDYKTARKKPPPPPVTGDDEEHQEV*STYH  1089
             SYFYG+++  +K+        +     E+ +T H
Sbjct  323   SYFYGEFRQTKKQK-------NKSSQTEIMATTH  349



>ref|XP_003522775.1| PREDICTED: purine permease 1-like [Glycine max]
Length=357

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 155/338 (46%), Positives = 227/338 (67%), Gaps = 3/338 (1%)
 Frame = +1

Query  19    EDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLL  198
             E   + K  + K L++I NC+ L +G  GG +++RLYFLHGG R WLSS L TAGFP +L
Sbjct  3     EGRNEDKDRTMKRLLLITNCLLLTIGTSGGPLVMRLYFLHGGHRVWLSSFLETAGFPLML  62

Query  199   VPIFISY---arnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSIS  369
             +P+ +SY    R  A   +  + + + P L  +SAF+G+L G+D YLY +G++ LPVS S
Sbjct  63    LPLAVSYFRRRRTAAAGTSKPKLISMKPPLLAASAFIGILTGLDDYLYAYGVARLPVSTS  122

Query  370   SLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTL  549
             +L+ +TQL FTA FA+ +V+ K T YSVNAVVL+T G+ VL LH +GDRP GES + Y +
Sbjct  123   ALIIATQLGFTAFFAFLLVRQKFTAYSVNAVVLLTVGAGVLALHTSGDRPPGESVKEYVM  182

Query  550   GFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDF  729
             GF MT+  AAL+GFI+  VE  +     P+T  L+M++QF++   + LFC + MIIN DF
Sbjct  183   GFVMTVIAAALYGFILPLVELVYKKIKQPLTYSLVMEIQFVMCFSATLFCLLGMIINNDF  242

Query  730   QAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQV  909
             + I +EA++F+ G   YY ++  +AI  Q   +G++GVIF +S+L  GI  ++L+ V +V
Sbjct  243   KVIPREAKKFEHGEGSYYAVLVGSAILWQAFFLGAIGVIFCASSLFSGILIAVLLPVTEV  302

Query  910   FSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARK  1023
              +VIF  E F A+K +SL + +WG  SYFYG+ K ++K
Sbjct  303   LAVIFYKEKFQAEKGVSLLLSLWGMVSYFYGEIKHSKK  340



>ref|XP_009598031.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=353

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/318 (45%), Positives = 220/318 (69%), Gaps = 0/318 (0%)
 Frame = +1

Query  88    AVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLV  267
             AVG  GG +++RLY++ GG R WLSS L T G+P  L+P+ I Y   +    +N +  L+
Sbjct  23    AVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTLIPLAILYYYRRKTEGSNAKFYLM  82

Query  268   TPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHY  447
             TP +F++S  +G+  G+D +LY++G S LPVS SSLL + QLAFTAV A+FIVK KL+ +
Sbjct  83    TPRIFIASFIIGVATGLDDFLYSWGGSKLPVSTSSLLLAAQLAFTAVGAFFIVKLKLSPF  142

Query  448   SVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHA  627
             S+NAVVL+T G+V+LG+   GDRPEG + + Y +GF MT+  AAL+G I+  +E  ++ A
Sbjct  143   SINAVVLLTVGAVLLGIRSNGDRPEGVTSKEYIIGFMMTLLAAALYGVILPCIELIYMKA  202

Query  628   GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAI  807
                +T+ L++++Q I+S  +  FCTV MI NKDFQA+S+EA++F+LG  +YY ++   A 
Sbjct  203   KQAITSTLVLEIQMIMSFAATAFCTVGMIANKDFQAMSREAKQFNLGEARYYTVIVCTAA  262

Query  808   ALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFA  987
               Q   +G +GVI+ SS+L+ G+  ++L+ V +V +VIF  E+FS +K L+L + +WGF 
Sbjct  263   IWQCFFVGIIGVIYCSSSLMSGVMIAVLLPVTEVLAVIFFKENFSGEKGLALFLSLWGFV  322

Query  988   SYFYGDYKTARKKPPPPP  1041
             SYFYG+++  +K+    P
Sbjct  323   SYFYGEFRQTKKQKNTSP  340



>ref|XP_010060066.1| PREDICTED: purine permease 1-like [Eucalyptus grandis]
Length=367

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/320 (45%), Positives = 220/320 (69%), Gaps = 0/320 (0%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K L++ +NC  L++G  GG +L+RLY+L+GG   WLSS L T G+P + + + ++Y R +
Sbjct  32    KPLLLALNCAMLSLGTCGGPLLMRLYYLYGGSGVWLSSWLETGGWPAIFLALAVAYLRRR  91

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
             +    + R VL+ P+LF +SA +G+L G+D YLY +G++ LP S S+LL +TQLAFTA F
Sbjct  92    SAEGPSARLVLMDPFLFAASAVVGVLTGLDDYLYAYGVARLPASTSALLIATQLAFTAGF  151

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A+ +V+ + T YS+N+V L+T  + VL L+ + DRP GESD+ Y  GFFMT+  AAL+GF
Sbjct  152   AFLLVRQQFTSYSINSVYLLTVAAGVLALNASSDRPAGESDQEYYAGFFMTLGAAALYGF  211

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             ++  VE  +  A   VT  L++++Q ++  F+  FCTV M++NKDFQAI  EA+ ++LG 
Sbjct  212   VLPLVELTYKKAKQAVTYSLVLEIQLVMCFFATAFCTVGMLVNKDFQAIPTEAKNYELGE  271

Query  772   EKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADK  951
               YY+++   AIA Q   +G +GVIF +S+L  GI  ++L+ V ++ ++I   E+F A K
Sbjct  272   ALYYVVLVGNAIAWQFFFLGVIGVIFCASSLFSGIMIAVLLPVTEILAIICFRETFQAAK  331

Query  952   LLSLAICIWGFASYFYGDYK  1011
              +SLA+ +WG ASYFYG++K
Sbjct  332   GVSLALSLWGLASYFYGEFK  351



>ref|XP_002462515.1| hypothetical protein SORBIDRAFT_02g027100 [Sorghum bicolor]
 gb|EER99036.1| hypothetical protein SORBIDRAFT_02g027100 [Sorghum bicolor]
Length=365

 Score =   287 bits (734),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 146/325 (45%), Positives = 222/325 (68%), Gaps = 5/325 (2%)
 Frame = +1

Query  61    VIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqaka  240
             ++ +NC  LA+G IGG +L RLYF  GG R+WLS+ L T G+P LLVP+ +S+   +A+ 
Sbjct  23    LVALNCGMLALGAIGGPLLSRLYFSKGGHRQWLSAWLETGGWPLLLVPVALSFVARRARD  82

Query  241   aanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYF  420
              A    +L  P + +++  LG+  GVD ++Y +G++YLPVS S++L STQLAFT  FA+ 
Sbjct  83    RAAPV-LLTPPRILLAAVALGVATGVDDFIYAYGLAYLPVSTSAILISTQLAFTVFFAFL  141

Query  421   IVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMA  600
             +V+ +LT  SVNAV L+T G+VVLGLH++ DRP G +   Y LGF +T+  AAL+G ++ 
Sbjct  142   VVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGVTRGQYWLGFTLTLGAAALYGLVLP  201

Query  601   GVEYAHVHA----GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG  768
              VE A+  A    G  V+  L++++Q ++  F+  FCTV MI+NKDFQAI +EAR+++LG
Sbjct  202   LVELAYKRAAAGGGRAVSYALVVEMQLVMGFFATAFCTVGMIVNKDFQAIPREARQYELG  261

Query  769   TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
               +YY ++ ++A+  Q   +G++GVIF    LL GI  ++ + V +V +VIFL E FS++
Sbjct  262   EARYYTVLVWSAVLWQCFFLGAVGVIFCVHTLLAGILIAVFIPVTEVAAVIFLHEKFSSE  321

Query  949   KLLSLAICIWGFASYFYGDYKTARK  1023
             K ++L + +WG ASY YG++  ARK
Sbjct  322   KGVALVLSLWGLASYSYGEWSQARK  346



>gb|KCW66598.1| hypothetical protein EUGRSUZ_F00392 [Eucalyptus grandis]
Length=480

 Score =   290 bits (742),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 145/344 (42%), Positives = 228/344 (66%), Gaps = 4/344 (1%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K L +++NC+ L+VG  G  +++RLYF+ GG R WL S L    +P LLVP+  +Y+R +
Sbjct  134   KRLFLVLNCIMLSVGTCGSPLIMRLYFVRGGARMWLVSWLEMGAWPMLLVPLGAAYSRRR  193

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
             +      R VL+  +LF ++A +G+LLG+D+Y Y +G+  LPVS S+LL +TQLAFTA F
Sbjct  194   SAEGPTARLVLMDRFLFAAAAGIGVLLGLDNYFYAYGVGRLPVSTSALLIATQLAFTAGF  253

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A+ +V+ + T  S+N++ L+T G+ VL +H + DRP GES  +Y  GFFMT+  AAL+G 
Sbjct  254   AFLLVRQRFTSCSINSIFLLTIGAGVLSMHTSSDRPAGESKGAYFTGFFMTLGAAALYGL  313

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             ++  VE  +  A   VT  L++++Q ++  F+  FCTVAM++NKDFQAI +EAR ++LG 
Sbjct  314   VLPLVELMYKKAKQAVTYSLVLEIQLVMCFFATAFCTVAMLVNKDFQAIPREARNYELGE  373

Query  772   EKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADK  951
              +YY+++ + AI  Q   +G++GVIF +S+L   +  + L+   ++ +VI   E F A+K
Sbjct  374   ARYYVVLVWTAIINQFFFLGAIGVIFYASSLFSAVIIATLLPFTEILAVICFQEKFQAEK  433

Query  952   LLSLAICIWGFASYFYGDYKTARKKPPPPPVT----GDDEEHQE  1071
              ++LA+ +WGFASYFYG++K A+K+      T     + E HQ+
Sbjct  434   GVALALSLWGFASYFYGEFKLAKKEKEATAGTVIKPAETEMHQQ  477



>ref|XP_009588639.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=356

 Score =   285 bits (730),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 146/339 (43%), Positives = 228/339 (67%), Gaps = 15/339 (4%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K  ++++NC+FLA+G  GG ++ RLYF+ GGKR WLSS L T+ +P +L+P+ ISY    
Sbjct  10    KKFLLVMNCIFLAIGNCGGPLISRLYFIKGGKRIWLSSWLQTSAWPIILIPLAISYFNRC  69

Query  232   akaaanrrrV---------------LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSI  366
                      V               L+TP +F+++  +G+L G+D+YL  +G++ LPVS 
Sbjct  70    KSQGKISTTVENNNNNDNNNNTKFILMTPRIFIAAVGMGILSGIDNYLSAYGVAKLPVST  129

Query  367   SSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYT  546
             S+LL ++QLAFTA FA+ +VK K + YS+N++ L+T G+VVL LH   DRP+GES + Y 
Sbjct  130   SALLIASQLAFTAGFAFLLVKQKFSAYSINSIYLLTLGAVVLALHAKSDRPKGESKKEYI  189

Query  547   LGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKD  726
             LGF +T+  AAL+G I+   E  +  A   +T  L++++Q +   F+ + CT+ MIINKD
Sbjct  190   LGFVLTLGAAALYGLILPLFELLYKKAKQTITYTLVLEIQAVYCFFATVVCTIGMIINKD  249

Query  727   FQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQ  906
             FQA+S+EA+ F+LG  +YY+++ ++AI  Q   +G++GV++SSS+L+  I  ++L+ V +
Sbjct  250   FQAMSREAKAFELGEGRYYIVIVWSAIIWQCFFLGAIGVVYSSSSLVSAILITVLLPVTE  309

Query  907   VFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARK  1023
             V +VIF  E F+A+K +SLA+ +WGF SYFYGD K ++K
Sbjct  310   VLAVIFYGEKFTAEKGVSLALSMWGFISYFYGDIKASKK  348



>gb|ADP30798.1| nicotine uptake permease 1 [Nicotiana tabacum]
Length=353

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/318 (45%), Positives = 220/318 (69%), Gaps = 0/318 (0%)
 Frame = +1

Query  88    AVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLV  267
             AVG  GG +++RLY++ GG R WLSS L T G+P  L+P+ I Y   +    +N +  L+
Sbjct  23    AVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTLIPLAILYYYRRKTEGSNAKFYLM  82

Query  268   TPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHY  447
             TP +F++S  +G+  G+D +LY++G S LPVS SSLL + QLAFTAV A+FIVK KL+ +
Sbjct  83    TPRIFIASFVIGVATGLDDFLYSWGGSKLPVSTSSLLLAAQLAFTAVGAFFIVKLKLSPF  142

Query  448   SVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHA  627
             S+NAVVL+T G+V+LG+   GDRPEG + + Y +GF MT+  AAL+G I+  +E  ++ A
Sbjct  143   SINAVVLLTVGAVLLGIRSNGDRPEGVTSKEYIIGFMMTLLAAALYGVILPCIELIYMKA  202

Query  628   GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAI  807
                +T+ L++++Q I+S  +  FCTV MI NKDFQA+S+EA++F++G  +YY ++   A 
Sbjct  203   KQAITSTLVLEIQMIMSFAATAFCTVGMIANKDFQAMSREAKQFNVGEARYYTVIVCTAA  262

Query  808   ALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFA  987
               Q   +G +GVI+ SS+L+ G+  ++L+ V +V +VIF  E+FS +K L+L + +WGF 
Sbjct  263   IWQCFFVGIIGVIYCSSSLMSGVMIAVLLPVTEVLAVIFFKENFSGEKGLALFLSLWGFV  322

Query  988   SYFYGDYKTARKKPPPPP  1041
             SYFYG+++  +K+    P
Sbjct  323   SYFYGEFRQTKKQKNTSP  340



>ref|XP_009795252.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/326 (44%), Positives = 216/326 (66%), Gaps = 0/326 (0%)
 Frame = +1

Query  94    GQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLVTP  273
             G  GG +++RLY++ GG R W SS L TAG+P   +P+ I Y   +     N +  L+TP
Sbjct  25    GICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTFIPLAILYFNRRKTEGINAKYYLITP  84

Query  274   WLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSV  453
              +F++S  +G + G+D +LY++G S LPVS SSLL + QLAFTA+ A+FIVK K T YS+
Sbjct  85    RIFIASFIIGFVTGLDDFLYSWGGSKLPVSTSSLLLAAQLAFTAIGAFFIVKLKFTPYSI  144

Query  454   NAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHAGV  633
             NAVVL+T G+V+LG+   GDRPEG + ++Y +GF MT+  AAL+G I+  +E  ++ A  
Sbjct  145   NAVVLLTLGAVLLGVRSNGDRPEGVTSKAYIIGFMMTLLAAALYGVILPCIELIYLKAKQ  204

Query  634   PVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAIAL  813
              +T  L++++Q ++   +  FCTV MI N DFQAIS+EA++F+LG  +YY +V +  I  
Sbjct  205   AITATLVLEIQMVMCFAATAFCTVGMIANNDFQAISREAKQFNLGEARYYTVVVWTTIIW  264

Query  814   QLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFASY  993
             Q   +G +GVI+ SS+L+ G+  ++L+ V +V +V+F  E+FS +K L+L + +WGF SY
Sbjct  265   QCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRENFSGEKGLALFLSLWGFVSY  324

Query  994   FYGDYKTARKKPPPPPVTGDDEEHQE  1071
             FYG+++  +K     P T     H E
Sbjct  325   FYGEFRQTKKLKNKSPKTEMATTHIE  350



>ref|XP_006357925.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=343

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 152/337 (45%), Positives = 223/337 (66%), Gaps = 4/337 (1%)
 Frame = +1

Query  64    IIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaa  243
             +IINC+ L +G  G  +++RLYF+ GGKR WLS  L T  +P   +P+ ISY   +    
Sbjct  6     LIINCIILTIGTCGAPLIMRLYFIKGGKRIWLSCWLQTVAWPINFIPLAISYLYRRNNNN  65

Query  244   anrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFI  423
             +++  +L+TP +FM++  +G+L G+ +Y Y++G++ LPVS + LL STQLAF A FA+ I
Sbjct  66    SSKL-ILMTPRIFMATIGIGILQGLSNYFYSYGVAKLPVSTNGLLISTQLAFIAFFAFII  124

Query  424   VKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAG  603
             VK KLT YS+N+V L+T G+VVL LH  GDRPEGE+++ Y LGF MT+A AAL G I   
Sbjct  125   VKLKLTSYSINSVFLLTIGAVVLALHSGGDRPEGETNKEYILGFIMTLASAALTGLIFPL  184

Query  604   VEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYY  783
             VE  +  A   +T   +++ Q +    + +F T+ M+IN DFQAIS EA+ F+LG  +YY
Sbjct  185   VELIYKKAQQAITYTFVLEFQTVYCFVATVFSTIGMVINNDFQAISGEAKAFELGEGRYY  244

Query  784   MIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSL  963
             +++   AI LQ   +G++GVI+S+S+L+ GI  + L+ V +V +V    E FSA+K +SL
Sbjct  245   VVIICIAIVLQFYFLGTIGVIYSASSLVSGILATFLLPVNEVLAVFLYSEKFSAEKGISL  304

Query  964   AICIWGFASYFYGDYKTARKKP---PPPPVTGDDEEH  1065
             A+ +WGFASYFYGDYK  +K+     P   T D   +
Sbjct  305   ALSLWGFASYFYGDYKENKKRKNDQSPETKTIDKTNY  341



>ref|XP_008652812.1| PREDICTED: purine permease 3-like [Zea mays]
 tpg|DAA61853.1| TPA: hypothetical protein ZEAMMB73_233624 [Zea mays]
Length=367

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 145/340 (43%), Positives = 220/340 (65%), Gaps = 5/340 (1%)
 Frame = +1

Query  19    EDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLL  198
              D    +  +    ++ +NC  LAVG IGG +L RLYF  GG R+WLS+ L T G+P L+
Sbjct  8     SDAPPARGKAMHRFLVALNCGMLAVGAIGGPLLSRLYFSKGGHRQWLSAWLETGGWPLLV  67

Query  199   VPIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLL  378
             +P+  S+   +A+       +L  P + +++A LG+  G D ++Y FG++YLPVS S++L
Sbjct  68    IPVAASFVARRARDRGAPV-LLAPPRILLAAAGLGVATGADDFIYAFGLAYLPVSTSAIL  126

Query  379   SSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFF  558
              STQLAFT  FA+ +V+ +LT  SVNAV L+T G+VVLGLH++ DRP G +   Y LGF 
Sbjct  127   ISTQLAFTVFFAFLVVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGVTRGQYWLGFV  186

Query  559   MTIAGAALHGFIMAGVEYAHVHAGVP----VTNGLLMQVQFIISMFSALFCTVAMIINKD  726
             +T+  AAL+G ++  VE A+  A       VT  L++++Q ++  F+  FCTV M++NKD
Sbjct  187   LTLGAAALYGLVLPLVELAYRRAAGAGGRAVTYALVVEMQLVMGFFATAFCTVGMVVNKD  246

Query  727   FQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQ  906
             FQAI +EAR + LG  +YY ++ ++A+  Q   +G++GVIF    LL GI  ++ + V +
Sbjct  247   FQAIPREARRYKLGEARYYAVLAWSAVLWQCFFLGAVGVIFCVHTLLAGILIAVFIPVTE  306

Query  907   VFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
             V +VIFL E FS++K ++L + +WG ASY YG++  AR K
Sbjct  307   VAAVIFLRERFSSEKGVALVLSLWGLASYSYGEWSEARAK  346



>ref|XP_004237961.1| PREDICTED: purine permease 1-like [Solanum lycopersicum]
Length=374

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 147/338 (43%), Positives = 223/338 (66%), Gaps = 5/338 (1%)
 Frame = +1

Query  1     TYLKNLEDMK-KMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLT  177
             T  +N +  K KMK L F    +I N + L++G  GG ++ RLYF+HGG+R W+ S L T
Sbjct  9     TINQNKQHQKSKMKKLIF----LIFNIIMLSIGNCGGPLISRLYFIHGGQRIWIPSVLQT  64

Query  178   AGFPCLLVPIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLP  357
              G P +L+P+ I+Y + +       + V +T   F++SA +G+++G+D YL ++G + LP
Sbjct  65    VGCPVILIPLAIAYFQRRKIQGPEAKIVFITRQEFIASAGVGIIVGLDGYLNSWGPAKLP  124

Query  358   VSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDR  537
             VS S+L+++TQLAFTA+FA  IVK KLT YS N+VVL+  G+  L L   GDRP GES +
Sbjct  125   VSTSTLINATQLAFTALFAVLIVKQKLTAYSTNSVVLLIAGAATLALRANGDRPAGESAK  184

Query  538   SYTLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMII  717
              Y LGF MT  GA L+G ++  +E  ++ +   VT   ++++Q ++ + + +FCT+ MII
Sbjct  185   DYMLGFVMTFVGAVLYGLMLPLIELIYMKSKQAVTYITVLEIQMVLGISATVFCTIGMII  244

Query  718   NKDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVA  897
             NKDFQAI +EA ++ +G  KYYM++   AI  Q  +MG +GVIF SS+LL GI  + L+ 
Sbjct  245   NKDFQAIPREASQYTIGESKYYMVLVLCAIIWQFALMGLVGVIFYSSSLLSGIIGAFLLP  304

Query  898   VQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYK  1011
             V +V +VI   E F A+K +++ + +WGF SYFYG+Y+
Sbjct  305   VTEVLAVILFHEKFQAEKGVAIFLALWGFVSYFYGEYE  342



>ref|XP_006305220.1| hypothetical protein CARUB_v10009586mg [Capsella rubella]
 gb|EOA38118.1| hypothetical protein CARUB_v10009586mg [Capsella rubella]
Length=351

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/342 (42%), Positives = 226/342 (66%), Gaps = 8/342 (2%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             KALVII  C+ LA+G  GG +++RLYF +GG+R W S+ L TAGFP + +P+  SY   +
Sbjct  3     KALVII-TCIILAIGNCGGPLIMRLYFNNGGQRIWFSTFLETAGFPVIFIPLLFSYIHRR  61

Query  232   aka--aanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
                  +      L+ P L  ++ F+G+L G D+YLY +G++YLPVS ++L+ ++QLAF A
Sbjct  62    RNNNGSEPTSFFLIKPRLLGAAIFIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIA  121

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
             +F++F+VKHK T +++NAVVL+T G+ VLG+H   D+P  E+ + Y  GF MT+A A ++
Sbjct  122   IFSFFMVKHKFTPFTINAVVLLTVGAAVLGMHTETDKPAHETRKQYVTGFLMTVAAAVMY  181

Query  586   GFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDL  765
               I+  VE A+  A  P++  L+++VQ ++   +++   + M I  DF+A+ KEA+EF L
Sbjct  182   SLILPLVELAYQKAKQPMSYTLVLEVQMVLCFLASIVSLIGMSIAGDFKALPKEAKEFKL  241

Query  766   GTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSA  945
             G   +Y++  F+AI  Q   +G++G+IF +S+L+ GI  S+L+ + +V +VIF  E F A
Sbjct  242   GEAVFYVVAVFSAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKFQA  301

Query  946   DKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
             +K LSLA+ +WGF SYFYG+ K+A++K          EE QE
Sbjct  302   EKGLSLALSLWGFVSYFYGEIKSAKEKK-----RIQQEESQE  338



>gb|KDP40942.1| hypothetical protein JCGZ_24941 [Jatropha curcas]
Length=355

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/320 (44%), Positives = 216/320 (68%), Gaps = 0/320 (0%)
 Frame = +1

Query  67    IINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaa  246
             I+N   LA+G  GG ++ RLYFL GGK  W+SS L TAG+P +L P+ +SY   ++   +
Sbjct  27    IVNGAMLAIGNCGGPLIQRLYFLEGGKAVWISSFLQTAGWPLVLFPLIVSYMYRRSNKGS  86

Query  247   nrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIV  426
               + + ++P LF++ A +GLL G+D +L  +G+S LPVS S+L+ +TQL FTA FAY +V
Sbjct  87    RTKLIYISPRLFLACAVIGLLTGLDDFLAAYGVSLLPVSTSALIIATQLGFTAGFAYILV  146

Query  427   KHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGV  606
             K K T +++NA+ L++ G+VVL +H + DRP+ E+   Y LGFFMT+  +AL+GF++  +
Sbjct  147   KQKFTPFTINAIFLLSIGAVVLVIHASSDRPDHETTEKYLLGFFMTLGASALYGFVLPLI  206

Query  607   EYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYM  786
             E  +  A   +T  L+M++Q +IS F+  FC + M+++KDF+AI +EA EF+LG  KYY+
Sbjct  207   ELTYKKAKQTITYTLVMEMQIVISFFATGFCAIGMLLHKDFEAIPREASEFELGRVKYYV  266

Query  787   IVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLA  966
             +  F A+  QL  MG++GV+F  S+LL GI  + L+ V +   V+F  E F  +K +SL 
Sbjct  267   VNVFTAVFWQLFFMGAVGVVFCGSSLLSGIIIATLLPVTESLGVMFYHEKFHFEKGISLV  326

Query  967   ICIWGFASYFYGDYKTARKK  1026
             + +WGF SYFYG+ +  +KK
Sbjct  327   LSLWGFISYFYGELQQNKKK  346



>ref|XP_010263027.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=365

 Score =   284 bits (727),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 148/319 (46%), Positives = 212/319 (66%), Gaps = 4/319 (1%)
 Frame = +1

Query  70    INCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaan  249
             INCV   +G I G + +RLYFLHGG RKW+ S L TAG P LL P+ + Y R +A     
Sbjct  42    INCVCTVLGTIAGPLFLRLYFLHGGNRKWIPSWLQTAGVPVLLGPLTVLYLRERASGVRF  101

Query  250   rrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVK  429
                 L    L + SA +G+L+G++ ++Y+ G+S+LPVS S+LL STQL FTA+FA  I K
Sbjct  102   ----LAPTKLLLLSAGIGILVGLNDFMYSHGLSFLPVSTSALLLSTQLGFTALFALLIAK  157

Query  430   HKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVE  609
              K T YS+NAVVLMT G+ +LGL  +GDR  G S+R Y LGF +T+  A L GFI+   E
Sbjct  158   QKFTPYSINAVVLMTLGAALLGLSKSGDRLLGVSNRDYWLGFVLTLGAAGLLGFILPCCE  217

Query  610   YAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMI  789
              A+  A   +T  +++Q QF ++ F+ +FCT+ M+INKDFQAI +EA  F+LG  KYY++
Sbjct  218   VAYATARKTITYSVVLQFQFGVNFFATVFCTIGMLINKDFQAIPREANAFELGAVKYYLV  277

Query  790   VGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAI  969
             +   AI  Q+  +G+LGV+FS+++L  G+  + L+ + +  +VI   E F+ +K ++LA+
Sbjct  278   LVSIAIVWQMAGVGTLGVVFSTTSLFAGVLNATLLPLTETAAVIVYHEKFTGEKGMALAL  337

Query  970   CIWGFASYFYGDYKTARKK  1026
             C WGF SYFYG YK  +K+
Sbjct  338   CSWGFISYFYGSYKEKKKQ  356



>ref|XP_007042882.1| Purine permease 3 isoform 2 [Theobroma cacao]
 gb|EOX98713.1| Purine permease 3 isoform 2 [Theobroma cacao]
Length=338

 Score =   283 bits (724),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/325 (42%), Positives = 215/325 (66%), Gaps = 0/325 (0%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K  ++++NC  LA G +GG ++++LYFL GGK  W SSCL TAG+P +++P+  SY   +
Sbjct  6     KRSLLVLNCALLAFGNVGGPLIMKLYFLKGGKGVWTSSCLETAGWPFMVMPLTFSYLYRR  65

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
              K         + P LF++SA +GLL GVD +LY +G++ LPVS  +L+ STQLAFT  F
Sbjct  66    RKEGPGTELFFIKPPLFLASAVIGLLTGVDDFLYAYGVARLPVSTLALIISTQLAFTVAF  125

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A+ +VK K T +++N+V L+  G+VVL LH + D P  ES+R Y  GFFMT+A +AL+GF
Sbjct  126   AFLLVKQKFTSFTINSVFLLNIGAVVLALHTSSDHPANESNRQYCSGFFMTLAASALYGF  185

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             ++  +E  +  A   ++  L++++Q ++S  + +FCT+ M+ +K+ +AI +EA +F+LG 
Sbjct  186   VLPAIELTYKKAKQTISYSLVIEMQMVMSFSATVFCTIGMLFHKEVEAIPREASKFELGQ  245

Query  772   EKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADK  951
               YY+++  +AI  Q   MG++GVIFS S+LL GI  + L+ V +  +V+F  E F  +K
Sbjct  246   STYYLVILLSAILWQFFFMGAVGVIFSGSSLLSGIIIAALLPVTESLAVLFFHEKFQVEK  305

Query  952   LLSLAICIWGFASYFYGDYKTARKK  1026
              +S+ + +WG  SYFYG+ +  +K 
Sbjct  306   AISVVLSLWGSLSYFYGELQKNKKN  330



>ref|XP_008667169.1| PREDICTED: uncharacterized protein LOC100193377 isoform X1 [Zea 
mays]
 gb|ACR36679.1| unknown [Zea mays]
 tpg|DAA40290.1| TPA: hypothetical protein ZEAMMB73_258363 [Zea mays]
Length=363

 Score =   283 bits (725),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 153/356 (43%), Positives = 229/356 (64%), Gaps = 4/356 (1%)
 Frame = +1

Query  19    EDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLL  198
              +   ++  + + L++  NCV LA+G  GG +L RLYF  GG R+WLS  L T G+P LL
Sbjct  7     HESPPLRSKTMRRLLVATNCVMLALGVTGGQLLSRLYFSKGGHRQWLSGWLQTGGWPLLL  66

Query  199   VPIFISYarnqakaaanrrrVLVT-PWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSL  375
              P+  SY R +A+  +    +  T P + +++A LGL+ GVD+ LY +G+ +LPVS S++
Sbjct  67    PPVAASYVRRRARYRSAPALLTQTQPRILLAAAGLGLIAGVDNLLYAWGLEFLPVSTSAI  126

Query  376   LSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGF  555
             L STQLAFT +FA+ IV+ +LT  +VNAV L+T G+VVLGLH++ DRP G +   Y LGF
Sbjct  127   LISTQLAFTVLFAFLIVRQRLTMATVNAVALLTVGAVVLGLHVSSDRPAGVTRSQYWLGF  186

Query  556   FMTIAGAALHGFIMAGVEYAHVHA---GVPVTNGLLMQVQFIISMFSALFCTVAMIINKD  726
              +T+  A L+G  +  VE  +  A   G  VT  L++++Q ++   +  FCTV MI+NKD
Sbjct  187   TLTLGAAVLYGLFLPLVELTYKCAAGGGRAVTYALVVELQLVMGFVATAFCTVGMIVNKD  246

Query  727   FQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQ  906
             FQAI +EAR+++LG  +YYM++ +AA+  Q   +G++GVIF    LL GI  ++ + V +
Sbjct  247   FQAIPREARQYELGEARYYMVLAWAAVLWQCFFLGAVGVIFCVHTLLAGILIAVFIPVTE  306

Query  907   VFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQEV  1074
             V +VIFL E FS++K ++LA+ +WG ASY YG++  A+ K        D E  Q V
Sbjct  307   VAAVIFLHEKFSSEKGVALALSLWGLASYSYGEWSQAKAKKEKKSEEDDGEVAQAV  362



>ref|XP_006338103.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=354

 Score =   283 bits (724),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 144/329 (44%), Positives = 219/329 (67%), Gaps = 7/329 (2%)
 Frame = +1

Query  25    MKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVP  204
             MKK+ FL F       N + L++G  GG ++ RLYF+HGG+R W+ S L T G P +L+P
Sbjct  1     MKKLIFLIF-------NIIMLSIGNCGGPLISRLYFIHGGQRIWIPSVLQTVGCPIILIP  53

Query  205   IFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSS  384
             + I+Y + +       + V +T   F++SA +G+++G+D YL ++G + LPVS S+L+++
Sbjct  54    LAIAYFQRRKIQGPEAKIVFITRQEFIASAGVGIIVGLDGYLNSWGPAKLPVSTSTLINA  113

Query  385   TQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMT  564
             TQLAFTA+FA  IVK KLT YS N+VVL+  G+  L L   GDRP GES + Y LGF MT
Sbjct  114   TQLAFTALFAVLIVKQKLTAYSTNSVVLLIAGAATLALRANGDRPAGESAKDYMLGFVMT  173

Query  565   IAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISK  744
               GA L+G ++  +E  ++ A   VT   ++++Q ++ + + +FCT+ MIINKDFQAI +
Sbjct  174   FIGAVLYGLMLPLIELIYMKAKQTVTYTTVLEIQMVLGISATVFCTIGMIINKDFQAIPR  233

Query  745   EAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIF  924
             EA ++ +G  KYYM++ + AI  Q  ++G +GVIF SS+LL GI  + L+ V +V +VI 
Sbjct  234   EASQYAIGESKYYMVLVWCAIIWQFALLGLVGVIFYSSSLLSGIIGAFLLPVTEVLAVIL  293

Query  925   LPESFSADKLLSLAICIWGFASYFYGDYK  1011
               E F A+K +++ + +WGF SYFYG+Y+
Sbjct  294   FHEKFQAEKGVAIFLALWGFVSYFYGEYE  322



>gb|KDP40961.1| hypothetical protein JCGZ_24960 [Jatropha curcas]
Length=472

 Score =   287 bits (734),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/320 (44%), Positives = 216/320 (68%), Gaps = 0/320 (0%)
 Frame = +1

Query  67    IINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaa  246
             I+N   LA+G  GG ++ RLYFL GGK  W+SS L TAG+P +L P+ +SY   ++   +
Sbjct  144   IVNGAMLAIGNCGGPLIQRLYFLKGGKAVWISSFLQTAGWPLVLFPLIVSYMYRRSNKGS  203

Query  247   nrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIV  426
               + + ++P LF++ A +GLL G+D +L  +G+S LPVS S+L+ +TQL FTA FAY +V
Sbjct  204   RTKLIYISPRLFLACAVIGLLTGLDDFLTAYGVSLLPVSTSALIIATQLGFTAGFAYILV  263

Query  427   KHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGV  606
             K K T +++NA+ L++ G+VVL +H + DRP+ E+   Y LGFFMT+  +AL+GF++  +
Sbjct  264   KQKFTPFTINAIFLLSIGAVVLVIHASSDRPDHETTEKYLLGFFMTLGASALYGFVLPLI  323

Query  607   EYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYM  786
             E  +  A   +T  L+M++Q +IS F+  FC + M+++KDF+AI +EA EF+LG  KYY+
Sbjct  324   ELTYKKAKQTITYTLVMEMQVVISFFATAFCAIGMLLHKDFEAIPREASEFELGRLKYYV  383

Query  787   IVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLA  966
             +  F A+  QL  MG++GV+F  S+LL GI  + L+ V +   V+F  E F  +K +SL 
Sbjct  384   VNVFTAVFWQLFFMGAVGVVFCDSSLLSGIIIATLLPVTESLGVMFYHEKFHFEKAISLV  443

Query  967   ICIWGFASYFYGDYKTARKK  1026
             + +WGF SYFYG+ +  +KK
Sbjct  444   LSLWGFVSYFYGELQQNKKK  463



>ref|XP_010064227.1| PREDICTED: purine permease 3-like [Eucalyptus grandis]
 gb|KCW66596.1| hypothetical protein EUGRSUZ_F00390 [Eucalyptus grandis]
Length=379

 Score =   284 bits (726),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 145/336 (43%), Positives = 227/336 (68%), Gaps = 4/336 (1%)
 Frame = +1

Query  19    EDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLL  198
             E M+  +  + K +++ +NC  L++    G +L+RLYF+HGG   WLSS L T G+P + 
Sbjct  3     ETMEAPQGKTLKLILLALNCAMLSL-SCAGPLLMRLYFIHGGASVWLSSWLETGGWPIIF  61

Query  199   VPIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLL  378
             +P+ ++Y R +A    + R VL+ P+LF+++A +G+L G+D YLY++G++ LPVS S+LL
Sbjct  62    IPLAVAYFRRRASEGPSARLVLMDPFLFVAAAVIGVLTGLDDYLYSYGVARLPVSTSALL  121

Query  379   SSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFF  558
              +TQLAFTA FA+ +V+   T YS+    L+T G+ VL +H + DRP GES  +Y  GFF
Sbjct  122   IATQLAFTAGFAFLLVRQLFTSYSI---FLLTIGAGVLAMHTSSDRPAGESKGAYYAGFF  178

Query  559   MTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAI  738
             MT+  AAL+G ++  VE  +  A   VT  L++++Q ++  F+  FCT+ M++NKDFQAI
Sbjct  179   MTLGAAALYGLVLPLVELTYKKAKQAVTYSLVLEIQLVMCFFATAFCTIGMLVNKDFQAI  238

Query  739   SKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSV  918
              +EAR F LG  +YY+++   AI  Q   +G++GVIF +S+L  GI  ++L+ V ++  V
Sbjct  239   PREARNFGLGEAQYYVVLVSNAIVWQFFFLGAIGVIFYASSLFSGIMIAILIPVTEILGV  298

Query  919   IFLPESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
             I   E F A+K +SLA+ +WGFASYFYG++K A+++
Sbjct  299   ICFHEKFQAEKGVSLALSLWGFASYFYGEFKRAKEE  334



>emb|CDP08377.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   283 bits (724),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/341 (41%), Positives = 222/341 (65%), Gaps = 7/341 (2%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
             + + ++++++C  LA+G  GG I++RLYF+ GGKR WLSS L T G+P   +P+ ISY  
Sbjct  8     TLRKILLVLSCFMLAIGNCGGPIIMRLYFVKGGKRIWLSSWLETGGWPITFIPLTISYFH  67

Query  226   nqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
              +     N + + +   +F+++A +GLL G+D YLY +G + LPVS ++++ +T L FTA
Sbjct  68    RRKTEGPNTKLIQMKCPVFIATAVIGLLTGLDDYLYAYGFARLPVSTATIIVATHLGFTA  127

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
              FA+ +VK K T YSVNA+VL++ GS VL +H + DRP+GES + Y LGF MT+A AAL+
Sbjct  128   FFAFLLVKQKFTAYSVNAIVLLSVGSGVLAMHTSSDRPKGESTKLYVLGFIMTLAAAALY  187

Query  586   GFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDL  765
             G ++  VE  ++ A   +T  LL+++  ++  F+ +FCTV M++N+DFQA+ +EA+ ++L
Sbjct  188   GLVLPMVELMYIKAKQAITYTLLLEINLVMCFFATVFCTVGMLVNRDFQAMPREAKAYEL  247

Query  766   GTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSA  945
             G  KYY++V + AI  Q   +G +GVIF +S+LL  I  + L+ V    +V+   E F  
Sbjct  248   GEAKYYVVVTWNAIIWQFFFLGVIGVIFCASSLLSAIIIASLLPVTGAIAVVAFDEKFPP  307

Query  946   DKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQ  1068
             +K ++L + +WGF SYFYG  K  R K        + E+H+
Sbjct  308   EKGVALFLSLWGFVSYFYGAIKHKRLKE-------EIEDHK  341



>dbj|BAJ86755.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=360

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/325 (45%), Positives = 218/325 (67%), Gaps = 4/325 (1%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
             + + L++ +NC  L +G  GG +L RLYF  GG RKWLS+ L T G+P LL+P+  SY R
Sbjct  21    AMQRLLVALNCGMLTLGTTGGPLLSRLYFSKGGHRKWLSAWLETGGWPLLLLPVAASYLR  80

Query  226   nqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
              +A+  +    VL  P + +++A LGL  G D +LY +G+S++PVS S++L STQLAFT 
Sbjct  81    RRAQDPSAPV-VLAPPRILVAAAGLGLATGADDFLYAYGLSFVPVSTSAILISTQLAFTV  139

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
             +FA+ IV+ +LT  SVNAV L+T G+VVLGLH++ DRP G +   Y LGF +T+  AAL+
Sbjct  140   LFAFLIVRQRLTALSVNAVALLTVGAVVLGLHVSSDRPAGVTRGQYWLGFLLTLGSAALY  199

Query  586   GFIMAGVEYAHVHA---GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEARE  756
             G ++  +E  +  A   G  VT  L+M++Q ++  F+  FCTV MI+N DFQA+++EAR 
Sbjct  200   GLVLPLIELTYKRAAGGGRVVTYALVMEMQLVMGFFATAFCTVGMIVNNDFQAMAREARA  259

Query  757   FDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPES  936
             F+LG  +YY ++ ++AI  Q   +G++GVIF    L  GI  ++ + V +V +VIFL E 
Sbjct  260   FELGEARYYTVLVWSAILWQFFFLGAVGVIFCVHTLFAGILIAVFIPVTEVLAVIFLHEK  319

Query  937   FSADKLLSLAICIWGFASYFYGDYK  1011
             FS++K ++L + +WG ASY YG+Y 
Sbjct  320   FSSEKGVALVLSLWGLASYSYGEYS  344



>emb|CDY27947.1| BnaCnng05320D [Brassica napus]
Length=349

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/332 (42%), Positives = 221/332 (67%), Gaps = 4/332 (1%)
 Frame = +1

Query  43    LSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYa  222
             +  K +++IINC+ LA+G  GG ++ RLYF +GGKR W SS L T+G P +L+P+ IS+ 
Sbjct  1     MKMKTVLVIINCIILAIGNCGGPLMTRLYFRNGGKRIWFSSFLQTSGCPIILLPLLISFL  60

Query  223   rnqakaaanrrrV---LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQL  393
                 K      +    L+ P LF++S   GLL+G D+YLY +G++YLPVS SSL+ S+QL
Sbjct  61    TRHRKQEQEDTKTTLFLIKPPLFLASVVFGLLIGFDNYLYAYGLAYLPVSTSSLIISSQL  120

Query  394   AFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAG  573
             AFTA+FA+F+VK + T +++NAVVL+T G+  L LH  GD+   E+ + Y +GF MT+A 
Sbjct  121   AFTALFAFFMVKQRFTPFTINAVVLLTLGAGSLALHADGDKLPKETRKEYIVGFAMTVAA  180

Query  574   AALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAR  753
             A L+ F++  VE  +  A   ++  L++++Q ++ + +  FC V M+ + DF+ + +EAR
Sbjct  181   AVLYAFVLPLVELTYKKASQRISYTLVLEMQLVLCVVATCFCLVGMLADGDFKELRREAR  240

Query  754   EFDLGTEKYY-MIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLP  930
             EF LG  KYY ++V F A+  Q   +GS+G+IF +S+L+ G+  S L+ + +V +V+F  
Sbjct  241   EFKLGGSKYYCVVVAFTAVIWQGFFLGSIGMIFCASSLVSGVLISTLLPLTEVLAVLFFR  300

Query  931   ESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
             E F A+K +SL + +WGF SYFYG  ++ ++K
Sbjct  301   EKFQAEKGVSLFLSLWGFVSYFYGKIQSEKEK  332



>ref|NP_174143.1| purine permease 3 [Arabidopsis thaliana]
 sp|Q9FZ95.1|PUP3_ARATH RecName: Full=Purine permease 3; Short=AtPUP3 [Arabidopsis thaliana]
 gb|AAF98433.1|AC021044_12 Similar to purine permease [Arabidopsis thaliana]
 gb|AEE30933.1| purine permease 3 [Arabidopsis thaliana]
Length=351

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/327 (43%), Positives = 221/327 (68%), Gaps = 3/327 (1%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             KALVII NC+ LA+G  GG +++RLYF +GGKR W S+ L TAGFP + +P+  SY   +
Sbjct  3     KALVII-NCIILAIGNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYITRR  61

Query  232   akaaa--nrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
                    +    L+ P L +++  +G+L G D+YLY +G++YLPVS ++L+ ++QLAF A
Sbjct  62    RSNNVGDSTSFFLIKPRLLIAAVIVGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIA  121

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
             +F++F+VKHK T +++NAVVL+T G+ VLG+H   D+P  E+ + Y  GF +T+A A ++
Sbjct  122   IFSFFMVKHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYITGFLITVAAAVMY  181

Query  586   GFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDL  765
              FI+  VE A+  A   ++  L+++ Q I+ + +++   + M I  DF+A+ KEAREF L
Sbjct  182   AFILPLVELAYQKAKQTMSYTLVLEFQLILCLLASIVSVIGMFIAGDFKALPKEAREFKL  241

Query  766   GTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSA  945
             G   +Y++  F+AI  Q   +G++G+IFS+S+L+ GI  S+L+ + +V +VIF  E F A
Sbjct  242   GEALFYVVAVFSAIIWQGFFLGAIGLIFSTSSLVSGIMISVLLPITEVLAVIFYHEKFQA  301

Query  946   DKLLSLAICIWGFASYFYGDYKTARKK  1026
             +K LSLA+ +WGF SYFYG+ K+   K
Sbjct  302   EKGLSLALSLWGFVSYFYGEIKSGEDK  328



>ref|XP_010266586.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=373

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/326 (44%), Positives = 219/326 (67%), Gaps = 5/326 (2%)
 Frame = +1

Query  94    GQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVL-VT  270
             G+ GG +L+RLYF  GG R WLSS L T G+P  L P+  SY   ++K      R+  + 
Sbjct  44    GESGGPLLMRLYFNRGGNRIWLSSWLETGGWPIFLFPLLFSYLHRRSKLGEQGARLFFMK  103

Query  271   PWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYS  450
             P LF++SA LGLL G+  YLY +GMS LPVS  SL++S+QLAF A+F++ +V+ + T +S
Sbjct  104   PRLFVASASLGLLTGLVDYLYAYGMSRLPVSTISLINSSQLAFNALFSFLLVRQRFTPFS  163

Query  451   VNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHAG  630
             +N+VVL+T G++VLGLH + DRP+ E+   Y +GFF++I  A L+G ++  VE+ +  A 
Sbjct  164   INSVVLLTIGAIVLGLHSSSDRPKDEAKDQYYMGFFVSIGAAVLYGLLLPMVEFTYKRAK  223

Query  631   VPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAIA  810
               +T  L+M++Q ++S+F+  FCTV M++NKDF+AI  EARE +LG  KYY+++  +AI 
Sbjct  224   QAITYPLVMEIQMVMSIFATAFCTVGMLVNKDFKAIGSEAREHELGVVKYYVVLVCSAIF  283

Query  811   LQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFAS  990
              Q   +G++GVIF +S+L+ GI ++ L+ + ++ +VIF  E F  +K +SL + +WGF S
Sbjct  284   WQFFYLGAVGVIFYASSLVAGITSATLLPILEILAVIFYKEKFKGEKGISLTLALWGFTS  343

Query  991   YFYGDYKTARKKPPPPPVTGDDEEHQ  1068
             YFYG+ K   ++   P    + E HQ
Sbjct  344   YFYGELKGNNQQDQKP----ESEPHQ  365



>ref|XP_009763953.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
 gb|ADP30799.1| nicotine uptake permease 2 [Nicotiana tabacum]
Length=352

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/328 (43%), Positives = 218/328 (66%), Gaps = 0/328 (0%)
 Frame = +1

Query  88    AVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLV  267
             AVG  GG +++RLY++ GG R WLSS L T G+P   +P+   Y   +    +N +  L+
Sbjct  23    AVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTFIPLAFLYYYRRKIEGSNAKFYLM  82

Query  268   TPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHY  447
             TP +F+++  +G+  G+D +LY++G S LPVS SSLL + QLAFTAV A+FIVK KL+ +
Sbjct  83    TPRIFIAAFVIGIATGLDDFLYSWGGSKLPVSTSSLLLAAQLAFTAVGAFFIVKLKLSPF  142

Query  448   SVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHA  627
             S+NAVVL+T G+V+LG+   GDRPEG + + Y +GF MT+  AAL+G I+  +E  ++ A
Sbjct  143   SINAVVLLTVGAVLLGIRSNGDRPEGVTSKEYIIGFMMTLLAAALYGVILPCIELIYMKA  202

Query  628   GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAI  807
                +T  L++++Q I+S  +  FCTV MI NKDFQA+S+EA++F+LG  +YY ++   A 
Sbjct  203   KQAITATLVLEIQMIMSFAATAFCTVGMIANKDFQAMSREAKQFNLGEARYYTVIVCTAA  262

Query  808   ALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFA  987
               +   +G +GVI+ SS+L+ G+  ++L+ V +V +VIF  E FS +K L+L + +WGF 
Sbjct  263   IWECFFVGIIGVIYCSSSLMSGVMIAVLLPVTEVLAVIFFKEKFSGEKGLALFLSLWGFV  322

Query  988   SYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
             SYFYG+++  +K+    P       H E
Sbjct  323   SYFYGEFRQTKKEKNKSPEAEMTTTHTE  350



>ref|XP_003615204.1| Purine permease [Medicago truncatula]
 gb|AES98162.1| purine permease [Medicago truncatula]
Length=364

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/317 (46%), Positives = 214/317 (68%), Gaps = 7/317 (2%)
 Frame = +1

Query  94    GQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrr-----  258
             G  GG +++RLYF+HGGKR WLSS L T+ FP +L+P+ IS+  N+ +            
Sbjct  32    GTCGGPLVMRLYFIHGGKRVWLSSFLETSAFPIILIPLTISHVHNRYRYQNPNGNNNNNN  91

Query  259   -VLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHK  435
              V + P LF++SA +G+L G+D YLY  G+  LPVS SSL+ S+ LAFTAVFA+F+VKHK
Sbjct  92    FVSMKPPLFIASAVIGVLTGLDDYLYACGIKRLPVSTSSLIQSSHLAFTAVFAFFLVKHK  151

Query  436   LTHYSVNAVVLMTFGSVVLGLHM-AGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEY  612
              T YSVN++VL+T GSVVL L+   GDR  GES + Y +GF M +A AAL+GF++  +E 
Sbjct  152   FTAYSVNSIVLLTLGSVVLALNSDGGDRLVGESTKDYVIGFVMILASAALYGFVLPLLEL  211

Query  613   AHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIV  792
              +  +   +T  L+M++Q ++  F+ LFC V MII+ DF+ I +EAR+F LG  KYY+++
Sbjct  212   VYKKSKQVITYSLVMEIQLVMCFFATLFCVVGMIIDNDFKVIPREARDFKLGETKYYVVL  271

Query  793   GFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAIC  972
              ++AI  Q   +G++GVIF +S+LL GI  +  + + ++ +VI   E F A+K ++L + 
Sbjct  272   VWSAIMWQFFFLGAIGVIFCASSLLSGIIIAAFLPITEILAVIVYKEKFQAEKGVALVLS  331

Query  973   IWGFASYFYGDYKTARK  1023
             +WGF SYFY + K A+K
Sbjct  332   LWGFVSYFYDEIKEAKK  348



>ref|XP_002531513.1| purine transporter, putative [Ricinus communis]
 gb|EEF30867.1| purine transporter, putative [Ricinus communis]
Length=380

 Score =   282 bits (722),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/327 (44%), Positives = 218/327 (67%), Gaps = 0/327 (0%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
             +    ++I+N   LA+G  GG ++ RLYFL GGK  W+SS L TAG+P ++ P+F+SY  
Sbjct  45    TLNKFLLIVNGTMLAIGNCGGPLIQRLYFLKGGKGVWISSFLQTAGWPFIIFPLFVSYIH  104

Query  226   nqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
              ++K A + +   +TP LF++ A +G+L G+D +L  +G+S LPVS S+L+ +TQL FTA
Sbjct  105   RRSKNAGSTKLYYITPRLFIACAVIGVLTGLDDFLAAYGVSLLPVSTSALIIATQLGFTA  164

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
              FAY +VK K T ++VNA+ L++ G+VVL LH + DRP  E++  Y  GFFMT+  +AL+
Sbjct  165   GFAYVLVKQKFTPFTVNAIFLLSIGAVVLVLHASSDRPPHETNGQYLSGFFMTLGASALY  224

Query  586   GFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDL  765
             GF++  +E  +  A   +T  L+M++Q +IS F+  FCT  M+++KDF AI +EA EF+L
Sbjct  225   GFVLPLIELTYKKANQTITYTLVMEMQLVISFFATAFCTTGMLLHKDFAAIPREASEFEL  284

Query  766   GTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSA  945
             G  KYY+++   AI  QL  MG++GV+F  S+LL GI  + L+ V +  +V F  E F  
Sbjct  285   GKAKYYVVLMVNAIFWQLFFMGAVGVVFCGSSLLSGIIIATLLPVTETLAVFFYHEKFRV  344

Query  946   DKLLSLAICIWGFASYFYGDYKTARKK  1026
             +K +SL + +WGF  YFYG+ +  +KK
Sbjct  345   EKGISLVLSLWGFMFYFYGELQRNKKK  371



>ref|XP_009102926.1| PREDICTED: purine permease 3 [Brassica rapa]
 ref|XP_009102927.1| PREDICTED: purine permease 3 [Brassica rapa]
 emb|CDX94594.1| BnaC07g10640D [Brassica napus]
Length=349

 Score =   281 bits (718),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 140/328 (43%), Positives = 218/328 (66%), Gaps = 4/328 (1%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             +ALVII NC+ LA+G  GG +++RLYF +GG R W S+ L TAGFP + +P+F SY   +
Sbjct  3     RALVII-NCIILAIGNCGGPLIMRLYFNNGGHRIWFSTFLETAGFPIIFIPLFFSYLNRR  61

Query  232   akaaanrrrV---LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFT  402
                          L+ P L M++  +G+L G D+YLY +G++YLPVS ++L+ ++QLAF 
Sbjct  62    RSNNNEGENTRFFLIKPRLLMAAILIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFI  121

Query  403   AVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAAL  582
             A+F+YF+V HK T +++NAVVL+T G+ VLG+H   D+P  E+ + Y +GF +T+A A +
Sbjct  122   AIFSYFMVSHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYMVGFLVTVAAAVM  181

Query  583   HGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFD  762
             + F++  VE A+  A  P++  L+++VQ I+   ++L   V M+I  DF+A+  EAREF 
Sbjct  182   YAFLLPLVELAYQKAKQPMSYTLVLEVQMILCFLASLVSLVGMLIAGDFKALPNEAREFK  241

Query  763   LGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFS  942
             LG   +Y++   +AI  Q   +G++G+IF +S+L+ GI  S+L+ + +V +VIF  E F 
Sbjct  242   LGEAMFYVVAVLSAIIWQGFFLGAIGLIFCASSLVSGIMISVLLPITEVLAVIFYHEKFQ  301

Query  943   ADKLLSLAICIWGFASYFYGDYKTARKK  1026
              +K LSLA+ +WGF SYFYG+ K  + K
Sbjct  302   KEKGLSLALSLWGFVSYFYGEIKADKDK  329



>emb|CDX94595.1| BnaC07g10630D [Brassica napus]
Length=349

 Score =   280 bits (717),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 139/328 (42%), Positives = 219/328 (67%), Gaps = 4/328 (1%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             +ALVII NC+ LA+G  GG +++RLYF +GG R W S+ L TAGFP + +P+F SY   +
Sbjct  3     RALVII-NCIILAIGNCGGPLIMRLYFNNGGHRIWFSTFLETAGFPIIFIPLFFSYLNRR  61

Query  232   akaaanrrrV---LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFT  402
                +         L+ P L M++  +G+L G D+YLY +G++YLPVS ++L+ ++QLAF 
Sbjct  62    RSNSNEGENTRFFLIKPRLLMAAILIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFI  121

Query  403   AVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAAL  582
             A+F+YF+V HK T +++NAVVL+T G+ VLG+H   D+P  E+ + Y +GF +T+A A +
Sbjct  122   AIFSYFMVSHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYMVGFLVTVAAAVM  181

Query  583   HGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFD  762
             + F++  VE A+  A  P++  L+++VQ I+   ++L   + M+I  DF+A+  EAREF 
Sbjct  182   YAFLLPLVELAYQKAKQPMSYTLVLEVQMILCFLASLVSLIGMLIAGDFKALPNEAREFK  241

Query  763   LGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFS  942
             LG   +Y++   +AI  Q   +G++G+IF +S+L+ GI  S+L+ + +V +VIF  E F 
Sbjct  242   LGEAMFYVVAVLSAIIWQGFFLGAIGLIFCASSLVSGIMISVLLPITEVLAVIFYHEKFQ  301

Query  943   ADKLLSLAICIWGFASYFYGDYKTARKK  1026
              +K LSLA+ +WGF SYFYG+ K  + K
Sbjct  302   KEKGLSLALSLWGFVSYFYGEIKADKDK  329



>ref|XP_006338102.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=352

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/331 (43%), Positives = 218/331 (66%), Gaps = 0/331 (0%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
              ++  ++++NC+ L +G  GG ++ RLYFLHGG+R WLSS L   G+P +L+ + I+Y  
Sbjct  7     KWRKFILVLNCIALGIGYCGGPVISRLYFLHGGQRIWLSSWLACIGWPIILIVLIIAYFY  66

Query  226   nqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
                   ++   + +T   F SSA LG+L+G+  YLYT+G + LPVS S+++ + QL FT 
Sbjct  67    RLKTQGSDINFLCITLQEFTSSAALGILVGLAGYLYTWGPAKLPVSTSTVIYAAQLGFTV  126

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
             +FA+ IVK KLT YSVNAVVL+  G+  L L    DRPEGES + Y LGF MT+  AA  
Sbjct  127   IFAFLIVKQKLTAYSVNAVVLLIVGAGTLALRAESDRPEGESTKQYVLGFVMTLLAAAST  186

Query  586   GFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDL  765
             G  +  +E  ++ A   VT  +++++Q I+++F++ FCTV MI+NKDFQAIS+EA +F+L
Sbjct  187   GLALPLLELIYIRAKKNVTYIMILEIQMILNIFASAFCTVGMIVNKDFQAISREASQFEL  246

Query  766   GTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSA  945
             G  KYY+++ ++AI  Q   +G +GV+   S+LL GI  +LL+ + ++  VI   E+F  
Sbjct  247   GKAKYYLVLVWSAIIWQFSTLGIVGVVQYGSSLLCGILIALLLPLTELLGVILYHETFQV  306

Query  946   DKLLSLAICIWGFASYFYGDYKTARKKPPPP  1038
              K L++ + +WGF SYFYG+ K ++KK   P
Sbjct  307   TKGLAIFLSLWGFVSYFYGEMKQSKKKEESP  337



>ref|XP_009762239.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 215/313 (69%), Gaps = 0/313 (0%)
 Frame = +1

Query  88    AVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLV  267
             AVG  GG +++RLY++ GG R W SS L T G+P  L+P+ I Y   +    A+ +  L+
Sbjct  23    AVGVCGGPLMMRLYYVGGGSRVWFSSWLQTGGWPLTLIPLAILYFYRRKSKGADAKVCLI  82

Query  268   TPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHY  447
             TP +F++S  LG+  G+D +LY++G S LPVS SSLL + QL FTAV A+FIVK K T Y
Sbjct  83    TPQIFIASFVLGVGTGIDDFLYSWGGSKLPVSTSSLLLAAQLGFTAVGAFFIVKLKFTPY  142

Query  448   SVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHA  627
             S+NAV+L+T G+V+LG+   GD+P G + ++Y LGF MT+  AAL+G I+  +E  ++ A
Sbjct  143   SINAVILLTVGAVLLGIRSNGDKPAGVTSKAYVLGFIMTLLAAALYGIILPSIELIYLKA  202

Query  628   GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAI  807
                +T  L++++Q ++   +  FCT+ M+ NKDFQAIS+EA +F+LG  +YY ++ + AI
Sbjct  203   KQAITVTLVLEIQMVMCFAATTFCTIGMVANKDFQAISREAIQFNLGEARYYTVIIWTAI  262

Query  808   ALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFA  987
               Q   +G++GVI+ SSAL+ G+  ++L+ V +V +++F  E FS +K +SL + +WGF 
Sbjct  263   LWQCFFVGAVGVIYCSSALMSGVIIAVLLPVTEVLAIVFFSEKFSGEKGVSLFLSLWGFV  322

Query  988   SYFYGDYKTARKK  1026
             SYFYG+++  +K+
Sbjct  323   SYFYGEFRLMKKQ  335



>gb|EEC84724.1| hypothetical protein OsI_31699 [Oryza sativa Indica Group]
Length=361

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 215/319 (67%), Gaps = 6/319 (2%)
 Frame = +1

Query  58    LVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqak  237
             L++ +NC  L VG  GG IL RLYF  GG RKWLS+ L TAG+P LLVP+  SY   +A+
Sbjct  26    LLVALNCGMLVVGTTGGPILSRLYFSKGGHRKWLSAWLETAGWPLLLVPVSASYLSRRAR  85

Query  238   aaanrrrVLVTPW-LFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFA  414
                    + +TP  + ++ A LG+L G D ++Y +G++YLPVS S++L STQLAFT  FA
Sbjct  86    DRGAP--LFLTPRRVLLAGAVLGVLTGADDFVYAYGLAYLPVSTSAILISTQLAFTVFFA  143

Query  415   YFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFI  594
               IV+ +LT  ++NAV L+T G+VVLGLH + DRP G +   Y +GFF+T+  AAL+G I
Sbjct  144   CLIVRQRLTAATLNAVALLTIGAVVLGLHASKDRPAGVTTGKYWMGFFLTLGAAALYGLI  203

Query  595   MAGVEYAHVHA---GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDL  765
             +  VE A+ HA   G  VT  L+M++Q ++  F+  FCTV +I+NKDFQAI +EA++++L
Sbjct  204   LPLVELAYKHAAGGGRAVTYALVMEMQLVMGFFATAFCTVGVIVNKDFQAIPREAKQYEL  263

Query  766   GTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSA  945
             G  +YY+++ F A+  +   +G++GVIF    LL GI  ++ + + +V  VIFL E FS+
Sbjct  264   GEARYYVVLVFNAVLWEFFFVGAVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFSS  323

Query  946   DKLLSLAICIWGFASYFYG  1002
             +K ++L + +WG ASY YG
Sbjct  324   EKGVALVLSLWGLASYSYG  342



>dbj|BAD19737.1| putative purine permease [Oryza sativa Japonica Group]
Length=361

 Score =   279 bits (714),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 215/319 (67%), Gaps = 6/319 (2%)
 Frame = +1

Query  58    LVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqak  237
             L++ +NC  L VG  GG IL RLYF  GG RKWLS+ L TAG+P LLVP+  SY   +A+
Sbjct  26    LLVALNCGMLVVGTTGGPILSRLYFSKGGHRKWLSAWLETAGWPLLLVPVSASYHSRRAR  85

Query  238   aaanrrrVLVTPW-LFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFA  414
                    + +TP  + ++ A LG+L G D ++Y +G++YLPVS S++L STQLAFT  FA
Sbjct  86    DRGAP--LFLTPRRVLLAGAVLGVLTGADDFVYAYGLAYLPVSTSAILISTQLAFTVFFA  143

Query  415   YFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFI  594
               IV+ +LT  ++NAV L+T G+VVLGLH + DRP G +   Y +GFF+T+  AAL+G I
Sbjct  144   CLIVRQRLTAATLNAVALLTIGAVVLGLHASKDRPAGVTTGKYWMGFFLTLGAAALYGLI  203

Query  595   MAGVEYAHVHA---GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDL  765
             +  VE A+ HA   G  VT  L+M++Q ++  F+  FCTV +I+NKDFQAI +EA++++L
Sbjct  204   LPLVELAYKHAAGGGRAVTYALVMEMQLVMGFFATAFCTVGVIVNKDFQAIPREAKQYEL  263

Query  766   GTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSA  945
             G  +YY+++ F A+  +   +G++GVIF    LL GI  ++ + + +V  VIFL E FS+
Sbjct  264   GEARYYVVLVFNAVLWEFFFVGAVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFSS  323

Query  946   DKLLSLAICIWGFASYFYG  1002
             +K ++L + +WG ASY YG
Sbjct  324   EKGVALVLSLWGLASYSYG  342



>ref|XP_004959525.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=409

 Score =   280 bits (717),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 146/326 (45%), Positives = 219/326 (67%), Gaps = 4/326 (1%)
 Frame = +1

Query  58    LVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqak  237
             L++ +NC  LA+G  GG +L RLY+++GG+R+WLS+ L T G+P LL+P+  SYA  +A+
Sbjct  73    LLVALNCTLLALGGTGGQLLSRLYYINGGQRQWLSAGLQTGGWPLLLIPLAGSYASRRAR  132

Query  238   aaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAY  417
                    +L  P   +++A LG++ GVD +LY +G+ +LPVS S++L STQL FT +F++
Sbjct  133   DRGAPV-LLSPPRFLLAAAGLGVITGVDDFLYAWGLEFLPVSTSAILISTQLVFTVLFSF  191

Query  418   FIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIM  597
              IV+H+LT  +VNAV L+T G VVLGLH++ DRPEG +   Y LGF +T+  AAL G +M
Sbjct  192   LIVRHRLTAATVNAVALLTVGGVVLGLHVSSDRPEGVTRGQYWLGFVLTLGAAALGGVLM  251

Query  598   AGVEYAHVHA---GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG  768
               VE A+  A   G  +T  + M++Q +I + +  F T  MI+NKDFQAI  EA+ F+LG
Sbjct  252   PLVELAYKCAAGGGRVLTYSVAMELQLVIGLVATAFFTAGMIVNKDFQAIPSEAKRFELG  311

Query  769   TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
               +YY ++ +AA+  Q   +G++GVIF    LL GI  ++ + V +V +VIFL E FS++
Sbjct  312   EARYYTVLVWAAVLWQFFFLGAVGVIFCVHTLLAGILIAVFIPVTEVAAVIFLHEKFSSE  371

Query  949   KLLSLAICIWGFASYFYGDYKTARKK  1026
             K ++L + +WG ASY YG++  AR K
Sbjct  372   KGVALVLSLWGLASYSYGEWNEARAK  397



>ref|XP_004237962.1| PREDICTED: purine permease 3-like [Solanum lycopersicum]
Length=355

 Score =   278 bits (712),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 147/343 (43%), Positives = 219/343 (64%), Gaps = 5/343 (1%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
              ++  ++++NC+ L +G  GG ++ RLYFLHGG+R WLSS L   G+P +L+ + I+Y  
Sbjct  7     KWRKFILVLNCITLGIGYCGGPLISRLYFLHGGQRIWLSSWLACIGWPIVLIVLVIAYFY  66

Query  226   nqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
                   ++     +T   F SSA LG+L+G+  YLY +G + LPVS S+++ + QL FT 
Sbjct  67    RLKTQGSDTNFFCITRQEFTSSAALGILVGLAGYLYAWGPAKLPVSTSTVIYAAQLGFTV  126

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
             VFA+ IVK KLT YSVNAVVL+  G+  L L    DRPEGES + Y LGF MT+  AA  
Sbjct  127   VFAFLIVKQKLTSYSVNAVVLLIVGAGTLALRAESDRPEGESTKQYVLGFVMTLLAAAST  186

Query  586   GFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDL  765
             G  +  +E  ++ A   VT  +++++Q I+++F++ FCTV MI+NKDFQ IS+EAREF+L
Sbjct  187   GLALPLLELIYIKAKKDVTYIMILEIQMILNIFASAFCTVGMIVNKDFQVISREAREFEL  246

Query  766   GTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSA  945
             G  KYY+++ ++AI  QL  +G +GV+   S+LL GI  +LL+ + ++  V+   E+F  
Sbjct  247   GKAKYYLVLIWSAIIWQLSTLGIVGVVQYGSSLLCGILIALLLPLTELLGVVLYHETFEV  306

Query  946   DKLLSLAICIWGFASYFYGDYKTARKK-----PPPPPVTGDDE  1059
              K L++ + +WGF SYFYG+ K   KK       P P T  D+
Sbjct  307   TKGLAIFLSLWGFVSYFYGEMKQNHKKKREEEENPIPQTEMDQ  349



>ref|XP_007042881.1| Purine permease 3 isoform 1 [Theobroma cacao]
 gb|EOX98712.1| Purine permease 3 isoform 1 [Theobroma cacao]
Length=338

 Score =   278 bits (710),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 134/325 (41%), Positives = 214/325 (66%), Gaps = 0/325 (0%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K  ++++NC  LA G +GG ++++LYFL GGK  W SSCL TAG+P +++P+  SY   +
Sbjct  6     KRSLLVLNCALLAFGNVGGPLIMKLYFLKGGKGVWTSSCLETAGWPFMVMPLTFSYLYRR  65

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
              K         + P LF++SA +GLL GVD +LY +G++ LPVS  +L+ STQLAFT  F
Sbjct  66    RKEGPGTELFFIKPPLFLASAVIGLLTGVDDFLYAYGVARLPVSTLALIISTQLAFTVAF  125

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A+ +VK K T +++N+V L+  G+VVL LH + D P  ES+R Y  GFFMT+A +AL+GF
Sbjct  126   AFLLVKQKFTSFTINSVFLLNIGAVVLALHTSSDHPANESNRQYCSGFFMTLAASALYGF  185

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             ++  +E  +  A   ++  L++++Q ++S  + +FCT+ M+ +K+ +AI +EA +F+LG 
Sbjct  186   VLPAIELTYKKAKQTISYSLVIEMQMVMSFSATVFCTIGMLFHKEVEAIPREASKFELGQ  245

Query  772   EKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADK  951
               YY+++  +AI  Q   MG++GVIFS S+LL GI  + L+ V +  +V+F  E F  +K
Sbjct  246   STYYLVILLSAILWQFFFMGAVGVIFSGSSLLSGIIIAALLPVTESLAVLFFHEKFQVEK  305

Query  952   LLSLAICIWGFASYFYGDYKTARKK  1026
              +S+ + + G  SYFYG+ +  +K 
Sbjct  306   AISVVLSLLGSLSYFYGELQKNKKN  330



>ref|XP_010549316.1| PREDICTED: purine permease 3 [Tarenaya hassleriana]
Length=340

 Score =   277 bits (709),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 140/337 (42%), Positives = 218/337 (65%), Gaps = 11/337 (3%)
 Frame = +1

Query  61    VIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqaka  240
             ++IINC+ LA+G  GG +++RLYF +GG R W SS L TAGFP +L+P+   Y + +   
Sbjct  5     MVIINCIILAIGNCGGPLIMRLYFNNGGNRIWFSSFLETAGFPVILLPLLFFYLQRRRTD  64

Query  241   aanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYF  420
                    L+ P L M+S  +G+L G D+YLY +G+++LPVS ++L+ ++QLAF AVF++F
Sbjct  65    TKTSFF-LMKPRLLMASIIVGVLSGFDNYLYAYGLAFLPVSTAALIIASQLAFIAVFSFF  123

Query  421   IVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMA  600
             +VKHK TH+++NAVVL+T G+ VLG+H   D+P  ES + Y +GF M    A ++ FI+ 
Sbjct  124   MVKHKFTHFTINAVVLLTIGAAVLGMHTEADKPVEESHKQYVMGFIMAAGAAIMYAFILP  183

Query  601   GVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKY  780
              VE ++  A  P+T  L+++VQ ++  F++  C   M    DF+A+  EA  F LGT  +
Sbjct  184   LVELSYRKARQPITYTLVLEVQMVLCFFASCVCIGGMYFAGDFKALPVEADNFKLGTSMF  243

Query  781   YMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLS  960
             Y++V F+AI  Q   +G++G+IFS+S+L+ GI  S+L+ + +V +VI   E F  +K +S
Sbjct  244   YLVVIFSAIIWQGFFLGAIGLIFSASSLVSGIMISVLLPITEVLAVIIFHEKFPPEKAVS  303

Query  961   LAICIWGFASYFYGDYKTAR--------KKPP--PPP  1041
             L + +WGF SYFYG+ K+ +        + PP  P P
Sbjct  304   LVLSLWGFVSYFYGEVKSEKAAKQSEEIEAPPRLPEP  340



>ref|XP_009770717.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=350

 Score =   278 bits (710),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 136/313 (43%), Positives = 215/313 (69%), Gaps = 0/313 (0%)
 Frame = +1

Query  88    AVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLV  267
             AV   GG +++RLY++ GG R W SS L TAG+P  L+P+ I Y   Q     N +  L+
Sbjct  23    AVDICGGPLMMRLYYVEGGSRIWFSSWLQTAGWPITLIPLVILYFYRQKTEGTNAKYYLI  82

Query  268   TPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHY  447
             TP +F++S  +G++ G+D +LY++G S LPVS SSLL + QLAFTA+ A+FIVK K T Y
Sbjct  83    TPRIFIASFIIGVVTGLDDFLYSWGGSKLPVSTSSLLLAAQLAFTAIGAFFIVKLKFTPY  142

Query  448   SVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHA  627
             S+NAVVL+T G+V+LG+   GDRPEG + ++Y +GF MT+  AAL+G I+  +E  ++ A
Sbjct  143   SINAVVLLTLGAVLLGVRSNGDRPEGVTSKAYIIGFMMTLLAAALYGVILPCIELIYLKA  202

Query  628   GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAI  807
                +T  L++++Q ++   +  FCTV MI+N +F+AIS+EA++F+LG  +YY ++ +  I
Sbjct  203   KQAITATLVLEIQMVMCFAATAFCTVGMIVNNNFKAISREAKQFNLGEARYYTVIVWTTI  262

Query  808   ALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFA  987
                   +G +GVI+ SS+L+ G+  ++L+ V +V +V+F  E+F  +K L+L +C+WGF 
Sbjct  263   VWLCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRENFLVEKGLALFLCLWGFV  322

Query  988   SYFYGDYKTARKK  1026
             S FYG+++  +K+
Sbjct  323   SCFYGEFRQTKKQ  335



>ref|XP_007136297.1| hypothetical protein PHAVU_009G034400g [Phaseolus vulgaris]
 gb|ESW08291.1| hypothetical protein PHAVU_009G034400g [Phaseolus vulgaris]
Length=366

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 146/310 (47%), Positives = 208/310 (67%), Gaps = 4/310 (1%)
 Frame = +1

Query  88    AVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar----nqakaaanrr  255
             AVG  GG +++RLYFL GG R WLS  L TAGFP ++ P+ +SY R      A   A  R
Sbjct  26    AVGTTGGPLVMRLYFLRGGNRVWLSCFLETAGFPLMVPPLILSYLRRRRGAVAAGTAKPR  85

Query  256   rVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHK  435
              V +   L  +SAF+G+L G+D YLY +G++ LPVS S+L+ +TQL FTA FA+ +V+ K
Sbjct  86    LVSMNIPLLAASAFIGVLTGLDDYLYAYGVARLPVSTSALIIATQLGFTAFFAFLLVRQK  145

Query  436   LTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYA  615
              T YSVNAVVL+T G+VVL LH +GDRP GES ++Y +GF MT+  AAL+GF++  VE  
Sbjct  146   FTSYSVNAVVLLTIGAVVLALHASGDRPHGESVKAYVMGFVMTVIAAALYGFVLPLVELV  205

Query  616   HVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVG  795
             +     P+T  L+M++QF++   + LFC + MI+N DF+AI  EA++F  G   YY ++ 
Sbjct  206   YKKCKQPITYSLVMEIQFVLCFSATLFCGIGMIVNNDFKAIPIEAKKFKHGEVNYYTVLV  265

Query  796   FAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICI  975
              +AI  Q   +G++GVIF +S+LL GI  ++L+ V +V +VI   E F A+K +SL + +
Sbjct  266   ASAILWQAFFLGAIGVIFCASSLLSGILIAVLLPVTEVLAVILYREKFKAEKGVSLLLSL  325

Query  976   WGFASYFYGD  1005
             WG  SYFYG+
Sbjct  326   WGMVSYFYGE  335



>ref|XP_009143832.1| PREDICTED: purine permease 2 isoform X1 [Brassica rapa]
Length=351

 Score =   277 bits (708),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/333 (41%), Positives = 221/333 (66%), Gaps = 5/333 (2%)
 Frame = +1

Query  43    LSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISY-  219
             +  K +++IINC+ LA+G  GG ++ RLYF +GGKR W SS L T+G P +L+P+  S+ 
Sbjct  1     MKMKTVLVIINCIILAIGNCGGPLMTRLYFRNGGKRIWFSSFLQTSGCPIILLPLLFSFL  60

Query  220   ---arnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQ  390
                 + Q +        L+ P LF++S  +GLL+G D+YLY +G++YLPVS SSL+ S+Q
Sbjct  61    TRHRQQQEQEEPKTTLFLIKPPLFLASVVVGLLIGFDNYLYAYGLAYLPVSTSSLIISSQ  120

Query  391   LAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIA  570
             LAFTA+FA+F+VK + T +++NAVVL+T G+  L LH  GD+   E+ + Y +GF MT+A
Sbjct  121   LAFTALFAFFMVKQRFTPFTINAVVLLTLGAGSLALHADGDKLPKETRKEYIVGFVMTVA  180

Query  571   GAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEA  750
              A L+ F++  VE A+  A   ++  L++++Q ++ + +   C V M+ + DF+ + +EA
Sbjct  181   AAVLYAFVLPLVELAYKKASQRISYTLVLEMQLVLCVVATCLCLVGMLADGDFKELGREA  240

Query  751   REFDLGTEKYY-MIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFL  927
             REF LG  K+Y ++V F A+  Q   +GS+G+IF +S+L+ G+  S L+ + +V +V+F 
Sbjct  241   REFKLGGSKHYCLVVAFTAVIWQGFFLGSIGMIFCASSLVSGVLISALLPLTEVLAVLFF  300

Query  928   PESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
              E F A K +SL + +WGF SYFYG  ++ ++K
Sbjct  301   KEKFQAAKGVSLFLSLWGFVSYFYGKIQSEKEK  333



>ref|XP_006305203.1| hypothetical protein CARUB_v10009570mg [Capsella rubella]
 gb|EOA38101.1| hypothetical protein CARUB_v10009570mg [Capsella rubella]
Length=355

 Score =   276 bits (705),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 148/338 (44%), Positives = 223/338 (66%), Gaps = 13/338 (4%)
 Frame = +1

Query  61    VIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISY-------  219
             ++IINC+ LA+G  GG +L RLY+ +GGKR W  S L TAGFP +L+P+F+S+       
Sbjct  5     LLIINCIILAIGTCGGPLLTRLYYNNGGKRIWFMSFLSTAGFPIILIPLFVSFLNRRRCN  64

Query  220   arnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAF  399
              +N A AA     ++ TP LF++S  +GLL G+D+YLY++G++YLPVS SSL+  TQLAF
Sbjct  65    RKNVANAAKTELFLMETP-LFVASIVIGLLSGLDNYLYSYGLAYLPVSTSSLIVGTQLAF  123

Query  400   TAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAA  579
              A+F++ +VK K T +S+NAVVL+T G+ +L LH  GD+P  ES R Y +GF MT+  A 
Sbjct  124   NALFSFLLVKQKFTPFSINAVVLLTVGTGILALHSDGDKPANESHREYVIGFLMTLIAAV  183

Query  580   LHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREF  759
             L+ FI+  VE  +  A   +T  L++++Q ++ + +  FC V M I  DF+ I+KEAREF
Sbjct  184   LYAFILPLVELTYKKARQEITFQLVLEIQMVMCLAATGFCVVGMFIVGDFKVIAKEAREF  243

Query  760   DLGTEK-YYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPES  936
              +G    YY ++    I +Q   +G++GV+F +S+L  G+  S+L+ V +V +V+   E 
Sbjct  244   KIGGPVFYYALIVITGIIMQGFSLGAIGVVFCASSLASGVLISVLLPVTEVLAVVCFREK  303

Query  937   FSADKLLSLAICIWGFASYFYGDYKTARK----KPPPP  1038
             F A+K +SL + +WGF SYFYG++K+ +K    KP  P
Sbjct  304   FQAEKGVSLFLSMWGFVSYFYGEFKSGKKVVVDKPQQP  341



>ref|XP_004959530.1| PREDICTED: purine permease 1-like [Setaria italica]
Length=378

 Score =   276 bits (706),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 145/343 (42%), Positives = 220/343 (64%), Gaps = 6/343 (2%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             +  ++++N V + VG  GG + +R YFLHGG RKWLS+ L TAGFP LLVP+ +S++R +
Sbjct  34    RNPLLVVNFVLMVVGTAGGPLFLRAYFLHGGARKWLSAFLQTAGFPLLLVPLCVSFSRRK  93

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
               A       L+TP L ++SA +GL+ G+D  LYT+G++YLPVS SS+L STQLAFTA F
Sbjct  94    KAAGGTPF-FLMTPRLLVASAGIGLMTGLDDLLYTYGLAYLPVSTSSILISTQLAFTAAF  152

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A  +V+ + T  SVNAVVL++ G+ +LG++  GDRP G S   Y+ GF MT+  AAL G 
Sbjct  153   ALLLVRQRFTASSVNAVVLLSVGAAMLGMNAGGDRPAGVSRAQYSAGFAMTLGAAALFGL  212

Query  592   IMAGVEYAHV-HA----GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEARE  756
             ++  +E +   HA      PVT  L++++Q +I + + +F  V M++N DF AI +EAR+
Sbjct  213   VLPVMELSQARHAARPGAAPVTYTLVIEMQLVIGLTATIFTAVGMLVNNDFHAIPEEARQ  272

Query  757   FDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPES  936
             F  G   YY+++  +A   Q   +G++G IF  SALL G+  ++L+ V +V +V+   E 
Sbjct  273   FGFGRSGYYLLLAGSAATYQCFFLGTIGAIFFGSALLAGVIMTVLIPVTEVLAVMLFSEP  332

Query  937   FSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEH  1065
             F+  K ++LA+ +WGF SYFYG+ +T++           + EH
Sbjct  333   FNGTKGVALALSLWGFVSYFYGEVQTSKANHQSDDSDPPNAEH  375



>ref|XP_010499329.1| PREDICTED: purine permease 3-like [Camelina sativa]
 ref|XP_010499330.1| PREDICTED: purine permease 3-like [Camelina sativa]
Length=355

 Score =   275 bits (703),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/343 (43%), Positives = 227/343 (66%), Gaps = 7/343 (2%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             KALVII NC+ LA+G  GG +++RLYF +GGKR W S+ L TAGFP + +P+  SY   +
Sbjct  3     KALVII-NCIILAIGNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYIHRR  61

Query  232   akaa---anrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFT  402
                          L+ P L  ++ F+G+L G D+YLY +G++YLPVS ++L+ ++QLA  
Sbjct  62    KNNNGGENATSFFLIKPRLLGAAIFIGILSGFDNYLYAYGIAYLPVSTAALIIASQLACI  121

Query  403   AVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAAL  582
             A+F++F+VKHK T +++NAVVL+T G+ VLG+H   DRP  E+ + Y LGF +T+A A +
Sbjct  122   AIFSFFMVKHKFTPFTINAVVLLTVGAAVLGMHTETDRPVHETHKQYVLGFLVTVAAAVV  181

Query  583   HGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFD  762
             + FI+  VE A+  A  P++  L+++VQ I+   +++   + M I  DF+A+ KEA+EF 
Sbjct  182   YAFILPLVELAYQKAKQPLSYTLVLEVQMILCFLASIVSLIGMSIAGDFKALPKEAKEFK  241

Query  763   LGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFS  942
             LG   YY++  F+AI  Q   +G++G+IF +S+L+ GI  S+L+ + +V +VIF  E F 
Sbjct  242   LGEVLYYVVAVFSAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKFQ  301

Query  943   ADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
             A+K LSLA+ +WGF SYFYG+ K+   K     +  +++E QE
Sbjct  302   AEKGLSLALSLWGFVSYFYGEIKSDNDK---RRIQQEEKESQE  341



>gb|KFK44702.1| hypothetical protein AALP_AA1G292000 [Arabis alpina]
Length=354

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/338 (42%), Positives = 218/338 (64%), Gaps = 9/338 (3%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K  ++IINC+FL +G  GG +L RLY+ +GGKR W  S L TAGFP +L+P+  S+   +
Sbjct  2     KNGLLIINCIFLVIGTCGGPLLTRLYYTNGGKRIWFMSFLSTAGFPVILIPLLFSFLHRR  61

Query  232   akaaanrrr-----VLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLA  396
              +            +L+   LF++S  +GLL G+D+YLY +G++YLPVS SSL+  TQLA
Sbjct  62    NRTETTENAKKEGIILMETPLFIASIVIGLLTGLDNYLYAYGLAYLPVSTSSLIIGTQLA  121

Query  397   FTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGA  576
             F A+FA+ +VK K T +S+NAVVL+T G  +L LH  GD+P  ES + Y +GF MT+  A
Sbjct  122   FNALFAFLMVKQKFTPFSINAVVLLTVGIGILALHSDGDKPAHESRKEYVIGFLMTVVAA  181

Query  577   ALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEARE  756
              L+ FI+  VE  +  A   +T  L++++Q ++ +  ++FC V MII+ DF+ I++EARE
Sbjct  182   VLYAFILPLVELTYKKARQEITFTLVLEMQLVMCIAGSVFCLVGMIIDGDFKVIAREARE  241

Query  757   FDLGTEK-YYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPE  933
             F +G    YY ++    I  Q   +G++G++F +S+L  G+  S+L+ V +V +V+   E
Sbjct  242   FKIGGSMFYYSLIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFRE  301

Query  934   SFSADKLLSLAICIWGFASYFYGDYKTARK---KPPPP  1038
              F A+K ++L + +WGF SYFYG++K+ +K   K  PP
Sbjct  302   KFQAEKGVALLLSLWGFVSYFYGEFKSGKKVLEKAQPP  339



>ref|XP_006410518.1| hypothetical protein EUTSA_v10017788mg [Eutrema salsugineum]
 gb|ESQ51971.1| hypothetical protein EUTSA_v10017788mg [Eutrema salsugineum]
Length=372

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 146/341 (43%), Positives = 219/341 (64%), Gaps = 11/341 (3%)
 Frame = +1

Query  28    KKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPI  207
             KKMK       ++IINC+ LA+G  GG ++ RLY+ +GGKR W SS L TAG P + +P+
Sbjct  19    KKMK-----TALVIINCILLAIGNCGGPLITRLYYRNGGKRIWFSSFLQTAGCPIIFLPL  73

Query  208   FISYarnqakaaanrrrV-----LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISS  372
               S+ R + +             L+ P LF +S  +GLL G D+YLY++G++YLPVS +S
Sbjct  74    LFSFLRRRRRRKEEEEEAKTPFFLIKPPLFFASVVIGLLTGFDNYLYSYGLAYLPVSTAS  133

Query  373   LLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLG  552
             L+ S+QLAFTA+FA+F+VK K T + +NAVVL+T G+ +L LH  GD+   E+ + Y +G
Sbjct  134   LIISSQLAFTALFAFFMVKQKFTPFVINAVVLLTLGAGILALHTDGDKLAKETHKEYVVG  193

Query  553   FFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQ  732
             F MT+A A L+ FI+  VE  +  A   ++  L++++Q ++   +  FC V M+ + DF+
Sbjct  194   FLMTVAAAILYAFILPLVELTYKKARQQISYTLVLEIQMVLCFVATCFCLVGMLADGDFK  253

Query  733   AISKEAREFDLGTEKYY-MIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQV  909
              I+KEAR+F  G   YY ++V F AI  Q   +GS+G+IF +S+L+ GI  S L+ + +V
Sbjct  254   VIAKEARDFKHGGSSYYTVVVVFTAIIWQGFFLGSIGIIFCASSLVSGILISALLPLTEV  313

Query  910   FSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKKPP  1032
              +V+   E F A+K LSL + +WGF SYFYG  K+ +KK P
Sbjct  314   LAVLCFREKFQAEKGLSLFLSLWGFLSYFYGQIKSEKKKTP  354



>ref|NP_001063425.1| Os09g0467400 [Oryza sativa Japonica Group]
 dbj|BAD19736.1| putative purine permease [Oryza sativa Japonica Group]
 dbj|BAF25339.1| Os09g0467400 [Oryza sativa Japonica Group]
 dbj|BAG90051.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 211/320 (66%), Gaps = 4/320 (1%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             + L++ +NC  L VG  GG ++ RLYF  GG R+WLS+ L TAG+P LLVP+  SY   +
Sbjct  24    RWLLVALNCGMLVVGTTGGPLISRLYFSKGGHRQWLSAWLQTAGWPLLLVPVAASYLSRR  83

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
             A+       +  T  + ++   LG L G D ++Y +G++YLPVS S++L STQLAFT  F
Sbjct  84    ARDRRAPLFLTPTR-VLLAGVGLGFLNGADDFIYAYGLAYLPVSTSAILISTQLAFTVFF  142

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A  IV+ + T  ++NAV L+T G+VVLGLH + DRP G +   Y +GFF+T+  AAL+G 
Sbjct  143   ACLIVRQRFTAATLNAVALLTIGAVVLGLHASKDRPAGVTSGKYWMGFFLTLGAAALYGL  202

Query  592   IMAGVEYAHVHA---GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFD  762
             I+  VE A+ HA   G  VT  L+M++Q ++  F+  FCTV M++NKDFQAI +EA++++
Sbjct  203   ILPLVELAYKHAAGGGRAVTYALVMEMQLVMGFFATAFCTVGMVVNKDFQAIPREAKQYE  262

Query  763   LGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFS  942
             LG  +YY+++ F A+  +   +G++GVIF    LL GI  ++ + + +V  VIFL E FS
Sbjct  263   LGEARYYVVLVFNAVLWEFFFVGAVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFS  322

Query  943   ADKLLSLAICIWGFASYFYG  1002
             ++K ++L + +WG ASY YG
Sbjct  323   SEKGVALVLSLWGLASYSYG  342



>ref|XP_003579811.2| PREDICTED: purine permease 3-like [Brachypodium distachyon]
Length=365

 Score =   274 bits (700),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 213/321 (66%), Gaps = 3/321 (1%)
 Frame = +1

Query  58    LVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqak  237
             L++ +NC  L +G  GG +L RLY+  GG+R+WLS+ L T G+P LL P+  SY   +A+
Sbjct  29    LMVALNCGMLTLGTTGGPLLSRLYYSKGGQRQWLSAWLETGGWPLLLFPVSFSYLARRAR  88

Query  238   aaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAY  417
                    VL  P   M++A LGL  G D ++Y +G+SYLPVS S++L STQLAFT  FA+
Sbjct  89    DGPGAPLVLTRPRTLMAAAALGLATGADDFIYAYGLSYLPVSTSAILISTQLAFTVFFAF  148

Query  418   FIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIM  597
              +V+ +LT +SVNAV L+T G+VVLGLH + DRP G +   Y LGFF+++  AAL+G ++
Sbjct  149   LVVRQRLTAFSVNAVALLTVGAVVLGLHASSDRPAGVTRGQYWLGFFLSLGAAALYGLVL  208

Query  598   AGVEYAHVHA---GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG  768
               +E A+ HA   G  VT  L++++Q ++  F+  FCTV M++N DFQAIS+EAR F+LG
Sbjct  209   PLIELAYKHAAGGGREVTYALVLEMQLVMGFFATAFCTVGMVVNNDFQAISREARAFELG  268

Query  769   TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
               +YY+++   A+  Q   +G++GVIF    L  GI  ++ + V +V  VIFL E FS++
Sbjct  269   ETRYYVVLVSCAVLWQFFFLGAVGVIFCVHTLFAGILIAVFIPVTEVLGVIFLHEKFSSE  328

Query  949   KLLSLAICIWGFASYFYGDYK  1011
             K ++L + +WG ASY YG+Y 
Sbjct  329   KGVALVLSLWGLASYSYGEYS  349



>ref|XP_010460601.1| PREDICTED: purine permease 1 [Camelina sativa]
Length=354

 Score =   273 bits (699),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/349 (41%), Positives = 221/349 (63%), Gaps = 12/349 (3%)
 Frame = +1

Query  61    VIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqaka  240
             ++IINC+ L +G  GG +L RLY+ +GGKR W  S L TAG P +L+P+ +S+   + + 
Sbjct  5     LLIINCIILTIGTCGGPLLTRLYYNNGGKRIWFMSFLSTAGCPIILIPLLVSFLNRRKRN  64

Query  241   aanrrr-----VLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
              A         ++ TP LF++S  +GLL+G+D+YLY +G++YLPVS SSL+  TQLAF A
Sbjct  65    KAENVAKTELFLMETP-LFVASIVIGLLIGLDNYLYAYGLAYLPVSTSSLIIGTQLAFNA  123

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
             +FA+ +VK K T +SVNAVVL+T G+ +L LH  GD+P  ES + Y +GF MT+  A L+
Sbjct  124   LFAFLLVKQKFTPFSVNAVVLLTVGTGILALHSDGDKPANESHKEYVVGFLMTVIAAVLY  183

Query  586   GFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDL  765
              FI+  VE  +  A   +T  L++++Q ++ + +  FC V M I  DF+ I+KEAREF +
Sbjct  184   AFILPLVELTYKKARQEITFPLVLEIQMVMCLSATCFCVVGMFIVGDFKVIAKEAREFKI  243

Query  766   GTEK-YYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFS  942
             G    YY ++    I  Q   +G++G++F +S+L  G+  S+L+ V +V +V+   E F 
Sbjct  244   GGSAFYYALIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFREKFQ  303

Query  943   ADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQEV*STYH  1089
             A+K +SL + +WGF SYFYG++K+ +K    P      +   E+ +T H
Sbjct  304   AEKCVSLLLSLWGFVSYFYGEFKSGKKVVDKP-----QQTETELPTTLH  347



>ref|XP_009109746.1| PREDICTED: purine permease 1-like [Brassica rapa]
Length=356

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/353 (41%), Positives = 223/353 (63%), Gaps = 19/353 (5%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K  ++II C+FLA+G  GG +L RLY+  GG R W  S L TAG P +L+P+++S+ R  
Sbjct  3     KNGLLIIVCIFLAIGTCGGPLLTRLYYTKGGSRIWFMSFLATAGCPIILIPLYVSFLRRS  62

Query  232   -------akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQ  390
                      A   +  V+ TP LF++S  +GLL+G+D+YLY +G++YLPVS SSL+  TQ
Sbjct  63    NRNHNNSETAEKAKVFVMETP-LFIASIVIGLLIGLDNYLYAYGLAYLPVSTSSLIVGTQ  121

Query  391   LAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIA  570
             LAF A+F++ +VK K T +S+NAVVL+T G+ +L LH   DRP G S + Y +GF +T+ 
Sbjct  122   LAFNAIFSFLMVKQKFTPFSINAVVLLTVGTGILALHTDRDRPAGVSKKEYVVGFLLTLI  181

Query  571   GAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEA  750
              A L+ F+M  VE  +      +T  L++++Q ++ + S  FC V M++  DF AI +EA
Sbjct  182   AAVLYAFLMPLVELTYKKVRQEITFTLVLEMQMVMCVASTCFCLVGMVVKGDFVAIPREA  241

Query  751   REFDLGTEK-YYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFL  927
             REF +G+   YY ++    I  Q   +G+LGV++ +S+L  G+F S+L+ V +V +V+  
Sbjct  242   REFMIGSSLFYYTLIVVIGIVWQCFFLGALGVVYCASSLASGVFVSVLLPVTEVLAVVCF  301

Query  928   PESFSADKLLSLAICIWGFASYFYGDYKTARK----------KPPPPPVTGDD  1056
              E F A+K ++L + +WGF SYFYG++K+ +K          + PP PV+G D
Sbjct  302   REKFQAEKGVALLLSLWGFVSYFYGEFKSGKKIIDSPKSPETELPPLPVSGSD  354



>ref|XP_010460596.1| PREDICTED: purine permease 3 [Camelina sativa]
Length=353

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/343 (43%), Positives = 224/343 (65%), Gaps = 9/343 (3%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             KALVII NC+ LA+G  GG +++RLYF +GGKR W S+ L TAGFP + +P+  SY   +
Sbjct  3     KALVII-NCIILAIGNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYIHRR  61

Query  232   akaaanrrrV---LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFT  402
                          L+ P L  ++  +G+L G D+YLY +G++YLPVS ++L+ ++QLAF 
Sbjct  62    RNNNGGENATSFFLIKPRLLGAAIVIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFI  121

Query  403   AVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAAL  582
             A+F++F+VKHK T +++NAVVL+T G+ VLG+H   DRP  E+ + Y +GF +T+A A +
Sbjct  122   AIFSFFMVKHKFTPFTINAVVLLTVGAAVLGMHTETDRPVHETHKQYVIGFLVTVAAAVV  181

Query  583   HGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFD  762
             + FI+  VE A+  A  P++  L+++VQ I+   +++   + M I  DF+A+ KEA+EF 
Sbjct  182   YAFILPLVELAYQKAKQPLSYTLVLEVQMILCFLASIVSLIGMSIAGDFKALPKEAKEFK  241

Query  763   LGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFS  942
             LG   +Y++  F+AI  Q   +G++G+IF +S+L+ GI  S+L+ + +V +VIF  E F 
Sbjct  242   LGEALFYVVAVFSAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKFQ  301

Query  943   ADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
             A+K LSLA+ +WGF SYFYG+ K+   K          EE QE
Sbjct  302   AEKGLSLALSLWGFVSYFYGEIKSDNDKK-----RIQQEESQE  339



>ref|XP_010926344.1| PREDICTED: purine permease 3-like isoform X1 [Elaeis guineensis]
Length=367

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 151/329 (46%), Positives = 222/329 (67%), Gaps = 1/329 (0%)
 Frame = +1

Query  61    VIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqaka  240
             ++  N V + VG  GG +L+RLYF+ GG R WLS+ L  A +P LL+P+++S        
Sbjct  32    LVAFNAVLMLVGSGGGSLLLRLYFVRGGHRMWLSTFLQVAAWPILLLPLYLSRLFLPTTT  91

Query  241   aanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYF  420
                R  +L+   L  +SAFLGLL+ +D YLY +G S LP+S SSLL ++QLAFTAVF++ 
Sbjct  92    TPRRHHLLLPLPLAAASAFLGLLIALDCYLYAYGSSCLPLSTSSLLIASQLAFTAVFSFL  151

Query  421   IVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMA  600
             IV+ + T +S+NAVVL+T G VVL L  AGDRPEGE+   Y +GFFM+IA AAL G ++ 
Sbjct  152   IVRQRFTAFSLNAVVLLTLGPVVLSLGAAGDRPEGEAMSKYYVGFFMSIAAAALIGLVLP  211

Query  601   GVEYAHVHAGVP-VTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEK  777
              VE A+       +T   ++  Q ++    ++FC + M+INKDFQAI KEA++F+LG  K
Sbjct  212   LVELAYRRMSTEEMTYATVIVTQIVMGASGSVFCLLGMLINKDFQAIPKEAKDFELGELK  271

Query  778   YYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLL  957
             YYM++ + AI  Q++ +G +GVIF++S+L  G+  ++LV V ++ +VIFL E F+  K +
Sbjct  272   YYMVLIWNAICWQIINVGMVGVIFTASSLFCGVMIAILVPVGEILAVIFLNEKFNGSKGV  331

Query  958   SLAICIWGFASYFYGDYKTARKKPPPPPV  1044
             +LA+C+WGFASY YG+ K ++K+  P  V
Sbjct  332   ALALCLWGFASYMYGEMKQSKKQKQPSSV  360



>ref|XP_010538169.1| PREDICTED: purine permease 3-like [Tarenaya hassleriana]
Length=346

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 144/342 (42%), Positives = 224/342 (65%), Gaps = 10/342 (3%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISY--ar  225
             KAL II NC+ L +G  GG ++ RLY+ +GG+R WLSS L T GFP + +P+F      +
Sbjct  3     KALAII-NCILLGIGNCGGPLMSRLYYNNGGQRIWLSSLLETGGFPIMSIPLFFCLLDRK  61

Query  226   nqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
              +       R +L+ P LF ++A  GLL GVD Y+Y +G+S+LPVS +SL+ ++QLAFTA
Sbjct  62    RKRNRDEKTRLILMKPRLFAAAAVAGLLTGVDDYIYAYGLSFLPVSTASLIIASQLAFTA  121

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
              FA+F+VK K T +S+NA+VL+T G+ VL LH AGD P  E+ + Y  GF +TI  A L+
Sbjct  122   FFAFFLVKQKFTPFSINAIVLLTLGAGVLALHTAGDVPPNETHKQYITGFLLTIGAAVLY  181

Query  586   GFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDL  765
              F++  VE ++  A  P+T  L+++ QF++  F+ LFC   + I+ DF+ I  EA+ F L
Sbjct  182   AFVLPLVELSYKKANQPITYTLVLEFQFVMCFFATLFCATGLFISGDFKMIPAEAKTFKL  241

Query  766   GTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSA  945
             G   YY+++ FA++  Q   +G++GVIF +S+L+ GI  ++L+ + ++ +V+F  E F A
Sbjct  242   GETLYYVVIVFASMMWQCFFLGAIGVIFCASSLVSGILIAVLLPLTEILAVVFFGEKFQA  301

Query  946   DKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
             +K +SL + +WGFASYFYG+ K+ +++        D+E  +E
Sbjct  302   EKGVSLVLSLWGFASYFYGEVKSDKER-------RDNERTRE  336



>ref|XP_010478191.1| PREDICTED: purine permease 1-like [Camelina sativa]
Length=354

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 140/338 (41%), Positives = 214/338 (63%), Gaps = 7/338 (2%)
 Frame = +1

Query  61    VIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqaka  240
             ++IINC+ L +G  GG +L RLY+ +GGKR W  S L TAG P +L+P+  S+   + + 
Sbjct  5     LLIINCIILTIGTCGGPLLTRLYYNNGGKRIWFMSFLSTAGCPIILIPLLFSFLNRRNRN  64

Query  241   aanrrr-----VLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
              A         ++ TP LF++S  +GLL+G+D+YLY +G+ YLPVS SSL+  TQLAF A
Sbjct  65    KAENVAKTELFLMETP-LFIASTVIGLLIGLDNYLYAYGLRYLPVSTSSLIIGTQLAFNA  123

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
             +FA+ +VK K T +S+NAVVL+T G+ +L LH  GD+P  ES R Y +GF MT+  A L+
Sbjct  124   LFAFLLVKQKFTPFSINAVVLLTVGTGILALHSDGDKPANESHREYVVGFLMTVIAAVLY  183

Query  586   GFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDL  765
              FI+  VE  +  A   +T  L++++Q ++ + +  FC V M I  DF+ I+KEAREF +
Sbjct  184   AFILPLVELTYKKARQEITFPLVLEIQMVMCLSATCFCVVGMFIVGDFKVIAKEAREFKI  243

Query  766   GTEK-YYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFS  942
             G    YY ++    I  Q   +G++G++F +S+L  G+  S+L+ + +V +V+   E F 
Sbjct  244   GGSAFYYALIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPMTEVLAVVCFREKFQ  303

Query  943   ADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDD  1056
             A+K  SL + +WGF SYFYG++K+ +K    P  T  +
Sbjct  304   AEKCASLLLSLWGFVSYFYGEFKSGKKVVDKPQQTETE  341



>gb|EYU21538.1| hypothetical protein MIMGU_mgv1a020196mg [Erythranthe guttata]
Length=353

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 151/322 (47%), Positives = 223/322 (69%), Gaps = 4/322 (1%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K   +I+N V LAVG  GG +++RLYF+ GG+R W SS L T G+P +L+P+  +Y R +
Sbjct  2     KTTFLIMNGVILAVGNCGGPLIMRLYFIRGGERIWFSSWLETGGWPIILIPLIAAYIRRR  61

Query  232   akaaanr----rrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAF  399
                 A      + +L+ P LF +++ +G+L G+D YLY  G++ LP+S ++LL++T L F
Sbjct  62    RSTTAAADGAAKLILMKPRLFSAASVIGILTGLDDYLYAKGVAKLPISTAALLAATHLVF  121

Query  400   TAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAA  579
             TA FA+ +VK K T YSVNAVVL+T G+VVLGLH +GDRPEGES++ Y +GF M ++ AA
Sbjct  122   TAAFAFLLVKQKFTAYSVNAVVLLTVGTVVLGLHTSGDRPEGESEKEYVVGFIMALSAAA  181

Query  580   LHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREF  759
             L+G I+  VE  +  A   +T  L+M++Q +I  F+ LFCTV M+IN DFQAIS+EA+E+
Sbjct  182   LYGLILPVVELMYKKAKQALTYTLIMEIQLVICFFATLFCTVGMLINNDFQAISREAKEY  241

Query  760   DLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESF  939
             +LG  KYY++V ++AI  QL  +G +GVIF SS+LL GI  ++ + + Q+  V    E F
Sbjct  242   ELGEMKYYLVVIWSAIIWQLFFLGVVGVIFYSSSLLSGIIITVTIPITQILGVFIYNEKF  301

Query  940   SADKLLSLAICIWGFASYFYGD  1005
              A+K ++L + +WGF SYF+G+
Sbjct  302   QAEKGIALFLSLWGFISYFFGE  323



>ref|XP_010248452.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=326

 Score =   270 bits (689),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 151/328 (46%), Positives = 221/328 (67%), Gaps = 3/328 (1%)
 Frame = +1

Query  85    LAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVL  264
             +A+G IGG +L+RLY+LHGG R+WLS  L +AGFP LL+P+ + Y  ++ +   +     
Sbjct  1     MAIGNIGGPLLMRLYYLHGGNRRWLSCSLQSAGFPILLIPLSLLYLHHRRRRGVSPSEFF  60

Query  265   VTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTH  444
             + P L +SSA LGLLLG+D+++Y  G+SY+PVS S+LL +TQLAFTA FA  IVK + T 
Sbjct  61    IEPKLLVSSAVLGLLLGLDNFMYALGLSYIPVSTSALLFATQLAFTAGFARLIVKQRFTP  120

Query  445   YSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVH  624
             YS+N+VVLM  GS+ LG+H  GD P G SD  Y  GFF+T+  A L GFI+  +E+A+  
Sbjct  121   YSINSVVLMILGSITLGIHSGGDWPAGVSDGEYLSGFFLTLGSALLVGFILPCIEFAYSK  180

Query  625   AGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAA  804
             A   V    +MQ QF + +F+ +F  + M+INKDFQ I +EARE++LG   YY ++  +A
Sbjct  181   ASRAVDFAAVMQFQFNMGLFATIFAAMEMLINKDFQEIPREAREYELGHGMYYFVLSASA  240

Query  805   IALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGF  984
             I  QL ++G LG+IF +++L  GI+ ++L+   ++ +VI   E F+ +K ++LA+C+WGF
Sbjct  241   IVWQLSLIGLLGLIFCTTSLFTGIYGAVLLPFAEIGAVIAYHEKFTGEKGIALALCLWGF  300

Query  985   ASYFYGDYKTARKKPPPPPVTGDDEEHQ  1068
              SYFYG+Y   RK      +T DD+  Q
Sbjct  301   TSYFYGEY---RKSKVERSMTIDDQSPQ  325



>gb|EPS67422.1| hypothetical protein M569_07351, partial [Genlisea aurea]
Length=319

 Score =   269 bits (688),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 140/320 (44%), Positives = 209/320 (65%), Gaps = 2/320 (1%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             + + +I+N   L VG   G +++RLYF  GG R W SS L +AGFP +L+P+  SY   +
Sbjct  2     RMIFLIMNAALLTVGSCAGPLIMRLYFTRGGNRIWFSSWLESAGFPIILIPLIYSYCAGR  61

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
                 +    + + P L  ++A +G+L G+D+YLY +G++ LPVS SSL+ ++QL FTAVF
Sbjct  62    GTHPSGI--ISMNPKLCSAAAVVGVLAGLDNYLYAYGVAKLPVSTSSLIIASQLGFTAVF  119

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             AY IVK K T +S+NAVVL+T  + +L LH  GDRP+GES+  Y  GF +T+A AAL+G 
Sbjct  120   AYLIVKQKFTAFSINAVVLLTVAAGILALHSNGDRPKGESNGDYYTGFVLTLAAAALYGL  179

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             ++  VE A+   G  +    +++ QF++  F+ L CT+ M ++ DF AI  EAR F LG 
Sbjct  180   MLPLVELAYAKTGQDLNYDAVLKFQFVLGFFATLACTIGMAVSGDFPAIPTEARGFQLGE  239

Query  772   EKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADK  951
              +YY +V  +AI  Q   +G++GVIF SSALL G+  S+L+   ++ +V+F  E F A+K
Sbjct  240   GRYYAVVVSSAIIWQCFFLGNIGVIFYSSALLSGVLISVLLPPTEILAVLFFREKFQAEK  299

Query  952   LLSLAICIWGFASYFYGDYK  1011
              +SL + ++GF SYFYG+YK
Sbjct  300   GVSLFLSLFGFVSYFYGEYK  319



>ref|XP_009143833.1| PREDICTED: purine permease 2 isoform X2 [Brassica rapa]
Length=362

 Score =   270 bits (691),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 139/344 (40%), Positives = 221/344 (64%), Gaps = 16/344 (5%)
 Frame = +1

Query  43    LSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISY-  219
             +  K +++IINC+ LA+G  GG ++ RLYF +GGKR W SS L T+G P +L+P+  S+ 
Sbjct  1     MKMKTVLVIINCIILAIGNCGGPLMTRLYFRNGGKRIWFSSFLQTSGCPIILLPLLFSFL  60

Query  220   ---arnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQ  390
                 + Q +        L+ P LF++S  +GLL+G D+YLY +G++YLPVS SSL+ S+Q
Sbjct  61    TRHRQQQEQEEPKTTLFLIKPPLFLASVVVGLLIGFDNYLYAYGLAYLPVSTSSLIISSQ  120

Query  391   LAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIA  570
             LAFTA+FA+F+VK + T +++NAVVL+T G+  L LH  GD+   E+ + Y +GF MT+A
Sbjct  121   LAFTALFAFFMVKQRFTPFTINAVVLLTLGAGSLALHADGDKLPKETRKEYIVGFVMTVA  180

Query  571   GAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDF-------  729
              A L+ F++  VE A+  A   ++  L++++Q ++ + +   C V M+ + DF       
Sbjct  181   AAVLYAFVLPLVELAYKKASQRISYTLVLEMQLVLCVVATCLCLVGMLADGDFKNQEFDF  240

Query  730   ----QAISKEAREFDLGTEKYY-MIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLV  894
                 Q + +EAREF LG  K+Y ++V F A+  Q   +GS+G+IF +S+L+ G+  S L+
Sbjct  241   LFTVQELGREAREFKLGGSKHYCLVVAFTAVIWQGFFLGSIGMIFCASSLVSGVLISALL  300

Query  895   AVQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
              + +V +V+F  E F A K +SL + +WGF SYFYG  ++ ++K
Sbjct  301   PLTEVLAVLFFKEKFQAAKGVSLFLSLWGFVSYFYGKIQSEKEK  344



>gb|EYU38177.1| hypothetical protein MIMGU_mgv1a023817mg [Erythranthe guttata]
Length=357

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 152/348 (44%), Positives = 224/348 (64%), Gaps = 8/348 (2%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K   +I+N V LAVG  GG +++RLYF+ GGKR W SS L T G+P +L+P+  +Y   +
Sbjct  2     KTTFLIMNGVILAVGNSGGPLIMRLYFIRGGKRIWFSSWLETGGWPIILIPLLAAYISRR  61

Query  232   akaaanrrrV--------LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSST  387
              +   +            L+ P LF +++ +G+L G+D YLY  G++ LP+S ++LL++T
Sbjct  62    RRRRRSTTTAADGAAKLFLMKPRLFSAASAIGILTGLDDYLYAKGVAELPISTAALLAAT  121

Query  388   QLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTI  567
              L FTA FA+ +VK K T YSVNAVVL+T G+VVLGLH +GDRPEGES++ Y +GFFM +
Sbjct  122   HLVFTAAFAFLLVKQKFTAYSVNAVVLLTVGTVVLGLHTSGDRPEGESEKEYVVGFFMAL  181

Query  568   AGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKE  747
             + A L+GFI+  VE  +  A   +T  L+M++Q +I  F+ LFCTV M+IN DFQAIS+E
Sbjct  182   SAAGLYGFILPVVELMYKKAKQALTYTLIMEIQLVICFFATLFCTVGMLINNDFQAISRE  241

Query  748   AREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFL  927
             A+E++LG  KYY++V ++AI  QL  +G +GVIF SS+LL  I  ++ + + Q+  V   
Sbjct  242   AKEYELGEMKYYLVVIWSAIIWQLFFLGVVGVIFYSSSLLCAIIITVTIPITQILGVFIY  301

Query  928   PESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
              E F A+K ++L + +WGF SYF+G+    +        T    E   
Sbjct  302   NEKFQAEKGIALFLSLWGFISYFFGEITKTKNSNENNDQTRTTTETDR  349



>ref|XP_003519187.1| PREDICTED: purine permease 1-like [Glycine max]
Length=344

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 214/313 (68%), Gaps = 1/313 (0%)
 Frame = +1

Query  88    AVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLV  267
             A G  GG +++RLYF+HGGKR WLSS L TA FP +++   I    ++ +   +   + +
Sbjct  15    ATGTSGGALVMRLYFIHGGKRIWLSSFLETAAFPIIIL-PIIISYIHKRRRHRSSALISI  73

Query  268   TPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHY  447
              P LF++SA +GLL G+D YLY  G++ LPVS  SL+ ++ LAFTAVFA+ +V+H+ T Y
Sbjct  74    KPPLFLASALIGLLTGLDDYLYACGVARLPVSTFSLIQASHLAFTAVFAFLLVRHRFTPY  133

Query  448   SVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHA  627
             SVN+VVL+T  +VVL L  +GDRP GES R Y +GF M +A AAL+GF++  +E  +  +
Sbjct  134   SVNSVVLLTVAAVVLALRSSGDRPAGESSRQYVIGFVMILAAAALYGFVLPLMELVYKKS  193

Query  628   GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAI  807
                +T  L+M++Q ++  F+ LFCTV MIIN DF+ I +EAR+F LG  KYY+++ ++AI
Sbjct  194   RQRITYSLVMEIQLVLCFFATLFCTVGMIINNDFKVIPREARDFKLGETKYYVVLVWSAI  253

Query  808   ALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFA  987
               Q   +G++GVIF +S+LL GI  +  + V +V +VI   ESF A+K ++L + +WGF 
Sbjct  254   MWQFFFLGAIGVIFCASSLLSGIIIAAFLPVTEVLAVIVYKESFHAEKGVALVLSLWGFV  313

Query  988   SYFYGDYKTARKK  1026
             SYFYG+ K  R+K
Sbjct  314   SYFYGEIKQDREK  326



>ref|XP_009599635.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=352

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/318 (45%), Positives = 217/318 (68%), Gaps = 0/318 (0%)
 Frame = +1

Query  88    AVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLV  267
             AVG  GG +++RLY++ GG R W SS L TAG+P  L+P+ I Y   +     N +  L+
Sbjct  23    AVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTLIPLAILYFYRRKTEGINAKYYLI  82

Query  268   TPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHY  447
             TP +F++S  +G++ G+D +LY++G S LPVS SSLL + QLAFTAV A+FIVK K T Y
Sbjct  83    TPRIFIASFIIGVVTGLDDFLYSWGGSKLPVSTSSLLLAAQLAFTAVGAFFIVKLKFTPY  142

Query  448   SVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHA  627
             S+NAVVL+T G V+LG+   GDRPEG + ++Y LGF MT+  AAL+G I+  +E  ++ A
Sbjct  143   SINAVVLLTVGVVLLGVRSNGDRPEGVTSKAYILGFMMTLLAAALYGVILPCIELIYLKA  202

Query  628   GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAI  807
                +T  L++++Q ++   +  FCTV MI N DFQAIS+EA++F+LG  +YY ++ +  I
Sbjct  203   KQAITATLVLEIQMVMCFAATAFCTVGMIANNDFQAISREAKQFNLGEARYYTVIVWTTI  262

Query  808   ALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFA  987
               Q   +G +GVI+ SS+L+ G+  ++L+ V +V +V+F  E+FS +K L+L + +WGF 
Sbjct  263   IWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRENFSGEKGLALFLSLWGFV  322

Query  988   SYFYGDYKTARKKPPPPP  1041
             SYFYG+++  +K+    P
Sbjct  323   SYFYGEFRQTKKEKNKSP  340



>tpg|DAA61854.1| TPA: hypothetical protein ZEAMMB73_233624 [Zea mays]
Length=394

 Score =   270 bits (690),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 145/366 (40%), Positives = 220/366 (60%), Gaps = 32/366 (9%)
 Frame = +1

Query  22    DMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLV  201
             D    +  +    ++ +NC  LAVG IGG +L RLYF  GG R+WLS+ L T G+P L++
Sbjct  9     DAPPARGKAMHRFLVALNCGMLAVGAIGGPLLSRLYFSKGGHRQWLSAWLETGGWPLLVI  68

Query  202   PIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLS  381
             P+  S+   +A+       +L  P + +++A LG+  G D ++Y FG++YLPVS S++L 
Sbjct  69    PVAASFVARRARDRGAPV-LLAPPRILLAAAGLGVATGADDFIYAFGLAYLPVSTSAILI  127

Query  382   STQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFM  561
             STQLAFT  FA+ +V+ +LT  SVNAV L+T G+VVLGLH++ DRP G +   Y LGF +
Sbjct  128   STQLAFTVFFAFLVVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGVTRGQYWLGFVL  187

Query  562   TIAGAALHGFIMAGVEYAH----VHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDF  729
             T+  AAL+G ++  VE A+       G  VT  L++++Q ++  F+  FCTV M++NKDF
Sbjct  188   TLGAAALYGLVLPLVELAYRRAAGAGGRAVTYALVVEMQLVMGFFATAFCTVGMVVNKDF  247

Query  730   Q---------------------------AISKEAREFDLGTEKYYMIVGFAAIALQLMVM  828
             Q                           AI +EAR + LG  +YY ++ ++A+  Q   +
Sbjct  248   QGAHRLANWQQQCPRAEMPPDDGIIIGAAIPREARRYKLGEARYYAVLAWSAVLWQCFFL  307

Query  829   GSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDY  1008
             G++GVIF    LL GI  ++ + V +V +VIFL E FS++K ++L + +WG ASY YG++
Sbjct  308   GAVGVIFCVHTLLAGILIAVFIPVTEVAAVIFLRERFSSEKGVALVLSLWGLASYSYGEW  367

Query  1009  KTARKK  1026
               AR K
Sbjct  368   SEARAK  373



>ref|XP_008667894.1| PREDICTED: PUP1 isoform X1 [Zea mays]
 tpg|DAA40285.1| TPA: PUP1 [Zea mays]
Length=387

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 141/333 (42%), Positives = 215/333 (65%), Gaps = 8/333 (2%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
             + +  ++++N V + VG  GG + +R YFLHGG RKWLS+ L TAGFP LLVP+ +S++R
Sbjct  38    TLRNPLLVVNFVLMVVGSAGGPLFLRAYFLHGGARKWLSALLQTAGFPLLLVPLCVSFSR  97

Query  226   nqak----aaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQL  393
              + +    A A     L+TP L  +SA +GL+ G+D  LY +G++YLPVS SS+L STQL
Sbjct  98    RRRRRDDGAPAKAPFFLMTPRLLAASAAIGLMTGLDDLLYAYGLAYLPVSTSSILISTQL  157

Query  394   AFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAG  573
             AFTA FA  +V+ + T +SVNAV L++ G+ +LG++  GDRP G S   Y  GF MT+  
Sbjct  158   AFTAAFALLLVRQRFTAFSVNAVALLSAGAAMLGMNAGGDRPAGVSPAQYGAGFAMTLGA  217

Query  574   AALHGFIMAGVEYAH----VHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAIS  741
             AAL+G ++  +E +           VT  L++++Q +I + + +F  V M+ N D  AI 
Sbjct  218   AALYGLLLPAMELSQAQARAGTAAAVTYTLVIEMQLVIGLTATVFSAVGMLANHDLHAIP  277

Query  742   KEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVI  921
              EAREFDLG   YY+++  +A   Q   +G++G +F  SALL G+  ++L+ V +V +V+
Sbjct  278   GEAREFDLGRSGYYLLLAGSAATYQCFFLGTIGAVFFGSALLAGVVMTVLIPVTEVLAVV  337

Query  922   FLPESFSADKLLSLAICIWGFASYFYGDYKTAR  1020
             F  E F+  K ++LA+ +WGF SYFYG+ +T++
Sbjct  338   FFHEPFNGTKGVALALSLWGFVSYFYGEVQTSK  370



>ref|XP_006295883.1| hypothetical protein CARUB_v10025013mg [Capsella rubella]
 gb|EOA28781.1| hypothetical protein CARUB_v10025013mg [Capsella rubella]
Length=349

 Score =   267 bits (683),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 136/326 (42%), Positives = 212/326 (65%), Gaps = 1/326 (0%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K +++I+NCVFLA+G  GG ++IRLYF +GG+R W SS L T GFP +L P+  S+ R +
Sbjct  5     KTVLVIVNCVFLAIGNCGGPLMIRLYFHNGGERIWFSSFLQTVGFPLILFPLLFSFLRRR  64

Query  232   akaaanrrrV-LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAV  408
                   +    L+ P LF++S  +GLL+G D+YLY++G++YLPVS +SL+ S QL FTA+
Sbjct  65    RLEEQEKTSFFLMKPRLFIASVVVGLLMGFDNYLYSYGLAYLPVSTASLIISAQLGFTAL  124

Query  409   FAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHG  588
             FA+F+VK K T +++NA+VL+T G+VVL L+   D+   E+ + Y +GF M +  A L+ 
Sbjct  125   FAFFMVKQKFTPFTINAIVLLTVGAVVLALNSESDKLANETHKEYVVGFLMVVGAALLYA  184

Query  589   FIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG  768
             FI+  VE  +  +   +T  L+++ Q ++   +  FC V M+   DF+ I++EAR F LG
Sbjct  185   FILPLVELTYKKSRQRITYTLVLEFQMVLCFVATCFCLVGMLAAGDFKVIAREARGFKLG  244

Query  769   TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
                YY+++ F A+  Q   +G++G+IF +S+L+ GI  S L+ V  + +VI   E F A 
Sbjct  245   ESLYYVVIVFTAVIWQAFFVGAIGLIFCASSLVSGIMISALLPVTVILAVICFREKFQAG  304

Query  949   KLLSLAICIWGFASYFYGDYKTARKK  1026
             K ++LA+ +WG  SYFYG  K+ + K
Sbjct  305   KGVALALSLWGSVSYFYGQIKSEKTK  330



>gb|EAZ09425.1| hypothetical protein OsI_31698 [Oryza sativa Indica Group]
Length=388

 Score =   268 bits (686),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 146/351 (42%), Positives = 214/351 (61%), Gaps = 21/351 (6%)
 Frame = +1

Query  49    FKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarn  228
             F++ ++++N V + VG   G +L+R YFL GG RKWLSS L TAG+P LL P+  SY+  
Sbjct  33    FRSPLLVVNFVLMVVGSACGPLLLRAYFLRGGNRKWLSSLLQTAGWPLLLAPLCFSYSSR  92

Query  229   qakaaanrrrV----------LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLL  378
             + +                  L+TP L ++SA +GL+ GVD  LY +G++YLPVS SS+L
Sbjct  93    RRRREVEDDGAGAGAAATPLFLMTPRLLVASAVVGLMTGVDDLLYAYGLAYLPVSTSSIL  152

Query  379   SSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFF  558
              STQLAFTA FA  +V+ + T +SVNAVVL++ G+ +LG++  GDRP G S   Y  GF 
Sbjct  153   ISTQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVSRAQYCAGFA  212

Query  559   MTIAGAALHGFIMAGVEYAHVH---AGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDF  729
             MT+A AAL+G ++  +E +  H   A   VT  L+M++Q +I   +  F  V M++N DF
Sbjct  213   MTLAAAALYGLVLPVMELSQAHHAAARGAVTYTLVMEMQLVIGFVATAFSAVGMLVNNDF  272

Query  730   QAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQV  909
              AI  EA EF LG   YY+++  +A   Q   +G++G IF  SALL G+  ++L+ V +V
Sbjct  273   HAIPGEAHEFGLGQAGYYLLLAGSAAMYQCFFLGTIGAIFYGSALLAGVIMTVLIPVTEV  332

Query  910   FSVIFLPESFSADKLLSLAICIWGFASYFYGD--------YKTARKKPPPP  1038
              +V+F  E F+  K ++LA+ +WGF SYFYG+         +    +PP P
Sbjct  333   LAVMFFHEPFNGTKGVALALSLWGFVSYFYGEVRAAKAAHRRRHSDEPPKP  383



>ref|NP_001063424.1| Os09g0467300 [Oryza sativa Japonica Group]
 dbj|BAD17524.1| putative purine permease [Oryza sativa Japonica Group]
 dbj|BAD19735.1| putative purine permease [Oryza sativa Japonica Group]
 dbj|BAF25338.1| Os09g0467300 [Oryza sativa Japonica Group]
Length=390

 Score =   268 bits (686),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 146/351 (42%), Positives = 214/351 (61%), Gaps = 21/351 (6%)
 Frame = +1

Query  49    FKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarn  228
             F++ ++++N V + VG   G +L+R YFL GG RKWLSS L TAG+P LL P+  SY+  
Sbjct  35    FRSPLLVVNFVLMVVGSACGPLLLRAYFLRGGNRKWLSSLLQTAGWPLLLAPLCFSYSSR  94

Query  229   qakaaanrrrV----------LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLL  378
             + +                  L+TP L ++SA +GL+ GVD  LY +G++YLPVS SS+L
Sbjct  95    RRRREVEDDGAGAGAAATPLFLMTPRLLVASAVVGLMTGVDDLLYAYGLAYLPVSTSSIL  154

Query  379   SSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFF  558
              STQLAFTA FA  +V+ + T +SVNAVVL++ G+ +LG++  GDRP G S   Y  GF 
Sbjct  155   ISTQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVSRAQYCAGFA  214

Query  559   MTIAGAALHGFIMAGVEYAHVH---AGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDF  729
             MT+A AAL+G ++  +E +  H   A   VT  L+M++Q +I   +  F  V M++N DF
Sbjct  215   MTLAAAALYGLVLPVMELSQAHHAAARGAVTYTLVMEMQLVIGFVATAFSAVGMLVNNDF  274

Query  730   QAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQV  909
              AI  EA EF LG   YY+++  +A   Q   +G++G IF  SALL G+  ++L+ V +V
Sbjct  275   HAIPGEAHEFGLGQAGYYLLLAGSAAMYQCFFLGTIGAIFYGSALLAGVIMTVLIPVTEV  334

Query  910   FSVIFLPESFSADKLLSLAICIWGFASYFYGD--------YKTARKKPPPP  1038
              +V+F  E F+  K ++LA+ +WGF SYFYG+         +    +PP P
Sbjct  335   LAVMFFHEPFNGTKGVALALSLWGFVSYFYGEVRAAKAAHRRRHSDEPPKP  385



>ref|XP_009401279.1| PREDICTED: purine permease 1-like [Musa acuminata subsp. malaccensis]
Length=368

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/346 (41%), Positives = 222/346 (64%), Gaps = 8/346 (2%)
 Frame = +1

Query  10    KNLEDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFP  189
             +  +D         +  +I +NCV +A+G  GG +L+RLYF  GGKR+WLS  L T G+P
Sbjct  10    RRNKDAPPQMNKGLRRALIAVNCVLMAIGNAGGPLLLRLYFHSGGKRQWLSGWLETGGWP  69

Query  190   CLLVPIFISYarnqakaaanrrrV--------LVTPWLFMSSAFLGLLLGVDSYLYTFGM  345
              + +P+ +SY   + +                L+T  LF+  A LGLLLG+D +LY +G+
Sbjct  70    IIFLPLLVSYLHRRRRLLRGHGHRHQPPTKLFLITRPLFLYCAALGLLLGLDDFLYAYGL  129

Query  346   SYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEG  525
             S+LPVS S+LL S QL FTA FA+ +VK K T YS+N+VVL+T G+V+LGLH++ DRP  
Sbjct  130   SFLPVSTSALLISAQLVFTAFFAFVLVKQKFTPYSINSVVLLTVGAVMLGLHVSSDRPNN  189

Query  526   ESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTV  705
              +   Y +GF +T+  AA++G  +  VE  +  A   +T  L+M++Q ++  F+  FCTV
Sbjct  190   VTRGEYYMGFVLTLGAAAVYGLFLPLVELTYTKAKQAITYTLVMEMQMVMGFFATAFCTV  249

Query  706   AMIINKDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTS  885
              M++NKDFQAI +EA+ ++ G  +YY+++ + AI  Q + +G++GVIF  + LL G+  +
Sbjct  250   GMLVNKDFQAIPREAKHYEQGEFRYYVVLVWCAILWQFLFLGTVGVIFCVNTLLAGVLIA  309

Query  886   LLVAVQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARK  1023
             + + V +VF+VIF  E F ++K ++LA+ +WG ASY YG+Y+  ++
Sbjct  310   VFIPVTEVFAVIFFKEKFGSEKGVALALSLWGLASYSYGEYREGKR  355



>dbj|BAJ94351.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=395

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 216/351 (62%), Gaps = 14/351 (4%)
 Frame = +1

Query  49    FKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarn  228
             ++  V+++N + +A+G + G +L+R Y+LHGG  KWL+S L TAG+P LL P+ +S+   
Sbjct  48    YRNPVVVVNFLLMALGTVSGPLLLRAYYLHGGTSKWLTSLLQTAGWPLLLPPLCVSFISR  107

Query  229   qakaaanrrrVLVTPWLFMSSAFL------GLLLGVDSYLYTFGMSYLPVSISSLLSSTQ  390
             + +  +            MS+  L      GL++G+ +YLY +G++ LPVS SS+L STQ
Sbjct  108   RRRRQSEESATEAASLSLMSAGLLAATIAIGLVIGLINYLYAYGLANLPVSTSSILISTQ  167

Query  391   LAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIA  570
             LAFTAVFA  +V+H+ T +SVNAVVL+  G+ +LGL+  GDRP G S   Y  GF MT+ 
Sbjct  168   LAFTAVFALLVVRHRFTAFSVNAVVLLVVGAAMLGLNGGGDRPAGVSRAQYYAGFAMTLG  227

Query  571   GAALHGFIMAGVEYAHVHAGVP----VTNGLLMQVQFIISMFSALFCTVAMIINKDFQAI  738
              AAL+G ++  +E +           VT  L++++Q +I + +  F  V M++NKDF  I
Sbjct  228   SAALYGLVLPLMELSQARHAARAGAAVTYTLVLEIQMVIGITATAFSVVGMLVNKDFHEI  287

Query  739   SKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSV  918
               EAR FDLG   YY I+  +A A Q   +G +G IF  SALL G+  +LL++V +VF+V
Sbjct  288   PDEARRFDLGEAGYYFILVSSATAFQCFFIGMIGAIFYGSALLAGVIMTLLISVTEVFAV  347

Query  919   IFLPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
             +   E F+  K ++LAI IWGF SYFYG+ +T +K+      T  D+E  E
Sbjct  348   LLFHEPFNGTKGVALAISIWGFISYFYGEIRTNKKQSN----TSTDKEQLE  394



>gb|KGN64615.1| hypothetical protein Csa_1G071290 [Cucumis sativus]
Length=366

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 142/346 (41%), Positives = 220/346 (64%), Gaps = 9/346 (3%)
 Frame = +1

Query  16    LEDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCL  195
             ++  ++    + +  +++ NC  LAVG  GG +L+RLYFLHGG R WLS+ L T G P +
Sbjct  1     MDQQQQQTTPAMRRTLLVFNCFLLAVGTCGGPLLMRLYFLHGGNRVWLSTFLETGGCPII  60

Query  196   LVPIFISYarnqaka---------aanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMS  348
              +P+ ISY   + +            +   + +   LF++S  +G++ G   +LY +G++
Sbjct  61    FIPLLISYIHRRRRRAHSLNPSESTNSTEMIFMKSRLFLASGVIGIITGFVDFLYAYGVA  120

Query  349   YLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGE  528
              +PVS S+L+ + QLAFTA FA+++VK K T YS+N+VVL+T G  +L LH +GDR  GE
Sbjct  121   RIPVSTSALIRACQLAFTAGFAFWLVKQKFTAYSINSVVLVTAGGAILALHTSGDRRAGE  180

Query  529   SDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVA  708
             S+R Y  GF  T+A + ++GFI+  VE  +  A   +T  L+++VQ I+S+F+ L C++A
Sbjct  181   SNREYIEGFLTTVAASVVYGFILPLVELTYKKARQQITYTLVLEVQLIMSLFATLVCSIA  240

Query  709   MIINKDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSL  888
             M+IN DFQ I+ EA  F LG  KYY+I+  +AI  Q   +G +GVIFSSS+   GI  ++
Sbjct  241   MLINNDFQMIAMEAEAFGLGKAKYYVILVLSAIIWQGFFLGVIGVIFSSSSFFSGIIIAV  300

Query  889   LVAVQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
             L+ V ++ +V+   E F A+K +SL + +WGF SYFYG+ K  +KK
Sbjct  301   LLPVTEILAVVTFNEKFQAEKTISLILNLWGFVSYFYGEIKHNKKK  346



>ref|NP_001147096.1| PUP1 [Zea mays]
 gb|ACG25423.1| PUP1 [Zea mays]
Length=373

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/350 (41%), Positives = 218/350 (62%), Gaps = 12/350 (3%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
             + +  ++++N V + VG  GG + +R YFLHGG RKWLS+ L TAGFP LLVP+ +S++R
Sbjct  21    TLRNPLLVVNFVLMVVGSAGGPLFLRAYFLHGGARKWLSALLQTAGFPLLLVPLCVSFSR  80

Query  226   nqak--------aaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLS  381
              + +        A A     L+TP L  +SA +GL+ G+D  LY +G++YLPVS SS+L 
Sbjct  81    RRRRRPRRPDDGAPAMAPFFLMTPRLLAASAAIGLMTGLDDLLYAYGLAYLPVSTSSILI  140

Query  382   STQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFM  561
             STQLAFTA FA  +V+ + T +SVNAV L++ G+ +LG++  GDRP G S   Y  GF M
Sbjct  141   STQLAFTAAFALLLVRQRFTAFSVNAVALLSAGAAMLGMNAGGDRPAGVSPAQYGAGFAM  200

Query  562   TIAGAALHGFIMAGVEYAH----VHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDF  729
             T+  AAL+G ++  +E +           VT  L++++Q +I + + +F  V M+ N D 
Sbjct  201   TLGAAALYGLLLHAMELSQAQARAGTAAAVTYTLVIEMQLVIGLTATVFSAVGMLANHDL  260

Query  730   QAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQV  909
              AI  EAREFDLG   YY+++  +A   Q   +G++G +F  SALL G+  ++L+ V +V
Sbjct  261   HAIPGEAREFDLGRSGYYLLLAGSAATYQCFFLGTIGAVFFGSALLAGVVMTVLIPVTEV  320

Query  910   FSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDE  1059
              +V+F  E F+  K ++LA+ +WGF SYFYG+ +T++    P   T  + 
Sbjct  321   LAVVFFHEPFNGTKGVALALSLWGFVSYFYGEVQTSKAHHLPDKPTNVER  370



>ref|XP_004146629.1| PREDICTED: purine permease 3-like [Cucumis sativus]
Length=355

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 142/334 (43%), Positives = 215/334 (64%), Gaps = 9/334 (3%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             +  +++ NC  LAVG  GG +L+RLYFLHGG R WLS+ L T G P + +P+ ISY   +
Sbjct  2     RRTLLVFNCFLLAVGTCGGPLLMRLYFLHGGNRVWLSTFLETGGCPIIFIPLLISYIHRR  61

Query  232   aka---------aanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSS  384
              +            +   + +   LF++S  +G++ G   +LY +G++ +PVS S+L+ +
Sbjct  62    RRRAHSLNPSESTNSTEMIFMKSRLFLASGVIGIITGFVDFLYAYGVARIPVSTSALIRA  121

Query  385   TQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMT  564
              QLAFTA FA+++VK K T YS+N+VVL+T G  +L LH +GDR  GES+R Y  GF  T
Sbjct  122   CQLAFTAGFAFWLVKQKFTAYSINSVVLVTAGGAILALHTSGDRRAGESNREYIEGFLTT  181

Query  565   IAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISK  744
             +A + ++GFI+  VE  +  A   +T  L+++VQ I+S+F+ L C++AM+IN DFQ I+ 
Sbjct  182   VAASVVYGFILPLVELTYKKARQQITYTLVLEVQLIMSLFATLVCSIAMLINNDFQMIAM  241

Query  745   EAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIF  924
             EA  F LG  KYY+I+  +AI  Q   +G +GVIFSSS+   GI  ++L+ V ++ +V+ 
Sbjct  242   EAEAFGLGKAKYYVILVLSAIIWQGFFLGVIGVIFSSSSFFSGIIIAVLLPVTEILAVVT  301

Query  925   LPESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
               E F A+K +SL + +WGF SYFYG+ K  +KK
Sbjct  302   FNEKFQAEKTISLILNLWGFVSYFYGEIKHNKKK  335



>ref|XP_006841261.1| hypothetical protein AMTR_s00135p00099660 [Amborella trichopoda]
 gb|ERN02936.1| hypothetical protein AMTR_s00135p00099660 [Amborella trichopoda]
Length=366

 Score =   266 bits (679),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 147/334 (44%), Positives = 220/334 (66%), Gaps = 1/334 (0%)
 Frame = +1

Query  58    LVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqak  237
             +++ +N +FL +G     ++ R+YFLHGG+RKW ++ + TA +P LL+P+ +    ++  
Sbjct  33    ILLAVNGLFLTLGGGCAPLVSRIYFLHGGQRKWFTAWIQTAAWPLLLIPLSLPKFFSKKL  92

Query  238   aaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAY  417
              +   +  L  P L + SA +GLL+G+D Y+Y FG+SYLPVS SSLL  TQLAFTA+FA+
Sbjct  93    QSQQEKSHLTFP-LALQSAGIGLLIGLDDYMYAFGLSYLPVSTSSLLLCTQLAFTALFAF  151

Query  418   FIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIM  597
              +V+++ T YS+NAVVL+T G V+LGL   GDRPEG S   Y LG+ MT+  AA+ G ++
Sbjct  152   VLVRYRFTAYSINAVVLLTLGPVLLGLGARGDRPEGVSGAKYALGYVMTVGTAAVFGLVV  211

Query  598   AGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEK  777
               +E  +  A V VT  L++++Q I+ + +  FCTV MI NKDFQAI  EAREF LG  K
Sbjct  212   PLLELVYGKAKVVVTYTLVLEMQVIMYVVATAFCTVGMIANKDFQAIPIEAREFGLGEFK  271

Query  778   YYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLL  957
             YY+ V  + +  QL  +GS G IF +S++  G+F +L + + ++  VIF  E F+ +K +
Sbjct  272   YYLTVVASGVMWQLFFIGSAGFIFCTSSMFTGVFVALQIPLSELLVVIFFHEKFTGEKGM  331

Query  958   SLAICIWGFASYFYGDYKTARKKPPPPPVTGDDE  1059
             +L + +WGF SYFYG++  ARKK  P   T  ++
Sbjct  332   ALVLSMWGFVSYFYGEHLNARKKKGPDMDTAINQ  365



>ref|XP_010469434.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=350

 Score =   265 bits (676),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 135/325 (42%), Positives = 214/325 (66%), Gaps = 1/325 (0%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K++ +IINC+FLA+G  GG +++RLYF +GG+R W SS L T G P +L P+  S+ R +
Sbjct  5     KSVRVIINCMFLAIGNCGGPLMMRLYFHNGGERIWFSSFLQTVGCPLILFPLLFSFLRRR  64

Query  232   akaaanrrrV-LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAV  408
                   +  + L+ P LF++S   GLL+G D+YLY++G++Y+PVS +SL+ S QL FTA+
Sbjct  65    RLVEQEKTSLFLMKPPLFIASVVAGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGFTAL  124

Query  409   FAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHG  588
             FA+F+V+ K T +++NA+VL+T G+VVL ++   D+   E+ + Y +GF MT+  A L+ 
Sbjct  125   FAFFMVRQKFTPFTINAIVLLTVGAVVLAINSDSDKLANETHKEYVVGFLMTVGAALLYA  184

Query  589   FIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG  768
             FI+  VE ++  +   VT  L+++ Q ++   +  FC V M++  DF+ I++EAR+F LG
Sbjct  185   FILPLVELSYKKSRQGVTYTLVLEFQMVLCFAATCFCLVGMLVAGDFKVIAREARDFKLG  244

Query  769   TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
                YY++V F A+  Q   +G++G+IF  S+L+ GI  S L+ V  V +VI   E F A 
Sbjct  245   ESLYYVVVVFTAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKFQAG  304

Query  949   KLLSLAICIWGFASYFYGDYKTARK  1023
             K ++LA+ +WG  SYFYG +K+  K
Sbjct  305   KGVALALSLWGSVSYFYGQFKSDEK  329



>emb|CDP11456.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   265 bits (676),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 133/330 (40%), Positives = 217/330 (66%), Gaps = 2/330 (1%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             + L+++++ + + VG  GG +++RLYFLHGGKR WL+  L TA +P +L+P+  SY   +
Sbjct  11    RKLLLMLSIILVTVGACGGPLIMRLYFLHGGKRIWLTGWLQTAAWPLILIPLVASYCNRR  70

Query  232   akaa--anrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
              K    +  + VL+     +S   +G L+G+ ++LY+FG+ +LPVS +SL+ +TQL FTA
Sbjct  71    KKPEGGSPTKLVLIDLRTLISGVIIGCLVGLTNHLYSFGVGHLPVSTNSLILATQLVFTA  130

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
               A+ +V  K   Y+VNA+VL+T GSVVL +H   +RP+GE ++ Y LGF +T+A AAL 
Sbjct  131   FSAFILVGQKFNAYTVNAIVLLTLGSVVLAIHAGSERPKGEKNKMYVLGFILTLAAAALS  190

Query  586   GFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDL  765
             G ++  +E  ++ A   ++  L+M+ Q ++ + + +F TV M++N DF+ IS+EARE+ L
Sbjct  191   GCLLPLIELTYMKAKQAISYTLVMEFQSVVCISATVFSTVGMLVNNDFKEISQEAREYQL  250

Query  766   GTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSA  945
             G  KYY+++ + AI  Q   +G  G+IF +S+L  GI  + L+ + +V +VIF  E F A
Sbjct  251   GETKYYLVLVWCAIVWQCFTVGFTGIIFCASSLFSGIMLAALLPITEVLAVIFYHEKFQA  310

Query  946   DKLLSLAICIWGFASYFYGDYKTARKKPPP  1035
             +K ++LA+ +WGF S+FYG  K  +K+  P
Sbjct  311   EKGIALALSLWGFISHFYGAIKHGKKQQIP  340



>ref|XP_006841259.1| hypothetical protein AMTR_s00135p00097090 [Amborella trichopoda]
 gb|ERN02934.1| hypothetical protein AMTR_s00135p00097090 [Amborella trichopoda]
Length=362

 Score =   265 bits (677),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/311 (45%), Positives = 205/311 (66%), Gaps = 7/311 (2%)
 Frame = +1

Query  91    VGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISY-------arnqakaaan  249
             +G  GG ++ RLYFLHGG + WLS+ L T G+P LL P+  S           Q++    
Sbjct  28    LGATGGPLISRLYFLHGGHKLWLSAFLETGGWPILLFPLAFSKFFNKTNKKNPQSQQQEG  87

Query  250   rrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVK  429
               R  +T  LF+  +F+GLL GVD Y+Y FG+SYLPVS S+LL ++QLAFTA+FA  +V+
Sbjct  88    EERTHITLPLFLQCSFIGLLTGVDDYMYAFGLSYLPVSTSALLIASQLAFTALFALIVVR  147

Query  430   HKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVE  609
             HK T +  N+VVL+T GS  LGL   GDRP+G S+  Y LGFFMT+  AAL+G ++  +E
Sbjct  148   HKFTAFLTNSVVLLTLGSAFLGLGANGDRPKGLSNGRYFLGFFMTLGAAALYGLVLPLIE  207

Query  610   YAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMI  789
               +  +   +T  L++++Q ++S+F+  FC V M+INKDFQ I KEAR FDLG   YY  
Sbjct  208   LMYARSRQKITYMLVLEMQLVMSVFATAFCAVGMLINKDFQHIPKEARAFDLGAVGYYAT  267

Query  790   VGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAI  969
             +  + +A QL  +G++G+IF +S+++ GI  + L+ + ++ +VIF  E F+ +K ++L +
Sbjct  268   LVGSGVAWQLFFIGTVGLIFCASSVVSGIMIAFLIPITEILAVIFYHEKFTGEKAMALIM  327

Query  970   CIWGFASYFYG  1002
              +WGFASY YG
Sbjct  328   SLWGFASYIYG  338



>ref|XP_010234593.1| PREDICTED: purine permease 3-like isoform X1 [Brachypodium distachyon]
Length=375

 Score =   265 bits (676),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/326 (43%), Positives = 206/326 (63%), Gaps = 6/326 (2%)
 Frame = +1

Query  61    VIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqaka  240
             ++++N V LA G   G +L+R YF+HGG RKWLSS L TAG+P LLVP+  S+   + + 
Sbjct  35    LLVVNFVLLAAGTACGPLLLRAYFVHGGTRKWLSSLLQTAGWPLLLVPLCASFFSRRRRH  94

Query  241   a----anrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAV  408
                  ++     +TP L  +S  +G++ GVD++ Y +G +YLPVS SS+L STQL FTA 
Sbjct  95    LQDHGSSCELFFMTPRLLAASTAIGVMTGVDNFFYAYGQAYLPVSTSSILLSTQLVFTAA  154

Query  409   FAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHG  588
             FA  +V+ +    +VNAVVL+T G+ +LG++  GDRP G S   Y  GF M +  AAL+G
Sbjct  155   FALLLVRQRFAAATVNAVVLLTVGAAMLGMNAGGDRPAGVSAPQYRAGFGMVLGAAALYG  214

Query  589   FIMAGVEYAHV-HAGV-PVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFD  762
              ++  +E +   HA    VT  L++++Q +I + ++ FC + MIINKDFQ IS EARE +
Sbjct  215   LLLPAMELSQARHAARGAVTYTLVVEIQLVIGLSASAFCAIGMIINKDFQGISGEARESE  274

Query  763   LGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFS  942
             LG   YY+++   A   Q   +G++G IF  SALL G+  ++ + V +V +VIF  E FS
Sbjct  275   LGEAGYYLLLAGTAAVYQCFCLGTIGAIFYGSALLAGVIITVFIPVSEVLAVIFFHEPFS  334

Query  943   ADKLLSLAICIWGFASYFYGDYKTAR  1020
               K ++L + +WG  SYFYGD +T +
Sbjct  335   PTKGIALGLSLWGLISYFYGDVRTKQ  360



>ref|NP_174144.1| purine permease 1 [Arabidopsis thaliana]
 sp|Q9FZ96.1|PUP1_ARATH RecName: Full=Purine permease 1; Short=AtPUP1 [Arabidopsis thaliana]
 gb|AAF98432.1|AC021044_11 purine permease [Arabidopsis thaliana]
 dbj|BAC42317.1| putative purine permease [Arabidopsis thaliana]
 gb|AAO63924.1| putative purine permease [Arabidopsis thaliana]
 gb|AEE30934.1| purine permease 1 [Arabidopsis thaliana]
Length=356

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 137/328 (42%), Positives = 208/328 (63%), Gaps = 14/328 (4%)
 Frame = +1

Query  94    GQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarn---------qakaaa  246
             G  GG +L RLYF +GGKR W  S L TAGFP +L+P+ +S+                  
Sbjct  16    GTCGGPLLTRLYFTNGGKRIWFMSFLSTAGFPIILIPLLVSFLSRRRSNRNPNNAENKRK  75

Query  247   nrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIV  426
              +  ++ TP LF++S  +GLL G+D+YLY++G++YLPVS SSL+  TQLAF A+FA+ +V
Sbjct  76    TKLFLMETP-LFIASIVIGLLTGLDNYLYSYGLAYLPVSTSSLIIGTQLAFNALFAFLLV  134

Query  427   KHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGV  606
             K K T +S+NAVVL+T G  +L LH  GD+P  ES + Y +GF MT+  A L+ FI+  V
Sbjct  135   KQKFTPFSINAVVLLTVGIGILALHSDGDKPAKESKKEYVVGFLMTVVAALLYAFILPLV  194

Query  607   EYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEK-YY  783
             E  +  A   +T  L++++Q ++ + +  FC + M I  DF+ I++EAREF +G    YY
Sbjct  195   ELTYKKARQEITFPLVLEIQMVMCLAATFFCVIGMFIVGDFKVIAREAREFKIGGSVFYY  254

Query  784   MIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSL  963
              ++    I  Q   +G++G++F +S+L  G+  S+L+ V +VF+V+   E F A+K +SL
Sbjct  255   ALIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVFAVVCFREKFQAEKGVSL  314

Query  964   AICIWGFASYFYGDYKTARK---KPPPP  1038
              + +WGF SYFYG++K+ +K   KP PP
Sbjct  315   LLSLWGFVSYFYGEFKSGKKVVDKPQPP  342



>gb|AAF64547.1|AF078531_1 purine permease [Arabidopsis thaliana]
Length=356

 Score =   263 bits (673),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 137/328 (42%), Positives = 208/328 (63%), Gaps = 14/328 (4%)
 Frame = +1

Query  94    GQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarn---------qakaaa  246
             G  GG +L RLYF +GGKR W  S L TAGFP +L+P+ +S+                  
Sbjct  16    GTCGGPLLTRLYFTNGGKRIWFMSFLSTAGFPIILIPLLVSFLSRRRGNRNPNNAENKRK  75

Query  247   nrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIV  426
              +  ++ TP LF++S  +GLL G+D+YLY++G++YLPVS SSL+  TQLAF A+FA+ +V
Sbjct  76    TKLFLMETP-LFIASIVIGLLTGLDNYLYSYGLAYLPVSTSSLIIGTQLAFNALFAFLLV  134

Query  427   KHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGV  606
             K K T +S+NAVVL+T G  +L LH  GD+P  ES + Y +GF MT+  A L+ FI+  V
Sbjct  135   KQKFTPFSINAVVLLTVGIGILALHSDGDKPAKESKKEYVVGFLMTVVAALLYAFILPLV  194

Query  607   EYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEK-YY  783
             E  +  A   +T  L++++Q ++ + +  FC + M I  DF+ I++EAREF +G    YY
Sbjct  195   ELTYKKARQEITFPLVLEIQMVMCLAATFFCVIGMFIVGDFKVIAREAREFKIGGSVFYY  254

Query  784   MIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSL  963
              ++    I  Q   +G++G++F +S+L  G+  S+L+ V +VF+V+   E F A+K +SL
Sbjct  255   ALIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVFAVVCFREKFQAEKGVSL  314

Query  964   AICIWGFASYFYGDYKTARK---KPPPP  1038
              + +WGF SYFYG++K+ +K   KP PP
Sbjct  315   LLSLWGFVSYFYGEFKSGKKVVDKPQPP  342



>emb|CDY17197.1| BnaA05g09910D [Brassica napus]
Length=351

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 139/333 (42%), Positives = 221/333 (66%), Gaps = 5/333 (2%)
 Frame = +1

Query  43    LSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISY-  219
             +  K +++IINC+ LA+G  GG ++ RLYF +GGKR W SS L T+G P +L+P+  S+ 
Sbjct  1     MKMKTVLVIINCIILAIGNCGGPLMTRLYFRNGGKRIWFSSFLQTSGCPIILLPLLFSFL  60

Query  220   ---arnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQ  390
                 + Q +        L+ P LF++S  +GLL+G D+YLY +G++YLPVS SSL+ S+Q
Sbjct  61    TRHRQQQEQEEPKTTLFLIKPPLFLASVVVGLLIGFDNYLYAYGLAYLPVSTSSLIISSQ  120

Query  391   LAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIA  570
             LAFTA FA+F+VK + T +++NAVVL+T G+  L LH  GD+   E+ + Y +GF MT+A
Sbjct  121   LAFTAFFAFFMVKQRFTPFTINAVVLLTLGAGSLALHADGDKLPKETRKEYIVGFVMTVA  180

Query  571   GAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEA  750
              A L+ F++  VE A+  A   ++  L++++Q ++   +  FC V M+ + DF+ + +EA
Sbjct  181   AAVLYAFVLPLVELAYKKASQRISYTLVLEMQLVLCFVATCFCLVGMLADGDFKELGREA  240

Query  751   REFDLGTEKYY-MIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFL  927
             REF LG  K+Y ++V F A+  Q   +GS+G+IF +S+L+ G+  S L+ + +V +V+F 
Sbjct  241   REFKLGGSKHYCLVVAFTAVIWQGFFLGSIGMIFCASSLVSGVLISALLPLTEVLAVLFF  300

Query  928   PESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
              E F A+K +SL + +WGF SYFYG  ++ ++K
Sbjct  301   KEKFQAEKGVSLFLSLWGFVSYFYGKIQSEKEK  333



>ref|XP_010478189.1| PREDICTED: purine permease 3-like [Camelina sativa]
Length=345

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 141/328 (43%), Positives = 219/328 (67%), Gaps = 6/328 (2%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             KALVII NC+ LA+G  GG +++RLYF +GGKR W S+ L TAGFP + +P+  SY   +
Sbjct  3     KALVII-NCIILAIGNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYIHRR  61

Query  232   akaaanrrrV---LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFT  402
                          L+ P L  ++ F+G+L G D+YLY +G++YLPVS ++L+ ++QLAF 
Sbjct  62    RNNNGGENATSFFLIKPRLLGAAIFIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFI  121

Query  403   AVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAAL  582
             A+F++F+VKHK T +++NAVVL+T G+ VLG+H   D+P  E+ + Y  GF +T+A A +
Sbjct  122   AIFSFFMVKHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYVTGFLVTVAAAVV  181

Query  583   HGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFD  762
             + FI+  VE A+  A  P++  L++Q+  I+   +++   + M I  DF+A+ KEA+EF 
Sbjct  182   YAFILPLVELAYQKAKQPLSYTLVLQM--ILCFLASIVSLIGMSIAGDFKALPKEAKEFK  239

Query  763   LGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFS  942
             LG   +Y++  F+AI  Q   +G++G+IF +S+L+ GI  S+L+ + +V +VIF  E F 
Sbjct  240   LGEVLFYVVAVFSAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKFQ  299

Query  943   ADKLLSLAICIWGFASYFYGDYKTARKK  1026
             A+K LSLA+ +WGF SYFYG+ K+   K
Sbjct  300   AEKGLSLALSLWGFVSYFYGEIKSDNDK  327



>ref|XP_010413821.1| PREDICTED: purine permease 2 [Camelina sativa]
Length=351

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/331 (41%), Positives = 212/331 (64%), Gaps = 4/331 (1%)
 Frame = +1

Query  43    LSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYa  222
             +  K++ +IINC+FLA+G  GG +++RLYF +GG+R W SS L T G P +L P+  S+ 
Sbjct  3     MKMKSVRVIINCIFLAIGSCGGPLMLRLYFHNGGERIWFSSFLQTVGCPLILFPLLFSFL  62

Query  223   rnqakaaanrrrV-LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAF  399
               +      +  + L+ P LF++S  +GLL+G D+YLY++G++Y+PVS +SL+ S QL F
Sbjct  63    SRRRLEEQEKTSLFLMKPPLFIASVVVGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGF  122

Query  400   TAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAA  579
             TA+FA+F+VK K T +++NA+VL+T G+VVL  +   D+   E+ + Y +GF MT   A 
Sbjct  123   TALFAFFMVKQKFTPFTINAIVLLTVGAVVLAFNSDSDKLANETHKEYVVGFLMTAGAAL  182

Query  580   LHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEARE-  756
             L+ FI+  VE A+  +   VT  L+++ Q ++   +  FC V M+ + DF+ I++EARE 
Sbjct  183   LYAFILPLVELAYKKSRQRVTYTLVLEFQMVLCFVATCFCLVGMLASGDFKVIAREAREA  242

Query  757   --FDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLP  930
               F LG   YY++V F A+  Q   +G++G+IF  S+L+ GI  S L+ V  V +VI   
Sbjct  243   RDFKLGESLYYVVVVFTAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQ  302

Query  931   ESFSADKLLSLAICIWGFASYFYGDYKTARK  1023
             E F A K ++LA+ +WG  SYFYG  K+  K
Sbjct  303   EKFQAGKGVALALSLWGSVSYFYGQIKSEEK  333



>ref|XP_003578263.2| PREDICTED: purine permease 3-like [Brachypodium distachyon]
Length=397

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 140/336 (42%), Positives = 210/336 (63%), Gaps = 14/336 (4%)
 Frame = +1

Query  67    IINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaa  246
             ++N + + VG   G +L+R YFLHGG RKWLSS L TAG+P LL  +  S+   + +  A
Sbjct  52    VVNFLLMVVGSACGPLLLRAYFLHGGNRKWLSSLLQTAGWPLLLPALGFSFVSRRRRRKA  111

Query  247   nrrrV-----LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
              +        L++P L  ++  +G + G+D  LY +G++YLPVS SS+L STQL FTA F
Sbjct  112   TKGATAAPLFLMSPRLLAATVAVGFMTGLDDLLYAYGLAYLPVSTSSILISTQLVFTAAF  171

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A  +V+ + T +SVNAVVL++ G+ +LG++  GDRP G +   Y  GF MT+  AAL+G 
Sbjct  172   ALLLVRQRFTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVTKGQYVAGFAMTLGAAALYGL  231

Query  592   IMAGVEYAHV-HA---GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREF  759
             ++  +E +   HA   G PVT  L+M++Q +I + +  F  V M++N DFQAI  EAREF
Sbjct  232   VLPVMELSQARHAARYGRPVTYALVMEMQAVIGLTATAFSAVGMLVNNDFQAIPGEAREF  291

Query  760   DLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESF  939
              LG   YY+++  +A   Q   +G++G IF  SALL G+  ++L+ V +V +V+F  E F
Sbjct  292   GLGQVGYYLLLAGSATVYQFFFLGTIGAIFYGSALLAGVIMTVLIPVTEVLAVMFFHEPF  351

Query  940   SADKLLSLAICIWGFASYFYGD-----YKTARKKPP  1032
             +  K ++LA+ +WGF SY YG+     +K+   KPP
Sbjct  352   NGTKGIALALSLWGFVSYLYGEVRAKAHKSESDKPP  387



>dbj|BAK04933.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 139/333 (42%), Positives = 209/333 (63%), Gaps = 7/333 (2%)
 Frame = +1

Query  61    VIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPI---FISYarnq  231
             +++IN + + VG   G +L+R YFLHGG RKWLSS L TAG+P LL P+   F+S  R+ 
Sbjct  37    LLVINFLLMVVGSAFGPLLLRAYFLHGGTRKWLSSLLQTAGWPLLLAPLGASFLSRRRSN  96

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
                 +     L++P L  ++  +GL+ G+D  LY +G++YLPVS SS+L STQLAFTA F
Sbjct  97    KDGGSATPLFLMSPRLLAATVAVGLMTGLDDLLYAYGLAYLPVSTSSILISTQLAFTAAF  156

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A  +V+ + T +SVNAVVL++ G+ +LG++  GDRP G +   Y  GF MT+  A ++G 
Sbjct  157   ALLLVRQRFTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVTRPQYYAGFGMTLGAALIYGI  216

Query  592   IMAGVEYAHV-HA---GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREF  759
             ++  +E +   HA   G  VT  L+M++Q +I   +  F  V M++N DF AI  EAREF
Sbjct  217   VLPVMELSQARHAARTGAAVTYTLVMEMQIVIGFTATAFSAVGMLVNNDFHAIRGEAREF  276

Query  760   DLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESF  939
              LG   YY+++  +A   Q   +G++G IF  SALL G+  ++L+ V +V +V+F  E F
Sbjct  277   GLGQSGYYLLLAGSATVYQFFFLGTIGAIFYGSALLAGVIMTVLIPVTEVLAVMFFHEPF  336

Query  940   SADKLLSLAICIWGFASYFYGDYKTARKKPPPP  1038
             +  K ++LA+ +WGF SY YG+ +   K+   P
Sbjct  337   NGTKGVALALSLWGFVSYLYGEVRAKAKQSDKP  369



>ref|XP_010499327.1| PREDICTED: purine permease 1-like isoform X1 [Camelina sativa]
 ref|XP_010499328.1| PREDICTED: purine permease 1-like isoform X2 [Camelina sativa]
Length=354

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/338 (41%), Positives = 214/338 (63%), Gaps = 7/338 (2%)
 Frame = +1

Query  61    VIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqaka  240
             ++IINC+ L +G  GG +L RLY+ +GGKR W  S L TAG P +L+P+  S+   + + 
Sbjct  5     LLIINCIILTIGTCGGPLLTRLYYNNGGKRIWFMSFLSTAGCPIILIPLLFSFLNRRNRN  64

Query  241   aanrrr-----VLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
              A         ++ TP LF++S  +GLL+G+D+YLY +G++YL VS SSL+  TQLAF A
Sbjct  65    KAENVAKTELFLMETP-LFIASIVIGLLIGLDNYLYAYGLAYLQVSTSSLIIGTQLAFNA  123

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
             +FA+ +VK K T +SVNAVVL+T G+ +L LH  GD P  ES + Y +GF MT+  A L+
Sbjct  124   LFAFLLVKQKFTPFSVNAVVLLTVGTGILALHSDGDLPANESHKEYVVGFLMTVIAAVLY  183

Query  586   GFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDL  765
              FI+  VE  +  A   +T  L++++Q ++ + +  FC V M I  DF+ I+KEAREF +
Sbjct  184   AFILPLVELTYKKARQEITFPLVLEIQMVMCLSATCFCVVGMFIVGDFKVIAKEAREFKI  243

Query  766   -GTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFS  942
              G+  YY ++    I  Q   +G++G++F +S+L  G+  S+L+ V +V +V+   E F 
Sbjct  244   RGSAFYYALIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFREKFQ  303

Query  943   ADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDD  1056
             A+K +SL + +WGF SYFYG++K+ +     P  T  +
Sbjct  304   AEKGVSLLLSLWGFVSYFYGEFKSGKIVVDKPQQTETE  341



>ref|XP_006415682.1| hypothetical protein EUTSA_v10008037mg [Eutrema salsugineum]
 gb|ESQ34035.1| hypothetical protein EUTSA_v10008037mg [Eutrema salsugineum]
Length=356

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/328 (42%), Positives = 209/328 (64%), Gaps = 14/328 (4%)
 Frame = +1

Query  94    GQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq---------akaaa  246
             G  GG +L RLY+ +GGKR W  S L TAG P +L+P+F S+               A  
Sbjct  16    GTCGGPLLTRLYYNNGGKRIWFMSSLSTAGCPIILIPLFFSFLSRHRSNRNRNNSENAEK  75

Query  247   nrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIV  426
              +  ++ TP LF++S  +GLL G+D+YLY +G++YLPVS SSL+  TQLAF A+FA+F+V
Sbjct  76    TKIFLMETP-LFIASIVIGLLTGLDNYLYAYGLAYLPVSTSSLIIGTQLAFNALFAFFMV  134

Query  427   KHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGV  606
             K K T +S+NAVVL+T G+ +L LH  GD+P  ES + Y +GF MT+  A L+ FI+  V
Sbjct  135   KQKFTPFSINAVVLLTVGTGILALHSDGDKPAKESHKEYVVGFLMTVIAAVLYAFILPLV  194

Query  607   EYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEK-YY  783
             E  +  A   +T  L++++Q ++ + +  FC V M+I+ DF+ I++EAREF +G    YY
Sbjct  195   ELTYKKARQEITFTLVLEIQMVMCLAATCFCLVGMLIDGDFKVIAREAREFKIGGSAFYY  254

Query  784   MIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSL  963
              ++    I  Q   +G++G++F +S+L  G+  S+L+ V +V +V+   E F ADK ++L
Sbjct  255   TLIVMTGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFREKFQADKGVAL  314

Query  964   AICIWGFASYFYGDYKTARK---KPPPP  1038
              + +WGF SYFYG++K+ +K   K  PP
Sbjct  315   LLSLWGFVSYFYGEFKSGKKVLEKEQPP  342



>ref|XP_010509839.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=351

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/337 (40%), Positives = 214/337 (64%), Gaps = 9/337 (3%)
 Frame = +1

Query  64    IIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaa  243
             +IINC+FLA+G  GG +++RLYF +GG R W SS L T G P ++ P+  S+ R +    
Sbjct  10    VIINCIFLAIGNCGGPLMMRLYFHNGGARIWFSSFLQTVGCPLIIFPLLFSFLRRRRLEE  69

Query  244   anrrrV-LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYF  420
               +  + L+ P LF++S  +GLL+G D+YLY++G++Y+PVS +SL+ S QL FTA+FA+F
Sbjct  70    QEKTSLFLMKPPLFIASVVVGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGFTALFAFF  129

Query  421   IVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMA  600
             +VK K T +++NA+VL+T G+VVL ++   D+   ++ + Y + F MT+  A L+ FI+ 
Sbjct  130   MVKQKFTPFTINAIVLLTVGAVVLAINSDSDKLANDTHKEYVVAFLMTVGAALLYAFILP  189

Query  601   GVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKY  780
              VE ++  +   VT  L+++ Q ++   +  FC V M++  DF+ I++EAR+F LG   Y
Sbjct  190   LVELSYKKSRQRVTYTLVLEFQMVLCFVATCFCFVGMLVAGDFKVIAREARDFKLGESLY  249

Query  781   YMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLS  960
             Y++V F A+  Q   +G++G+IF +S+L+ GI  S L+ V  V +VI   E F A K ++
Sbjct  250   YVVVVFTAVIWQAFFVGAIGLIFCASSLVSGIMVSALLPVTVVLAVICFQEKFQAGKGVA  309

Query  961   LAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
             LA+ +WG  SYFYG  K+  K           +E QE
Sbjct  310   LALSLWGSVSYFYGQIKSEEKT--------KAQETQE  338



>emb|CDP16579.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   257 bits (657),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 127/265 (48%), Positives = 183/265 (69%), Gaps = 7/265 (3%)
 Frame = +1

Query  277   LFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVN  456
             +F+++A +GLL G D Y Y +G + LPVS S+++ +TQLAFTA+FA+ +VK K T YSVN
Sbjct  5     VFIATACIGLLTGSDDYFYGYGAARLPVSTSAIIIATQLAFTALFAFLLVKQKFTAYSVN  64

Query  457   AVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHAGVP  636
             A+VL+T GS VLGLH + DRP+GES++ Y LGF M +A AAL+G I+  V   ++ A  P
Sbjct  65    AIVLLTVGSAVLGLHASSDRPKGESNKMYVLGFLMMLAAAALYGLILPMVGLMYMKAKQP  124

Query  637   VTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAIALQ  816
             +T  L++++Q ++  F+  FCTV M+IN DFQAIS+EARE++LG  KYY+++   AI  Q
Sbjct  125   ITYTLVLEIQLVMCFFATAFCTVGMLINNDFQAISREAREYELGETKYYIVLVSCAIVSQ  184

Query  817   LMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFASYF  996
                MG++GVIF +S+LL GI  ++L+ V ++ +VIF  E F A+K ++L + +WGF SYF
Sbjct  185   CFFMGAIGVIFCASSLLSGIMIAVLLPVTEILAVIFFNEKFQAEKAVALVLSLWGFVSYF  244

Query  997   YGD-----YKTARKKPP--PPPVTG  1050
             YGD      +  RK     P   TG
Sbjct  245   YGDISKTKLEEERKDERIIPSQATG  269



>emb|CDY16284.1| BnaC01g23190D [Brassica napus]
Length=377

 Score =   261 bits (666),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 147/341 (43%), Positives = 217/341 (64%), Gaps = 10/341 (3%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K  ++IINC+ LA+G  GG ++ RLYF +GGKR W SS L TAG P +L P+  S+ R +
Sbjct  36    KTGLVIINCIILAIGNCGGPLITRLYFRNGGKRIWFSSFLQTAGCPSILFPLLFSFLRRK  95

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
                       L+ P LF++S  +GLL GVD+YLY +G++YLPVS SSL+ S+ LAFTA F
Sbjct  96    EATTTPFF--LIKPPLFLASIVIGLLTGVDNYLYAYGLAYLPVSTSSLVISSHLAFTAFF  153

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A+F+VK K T + +NAVVL+T G+ +L LH  GD+   E+ + Y +GFFMT+A A L+ F
Sbjct  154   AFFMVKQKFTPFIINAVVLLTLGAGILALHTDGDKLAKETHKEYIVGFFMTLAAAILYAF  213

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG-  768
             ++  VE  +  A   ++  L++++Q ++   +  FC V M+ + DF+ +++EAR+F LG 
Sbjct  214   VLPLVELTYKKARQRISYTLVLEMQLVLCFVATCFCLVGMLADGDFKELAREARDFKLGG  273

Query  769   -TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSA  945
              T  YY++V F AI  Q   +GS+G+IF +S+L+ GI    L+ + +V +V F  E F A
Sbjct  274   STTYYYVVVVFTAIIWQGFFLGSIGMIFCASSLVSGILICALLPLTEVLAVFFFREKFQA  333

Query  946   DKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQ  1068
             +K +SL + +WGF SYFYG  K   K   P      D+E Q
Sbjct  334   EKSISLFLSLWGFVSYFYGQIKAENKTETP------DQEAQ  368



>ref|XP_006661330.1| PREDICTED: purine permease 3-like [Oryza brachyantha]
Length=377

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 140/336 (42%), Positives = 211/336 (63%), Gaps = 8/336 (2%)
 Frame = +1

Query  46    SFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYar  225
             +F+  ++++N + + VG   G +L+R YFL GG+RK LS+ L  AG+P LLVP+  SY  
Sbjct  29    AFRNPLLVVNFILMVVGSACGPLLLRAYFLRGGRRKGLSTLLPPAGWPLLLVPLCFSYCS  88

Query  226   nqaka-----aanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQ  390
              + +      AA     L+TP L  +SA +GL+ G+D  LY +G++YLPVS SS+L STQ
Sbjct  89    RRRREEEDGGAATTPLFLMTPRLLAASATVGLMTGLDDLLYAYGLAYLPVSTSSILISTQ  148

Query  391   LAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIA  570
             LAFTA FA  +V+ + T +SVNAVVL++ G+ +LG++  GDRP G S   Y  GF MT+ 
Sbjct  149   LAFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGMNTGGDRPAGVSRAQYYAGFAMTLG  208

Query  571   GAALHGFIMAGVEYA---HVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAIS  741
              AAL+G ++  +E +   H  A   VT  L+M++Q +I   +  F  V M++N DF AI 
Sbjct  209   AAALYGLVLPVMELSQARHAAARGAVTYTLVMEMQLVIGFVATAFSAVGMLVNNDFHAIP  268

Query  742   KEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVI  921
              EA+ F LG   YY+++  +A   Q   +G++G IF  SALL G+  ++L+ V +V +V+
Sbjct  269   GEAQGFGLGQAGYYLLLAGSAAMYQCFFLGTIGAIFYGSALLAGVIMTVLIPVTEVLAVM  328

Query  922   FLPESFSADKLLSLAICIWGFASYFYGDYKTARKKP  1029
             F  E F+  K ++LA+ +WGF SYFYG+ +    +P
Sbjct  329   FFHEPFNGTKGVALALSLWGFVSYFYGEVRAKAARP  364



>ref|XP_010509840.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=380

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/322 (41%), Positives = 210/322 (65%), Gaps = 1/322 (0%)
 Frame = +1

Query  64    IIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaa  243
             +I+N +FLA+G  GG +++RLYF +GG R W SS L T G P +L P+  S+ R +    
Sbjct  39    LIVNSIFLAIGDCGGPLMMRLYFHNGGARIWFSSFLQTVGCPLILFPLLFSFLRRRRLEE  98

Query  244   anrrrV-LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYF  420
               +  + L+ P LF++S  +GLL+G D+YLY++G++Y+PVS  SL+ S QL FTA+FA+F
Sbjct  99    QEKTSLFLMKPPLFIASVVVGLLVGFDNYLYSYGLAYIPVSTESLIISAQLGFTALFAFF  158

Query  421   IVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMA  600
             +VK K+T +++NA+VL+T G+VVL ++   D+   E+ + Y +GF MT+  A L+ FI+ 
Sbjct  159   MVKQKITPFTINAIVLLTVGAVVLAINSDSDKLANETHKEYVVGFLMTVGAALLYAFILP  218

Query  601   GVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKY  780
              VE ++  +   VT  L+++ Q ++   +  FC V M++  DF+ I++EAR+F LG   Y
Sbjct  219   LVELSYKKSCQRVTYTLVLEFQMVLCFVATCFCLVGMLVAGDFKVIAREARDFKLGESLY  278

Query  781   YMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLS  960
             Y++V F A+  Q   +G++G+IF  S+L+ GI  S L+ V  V +VI   E F A K ++
Sbjct  279   YVVVVFTAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKFQAGKGVA  338

Query  961   LAICIWGFASYFYGDYKTARKK  1026
             LA+ +WG  SYFYG +K+  K 
Sbjct  339   LALSLWGSVSYFYGQFKSEEKN  360



>emb|CDY12422.1| BnaC08g09110D [Brassica napus]
Length=376

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 146/341 (43%), Positives = 218/341 (64%), Gaps = 9/341 (3%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K  +++INC+ LA+G  GG ++ RLYF +GGKR W SS L TAG P +L P+  S+   +
Sbjct  34    KTGLVMINCIILAIGNCGGPLITRLYFRNGGKRIWFSSFLQTAGCPIILFPLLFSFRLRR  93

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
              +A       L+ P LF++S  +GLL GVD+YLY +G++YLPVS SSL+ S+QLAFTA F
Sbjct  94    KEATTTPFF-LIKPPLFLASIVIGLLTGVDNYLYAYGLAYLPVSTSSLVISSQLAFTAFF  152

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A+F+VK K T + +NAVVL+T G+ +L LH  GD+   E+ + Y +GF MT+A A L+ F
Sbjct  153   AFFMVKQKFTPFIINAVVLLTLGAGILALHTDGDKLAKETHKEYIVGFLMTLAAAILYAF  212

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG-  768
             ++  VE  +  A   ++  L++++Q ++   +  FC V M+ + DF+ +++EAR+F LG 
Sbjct  213   VLPLVELTYKKARQRISYTLVLEMQLVLCFVATCFCLVGMLADGDFKELAREARDFKLGG  272

Query  769   -TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSA  945
              T  YY++V F AI  Q   +GS+G+IF +S+L+ GI    L+ + +V +V F  E F A
Sbjct  273   STTYYYVVVVFTAIIWQGFFLGSIGMIFCASSLVSGILICALLPLTEVLAVFFFREKFQA  332

Query  946   DKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQ  1068
             +K +SL + +WGF SYFYG  K   K   P      D+E Q
Sbjct  333   EKSISLFLSLWGFVSYFYGQIKAENKTETP------DQEAQ  367



>ref|XP_010413817.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=349

 Score =   258 bits (658),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 135/344 (39%), Positives = 215/344 (63%), Gaps = 9/344 (3%)
 Frame = +1

Query  43    LSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYa  222
             +  K++ +IINC+FLA+G  GG +++RLYF +GG+R W SS L T G P +L P+  S+ 
Sbjct  1     MKMKSVRVIINCIFLAIGNCGGPLMMRLYFHNGGERIWFSSFLQTVGCPLILFPLLFSFL  60

Query  223   rnqakaaanrrrV-LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAF  399
             R +      +  + L+ P LF++S   GLL+G D+YLY++G++Y+PVS +SL+ S QL F
Sbjct  61    RRRRLVKQEKTSLFLMKPPLFIASVVAGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGF  120

Query  400   TAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAA  579
             TA+FA+ +VK K T +++NA+VL+T  +VVL ++    +   E+ + Y +GF MT+  A 
Sbjct  121   TALFAFCMVKQKFTPFTINAIVLLTLSAVVLAINSDSYKLANETHKEYVVGFLMTVGAAL  180

Query  580   LHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREF  759
             L+ FI+  VE ++  +   VT  L+++ Q ++   +  FC V M++  DF+ I++EAR+F
Sbjct  181   LYAFILPLVELSYKKSRQGVTYTLVLEFQMVLCFVATCFCLVGMLVAGDFKVIAREARDF  240

Query  760   DLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESF  939
              LG   YY++V F A+  Q   +G++G+IF  S+L+ GI  S L+ V  V +VI   E F
Sbjct  241   KLGESLYYVVVVFTAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKF  300

Query  940   SADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
              A K ++L + +WG  SYFYG +K+  K           +E QE
Sbjct  301   QAGKGIALTLSLWGSVSYFYGQFKSGEKT--------KAQETQE  336



>ref|XP_009148632.1| PREDICTED: purine permease 2-like [Brassica rapa]
Length=376

 Score =   258 bits (660),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 146/340 (43%), Positives = 217/340 (64%), Gaps = 8/340 (2%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K  ++IINC+ LA+G  GG ++ RLYF +GGKR W SS L TAG P +L P+  S+   +
Sbjct  33    KTGLVIINCIILAIGNCGGPLITRLYFRNGGKRIWFSSFLQTAGCPIILFPLLFSFRLRR  92

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
              +A       L+ P LF++S  +GLL GVD+YLY +G++YLPVS SSL+ S+QLAFTA F
Sbjct  93    KEATTTPFF-LIKPPLFLASIVIGLLTGVDNYLYAYGLAYLPVSTSSLVISSQLAFTAFF  151

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A+F+VK K T + +NAVVL+T G+ +L LH  GD+   E+ + Y +GF MT+A A L+ F
Sbjct  152   AFFMVKQKFTPFIINAVVLLTLGAGILALHTDGDKLAKETHKEYIVGFLMTLAAAILYAF  211

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             ++  VE  +  A   ++  L++++Q ++   +  FC V M+ + DF+ +++EAR+F LG 
Sbjct  212   VLPLVELTYKKARKRISYTLVLEMQMVLCFVATCFCLVGMLADGDFKELAREARDFKLGR  271

Query  772   EK-YYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
                YY++V F AI  Q   +GS+G+IF +S+L+ GI    L+ + +V +V F  E F A+
Sbjct  272   STYYYVVVVFTAIIWQGFFLGSIGMIFCASSLVSGILICALLPLTEVLAVFFFREKFQAE  331

Query  949   KLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQ  1068
             K LSL + +WGF SYFYG  K+  K          D+E Q
Sbjct  332   KGLSLFLSLWGFVSYFYGQIKSENK------TETQDQEAQ  365



>ref|XP_010549318.1| PREDICTED: purine permease 3-like [Tarenaya hassleriana]
Length=347

 Score =   257 bits (657),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 140/329 (43%), Positives = 218/329 (66%), Gaps = 5/329 (2%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             KALVI+ NCV L +G  GG ++ RLY+ +GGK  WLSS L T GFP +L+P+   +   +
Sbjct  3     KALVIL-NCVLLGIGNCGGPLMSRLYYNNGGKSVWLSSFLETGGFPLMLIPLLFCFLNRR  61

Query  232   ak----aaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAF  399
                   +  N   +L+ P LFM +A  GLL GVD Y+Y +G+S+LPVS +SL+ ++QLAF
Sbjct  62    RNHGRNSDGNAGVILMKPRLFMGAAVSGLLTGVDDYIYAYGLSFLPVSTASLIIASQLAF  121

Query  400   TAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAA  579
             TA FA+F+VK K T +S+NA+VL+T G+ VL LH A D P  E+ + Y  GF +T+  A 
Sbjct  122   TAFFAFFLVKQKFTPFSINAIVLLTLGAGVLALHTASDIPANETKKQYVTGFVLTVGAAV  181

Query  580   LHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREF  759
             L+ F++  +E ++  A   ++  ++++ QF++  F+ LFC   M+I+ DF+ I KEA  F
Sbjct  182   LYAFVLPLIELSYKKARQTISYDVVLEFQFVMCFFATLFCFAGMLISGDFKMIPKEAETF  241

Query  760   DLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESF  939
              LG   YY+++  A++  Q   +G++GVIF +S+L+ GI  ++L+ V +V +V+F  E+F
Sbjct  242   QLGPSLYYVVLVGASLMWQCFFLGAIGVIFCASSLVSGILIAVLLPVTEVLAVVFYHETF  301

Query  940   SADKLLSLAICIWGFASYFYGDYKTARKK  1026
             S++K +SL + +WGFASYFYG+ K  + +
Sbjct  302   SSEKGVSLVLSLWGFASYFYGEAKAGKAE  330



>ref|XP_002893513.1| hypothetical protein ARALYDRAFT_890360 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69772.1| hypothetical protein ARALYDRAFT_890360 [Arabidopsis lyrata subsp. 
lyrata]
Length=356

 Score =   257 bits (656),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 138/328 (42%), Positives = 206/328 (63%), Gaps = 14/328 (4%)
 Frame = +1

Query  94    GQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarn---------qakaaa  246
             G  GG +L RLYF +GGKR W  S L TAG P +L+P+  S+ R                
Sbjct  16    GTCGGPLLTRLYFTNGGKRIWFMSFLQTAGCPIILLPLVASFLRRRRSNRNSNNAENTPK  75

Query  247   nrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIV  426
              +  ++ TP LF++S  +GLL G+D+YLY++G++YLPVS SSL+  TQLAF A+FA+ +V
Sbjct  76    TKIFLMETP-LFIASIVIGLLTGLDNYLYSYGLAYLPVSTSSLIIGTQLAFNALFAFLLV  134

Query  427   KHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGV  606
             K K T +S+NAVVL+T G+ +L LH  GD+P  ES + Y +GF MT+  A L+ FI+  V
Sbjct  135   KQKFTPFSINAVVLLTVGTGILALHSDGDKPANESHKQYVIGFLMTVVAAVLYAFILPLV  194

Query  607   EYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEK-YY  783
             E  +  A   +T  L+ ++Q ++ + + LFC V M I  DF+ I++EAREF +G    YY
Sbjct  195   ELTYKKARQEITFPLVFEIQMVMCVAATLFCLVGMFIVGDFKVIAREAREFKIGGSVFYY  254

Query  784   MIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSL  963
              ++    I  Q   +G++G++F +S+L  G+  S+L+ V +V +V+   E F A+K +SL
Sbjct  255   ALIVITGIVWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFREKFQAEKGVSL  314

Query  964   AICIWGFASYFYGDYKTARK---KPPPP  1038
              + +WGF SYFYG+ K+ +K   KP PP
Sbjct  315   LLSLWGFVSYFYGEIKSGKKVLDKPQPP  342



>ref|XP_010509841.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=347

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/337 (41%), Positives = 211/337 (63%), Gaps = 9/337 (3%)
 Frame = +1

Query  64    IIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaa  243
             +IIN +FLA+G  GG +++RLYF +GG R W SS L T G P +L P+  S+ R +    
Sbjct  6     VIINFIFLAIGSCGGPLMLRLYFHNGGARIWFSSFLQTVGCPLILFPLLFSFLRRRCLEE  65

Query  244   anrrrV-LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYF  420
                  + L+ P LF++S  +GLL+G D+YLY++G++Y+PVS ++L+ S QL FTA+FA+F
Sbjct  66    QETTSLFLMKPPLFIASVVVGLLMGFDNYLYSYGLAYIPVSTAALIISAQLGFTALFAFF  125

Query  421   IVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMA  600
             +VK K T +++NA+VL+T G+VVL ++   D+   E+ + Y +GF MT   A L+ FI+ 
Sbjct  126   MVKQKFTPFTINAIVLLTVGAVVLAINSDSDKLANETHKEYVVGFLMTAGAALLYAFILP  185

Query  601   GVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKY  780
              VE A+  +   VT  L+++ Q ++   +  FC V M+ + DF+ I++EAR+F LG   Y
Sbjct  186   LVELAYKKSRQRVTYTLVLEFQMVLCFVATCFCLVGMLASGDFKVIAREARDFKLGESLY  245

Query  781   YMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLS  960
             Y++V F A+  Q   +G++G+IF  S+L+ GI  S L+ V  V +VI   E F A K ++
Sbjct  246   YVVVVFTAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKFQAGKGVA  305

Query  961   LAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
             LA+ +WG  SYFYG  K+  K           +E QE
Sbjct  306   LALSLWGSVSYFYGQIKSEEKT--------KAQETQE  334



>ref|XP_002881298.1| ATPUP2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57557.1| ATPUP2 [Arabidopsis lyrata subsp. lyrata]
Length=358

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 136/340 (40%), Positives = 211/340 (62%), Gaps = 13/340 (4%)
 Frame = +1

Query  43    LSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYa  222
             +  K +++IINC+FLA+G  GG +++RLYF +GG+R W SS L T G P ++ P+  S+ 
Sbjct  1     MKMKTVLVIINCIFLAIGNCGGPLMMRLYFSNGGQRIWFSSFLQTVGCPLIIFPLLFSFI  60

Query  223   rnqakaaanrrr--VLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLA  396
             R         +    L+ P LF+++  +GLL+G D+YLY++G++Y+PVS +SL+ S QL 
Sbjct  61    RRLRCLDEQEKTPFFLMKPPLFIAAILVGLLMGFDNYLYSYGLAYIPVSTASLIISAQLG  120

Query  397   FTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGA  576
             FTA+FA+F+VK K T +++NAVVL+T G+VVL L+   D+   E+ + Y +GF MTI  A
Sbjct  121   FTALFAFFMVKQKFTPFTINAVVLLTVGAVVLALNSDSDKLANETHKEYVVGFLMTIGAA  180

Query  577   ALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDF---------  729
              L+ FI+  VE  +  +   +T  L ++ Q ++  F+  FC V M+   DF         
Sbjct  181   LLYAFILPLVELTYKKSCQRITYTLALEFQMVLCFFATCFCLVGMLAAGDFKVKHALFIF  240

Query  730   --QAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQ  903
               + I+ EAR+F LG   YY++V F A+  Q   +G++G+IF +S+L+ GI  S L+ V 
Sbjct  241   KNRVIAGEARDFKLGESLYYVVVVFTAVIWQAFFVGAIGLIFCASSLVSGIMISALLPVT  300

Query  904   QVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARK  1023
              + +VI   E F A K ++LA+ +WG  SYFYG  K+  K
Sbjct  301   VILAVICFQEKFQAGKGVALALSLWGSVSYFYGQMKSEEK  340



>emb|CDY29741.1| BnaA01g19250D [Brassica napus]
Length=377

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 145/340 (43%), Positives = 217/340 (64%), Gaps = 8/340 (2%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K  +++INC+ LA+G  GG ++ RLYF +GGKR W SS L TAG P +L P+  S+   +
Sbjct  34    KTGLVMINCIILAIGNCGGPLITRLYFRNGGKRIWFSSFLQTAGCPIILFPLLFSFRLRR  93

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
              +A       L+ P LF++S  +GLL GVD+YLY +G++YLPVS SSL+ S+QLAFTA F
Sbjct  94    KEATTTPFF-LIKPPLFLASIVIGLLTGVDNYLYAYGLAYLPVSTSSLVISSQLAFTAFF  152

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A+F+VK K T + +NAVVL+T G+ +L LH  GD+   E+ + Y +GF MT+A A L+ F
Sbjct  153   AFFMVKQKFTPFIINAVVLLTLGAGILALHTDGDKLAKETHKEYIVGFLMTLAAAILYAF  212

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             ++  VE  +  A   ++  L++++Q ++   +  FC V M+ + DF+ +++EAR+F LG 
Sbjct  213   VLPLVELTYKKARKRISYTLVLEMQMVLCFGATCFCLVGMLADGDFKELAREARDFKLGR  272

Query  772   EK-YYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
                YY++V F AI  Q   +GS+G+IF +S+L+ GI    L+ + +V +V F  E F A+
Sbjct  273   STYYYVVVVFTAIIWQGFFLGSIGMIFCASSLVSGILICALLPLTEVLAVFFFREKFQAE  332

Query  949   KLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQ  1068
             K LSL + +WGF SYFYG  K+  K          D+E Q
Sbjct  333   KGLSLFLSLWGFVSYFYGQIKSENK------TETQDQEAQ  366



>ref|XP_006841262.1| hypothetical protein AMTR_s00135p00100890 [Amborella trichopoda]
 gb|ERN02937.1| hypothetical protein AMTR_s00135p00100890 [Amborella trichopoda]
Length=357

 Score =   255 bits (652),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 138/311 (44%), Positives = 215/311 (69%), Gaps = 0/311 (0%)
 Frame = +1

Query  94    GQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLVTP  273
             G  G  ++ RLYF+HGG+RKWL++ + TA FP LL+P+F+S   +   + + RR+  +T 
Sbjct  35    GASGAPLVSRLYFIHGGQRKWLTAWIQTAAFPILLIPLFLSKISSTKTSQSQRRQSHLTF  94

Query  274   WLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSV  453
              L + SA +GLL+G+D Y+Y FG+SYLP+S S+LL STQL FTA FA+ IV  + T +++
Sbjct  95    PLALQSASIGLLIGIDDYMYAFGLSYLPISTSTLLVSTQLGFTAFFAFLIVGQRFTAHTI  154

Query  454   NAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHAGV  633
             NAVVL++ GSV+LG+  + DRPEG +   Y LGF +T+  AAL G +   +E  +V +  
Sbjct  155   NAVVLLSLGSVLLGIRASSDRPEGVTGAQYGLGFVLTLGAAALIGLVFPLIELVYVKSKQ  214

Query  634   PVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAIAL  813
              VT GL+M++  ++S+ +  FCT+ M+INKDFQ IS+E++EF LG  KY++ V  + I  
Sbjct  215   IVTFGLVMEMLLVMSVVATGFCTIGMVINKDFQVISRESKEFGLGEFKYHLTVVASGILW  274

Query  814   QLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFASY  993
             Q+ ++GS   I  +S+LL GI  ++ + +  + +VIF  E FSA+K ++L +C+WGFASY
Sbjct  275   QVFLIGSFSFILYTSSLLNGILLAVQLPLTSILAVIFFHEKFSAEKGMALVLCLWGFASY  334

Query  994   FYGDYKTARKK  1026
             +YG++  ++K+
Sbjct  335   YYGEHIQSKKR  345



>ref|NP_973592.1| purine permease 2 [Arabidopsis thaliana]
 gb|AEC08879.1| purine permease 2 [Arabidopsis thaliana]
Length=347

 Score =   254 bits (649),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 133/329 (40%), Positives = 211/329 (64%), Gaps = 2/329 (1%)
 Frame = +1

Query  43    LSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYa  222
             +  K +++IINC+FLA+G  GG +++RLYF +GG+R W  S L T G P +  P+ +S+ 
Sbjct  1     MKMKTVLVIINCIFLAIGNCGGPLMMRLYFQNGGERIWFPSFLQTVGCPLIFFPLLLSFL  60

Query  223   rnqakaaanrrrV--LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLA  396
             R +            L+ P LF+++  +GLL+G D+YLY++G++Y+PVS +SL+ S QL 
Sbjct  61    RRRRCLEEQETTPFFLMKPPLFIAAIVVGLLVGFDNYLYSYGLAYIPVSTASLIISAQLG  120

Query  397   FTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGA  576
             FTA+FA+F+VK K T +++NA+VL+T G+VVL L+   D+   E+ + Y +GF MT+  A
Sbjct  121   FTALFAFFMVKQKFTPFTINAIVLLTGGAVVLALNSDSDKLANETHKEYVVGFIMTLGAA  180

Query  577   ALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEARE  756
              L+GFI+  VE ++  +G  +T  L ++ Q ++   +   C V M+   DF+ I+ EAR+
Sbjct  181   LLYGFILPLVELSYKKSGQRITYTLALEFQMVLCFAATCVCLVGMLAAGDFKVIAGEARD  240

Query  757   FDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPES  936
             F LG   YY+++ F AI  Q   +G++G+IF +S+L+ GI  S L+ V  + +VI   E 
Sbjct  241   FKLGESLYYVVIVFTAIIWQAFFVGAIGLIFCASSLVSGIMVSALLPVTVILAVICFQEK  300

Query  937   FSADKLLSLAICIWGFASYFYGDYKTARK  1023
             F A K ++LA+ +WG  SYFYG  K+  K
Sbjct  301   FQAGKGVALALSLWGSVSYFYGQVKSEEK  329



>gb|EMT19524.1| Purine permease 3 [Aegilops tauschii]
Length=333

 Score =   252 bits (643),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 136/325 (42%), Positives = 203/325 (62%), Gaps = 7/325 (2%)
 Frame = +1

Query  85    LAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPI---FISYarnqakaaanrr  255
             + VG   G +L+R  FLHGG RKWLSS L  AG+P LL P+   F+S  R+    ++   
Sbjct  1     MVVGSAFGPLLLRASFLHGGPRKWLSSLLQPAGWPLLLAPLSASFLSRRRSNKDGSSATP  60

Query  256   rVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHK  435
               L++P L  ++  +GL  G+D  LY +G++YLPVS SS+L STQLAFTA FA  +V+ +
Sbjct  61    LFLMSPRLLAATVAVGLRTGLDDLLYAYGLAYLPVSTSSILISTQLAFTAAFALLLVRQR  120

Query  436   LTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYA  615
              T +SVNAVVL++ G+ +LG++  GDRP G +   Y  GF MT+  AAL+G ++  +E +
Sbjct  121   FTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVTRAQYYAGFGMTLGAAALYGLMLPVMELS  180

Query  616   HV-HA---GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYY  783
                HA   G  VT  L+M++Q +I   +  F  + M++N DF AI +EAREF LG   YY
Sbjct  181   QARHAARTGAAVTYILVMEMQIVIGFTATAFSAIGMLVNNDFHAIPREAREFGLGQIGYY  240

Query  784   MIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSL  963
             +++  +AI  Q   +G++G IF  SALL G+  ++L+ V +V +V+F  E F+  K ++L
Sbjct  241   LLLAASAIVYQFFFLGTIGAIFYGSALLAGVIMTVLIPVTEVLAVLFFHEPFNGTKGVAL  300

Query  964   AICIWGFASYFYGDYKTARKKPPPP  1038
             A+ +WGF SY YG+ +   +    P
Sbjct  301   ALSLWGFVSYLYGEIRAKAQDSDKP  325



>ref|XP_006358992.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=358

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 134/342 (39%), Positives = 219/342 (64%), Gaps = 6/342 (2%)
 Frame = +1

Query  7     LKNLE-DMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAG  183
             ++N +  + KMK    K  ++I+N +  ++G  GG ++ RLYF+HGG+R WLSS L T  
Sbjct  2     IRNFDYRLAKMK----KFTLLILNIIMFSIGNCGGPLISRLYFIHGGQRIWLSSWLQTIA  57

Query  184   FPCLLVPIFISYarnqakaaanrrrVL-VTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPV  360
              P +L+P+ ISY   +   +    R+  +T    + S  +G++ G+D Y  ++G + LPV
Sbjct  58    CPLILIPLSISYFHRRKIESPATARIFSLTRREIIGSTGVGIIAGLDGYFISWGPAKLPV  117

Query  361   SISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRS  540
             S SSL+++TQLAFTA+FA  +VK KLT YS  +V L+  G+  L L   GDRP G S + 
Sbjct  118   STSSLINATQLAFTALFAVLLVKQKLTVYSKLSVFLLIAGAATLALRGKGDRPAGVSVKE  177

Query  541   YTLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIIN  720
             Y +GF MT+ GA   G +++ +E  ++ A   ++  +++++Q II + + +FCT+ MIIN
Sbjct  178   YVIGFVMTVMGAVCFGLMVSLIELIYIKAKNAISYTMVLEIQLIIGVSATVFCTIGMIIN  237

Query  721   KDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAV  900
              DFQAI KEA E+++G  KYY+++ + AI  QL +MG +GVIF SS+LL GI  + L+ V
Sbjct  238   NDFQAIPKEASEYEIGEAKYYLVLVWCAIIWQLALMGLVGVIFYSSSLLSGIIGAFLLPV  297

Query  901   QQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
              ++ +++   E F  +K +++ + + GF SYFYG+ + ++K+
Sbjct  298   TEILAIVLFHEKFQVEKGVAIFLALCGFVSYFYGEIEQSKKE  339



>ref|XP_008795222.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=351

 Score =   249 bits (637),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 133/299 (44%), Positives = 193/299 (65%), Gaps = 14/299 (5%)
 Frame = +1

Query  127   YFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLVTPWLFMSSAFLGL  306
             YF+ GG R WLS+              F+  A    +    R  +L+ P L  + A LGL
Sbjct  53    YFVRGGHRMWLSA--------------FLQTAAAATRRRCRRFFLLLPPALTAACAVLGL  98

Query  307   LLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSV  486
             L+ VDSY+Y++  S+LP+S SSLL ++QLAFTAVFA  IV+ + T +S+NAVVL+T G V
Sbjct  99    LIAVDSYMYSYASSFLPLSTSSLLMASQLAFTAVFALLIVRQRFTPFSLNAVVLLTLGPV  158

Query  487   VLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQ  666
             VLGL  A DRPEGE    Y LGF M +A AAL G ++  VE A+      +T  ++++ Q
Sbjct  159   VLGLGGASDRPEGEPQSKYYLGFCMMVAAAALIGLVLPLVELAYRRTTEEMTYAMVIETQ  218

Query  667   FIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVI  846
              ++    +LFC + M+++KDFQAI KEAREF+LG  +YYM++ + AI  Q++ +G +GVI
Sbjct  219   MVMGASGSLFCLLGMLLSKDFQAIPKEAREFELGELRYYMVLIWDAICWQILNVGLVGVI  278

Query  847   FSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARK  1023
             FS+S+L  G+  ++LV + ++  VIFL E F+  K ++LA+ +WGFASY YG+ K  +K
Sbjct  279   FSASSLFGGMMIAILVPIGEILPVIFLNEKFNGSKAVALALSLWGFASYLYGELKQGKK  337



>ref|XP_010234594.1| PREDICTED: purine permease 3-like isoform X2 [Brachypodium distachyon]
Length=375

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 143/344 (42%), Positives = 210/344 (61%), Gaps = 9/344 (3%)
 Frame = +1

Query  61    VIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqaka  240
             ++++N V LA G   G +L+R YF+HGG RKWLSS L TAG+P LLVP+  S+   + + 
Sbjct  35    LLVVNFVLLAAGTACGPLLLRAYFVHGGTRKWLSSLLQTAGWPLLLVPLCASFFSRRRRH  94

Query  241   aa----nrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAV  408
                   +     +TP L  +S  +G++ GVD++ Y +G +YLPVS SS+L STQL FTA 
Sbjct  95    LQDHGSSCELFFMTPRLLAASTAIGVMTGVDNFFYAYGQAYLPVSTSSILLSTQLVFTAA  154

Query  409   FAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHG  588
             FA  +V+ +    +VNAVVL+T G+ +LG++  GDRP G S   Y  GF M +  AAL+G
Sbjct  155   FALLLVRQRFAAATVNAVVLLTVGAAMLGMNAGGDRPAGVSAPQYRAGFGMVLGAAALYG  214

Query  589   FIMAGVEYAHV-HAGV-PVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFD  762
              ++  +E +   HA    VT  L++++Q +I + ++ FC + MIINKDFQ I  EAREF+
Sbjct  215   LLLPAMELSQARHAARGAVTYTLVVEIQLVIGLSASAFCAIGMIINKDFQEIPAEAREFE  274

Query  763   LGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFS  942
             LG   YY+++   A   Q + +G++G IF  SALL G+  ++ + V  + +V+F  E FS
Sbjct  275   LGEAGYYLLLVGTASVFQCICLGTIGAIFYGSALLAGVVLAMFIPVNGMLAVLFFHEPFS  334

Query  943   ADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQEV  1074
             A K ++L + +WG  SYFYGD +T   K         D EH  V
Sbjct  335   ATKGIALGLSLWGLLSYFYGDVRT---KQALQSDKHQDTEHPTV  375



>ref|XP_010675382.1| PREDICTED: purine permease 3-like [Beta vulgaris subsp. vulgaris]
Length=388

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/326 (38%), Positives = 205/326 (63%), Gaps = 2/326 (1%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K L++I+NC  LA+G   G +++RLY++HGGK  WLSS L T G+P +++P+ ++Y R +
Sbjct  49    KKLLLILNCFMLAIGISAGPLIMRLYYIHGGKSIWLSSWLETGGWPVMILPLLVAYFRRR  108

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
                   +   +     F  +A +GL+ G   Y Y +G+ ++PVS SSL+ +TQLAFTAVF
Sbjct  109   RTDPEAKLFYIKAN-TFCYAAIVGLVAGSADYCYAYGVKHIPVSTSSLILATQLAFTAVF  167

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             A+ +V+ K T +SVNAV L+TFG++VL LH   DRP GES   Y +GFF T+A +AL   
Sbjct  168   AFILVRQKFTAFSVNAVALLTFGAIVLALHAGNDRPAGESKAQYFVGFFFTLASSALFAL  227

Query  592   IMAGVEYAHVHAGVPVTN-GLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG  768
             ++  +E  +        N  L+M++Q ++S  +   CTV M+ + D++  ++E +E+ LG
Sbjct  228   MLPMIELTYRRVKHTAVNYSLVMEIQLVLSFSATALCTVGMLASGDYKGYAREVQEYKLG  287

Query  769   TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
                Y++++  +AI  Q   +G+ GVI+  S+LL GI  ++ + + ++ ++ F  E F  +
Sbjct  288   NAMYFVVLIISAIVWQFFYLGAAGVIYYGSSLLSGIIIAVALPITEIAAIFFYHEKFQVE  347

Query  949   KLLSLAICIWGFASYFYGDYKTARKK  1026
             K +SL + +WGF SYFYG+ K  +K+
Sbjct  348   KGVSLVLSLWGFFSYFYGEAKEMKKQ  373



>dbj|BAJ87663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=388

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/366 (38%), Positives = 213/366 (58%), Gaps = 26/366 (7%)
 Frame = +1

Query  19    EDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLL  198
              D+        +  ++ +N + LAVG   G +L+RLYFL GG RKWLSS L TAG+P LL
Sbjct  24    HDLTGAAARPLRDPLLAVNFLLLAVGASCGPLLLRLYFLRGGARKWLSSLLQTAGWPLLL  83

Query  199   VPIFISYarnqakaaanr---------rrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSY  351
             VP+  S++  + +    +            L+TP L  ++  +G++ G D++LY +G +Y
Sbjct  84    VPLCFSFSSRRRRRRHRQGGGDDPISGAVFLMTPRLLAATVVVGIMTGADNFLYAYGTAY  143

Query  352   LPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGES  531
             LPVS SS+L STQLAFTA FA  +V+ + T  +VNA+VL++ G+ +LG+   GDRP G +
Sbjct  144   LPVSTSSILISTQLAFTAAFALLVVRQRFTASTVNAIVLLSVGAAMLGMGSGGDRPAGVT  203

Query  532   DRSYTLGFFMTIAGAALHGFIMAGVEYAH-----VHAGVPVTNGLLMQVQFIISMFSALF  696
                Y  GF   +  AAL+G ++  +E +            +T  L++++Q +I + +  F
Sbjct  204   GAQYAAGFGTALGAAALYGLVLPVMELSQAWHAARAGAAALTYTLVVEIQVVIGLTATAF  263

Query  697   CTVAMIINKDFQAISKEAREFDLGTEKYY-MIVGFAAIALQLMVMGSLGVIFSSSALLLG  873
             C V M++NKDFQAI +EAR+ +LG   YY ++VG AA+  Q   +G +G I+  SAL  G
Sbjct  264   CAVGMLVNKDFQAIPREARQSELGKAGYYLLLVGTAAV-YQCFCLGIIGAIYYGSALFAG  322

Query  874   IFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGD  1053
             I  ++ + V +V +V+F  E FS  K ++L + +WG ASYFYG+    R   P       
Sbjct  323   IIITVFLPVTEVLAVVFFHEPFSGTKGVALGLSLWGLASYFYGE---VRHMAP-------  372

Query  1054  DEEHQE  1071
             D EHQ 
Sbjct  373   DAEHQS  378



>ref|NP_180931.2| purine permease 2 [Arabidopsis thaliana]
 sp|Q94GB1.1|PUP2_ARATH RecName: Full=Purine permease 2; Short=AtPUP2 [Arabidopsis thaliana]
 gb|AAK61813.1|AF078532_1 putative purine permease [Arabidopsis thaliana]
 gb|AEC08880.1| purine permease 2 [Arabidopsis thaliana]
Length=358

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/340 (39%), Positives = 211/340 (62%), Gaps = 13/340 (4%)
 Frame = +1

Query  43    LSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYa  222
             +  K +++IINC+FLA+G  GG +++RLYF +GG+R W  S L T G P +  P+ +S+ 
Sbjct  1     MKMKTVLVIINCIFLAIGNCGGPLMMRLYFQNGGERIWFPSFLQTVGCPLIFFPLLLSFL  60

Query  223   rnqakaaanrrr--VLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLA  396
             R +            L+ P LF+++  +GLL+G D+YLY++G++Y+PVS +SL+ S QL 
Sbjct  61    RRRRCLEEQETTPFFLMKPPLFIAAIVVGLLVGFDNYLYSYGLAYIPVSTASLIISAQLG  120

Query  397   FTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGA  576
             FTA+FA+F+VK K T +++NA+VL+T G+VVL L+   D+   E+ + Y +GF MT+  A
Sbjct  121   FTALFAFFMVKQKFTPFTINAIVLLTGGAVVLALNSDSDKLANETHKEYVVGFIMTLGAA  180

Query  577   ALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQ--------  732
              L+GFI+  VE ++  +G  +T  L ++ Q ++   +   C V M+   DF+        
Sbjct  181   LLYGFILPLVELSYKKSGQRITYTLALEFQMVLCFAATCVCLVGMLAAGDFKVKHALFIF  240

Query  733   ---AISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQ  903
                 I+ EAR+F LG   YY+++ F AI  Q   +G++G+IF +S+L+ GI  S L+ V 
Sbjct  241   KNRVIAGEARDFKLGESLYYVVIVFTAIIWQAFFVGAIGLIFCASSLVSGIMVSALLPVT  300

Query  904   QVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARK  1023
              + +VI   E F A K ++LA+ +WG  SYFYG  K+  K
Sbjct  301   VILAVICFQEKFQAGKGVALALSLWGSVSYFYGQVKSEEK  340



>gb|AAC69140.1| hypothetical protein [Arabidopsis thaliana]
Length=356

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 133/337 (39%), Positives = 210/337 (62%), Gaps = 13/337 (4%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K +++IINC+FLA+G  GG +++RLYF +GG+R W  S L T G P +  P+ +S+ R +
Sbjct  2     KTVLVIINCIFLAIGNCGGPLMMRLYFQNGGERIWFPSFLQTVGCPLIFFPLLLSFLRRR  61

Query  232   akaaanrrr--VLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
                         L+ P LF+++  +GLL+G D+YLY++G++Y+PVS +SL+ S QL FTA
Sbjct  62    RCLEEQETTPFFLMKPPLFIAAIVVGLLVGFDNYLYSYGLAYIPVSTASLIISAQLGFTA  121

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
             +FA+F+VK K T +++NA+VL+T G+VVL L+   D+   E+ + Y +GF MT+  A L+
Sbjct  122   LFAFFMVKQKFTPFTINAIVLLTGGAVVLALNSDSDKLANETHKEYVVGFIMTLGAALLY  181

Query  586   GFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQ-----------  732
             GFI+  VE ++  +G  +T  L ++ Q ++   +   C V M+   DF+           
Sbjct  182   GFILPLVELSYKKSGQRITYTLALEFQMVLCFAATCVCLVGMLAAGDFKVKHALFIFKNR  241

Query  733   AISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVF  912
              I+ EAR+F LG   YY+++ F AI  Q   +G++G+IF +S+L+ GI  S L+ V  + 
Sbjct  242   VIAGEARDFKLGESLYYVVIVFTAIIWQAFFVGAIGLIFCASSLVSGIMVSALLPVTVIL  301

Query  913   SVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARK  1023
             +VI   E F A K ++LA+ +WG  SYFYG  K+  K
Sbjct  302   AVICFQEKFQAGKGVALALSLWGSVSYFYGQVKSEEK  338



>dbj|BAJ88843.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score =   246 bits (629),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 213/365 (58%), Gaps = 26/365 (7%)
 Frame = +1

Query  19    EDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLL  198
              D+        +  ++ +N + LAVG   G +L+RLYFL GG RKWLSS L TAG+P LL
Sbjct  53    HDLTGAAARPLRDPLLAVNFLLLAVGASCGPLLLRLYFLRGGARKWLSSLLQTAGWPLLL  112

Query  199   VPIFISYarnqaka---------aanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSY  351
             VP+  S++  + +            +    L+TP L  ++  +G++ G D++LY +G +Y
Sbjct  113   VPLCFSFSSRRRRRRHRQGGGDDPISSAVFLMTPRLLAATVVVGIMTGADNFLYAYGTAY  172

Query  352   LPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGES  531
             LPVS SS+L STQLAFTA FA  +V+ + T  +VNA+VL++ G+ +LG+   GDRP G +
Sbjct  173   LPVSTSSILISTQLAFTAAFALLVVRQRFTASTVNAIVLLSVGAAMLGMGSGGDRPAGVT  232

Query  532   DRSYTLGFFMTIAGAALHGFIMAGVEYAH-----VHAGVPVTNGLLMQVQFIISMFSALF  696
                Y  GF   +  AAL+G ++  +E +            +T  L++++Q +I + +  F
Sbjct  233   GAQYAAGFGTALGAAALYGLVLPVMELSQAWHAARAGAAALTYTLVVEIQVVIGLTATAF  292

Query  697   CTVAMIINKDFQAISKEAREFDLGTEKYY-MIVGFAAIALQLMVMGSLGVIFSSSALLLG  873
             C V M++NKDFQAI +EAR+ +LG   YY ++VG AA+  Q   +G +G I+  SAL  G
Sbjct  293   CAVGMLVNKDFQAIPREARQSELGKAGYYLLLVGTAAV-YQCFCLGIIGAIYYGSALFAG  351

Query  874   IFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGD  1053
             I  ++ + V +V +V+F  E FS  K ++L + +WG ASYFYG+    R   P       
Sbjct  352   IIITVFLPVTEVLAVVFFHEPFSGTKGVALGLSLWGLASYFYGE---VRHMAP-------  401

Query  1054  DEEHQ  1068
             D EHQ
Sbjct  402   DAEHQ  406



>gb|ABR16841.1| unknown [Picea sitchensis]
Length=368

 Score =   244 bits (624),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 138/333 (41%), Positives = 212/333 (64%), Gaps = 12/333 (4%)
 Frame = +1

Query  94    GQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLVTP  273
             G   G +L R YFLHGG ++WLSS L TAG+P LL+P+++SY +   +         +TP
Sbjct  39    GSTAGPLLTRFYFLHGGSKRWLSSWLETAGWPLLLLPLYLSYRKQPNRENH------ITP  92

Query  274   WLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSV  453
              LF++   +G+L G D YLY +G+S+LP+S +S+L ++ L FTA FA  +V+ K + +SV
Sbjct  93    KLFLACCGIGILTGADDYLYAYGLSFLPLSTASVLIASHLGFTAGFALLLVRQKFSPFSV  152

Query  454   NAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHAGV  633
             N+VVL++  SV+L  H +GDRPEG + R Y +GF +T+  AAL+GF++  +E  +  A  
Sbjct  153   NSVVLLSASSVLLAFHTSGDRPEGVTSRQYVVGFVLTLGAAALYGFVIPLIELTYKRAKR  212

Query  634   PVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAIAL  813
             P+T  L+M++QF++S+ + +FCTV M+IN DFQA+ +EA  F LG   Y M + +AA+A 
Sbjct  213   PITYTLVMEMQFVMSVTATVFCTVGMLINGDFQALHREAEGFRLGKIDYSMALVWAAVAW  272

Query  814   QLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFASY  993
             QL  +G  GV   +S+LL G+  +L++   +V +VI   E FSA+K ++L + +WGFASY
Sbjct  273   QLFFIGVFGVTSMASSLLSGVIIALMIPGTEVLAVILFHEKFSAEKGMALVLALWGFASY  332

Query  994   -FYGDYKTARKKPPPPPVTGDDEE-----HQEV  1074
              +   Y   + +PP  P      E     HQ +
Sbjct  333   LYGEYYYYLKLRPPDVPKQQSKPEGAAHAHQSI  365



>gb|KFK31021.1| hypothetical protein AALP_AA6G057800 [Arabis alpina]
Length=317

 Score =   240 bits (613),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 128/342 (37%), Positives = 204/342 (60%), Gaps = 36/342 (11%)
 Frame = +1

Query  43    LSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYa  222
             +  K +++IINC+ LA+G  GG ++ RLY+ +GGKR W SS L TAG  C ++ + + ++
Sbjct  3     MKMKTVLVIINCIILAIGNCGGPLMTRLYYNNGGKRIWFSSFLQTAG--CPIILLPLLFS  60

Query  223   rnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFT  402
                 +       +L+   LF++S  +GLL G D+YLY +G++YLPVS SSL+ S+QLAFT
Sbjct  61    FFLRRKEEKTPYLLIKRPLFLASIVIGLLTGFDNYLYAYGLAYLPVSTSSLILSSQLAFT  120

Query  403   AVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAAL  582
             A+FA+F+VKHK T +++NA+VL+T GS +L LH  GD+   E+ + Y +GF MT+A + L
Sbjct  121   ALFAFFLVKHKFTPFTINAIVLITIGSGILALHTDGDKLAEETHKEYVIGFLMTLAASVL  180

Query  583   HGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFD  762
             + F++  VE  +  A   ++  L++++Q ++   +  FC V M+ + DF+ I+ EAREF 
Sbjct  181   YAFVLPLVELTYKKARQEISYTLVLEMQIVLCSVATCFCLVGMLADGDFKVIANEAREFK  240

Query  763   LGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFS  942
             LG  +YY +V                V+F++            +  Q++ +++F  E F 
Sbjct  241   LGGTRYYYVV----------------VVFTA------------IIWQELLAILFFREKFQ  272

Query  943   ADKLLSLAICIWGFASYFYGDYKTARKKPPPP------PVTG  1050
             A+K +SL + +WGF SYFYG  K+  K           PVTG
Sbjct  273   AEKGVSLGLSLWGFVSYFYGQIKSENKTQDHETQLSQLPVTG  314



>ref|XP_002462514.1| hypothetical protein SORBIDRAFT_02g027090 [Sorghum bicolor]
 gb|EER99035.1| hypothetical protein SORBIDRAFT_02g027090 [Sorghum bicolor]
Length=378

 Score =   239 bits (611),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 133/359 (37%), Positives = 205/359 (57%), Gaps = 33/359 (9%)
 Frame = +1

Query  10    KNLEDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFP  189
             +N+           +  ++++N   + VG  GG + +R YFLHGG RKWLS+ L TAGFP
Sbjct  11    RNVAQSAGTTRTLIRNPLLVVNFALMVVGSAGGPLFLRAYFLHGGARKWLSAFLQTAGFP  70

Query  190   CLLVPIFISYarnqakaaanrrrV----------------LVTPWLFMSSAFLGLLLGVD  321
              LLVP+ +S+   + +   +                    L+TP L  +SA +GL+ GVD
Sbjct  71    LLLVPLCVSFFSRRRQRDRDDADADADAPANKAATRTPFFLMTPRLLAASAAIGLMTGVD  130

Query  322   SYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLH  501
               LY +G++YLP           LAFTA FA  +V+ + T +SVNAV L+T G+ +LG++
Sbjct  131   DLLYAYGLAYLP-----------LAFTAAFALLLVRQRFTAFSVNAVALLTVGAAMLGMN  179

Query  502   MAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAH-----VHAGVPVTNGLLMQVQ  666
               GDRP G S   Y  GF MT+  AAL+G ++  VE +            VT  L++++Q
Sbjct  180   AGGDRPAGVSRAQYGAGFAMTLGAAALYGLVLPVVELSQARHAARAGAGAVTYTLVIEMQ  239

Query  667   FIISMFSALFCTVAMIINKDFQAISKEAREFDL-GTEKYYMIVGFAAIALQLMVMGSLGV  843
              +I + + +F  V M+ N D  AI  EAREFDL G+  YY+++  +A   Q   +G++G 
Sbjct  240   LVIGLTATVFSAVGMLANNDLHAIPGEAREFDLGGSAGYYLLLAGSAATYQCFFLGTIGA  299

Query  844   IFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTAR  1020
             +F  SALL G+  ++L+ V +V +V+F  E F+  K ++LA+ +WGF SYFYG+ +T++
Sbjct  300   VFFGSALLAGVVMTVLIPVTEVLAVMFFHEPFNGTKGVALALSLWGFVSYFYGEVQTSK  358



>ref|XP_006661332.1| PREDICTED: purine permease 3-like, partial [Oryza brachyantha]
Length=265

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/251 (45%), Positives = 173/251 (69%), Gaps = 3/251 (1%)
 Frame = +1

Query  283   MSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAV  462
             ++ A LG+L G D ++Y  G++YLPVS S++L+ST LAFT  FA  IV+ +LT  ++NAV
Sbjct  1     LAGAGLGVLTGADDFIYASGLAYLPVSTSAILTSTHLAFTVFFACLIVRQRLTAATLNAV  60

Query  463   VLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHA---GV  633
              L+T G+VVLGLH + DRP G ++  Y +GFF+T+  AAL+G I+  VE A+ HA   G 
Sbjct  61    ALLTIGAVVLGLHTSNDRPAGVTNGKYWMGFFLTLGAAALYGLILPLVELAYKHAAGGGR  120

Query  634   PVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAIAL  813
              VT  L++++Q ++  F+  FCTV MI++KDFQAI +EA++++LG  +YY ++ F AI  
Sbjct  121   AVTYALVVEMQLVMGFFATAFCTVGMIVDKDFQAIPREAKQYELGETRYYTVLVFNAILW  180

Query  814   QLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFASY  993
             Q   +G++GVIF    LL GI  ++ + + +V SV+FL E FS++K ++L + +WG ASY
Sbjct  181   QFFFVGAIGVIFYVHTLLAGIIIAVFIPITEVLSVVFLHEKFSSEKGVALVLSLWGLASY  240

Query  994   FYGDYKTARKK  1026
              YG+Y  A+  
Sbjct  241   SYGEYTDAKAN  251



>ref|XP_009113691.1| PREDICTED: purine permease 1-like [Brassica rapa]
Length=355

 Score =   234 bits (597),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 125/349 (36%), Positives = 215/349 (62%), Gaps = 17/349 (5%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K  ++++ C+ LA+G  GG +L RLY+ +GG+R W  S + TAG P + +P+ +S+ R +
Sbjct  2     KNSLLVLICMILAIGTCGGPLLTRLYYNNGGERIWFMSFISTAGCPVIFIPLVLSFLRRR  61

Query  232   ----akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAF  399
                 ++       VL+   +FM+S  +GLL+G+D+Y + +G++YLPVS +SL+  TQL F
Sbjct  62    NRNNSENIEKTEIVLMETPMFMASIVIGLLIGLDNYCFAYGLAYLPVSTTSLIVGTQLGF  121

Query  400   TAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMA-GDRPEGESDRSYTLGFFMTIAGA  576
              A+F++F+VK   T +S+NAVVL+T G+ +L L    G+R    S + Y +GF +T+  A
Sbjct  122   NAIFSFFMVKQTFTPFSINAVVLLTAGTGILALRGGDGERSADVSHKEYVVGFLVTLTAA  181

Query  577   ALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEARE  756
              L+ FI+  VE  +      +T  L++++Q ++ + ++ FC V M++  DF+ I  EARE
Sbjct  182   VLYAFILPFVELTYKKVRQQITFTLVLEMQLVMCIAASCFCIVGMLVEGDFKVIPIEARE  241

Query  757   FDL--GTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLP  930
             F +  G+  YYM++    I  Q + +G++GV+F +S+L  G+  S L+ V +V +V+   
Sbjct  242   FKVGGGSAFYYMLILMTGIVYQGLFLGAIGVVFCASSLASGVLISALLPVTEVLAVVCFR  301

Query  931   ESFSADKLLSLAICIWGFASYFYGDYKTARK----------KPPPPPVT  1047
             E F  +K ++L + +WGF SYFYG++K+ ++          + PP PV+
Sbjct  302   EKFQVEKGVALLLSLWGFVSYFYGEFKSGKRIINKTQLQETELPPLPVS  350



>gb|EPS58788.1| hypothetical protein M569_16026, partial [Genlisea aurea]
Length=330

 Score =   233 bits (594),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 126/328 (38%), Positives = 199/328 (61%), Gaps = 3/328 (1%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K L +++N V LAVG  G  + +RLYF  GG+  W +  L + G+P +L+P+ ++Y   +
Sbjct  2     KRLFLLVNAVILAVGYCGLPLTLRLYFGRGGEMVWFAGWLQSGGWPVILLPLAVNYLARR  61

Query  232   akaaan--rrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
              +   +   + + + P LF ++  +G++ G D+++Y +G+S LPVS  +L+ +TQLAFT 
Sbjct  62    RERTPSGSVKVIRLRPKLFAAAMAIGMITGADNFMYAYGISKLPVSTVALIDATQLAFTV  121

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALH  585
             VF++FIVK KLT +SVNAVVL+T G+VV  +H  GDRP GES   Y  GF M    AA  
Sbjct  122   VFSFFIVKQKLTAFSVNAVVLLTVGAVVFAVHSTGDRPAGESHSEYWKGFAMMAGSAATF  181

Query  586   GFIMAGVEYAHVHAGVPVTN-GLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFD  762
             G  ++ VE+++   G P  +   +++   + ++ + LF TV M    +FQAI  EA  + 
Sbjct  182   GLCLSLVEFSYAKTGGPSMDYAAVLEFDLVTNISATLFSTVGMAAEHNFQAIRGEATGYR  241

Query  763   LGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFS  942
              G  KYY  V   A+  Q + +G  GVI  SS+L  GI  S+L+ + +V +V+F  + + 
Sbjct  242   SGRIKYYAAVFSVALVCQCLRLGIAGVIHYSSSLYSGILLSVLLPLVEVLAVVFFKDEYP  301

Query  943   ADKLLSLAICIWGFASYFYGDYKTARKK  1026
              +K ++L + +WGF SYFYG+YK A  +
Sbjct  302   PEKGIALFLSLWGFVSYFYGEYKVANNR  329



>emb|CDY15687.1| BnaA07g08580D [Brassica napus]
Length=303

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/255 (43%), Positives = 175/255 (69%), Gaps = 0/255 (0%)
 Frame = +1

Query  262   LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLT  441
             L+ P L M++  +G+L G D+YLY +G++YLPVS ++L+ ++QLAF A+F+YF+V HK T
Sbjct  29    LIKPRLLMAAILIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAIFSYFMVSHKFT  88

Query  442   HYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHV  621
              +++NAVVL+T G+ VLG+H   D+P  E+ + Y +GF +T+A A ++ F++  VE A+ 
Sbjct  89    PFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYMVGFLVTVAAAVMYAFLLPLVELAYQ  148

Query  622   HAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFA  801
              A  P++  L+++VQ I+   ++L   V M+I  DF+A+  EAREF LG   +Y++   +
Sbjct  149   KAKQPMSYTLVLEVQMILCFLASLVSLVGMLIAGDFKALPNEAREFKLGEAMFYVVAVLS  208

Query  802   AIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWG  981
             AI  Q   +G++G+IF +S+L+ GI  S+L+ + +V +VIF  E F  +K LSLA+ +WG
Sbjct  209   AIIWQGFFLGAIGLIFCASSLVSGIMISVLLPITEVLAVIFYHEKFQKEKGLSLALSLWG  268

Query  982   FASYFYGDYKTARKK  1026
             F SYFYG+ K  + K
Sbjct  269   FVSYFYGEIKADKDK  283



>ref|XP_004158055.1| PREDICTED: LOW QUALITY PROTEIN: purine permease 3-like [Cucumis 
sativus]
Length=304

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/297 (42%), Positives = 191/297 (64%), Gaps = 9/297 (3%)
 Frame = +1

Query  52   KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
            +  +++ NC  LAVG  GG +L+RLYFLHGG R WLS+ L TAG P + +P+ ISY   +
Sbjct  2    RRTLLVFNCFLLAVGTCGGPLLMRLYFLHGGNRVWLSTFLETAGCPIIFIPLLISYIHRR  61

Query  232  aka---------aanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSS  384
             +            +   + +   LF++S  +G++ G   +LY +G++ +PVS S+L+ +
Sbjct  62   RRRAHSLNPSESTNSTEMIFMKSRLFLASGVIGIITGFVDFLYAYGVARIPVSTSALIRA  121

Query  385  TQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMT  564
             QLAFTA FA+++VK K T YS+N+VVL+T G  +L LH +GDR  GES+R Y  GF  T
Sbjct  122  CQLAFTAGFAFWLVKQKFTAYSINSVVLVTAGGAILALHTSGDRRAGESNREYIEGFLTT  181

Query  565  IAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISK  744
            +A + ++GFI+  VE  +  A   +T  L+++VQ I+S+F+ L C++AM+IN DFQ I+ 
Sbjct  182  VAASVVYGFILPLVELTYKKARQQITYTLVLEVQLIMSLFATLVCSIAMLINNDFQMIAM  241

Query  745  EAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFS  915
            EA  F LG  KYY+I+  +AI  Q   +G +GVIFSSS+   GI  ++L+ V ++ +
Sbjct  242  EAEAFGLGKAKYYVILVLSAIIWQGFFLGVIGVIFSSSSFXSGIIIAVLLPVTEILA  298



>gb|EPS72255.1| hypothetical protein M569_02503, partial [Genlisea aurea]
Length=232

 Score =   222 bits (565),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 161/231 (70%), Gaps = 0/231 (0%)
 Frame = +1

Query  313   GVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVL  492
             G+ +Y YT+G+S +PVS SSL+ ++QLAFTAVF +F+VK K T YS+NAVVL+T G+ VL
Sbjct  2     GLVNYFYTYGVSKIPVSTSSLIIASQLAFTAVFCFFLVKQKFTPYSINAVVLLTCGAAVL  61

Query  493   GLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFI  672
              +H + DRP GES++ Y +GF MT A + L+G I+  +E +++ AG  ++  L+++ Q +
Sbjct  62    AMHASSDRPNGESNKDYWMGFIMTAAVSVLYGLILPLMELSYMRAGQVLSYSLILEFQMV  121

Query  673   ISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFS  852
             +  F+  FCTV MI+NKDFQAI +EA  F+LG  KYY++V F     Q   +G +GVIF 
Sbjct  122   MCFFATAFCTVGMIVNKDFQAIGEEAEGFELGVAKYYVVVFFNVTINQCFFVGVVGVIFY  181

Query  853   SSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGD  1005
             SS+L  G+  +LL+   ++ +V+F  E F  +K +SL + +WGF SYFYG+
Sbjct  182   SSSLFSGVLLALLLPPTEILAVVFFHEKFQVEKGVSLFLALWGFVSYFYGE  232



>gb|EEE69873.1| hypothetical protein OsJ_29687 [Oryza sativa Japonica Group]
Length=341

 Score =   224 bits (570),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/238 (46%), Positives = 166/238 (70%), Gaps = 3/238 (1%)
 Frame = +1

Query  298   LGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTF  477
             +G+L G D ++Y +G++YLPVS S++L STQLAFT  FA  IV+ +LT  ++NAV L+T 
Sbjct  85    VGVLTGADDFVYAYGLAYLPVSTSAILISTQLAFTVFFACLIVRQRLTAATLNAVALLTI  144

Query  478   GSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHA---GVPVTNG  648
             G+VVLGLH + DRP G +   Y +GFF+T+  AAL+G I+  VE A+ HA   G  VT  
Sbjct  145   GAVVLGLHASKDRPAGVTTGKYWMGFFLTLGAAALYGLILPLVELAYKHAAGGGRAVTYA  204

Query  649   LLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVM  828
             L+M++Q ++  F+  FCTV +I+NKDFQAI +EA++++LG  +YY+++ F A+  +   +
Sbjct  205   LVMEMQLVMGFFATAFCTVGVIVNKDFQAIPREAKQYELGEARYYVVLVFNAVLWEFFFV  264

Query  829   GSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFASYFYG  1002
             G++GVIF    LL GI  ++ + + +V  VIFL E FS++K ++L + +WG ASY YG
Sbjct  265   GAVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFSSEKGVALVLSLWGLASYSYG  322



>gb|KCW51603.1| hypothetical protein EUGRSUZ_J01095 [Eucalyptus grandis]
Length=302

 Score =   222 bits (566),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/322 (37%), Positives = 195/322 (61%), Gaps = 27/322 (8%)
 Frame = +1

Query  118   IRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLVTPWLFMSSAF  297
             +RLYF+ G  R WL S L    +P LL+P+  +Y+R ++      R +L+  +LF ++A 
Sbjct  1     MRLYFVRGKARMWLVSWLEMGAWPMLLLPLAAAYSRRRSAMGPAARLILMDRFLFAAAAG  60

Query  298   LGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTF  477
             +G+L+G+D+Y Y +G+  LPVS S+LL +TQLAFTA FA+ +V+   T  S+N+      
Sbjct  61    IGVLMGLDNYFYVYGLGRLPVSTSALLIATQLAFTAGFAFLLVRQVFTSCSINS------  114

Query  478   GSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLM  657
                              S+ +   GFFM++  AAL+GF++  VE  +  A   VT  L++
Sbjct  115   -----------------SNGANYAGFFMSLGAAALYGFVLPLVELTYKKAKQAVTYSLVL  157

Query  658   QVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSL  837
             ++Q ++  F+  FCT+ M++NKDFQAI +EAR ++LG  +YY+++ + AI  Q   +G++
Sbjct  158   EIQLVMCFFATAFCTIGMLVNKDFQAIPREARSYELGEARYYVLLVWTAIINQFFFLGAI  217

Query  838   GVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTA  1017
             GVIF +S+L   +  + L+ V ++ +VI   E F A+K ++LA+ +WGFASYFYG++K  
Sbjct  218   GVIFYASSLFSAVIIAALLPVTEILAVICFQEKFQAEKGVALALSLWGFASYFYGEFKLV  277

Query  1018  RKKPPPPPVT----GDDEEHQE  1071
             +K+      T     + E HQ+
Sbjct  278   KKEKEATAGTVIKPAETEMHQQ  299



>ref|XP_010098677.1| Purine permease 3 [Morus notabilis]
 gb|EXB75580.1| Purine permease 3 [Morus notabilis]
Length=273

 Score =   221 bits (563),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 163/227 (72%), Gaps = 2/227 (1%)
 Frame = +1

Query  52   KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
            KAL +I+NC+ L++G  GG +++RLYFL+GGKR WLSS L T G+  +L+P+  S+ R +
Sbjct  14   KAL-LILNCILLSIGNCGGPLIMRLYFLNGGKRVWLSSWLETGGWAIILLPLAFSFYRRR  72

Query  232  akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
             + +A +    + P+LF++SA +GLL G+D Y+Y +G++ LPVS S+L+ ++QLAFTA F
Sbjct  73   RQNSAAKFFE-IKPFLFLASAGVGLLTGLDDYIYAYGVARLPVSTSALIIASQLAFTAAF  131

Query  412  AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
            AY +VK K T YSVNAVVL+T    VL LH +GDRP+GES++ Y +GF MT+  A L+GF
Sbjct  132  AYLLVKQKFTSYSVNAVVLLTIAGAVLALHTSGDRPKGESNKEYLMGFLMTVGAAVLYGF  191

Query  592  IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQ  732
            I+  +E  +  A   +T  L++++Q ++  F+  FCTV MI+NKDFQ
Sbjct  192  ILPLMELVYKKAKQEITYSLVLEIQMVMCFFATAFCTVGMIVNKDFQ  238



>gb|EPS74474.1| hypothetical protein M569_00285, partial [Genlisea aurea]
Length=311

 Score =   222 bits (565),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 128/316 (41%), Positives = 198/316 (63%), Gaps = 5/316 (2%)
 Frame = +1

Query  61    VIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqaka  240
             ++IIN + LAVG  G  +++RLYF+HGGK  W +S L T+ FP +L+P+  ++ R     
Sbjct  1     LLIINGLLLAVGSSGIPLIMRLYFIHGGKMLWFASWLQTSAFPLILIPLLFNHLRRTTTT  60

Query  241   aanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYF  420
             AA    +     L  ++A +G+ +G ++YLY +G S LPVS SSL+ STQL FTA+F++ 
Sbjct  61    AARFFSI--NRKLSAAAAAIGIAIGFNNYLYAYGSSKLPVSTSSLIFSTQLIFTALFSFL  118

Query  421   IVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMA  600
             +VKHK T YS+NA+VL+T G+V+L  H +    + ESDR Y  GF +T+   AL G I  
Sbjct  119   LVKHKFTAYSINAIVLLTVGAVILSFHSSA---KDESDRDYEFGFAVTVTAVALSGLIQP  175

Query  601   GVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKY  780
              +E  ++ +   V   + ++ QF++S F+  FCTV M++ KDF+ IS EA+ F++G   Y
Sbjct  176   LMELCYLKSDQAVDGVVALEFQFVLSSFATGFCTVGMLMGKDFEGISGEAKGFEIGAVNY  235

Query  781   YMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLS  960
              + V F A+  Q   +GS+GVI  SSALL G+     + + ++ +V+   E F  +K +S
Sbjct  236   ILTVFFTAVVSQCFFLGSVGVIHLSSALLAGVIICASLPLCEILAVVLFREKFRPEKGVS  295

Query  961   LAICIWGFASYFYGDY  1008
             L + +WG  SYFYG++
Sbjct  296   LLLSLWGSVSYFYGEF  311



>ref|XP_008779125.1| PREDICTED: purine permease 1-like [Phoenix dactylifera]
Length=261

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 155/221 (70%), Gaps = 1/221 (0%)
 Frame = +1

Query  70   INCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaan  249
            +N   + +G     +L+RLYFL GG RKWLS  L T G+P LL+P+ ISYA  +      
Sbjct  28   LNFAIMVIGTTASPLLLRLYFLKGGSRKWLSGWLETVGWPLLLIPLAISYAHRRRGGGPT  87

Query  250  rrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVK  429
            +   L+TP LF++   LGLLLG+D +L  +G+SYLPVS SS+L STQL FTA+FA+FIVK
Sbjct  88   KLY-LMTPPLFLACTVLGLLLGLDCFLNAYGLSYLPVSTSSILISTQLGFTALFAFFIVK  146

Query  430  HKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVE  609
             K T +S NAVVL++ G+V+LGLH +GDRPEGES+  Y LGF MT+A A L+ FI+  VE
Sbjct  147  QKFTSFSTNAVVLLSIGAVMLGLHASGDRPEGESNTLYYLGFAMTLAAAVLYAFILPLVE  206

Query  610  YAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQ  732
              +  A   V+  L+M++Q ++  F+A+FCTV M++NKDFQ
Sbjct  207  LTYAKAKQVVSYTLVMEMQLVMGFFAAVFCTVGMLVNKDFQ  247



>emb|CDX90135.1| BnaA08g18490D [Brassica napus]
Length=323

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 124/346 (36%), Positives = 195/346 (56%), Gaps = 37/346 (11%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
             K  ++II C+FLA+G  GG +L RLY+  GG R W  S L TAG P +L+P+++S+ R  
Sbjct  2     KNGLLIIVCIFLAIGTCGGPLLTRLYYTKGGSRIWFMSFLATAGCPIILIPLYVSFLRRS  61

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
              +   N           M +                     P+ I+S+L     AF A+F
Sbjct  62    NRNHNNSETAEKAKVFVMET---------------------PLFIASIL-----AFNAIF  95

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             ++ +VK K T +S+NAVVL+T G+ +L LH   DRP G S + Y +GF +T+  A L+ F
Sbjct  96    SFLMVKQKFTPFSINAVVLLTVGTGILALHTDRDRPAGVSKKEYVVGFLLTLIAAVLYAF  155

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             +M  VE  +      +T  L++++Q ++ + S  FC V M++  DF AI +EAREF +G+
Sbjct  156   LMPLVELTYKKVRQEITFTLVLEMQMVMCVASTCFCLVGMVVKGDFVAIPREAREFMIGS  215

Query  772   EK-YYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
                YY ++    I  Q   +G+LGV++ +S+L  G+F S+L+ V +V +V+   E F A+
Sbjct  216   SLFYYTLIVVIGIVWQCFFLGALGVVYCASSLASGVFVSVLLPVTEVLAVVCFREKFQAE  275

Query  949   KLLSLAICIWGFASYFYGDYKTARK----------KPPPPPVTGDD  1056
             K ++L + +WGF SYFYG++K+ +K          + PP PV+G D
Sbjct  276   KGVALLLSLWGFVSYFYGEFKSGKKIIDSPKSPETELPPLPVSGSD  321



>ref|XP_010939716.1| PREDICTED: purine permease 1-like isoform X1 [Elaeis guineensis]
Length=408

 Score =   217 bits (553),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 116/243 (48%), Positives = 164/243 (67%), Gaps = 4/243 (2%)
 Frame = +1

Query  52   KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
            +  ++ +N   + +G   G +L+RLYFL GG RKWLSS L T G+P L +P+ ISYA   
Sbjct  23   RWFLMALNFTIMVIGTAVGPLLLRLYFLKGGTRKWLSSWLQTGGWPLLFIPLAISYAHRC  82

Query  232  akaaanrrrV-LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAV  408
                    ++ L+TP LF++   LGLL+G+D +LY +G+SYLPVS SS+L S+QL FTA+
Sbjct  83   RCGGGRPIKLYLMTPPLFLACTVLGLLVGLDDFLYAYGLSYLPVSTSSILISSQLGFTAL  142

Query  409  FAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHG  588
            FA+F+VK K T +SVNAVVL++ G+V+LGLH +GDRP+GES+  Y LGFFMT+A A L+G
Sbjct  143  FAFFMVKQKFTSFSVNAVVLLSIGAVILGLHASGDRPKGESNTQYYLGFFMTLAAAVLYG  202

Query  589  FIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLG  768
            FI+  VE  +  A   V+  L++++Q  +  F+ +FCTV M++N DF  I    R   L 
Sbjct  203  FILPLVELTYAKAKQVVSYTLVIEMQLAMGFFATVFCTVGMLVNGDFHNILVHCR---LS  259

Query  769  TEK  777
             EK
Sbjct  260  REK  262



>gb|KCW66597.1| hypothetical protein EUGRSUZ_F00391 [Eucalyptus grandis]
Length=261

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/228 (45%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = +1

Query  52   KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
            K L++ +NC  L++G  GG +L+RLY+L+GG   WLSS L T G+P + + + ++Y R +
Sbjct  32   KPLLLALNCAMLSLGTCGGPLLMRLYYLYGGSGVWLSSWLETGGWPAIFLALAVAYLRRR  91

Query  232  akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
            +    + R VL+ P+LF +SA +G+L G+D YLY +G++ LP S S+LL +TQLAFTA F
Sbjct  92   SAEGPSARLVLMDPFLFAASAVVGVLTGLDDYLYAYGVARLPASTSALLIATQLAFTAGF  151

Query  412  AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
            A+ +V+ + T YS+N+V L+T  + VL L+ + DRP GESD+ Y  GFFMT+  AAL+GF
Sbjct  152  AFLLVRQQFTSYSINSVYLLTVAAGVLALNASSDRPAGESDQEYYAGFFMTLGAAALYGF  211

Query  592  IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQA  735
            ++  VE  +  A   VT  L++++Q ++  F+  FCTV M++NKDFQ+
Sbjct  212  VLPLVELTYKKAKQAVTYSLVLEIQLVMCFFATAFCTVGMLVNKDFQS  259



>ref|XP_006415683.1| hypothetical protein EUTSA_v10009673mg [Eutrema salsugineum]
 gb|ESQ34036.1| hypothetical protein EUTSA_v10009673mg [Eutrema salsugineum]
Length=338

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 117/324 (36%), Positives = 192/324 (59%), Gaps = 11/324 (3%)
 Frame = +1

Query  61    VIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqaka  240
             ++IINC+ LA+G  GG +++RLYF +GGK  W S+ L TAGFP + +P+  SY + +   
Sbjct  5     IVIINCIVLAIGNCGGPLIMRLYFNNGGKSIWFSTFLETAGFPIIFIPLLFSYLKRRRSN  64

Query  241   a--anrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFA  414
                 N    L+ P L +++  +G+L G D+YLY +G++YLPVS ++L+ ++QLAF A+F+
Sbjct  65    NGNENTSLFLIKPRLLIAAVLIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAIFS  124

Query  415   YFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFI  594
             YF+V HK T +++NAVVL+T G+ VLG+H   D+P  E+ + Y +GF +T+A A ++ F+
Sbjct  125   YFMVNHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYIIGFLVTVAAAVMYAFV  184

Query  595   MAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTE  774
             +  VE A+  A  P++  L+++VQ I+   ++L   + +  N+  +  +        G  
Sbjct  185   LPLVELAYQKAKQPMSYSLVLEVQLILCFLASLVSLIGL-TNRSKRIQAWRGNVLCGG--  241

Query  775   KYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKL  954
                   GF+   L  +++GS  +        LG +     A  +  S  F  E F A+K 
Sbjct  242   -----CGFSH-NLARILLGSHWIDLLRIISRLGYYDISPFAHHRGLSCYFYHEKFQAEKG  295

Query  955   LSLAICIWGFASYFYGDYKTARKK  1026
             LSLA+ +WGF SYFYG+ K  ++ 
Sbjct  296   LSLALSLWGFVSYFYGEIKANKEN  319



>ref|XP_003602861.1| Purine permease [Medicago truncatula]
Length=274

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 105/270 (39%), Positives = 166/270 (61%), Gaps = 13/270 (5%)
 Frame = +1

Query  16   LEDMKK-MKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPC  192
            +ED KK +     K  ++++NC+ L++G     +++RLYF+HGG+R WLS+ L TAGFP 
Sbjct  1    MEDGKKQVAEKKMKRFLLVVNCLILSLGTCSAPLIMRLYFIHGGQRVWLSAFLQTAGFPL  60

Query  193  LLVPIFISYarnqakaaanrrrVLVT------------PWLFMSSAFLGLLLGVDSYLYT  336
            +L+P+ ISY +             ++            P +F ++AF+G+L G+D YL+ 
Sbjct  61   MLIPLAISYIKRHRLHHHPPPLTTISIAPEKLNIISMKPPIFFAAAFIGILTGLDDYLFA  120

Query  337  FGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDR  516
            +G++ LPVS S+L+ ++QL FTA FA+ IVK K T ++VNAVVL+T G+ VL +H + DR
Sbjct  121  YGVARLPVSTSALIIASQLGFTAFFAFLIVKEKFTAFTVNAVVLLTVGAGVLAMHTSSDR  180

Query  517  PEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALF  696
            P G S + Y + F  T+A +AL+GFI+  VE  +     PVT   +M+ QF+  MF+ LF
Sbjct  181  PAGVSAKQYWISFSTTVAASALYGFILPSVELVYKKIKQPVTYSFVMEFQFVTCMFATLF  240

Query  697  CTVAMIINKDFQAISKEAREFDLGTEKYYM  786
            C + MI N DF+ + +    + L  E+ ++
Sbjct  241  CAIGMIANNDFKRVYENFVAWTLLIEELHL  270



>ref|XP_002977419.1| hypothetical protein SELMODRAFT_417455 [Selaginella moellendorffii]
 gb|EFJ21423.1| hypothetical protein SELMODRAFT_417455 [Selaginella moellendorffii]
Length=380

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/321 (38%), Positives = 182/321 (57%), Gaps = 15/321 (5%)
 Frame = +1

Query  94    GQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLVTP  273
             G + G +L R YF  GG RKWLS+ L T+G+P L V     Y +   K         +TP
Sbjct  68    GTVVGQLLTRFYFAAGGSRKWLSTWLQTSGWPLLAVATGSIYWKRGIKLTP------LTP  121

Query  274   WLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSV  453
              L  +   LG L+ + S++Y +G+SYLP S S LLSS+QLAF A+FA  I + K+  +  
Sbjct  122   ALAATYTALGFLVALYSFMYAYGLSYLPASTSGLLSSSQLAFNAIFALIITRQKINPFGW  181

Query  454   NAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVE-------Y  612
             NA+VL+T  +V+L LH   ++  G + +   LG+ MTI  AAL GF     E        
Sbjct  182   NAIVLVTSAAVILALHSDDEKLPGVTRKEVVLGYVMTIVAAALSGFFFPITELVIRKFLT  241

Query  613   AHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIV  792
                 +G   T  +L+++Q ++S+ S    +VAM IN DF AI  E+R F  G  +YY+ +
Sbjct  242   GSSRSGDAAT--VLLEMQTLLSLISTAVSSVAMAINHDFLAIPGESRRFKAGAARYYITL  299

Query  793   GFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAIC  972
                A++ Q   +G+LG+IF SS+LL G+  +L + +  +F+VIF  +SF   K++S+ + 
Sbjct  300   VSTAVSWQFAFLGTLGMIFLSSSLLAGVIMALEIPIGSIFAVIFFGDSFGGLKIMSMLLS  359

Query  973   IWGFASYFYGDYKTARKKPPP  1035
             +WGF SY YG Y   + K  P
Sbjct  360   LWGFVSYTYGGYMDMKNKSEP  380



>ref|XP_004985414.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=376

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 131/355 (37%), Positives = 190/355 (54%), Gaps = 19/355 (5%)
 Frame = +1

Query  7     LKNLEDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGF  186
             ++ + +   +   S   LV++    FL +   GG +LIR YF+HGG+R WLS+ +  +G+
Sbjct  1     MQGISNAPTLPRCSLSPLVVL--SAFLVLLGAGGSLLIRAYFVHGGRRLWLSTMIQLSGW  58

Query  187   PCLLVPIFISYarnqakaaanrrrV---LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLP  357
             P LL PI  S              V   L  P L  + A LG +  V  + Y+ G   LP
Sbjct  59    PLLLPPICASLLLRSRSRDGAGGGVADHLPPPRLVRAVAVLGAVFAVACFAYSLGSQALP  118

Query  358   VSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGD-RPEGESD  534
             +S SSLL +TQL F AV A+     + T +SVNAVVL+T G  VLG   + +   + E  
Sbjct  119   LSTSSLLQATQLTFNAVSAFLFAGLRFTPFSVNAVVLLTIGPAVLGFAPSSETEAQAEGS  178

Query  535   RSYTLGFFMTIAGAALHGFIMAGVEYAHVHAG-----------VPVTNGLLMQVQFIISM  681
              +Y  GF   ++ AAL G ++  VE A    G            P +   +MQ+Q ++  
Sbjct  179   TAYWTGFLECMSSAALIGLVLPLVEVAMSRYGRRDGGPAAARAPPPSYATVMQIQAVMGA  238

Query  682   FSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSA  861
                  C V M I KDFQAI  EA  F LG   YY+++ F A++ QL  +G +G+I  SS+
Sbjct  239   AGTAVCLVGMAIAKDFQAIPTEAAAFGLGETNYYLLLIFGAVSWQLSNLGIMGLIVCSSS  298

Query  862   LLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
             LL GI  +L++ + +V +VIFL E F   K ++L +C+WGF SY YG+  +ARKK
Sbjct  299   LLAGIMIALVLPLSEVLAVIFLHEKFDGVKGIALVLCLWGFVSYLYGE--SARKK  351



>gb|EEC84725.1| hypothetical protein OsI_31703 [Oryza sativa Indica Group]
Length=265

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/233 (46%), Positives = 154/233 (66%), Gaps = 6/233 (3%)
 Frame = +1

Query  52   KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
            + L++ +NC  L VG  GG ++ RLYF  GG R+WLS+ L TAG+P LLVP+  SY   +
Sbjct  24   RWLLVALNCGMLVVGTTGGPLISRLYFSKGGHRQWLSAWLQTAGWPLLLVPVAASYLSRR  83

Query  232  akaaanrrrVLVTP-WLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAV  408
            A+       + +TP  + ++   LG L G D ++Y +G++YLPVS S++L STQLAFT  
Sbjct  84   ARGRRAP--LFLTPTRVLLAGVGLGFLNGADDFIYAYGLAYLPVSTSAILISTQLAFTVF  141

Query  409  FAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHG  588
            FA  IV+ +LT  ++NAV L+T G+VVLGLH + DRP G +   Y +GFF+T+  AAL+G
Sbjct  142  FACLIVRQRLTAATLNAVALLTIGAVVLGLHASKDRPAGVTSGKYWMGFFLTLGAAALYG  201

Query  589  FIMAGVEYAHVHA---GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAI  738
             I+  VE A+ HA   G  VT  L+M++Q ++  F+  FCTV M++NKDFQ +
Sbjct  202  LILPLVELAYKHAAGGGRAVTYALVMEMQLVMGFFATAFCTVGMVVNKDFQGL  254



>gb|EAZ09428.1| hypothetical protein OsI_31702 [Oryza sativa Indica Group]
Length=262

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 159/246 (65%), Gaps = 6/246 (2%)
 Frame = +1

Query  19   EDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLL  198
            E     +  + + L++ +NC  L VG  GG ++ RLYF  GG R+WLS+ L TAG+P LL
Sbjct  13   EQAAPGRGRAARWLLVALNCGMLMVGTTGGPLISRLYFSKGGHRQWLSAWLETAGWPLLL  72

Query  199  VPIFISYarnqakaaanrrrVLVTPW-LFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSL  375
            VP+  SY   +A+       + +TP  + ++   LG+L G D ++Y +G+ YLPVS S++
Sbjct  73   VPVSASYLGRRARDRGAP--LFLTPRRVLLACVGLGVLTGADDFIYAYGLDYLPVSTSAI  130

Query  376  LSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGF  555
            L+ST LAFT  FA  IV+ +LT  ++NAV L+T G+VVLGLH++ DRP G ++  Y +GF
Sbjct  131  LTSTHLAFTVFFACLIVRQRLTAATLNAVALLTIGAVVLGLHVSKDRPAGVTNGKYWMGF  190

Query  556  FMTIAGAALHGFIMAGVE--YAHVHA-GVPVTNGLLMQVQFIISMFSALFCTVAMIINKD  726
            F+ I  AAL+G I+  VE  Y HV A G  VT  L+M++Q ++  F+  FCTV M++NKD
Sbjct  191  FLIIGAAALYGLILPLVELAYKHVAARGRAVTYALVMEMQLVMGFFATAFCTVGMVVNKD  250

Query  727  FQAISK  744
            FQ I+ 
Sbjct  251  FQVINN  256



>ref|XP_002993859.1| hypothetical protein SELMODRAFT_236829 [Selaginella moellendorffii]
 gb|EFJ05096.1| hypothetical protein SELMODRAFT_236829 [Selaginella moellendorffii]
Length=336

 Score =   202 bits (515),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 117/331 (35%), Positives = 196/331 (59%), Gaps = 6/331 (2%)
 Frame = +1

Query  91    VGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFP-CLLVPIFISYarnqakaaanrrrVLV  267
             VG I   +L+R Y+ +GG R+WL   + TAG+P C L  + + +  + + + +     L+
Sbjct  3     VGFIAATLLMRFYYSNGGSRRWLCGWVQTAGWPVCALAMLIVYFKASSSSSDSPGHHHLL  62

Query  268   TPWLF-MSSAF--LGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKL  438
              P+ F + +AF  +G L+ +D++LY++GMSYLP S + LL+S+QLAF ++FA F+++  +
Sbjct  63    APFSFKLVAAFASIGCLIALDNFLYSWGMSYLPASTAGLLTSSQLAFNSLFALFLLRKSI  122

Query  439   THYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAH  618
               Y  N++VL++  +V+LGLH + D   G S      G+ MTI  A L+G I++  E   
Sbjct  123   GPYVWNSIVLVSSSAVLLGLHSSSDELPGVSREQTGHGYVMTITAAGLYGLILSLTELVF  182

Query  619   VHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGF  798
                    +  L++Q+Q   ++ + +  TV M IN DF+AI  EA  F  G+  Y++ +  
Sbjct  183   AKVLGRKSTLLVLQMQTSTALVATIVSTVGMAINNDFEAIHVEAAVFKAGSLAYFVTLLC  242

Query  799   AAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIW  978
             + +A Q   +G++GVIF SS+LL G+  ++++ V  VF+ IF  ++F   K+++L +  W
Sbjct  243   STLAWQAAFLGTMGVIFLSSSLLAGVILTVVIPVGAVFAYIFFHDAFGGLKVMALLLSCW  302

Query  979   GFASYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
             GF SY YG Y  +   PP  P   + EEH+E
Sbjct  303   GFVSYVYGGYVESSAAPPAIP--DNKEEHEE  331



>gb|EEE69876.1| hypothetical protein OsJ_29691 [Oryza sativa Japonica Group]
Length=265

 Score =   199 bits (507),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 153/233 (66%), Gaps = 6/233 (3%)
 Frame = +1

Query  52   KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
            + L++ +NC  L VG  GG ++ RLYF  GG R+WLS+ L TAG+P LLVP+  SY   +
Sbjct  24   RWLLVALNCGMLVVGTTGGPLISRLYFSKGGHRQWLSAWLQTAGWPLLLVPVAASYLSRR  83

Query  232  akaaanrrrVLVTP-WLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAV  408
            A+       + +TP  + ++   LG L G D ++Y +G++YLPVS S++L STQLAFT  
Sbjct  84   ARDRRAP--LFLTPTRVLLAGVGLGFLNGADDFIYAYGLAYLPVSTSAILISTQLAFTVF  141

Query  409  FAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHG  588
            FA  IV+ + T  ++NAV L+T G+VVLGLH + DRP G +   Y +GFF+T+  AAL+G
Sbjct  142  FACLIVRQRFTAATLNAVALLTIGAVVLGLHASKDRPAGVTSGKYWMGFFLTLGAAALYG  201

Query  589  FIMAGVEYAHVHA---GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAI  738
             I+  VE A+ HA   G  VT  L+M++Q ++  F+  FCTV M++NKDFQ +
Sbjct  202  LILPLVELAYKHAAGGGRAVTYALVMEMQLVMGFFATAFCTVGMVVNKDFQGL  254



>ref|NP_001063426.2| Os09g0467500 [Oryza sativa Japonica Group]
 dbj|BAF25340.2| Os09g0467500 [Oryza sativa Japonica Group]
Length=253

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/242 (45%), Positives = 157/242 (65%), Gaps = 6/242 (2%)
 Frame = +1

Query  19   EDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLL  198
            E     +  + + L++ +NC  L VG  GG ++ RLYF  GG R+WLS+ L TAG+P LL
Sbjct  13   EQAAPGRGRAARWLLVALNCGMLMVGTTGGPLISRLYFSKGGHRQWLSAWLETAGWPLLL  72

Query  199  VPIFISYarnqakaaanrrrVLVTPW-LFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSL  375
            VP+  SY   +A+       + +TP  + ++   LG+L G D ++Y +G+ YLPVS S++
Sbjct  73   VPVSASYLGRRARDRGAP--LFLTPRRVLLACVGLGVLTGADDFIYAYGLDYLPVSTSAI  130

Query  376  LSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGF  555
            L+ST LAFT  FA  IV+ +LT  ++NAV L+T G+VVLGLH++ DRP G ++  Y +GF
Sbjct  131  LTSTHLAFTVFFACLIVRQRLTAATLNAVALLTIGAVVLGLHVSKDRPAGVTNGKYWMGF  190

Query  556  FMTIAGAALHGFIMAGVE--YAHVHA-GVPVTNGLLMQVQFIISMFSALFCTVAMIINKD  726
            F+ I  AAL+G I+  VE  Y HV A G  VT  L+M++Q ++  F+  FCTV M++NKD
Sbjct  191  FLIIGAAALYGLILPLVELAYKHVAARGRAVTYALVMEMQLVMGFFATAFCTVGMVVNKD  250

Query  727  FQ  732
            FQ
Sbjct  251  FQ  252



>emb|CDY35721.1| BnaC03g58420D [Brassica napus]
Length=319

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 117/346 (34%), Positives = 187/346 (54%), Gaps = 43/346 (12%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnq  231
               L+II+ C        GG +L RLY+  GG R W  S L TAG P +L+P+++S+ R  
Sbjct  4     NGLLIIVTC--------GGPLLTRLYYTKGGSRIWFMSFLATAGCPIILIPLYVSFLRLS  55

Query  232   akaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVF  411
              ++  N           M +                 ++Y  +S          AF A+F
Sbjct  56    NRSHNNSETTEKAKVFVMETPLF--------------IAYPSLS----------AFNAIF  91

Query  412   AYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGF  591
             ++ +VK K T +S+NAVVL+T G+ +L LH  GDRP G S + Y +GF +T+  A L+ F
Sbjct  92    SFLMVKQKFTPFSINAVVLLTVGTGILALHTNGDRPAGVSKKEYVVGFMLTLIAAVLYAF  151

Query  592   IMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
             +M  VE  +      +T  L++++Q ++ + S  FC V M++  DF+AI +EAREF +G+
Sbjct  152   LMPLVELTYKKVRQEITFTLVLEMQMVMCVASTCFCLVGMVVKGDFKAIPREAREFMIGS  211

Query  772   EK-YYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
                YY ++    I  Q   +G+ GV++ +S+L  G+F S+L+ V +V +V+   E F A 
Sbjct  212   SLFYYTLIVVIGIVWQCFFLGAFGVVYCASSLTSGVFVSVLLPVTEVLAVVCFREKFQAK  271

Query  949   KLLSLAICIWGFASYFYGDYKTARK----------KPPPPPVTGDD  1056
             K ++L + +WGF SYF G++K+ +K          + PP PV+G D
Sbjct  272   KGVALLLSLWGFVSYFSGEFKSGKKIIDSPKSPETELPPLPVSGSD  317



>ref|XP_002991403.1| hypothetical protein SELMODRAFT_236291 [Selaginella moellendorffii]
 gb|EFJ07515.1| hypothetical protein SELMODRAFT_236291 [Selaginella moellendorffii]
Length=340

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/335 (35%), Positives = 196/335 (59%), Gaps = 10/335 (3%)
 Frame = +1

Query  91    VGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrV---  261
             VG I   +L+R Y+ +GG R+WL   + TAG+P   + + I Y +  + + ++       
Sbjct  3     VGFIAATLLMRFYYSNGGSRRWLCGWVQTAGWPVCALAMLIVYFKASSSSNSSSSDSPGH  62

Query  262   --LVTPWLF-MSSAF--LGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIV  426
               L+ P+ F + +AF  +G L+ +D++LY++GMSYLP S + LL+S+QLAF ++FA F++
Sbjct  63    HHLLAPFSFKLVAAFASIGCLIALDNFLYSWGMSYLPASTAGLLTSSQLAFNSLFALFLL  122

Query  427   KHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGV  606
             +  +  Y  N++VL++  +V+LGLH + D   G S      G+ MTI  A L+G I++  
Sbjct  123   RKSIGPYVWNSIVLVSSSAVLLGLHSSSDELPGVSREQTGHGYVMTITAAGLYGLILSLT  182

Query  607   EYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYM  786
             E          +  L++Q+Q   ++ + +  TV M IN DF+AI  EA  F  G+  Y++
Sbjct  183   ELVFAKVLGRKSTLLVLQMQTSTALVATIVSTVGMAINNDFEAIHVEAAAFKAGSLAYFV  242

Query  787   IVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLA  966
              +  + +A Q   +G++GVIF SS+LL G+  ++++ V  VF+ IF  ++F   K+++L 
Sbjct  243   TLLCSTLAWQAAFLGTMGVIFLSSSLLAGVILTVVIPVGAVFAYIFFHDAFGGLKVMALL  302

Query  967   ICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
             +  WGF SY YG Y  +   PP  P   + EEH+E
Sbjct  303   LSCWGFVSYVYGGYVESSAAPPAIP--DNKEEHEE  335



>gb|ABR16480.1| unknown [Picea sitchensis]
Length=367

 Score =   201 bits (510),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 112/338 (33%), Positives = 195/338 (58%), Gaps = 12/338 (4%)
 Frame = +1

Query  58    LVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqak  237
             +++I + + L VGQ    +L R YF +GG  +W+S+ L T G+P LL+P+ +       +
Sbjct  41    VLVIFSILALLVGQAAATLLSRYYFAYGGDSRWISTLLQTVGWPILLIPLVL------YQ  94

Query  238   aaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAY  417
                  +   +TP L +    LGLLL  D+ LY++G+S++P S  SLL S+QLAF AVFA+
Sbjct  95    GKEASKLTPLTPKLVLIYVALGLLLAGDNLLYSWGVSFMPASTYSLLCSSQLAFNAVFAF  154

Query  418   FIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIM  597
              +++ K+T Y VN++VL+T  +++LG+H   DRPEG +   + +GF  TIA +A++G ++
Sbjct  155   MLIRQKITPYIVNSLVLLTLSAILLGVHSDSDRPEGVNTAKHIVGFICTIAASAIYGLLL  214

Query  598   AGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEK  777
               ++          T  +++++Q   S+ + + C V + ++ +F+ I +EA  F  G   
Sbjct  215   PLMQLVFDRVIKKETFAVVLEMQIYTSLVATVVCIVGLFVSGEFRDIKEEAHSFTRGKVA  274

Query  778   YYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLL  957
             YYM + ++AI  Q+  +G +G+IF  S+L   + ++L + V  + SV F  +   A K++
Sbjct  275   YYMTLIWSAIGWQVCSVGVVGLIFLVSSLFSNVISTLALPVVPILSVGFFHDKMDALKII  334

Query  958   SLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
             S+ + IWGF SY +G Y  ++      P  G     +E
Sbjct  335   SMLLSIWGFVSYIFGGYVDSK------PAMGSKNAARE  366



>tpg|DAA40289.1| TPA: hypothetical protein ZEAMMB73_258363 [Zea mays]
Length=281

 Score =   197 bits (502),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 106/242 (44%), Positives = 156/242 (64%), Gaps = 4/242 (2%)
 Frame = +1

Query  19   EDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLL  198
             +   ++  + + L++  NCV LA+G  GG +L RLYF  GG R+WLS  L T G+P LL
Sbjct  7    HESPPLRSKTMRRLLVATNCVMLALGVTGGQLLSRLYFSKGGHRQWLSGWLQTGGWPLLL  66

Query  199  VPIFISYarnqakaaanrrrVLVT-PWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSL  375
             P+  SY R +A+  +    +  T P + +++A LGL+ GVD+ LY +G+ +LPVS S++
Sbjct  67   PPVAASYVRRRARYRSAPALLTQTQPRILLAAAGLGLIAGVDNLLYAWGLEFLPVSTSAI  126

Query  376  LSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGF  555
            L STQLAFT +FA+ IV+ +LT  +VNAV L+T G+VVLGLH++ DRP G +   Y LGF
Sbjct  127  LISTQLAFTVLFAFLIVRQRLTMATVNAVALLTVGAVVLGLHVSSDRPAGVTRSQYWLGF  186

Query  556  FMTIAGAALHGFIMAGVEYAHVHA---GVPVTNGLLMQVQFIISMFSALFCTVAMIINKD  726
             +T+  A L+G  +  VE  +  A   G  VT  L++++Q ++   +  FCTV MI+NKD
Sbjct  187  TLTLGAAVLYGLFLPLVELTYKCAAGGGRAVTYALVVELQLVMGFVATAFCTVGMIVNKD  246

Query  727  FQ  732
            FQ
Sbjct  247  FQ  248



>ref|XP_002977418.1| hypothetical protein SELMODRAFT_417454 [Selaginella moellendorffii]
 gb|EFJ21422.1| hypothetical protein SELMODRAFT_417454 [Selaginella moellendorffii]
Length=388

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 117/321 (36%), Positives = 184/321 (57%), Gaps = 13/321 (4%)
 Frame = +1

Query  91    VGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLVT  270
              G I G +L R YF  GG RKWLS+ L T+G+P L V     Y +   K         +T
Sbjct  74    TGMIAGQLLTRFYFAAGGSRKWLSTWLQTSGWPLLAVATGSIYWKRGIKLTP------LT  127

Query  271   PWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYS  450
             P L  +   LG L  +D+++Y +G++YLP S + LLSS+QLAF A+FA  I + ++  + 
Sbjct  128   PALAATYIALGFLGALDNFMYAYGLAYLPASTNGLLSSSQLAFNAIFALIITRQRINPFG  187

Query  451   VNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHAG  630
              NA+VL++  +++L LH   ++  G + +   LG+ MTI  AAL G +   +E A     
Sbjct  188   WNAIVLVSSAAMILALHSDDEKLPGVTRKEVVLGYVMTIGAAALFGLLYPLIELAIRKFL  247

Query  631   VPVTNG----LLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGF  798
                ++G    +++++Q ++S+ S    +VAM IN DF AI  E+R F  G   YY+ +  
Sbjct  248   TRSSDGGAAAVVLEMQTLLSLISTAVASVAMAINHDFLAIPGESRRFKAGAASYYLTLVS  307

Query  799   AAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIW  978
              A++ Q   +G+LG+IF SS+LL G+  +L + +  +F+VIF  +SF   K++S+ + +W
Sbjct  308   TAVSWQFAFLGTLGIIFLSSSLLAGVILALAIPIGSIFAVIFFGDSFGGVKIMSMLLSLW  367

Query  979   GFASYFYG---DYKTARKKPP  1032
             GF SY +G   D K A K  P
Sbjct  368   GFVSYTFGGYVDMKKASKLEP  388



>ref|XP_009789614.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=271

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 150/217 (69%), Gaps = 0/217 (0%)
 Frame = +1

Query  88   AVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLV  267
            AVG  GG +++RLY++ GG R W SS L TAG+P  L+P+ I Y   +    +N +   +
Sbjct  23   AVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPLTLIPLAILYFYRRKTQGSNTKLYFI  82

Query  268  TPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHY  447
            TP +F++S  +G++ G+D +LY++G S LPVS SSLL + QLAFTAV A+FIVK K T Y
Sbjct  83   TPRIFIASFIIGVVTGLDDFLYSWGGSKLPVSTSSLLLAAQLAFTAVGAFFIVKLKFTPY  142

Query  448  SVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHA  627
            S+NAV+L+T G+V+LG+   GDRPEG + ++Y LGF MT+  AAL+G I+  +E  ++ A
Sbjct  143  SINAVILLTVGAVLLGIRSNGDRPEGVTSKAYILGFMMTLLAAALYGVILPCIELIYLKA  202

Query  628  GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAI  738
               +T  L++++Q I+ + +  FCT+ MI+N DFQ +
Sbjct  203  KQVITATLVLEIQMIMCLAATTFCTMGMIVNNDFQVL  239



>ref|XP_010418647.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=248

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/241 (40%), Positives = 156/241 (65%), Gaps = 1/241 (0%)
 Frame = +1

Query  43   LSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYa  222
            +  K++ +IINC+FLA+G  GG +++RLYF +GG+R W SS L T G P +L P+  S+ 
Sbjct  3    MKMKSVRVIINCIFLAIGSCGGPLMLRLYFHNGGERIWFSSFLQTVGCPLILFPLLFSFL  62

Query  223  rnqakaaanrrrV-LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAF  399
              +      +  + L+ P LF++S  +GLL+G D+YLY++G++Y+PVS +SL+ S QL F
Sbjct  63   SRRRLEEQEKTSLFLMKPPLFIASVVVGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGF  122

Query  400  TAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAA  579
            TA+FA+F+VK K T +++NA+VL+T G+VVL  +   D+   E+ + Y +GF MT   A 
Sbjct  123  TALFAFFMVKQKFTPFTINAIVLLTVGAVVLAFNSDSDKLANETHKEYVVGFLMTAGAAL  182

Query  580  LHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREF  759
            L+ FI+  VE A+  +   VT  L+++ Q ++   +  FC V M+ + DF+ I++E    
Sbjct  183  LYAFILPLVELAYKKSRQRVTYTLVLEFQMVLCFVATCFCLVGMLASGDFKVIAREXSTL  242

Query  760  D  762
            +
Sbjct  243  E  243



>ref|XP_002975003.1| hypothetical protein SELMODRAFT_232471 [Selaginella moellendorffii]
 gb|EFJ23788.1| hypothetical protein SELMODRAFT_232471 [Selaginella moellendorffii]
Length=292

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 114/312 (37%), Positives = 176/312 (56%), Gaps = 22/312 (7%)
 Frame = +1

Query  91    VGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLVT  270
              G I G +L R YF  GG RKWLS+ L T+G+P L V     Y +   K         +T
Sbjct  3     TGMIAGQLLTRFYFAAGGSRKWLSTWLQTSGWPLLAVATGSIYWKRGIKLTP------LT  56

Query  271   PWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYS  450
             P L  +   LG L  +D+++Y +G++YLP S + LLSS+QLAF A+FA  I + ++  + 
Sbjct  57    PALAATYIALGFLGALDNFMYAYGLAYLPASTNGLLSSSQLAFNAIFALIITRQRINPFG  116

Query  451   VNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHAG  630
              NA+VL++  +V+L LH   ++  G + +   LG+ MT   AAL        + A V   
Sbjct  117   WNAIVLVSSAAVILALHSDDEKLPGVTRKEVVLGYVMTTGAAALSS------DAATV---  167

Query  631   VPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAIA  810
                    L+++Q ++S+ S    +VAM IN DF AI  E+R F  G  +YY+ +   A++
Sbjct  168   -------LLEMQTLLSLISTAVSSVAMAINHDFLAIPGESRRFKAGAARYYITLVSTAVS  220

Query  811   LQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFAS  990
              Q   +G+LG+IF SS+LL G+  +L + +  +F+VIF  +SF   K++S+ + +WGF S
Sbjct  221   WQFAFLGTLGMIFLSSSLLAGVIMALEIPIGSIFAVIFFGDSFGGLKIMSMFLSLWGFVS  280

Query  991   YFYGDYKTARKK  1026
             Y YG Y   + K
Sbjct  281   YTYGGYMDMKNK  292



>ref|XP_009801739.1| PREDICTED: purine permease 1-like isoform X2 [Nicotiana sylvestris]
Length=264

 Score =   194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 106/242 (44%), Positives = 153/242 (63%), Gaps = 5/242 (2%)
 Frame = +1

Query  52   KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISY----  219
            K +++++NC+FLAVG  GG +++RLYF+ GGKR WLS+ L T  +P   +P+ ISY    
Sbjct  2    KIVLLVLNCIFLAVGTCGGPLVMRLYFIKGGKRIWLSTWLQTVAWPINFLPLGISYFYSL  61

Query  220  arnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAF  399
                     N + +L+TP +F+++  +G+L G  +Y Y++G + LPVS S LL +TQLAF
Sbjct  62   KNINDNNNNNTKVILMTPRIFVATIGIGVLQGFGNYFYSYGTAKLPVSTSGLLFATQLAF  121

Query  400  TAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAA  579
            T  FA+ I K K T Y VNAV+L+T G V+L LH  GD+PEGE+ + Y LGF MT+A AA
Sbjct  122  TTGFAFLIAKLKFTSYLVNAVILLTIGVVLLALHSGGDQPEGETKKEYILGFIMTLAAAA  181

Query  580  LHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAI-SKEARE  756
            L G I   VE  +  A   +T  L+++ Q +    + +  T+ MIINKDF  I + E  E
Sbjct  182  LSGLIFPLVELIYKKAHQAITYTLVLEFQTVYCFVATIVATIGMIINKDFLEIRATEDPE  241

Query  757  FD  762
            F+
Sbjct  242  FE  243



>ref|XP_004959528.1| PREDICTED: purine permease 2-like [Setaria italica]
Length=279

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/248 (42%), Positives = 158/248 (64%), Gaps = 4/248 (2%)
 Frame = +1

Query  10   KNLEDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFP  189
            +N     + K  + + L++ +NCV L VG  GG +L RLY+ +GG R+WLS+ L TAG+P
Sbjct  6    RNHSPPARSKSTTMRRLLMALNCVLLGVGITGGQLLSRLYYNNGGHRQWLSAWLQTAGWP  65

Query  190  CLLVPIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSIS  369
             LL+P+  SYA  +A+       +L  P + +++A LGL+ G D +LY +G+ +LPVS S
Sbjct  66   LLLIPVAGSYASRRARDRGAPV-LLCPPRVLLAAAGLGLITGADDFLYAWGLKFLPVSTS  124

Query  370  SLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTL  549
            ++L STQL FT +FA+ +V  +LT  ++NAV L+T G+VVLGLH++ DRP G +   Y L
Sbjct  125  AILISTQLVFTVLFAFLLVGQRLTAPTMNAVALLTVGAVVLGLHVSSDRPAGVTRGQYWL  184

Query  550  GFFMTIAGAALHGFIMAGVEYAHVHA---GVPVTNGLLMQVQFIISMFSALFCTVAMIIN  720
            GF +T+  A L+G  M  VE A+  A   G  +T  + +++Q +I   +  FCT  M++N
Sbjct  185  GFALTLGAAVLYGVFMPLVELAYRCAAGGGRALTYAVAVELQLVIGFVATAFCTAGMVVN  244

Query  721  KDFQAISK  744
            KDFQ ++ 
Sbjct  245  KDFQVVAD  252



>ref|XP_009801738.1| PREDICTED: purine permease 1-like isoform X1 [Nicotiana sylvestris]
Length=310

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 125/336 (37%), Positives = 183/336 (54%), Gaps = 46/336 (14%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISY----  219
             K +++++NC+FLAVG  GG +++RLYF+ GGKR WLS+ L T  +P   +P+ ISY    
Sbjct  2     KIVLLVLNCIFLAVGTCGGPLVMRLYFIKGGKRIWLSTWLQTVAWPINFLPLGISYFYSL  61

Query  220   arnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAF  399
                      N + +L+TP +F+++  +G+L G  +Y Y++G + LPVS S LL +TQLAF
Sbjct  62    KNINDNNNNNTKVILMTPRIFVATIGIGVLQGFGNYFYSYGTAKLPVSTSGLLFATQLAF  121

Query  400   TAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAA  579
             T  FA+ I K K T Y VNAV+L+T G V+L LH  GD+PEGE+ + Y LGF MT+A AA
Sbjct  122   TTGFAFLIAKLKFTSYLVNAVILLTIGVVLLALHSGGDQPEGETKKEYILGFIMTLAAAA  181

Query  580   LHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFC-------TVAMIINKDFQAI  738
             L G I   VE  +  A   +T  L+++       F  ++C       T+ MIINKDF   
Sbjct  182   LSGLIFPLVELIYKKAHQAITYTLVLE-------FQTVYCFVATIVATIGMIINKDFL--  232

Query  739   SKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSV  918
                          +Y              +G++GVI+S+S+L+ GI  S+L+ V ++ +V
Sbjct  233   -------------FYF-------------LGTIGVIYSASSLVSGILISVLLPVTEILAV  266

Query  919   IFLPESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
                 E     K   L          F    K AR+K
Sbjct  267   FIYGEKLVQKKEFLLPSLYGDLFHIFMVILKKARRK  302



>dbj|BAG88745.1| unnamed protein product [Oryza sativa Japonica Group]
Length=289

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/241 (43%), Positives = 150/241 (62%), Gaps = 13/241 (5%)
 Frame = +1

Query  49   FKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarn  228
            F++ ++++N V + VG   G +L+R YFL GG RKWLSS L TAG+P LL P+  SY+  
Sbjct  35   FRSPLLVVNFVLMVVGSACGPLLLRAYFLRGGNRKWLSSLLQTAGWPLLLAPLCFSYSSR  94

Query  229  qakaaanrrrV----------LVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLL  378
            + +                  L+TP L ++SA +GL+ GVD  LY +G++YLPVS SS+L
Sbjct  95   RRRREVEDDGAGAGAAATPLFLMTPRLLVASAVVGLMTGVDDLLYAYGLAYLPVSTSSIL  154

Query  379  SSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFF  558
             STQLAFTA FA  +V+ + T +SVNAVVL++ G+ +LG++  GDRP G S   Y  GF 
Sbjct  155  ISTQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVSRAQYCAGFA  214

Query  559  MTIAGAALHGFIMAGVEYAHVH---AGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDF  729
            MT+A AAL+G ++  +E +  H   A   VT  L+M++Q +I   +  F  V M++N DF
Sbjct  215  MTLAAAALYGLVLPVMELSQAHHAAARGAVTYTLVMEMQLVIGFVATAFSAVGMLVNNDF  274

Query  730  Q  732
             
Sbjct  275  H  275



>ref|XP_009380885.1| PREDICTED: purine permease 1-like [Musa acuminata subsp. malaccensis]
Length=266

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 97/233 (42%), Positives = 148/233 (64%), Gaps = 5/233 (2%)
 Frame = +1

Query  10   KNLEDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFP  189
            +  +D   +     + ++I +NCV +A+G  GG +L+RLYF  GGKR+WLSS L+T G+P
Sbjct  14   RQNQDAAPLMSKGLRRVLIGLNCVLMALGNTGGPLLLRLYFRSGGKRQWLSSWLVTGGWP  73

Query  190  CLLVPIFISYarnqakaaan-----rrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYL  354
             + +P+ ++Y   +            +   +TP LF++ AFLGLL G+D +LY +G+S+L
Sbjct  74   LIFLPLLVTYLHRRRHQIRPSHIHPTKLFFITPRLFLACAFLGLLTGLDDFLYAYGLSFL  133

Query  355  PVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESD  534
            PVS SSLL STQLAFTA FA+ IVK K T YS+N+V L+T G+ +LGLH++ DRP+  + 
Sbjct  134  PVSTSSLLISTQLAFTAFFAFLIVKQKFTPYSINSVALLTVGAAILGLHVSSDRPDNVTK  193

Query  535  RSYTLGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSAL  693
              Y +GF +T+  AAL+  I+  V+  +  +   +T  L+M+VQ +   F  L
Sbjct  194  SEYYMGFILTLGSAALYALILPLVQLMYAKSKQAITYTLVMEVQLVRGGFRTL  246



>ref|XP_006661331.1| PREDICTED: purine permease 3-like [Oryza brachyantha]
Length=269

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 141/205 (69%), Gaps = 3/205 (1%)
 Frame = +1

Query  421   IVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMA  600
             +V+ +LT  ++NAV L+T G+VVLGLH + DRP G ++  Y +GFF+T+  AAL+G I+ 
Sbjct  55    VVRQRLTAATLNAVALLTIGAVVLGLHTSNDRPAGVTNGKYWMGFFLTLGAAALYGLILP  114

Query  601   GVEYAHVHA---GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGT  771
              VE A+ HA   G  VT  L+M++Q ++  F+  FCTV MI+NKDFQAI +EA++++LG 
Sbjct  115   LVELAYKHAAGGGRAVTYALVMEMQLVMGFFATAFCTVGMIVNKDFQAIPREAKQYELGE  174

Query  772   EKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADK  951
              +YY ++ F+AI  +   +G++GVIF    LL GI  ++ + + +V  VIFL E FS++K
Sbjct  175   TRYYTVLVFSAILWEFFFVGAVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFSSEK  234

Query  952   LLSLAICIWGFASYFYGDYKTARKK  1026
              ++L + +WG ASY YG+Y  A+ K
Sbjct  235   GVALVLSLWGLASYSYGEYTDAKAK  259



>ref|XP_009801740.1| PREDICTED: purine permease 1-like isoform X3 [Nicotiana sylvestris]
Length=237

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/230 (44%), Positives = 147/230 (64%), Gaps = 4/230 (2%)
 Frame = +1

Query  52   KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISY----  219
            K +++++NC+FLAVG  GG +++RLYF+ GGKR WLS+ L T  +P   +P+ ISY    
Sbjct  2    KIVLLVLNCIFLAVGTCGGPLVMRLYFIKGGKRIWLSTWLQTVAWPINFLPLGISYFYSL  61

Query  220  arnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAF  399
                     N + +L+TP +F+++  +G+L G  +Y Y++G + LPVS S LL +TQLAF
Sbjct  62   KNINDNNNNNTKVILMTPRIFVATIGIGVLQGFGNYFYSYGTAKLPVSTSGLLFATQLAF  121

Query  400  TAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAA  579
            T  FA+ I K K T Y VNAV+L+T G V+L LH  GD+PEGE+ + Y LGF MT+A AA
Sbjct  122  TTGFAFLIAKLKFTSYLVNAVILLTIGVVLLALHSGGDQPEGETKKEYILGFIMTLAAAA  181

Query  580  LHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDF  729
            L G I   VE  +  A   +T  L+++ Q +    + +  T+ MIINKDF
Sbjct  182  LSGLIFPLVELIYKKAHQAITYTLVLEFQTVYCFVATIVATIGMIINKDF  231



>ref|XP_004959524.1| PREDICTED: purine permease 2-like [Setaria italica]
Length=257

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/241 (43%), Positives = 154/241 (64%), Gaps = 4/241 (2%)
 Frame = +1

Query  19   EDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLL  198
            +D    +    + L++ +NC  LA+G   G +L RLY+  GG+R+WLS+ L +AG+P LL
Sbjct  7    KDSSPTRGKLVRRLLVALNCGMLALGTTAGPLLTRLYYDKGGQREWLSAWLQSAGWPLLL  66

Query  199  VPIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLL  378
            VP+  SYA  +A        +L  P + +++A LG+  G D+++Y   + YLPVS S++L
Sbjct  67   VPVAASYAARRACDWRAPL-LLTPPRVLLAAAGLGVATGADNFIYALSLRYLPVSTSAIL  125

Query  379  SSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFF  558
             STQLAFT  FA+ IV+ +LT  +VNAV L+T G+ VLGLH++ DRP G +   Y +GF 
Sbjct  126  ISTQLAFTVFFAFLIVRQRLTATTVNAVALLTAGAAVLGLHVSSDRPAGATKGQYLMGFA  185

Query  559  MTIAGAALHGFIMAGVEYAHVHA---GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDF  729
            + +  AAL+G I+  VE A+  A   G  VT  L+M++Q ++  F+  FCTV MI+NKDF
Sbjct  186  LALGAAALYGLILPMVELAYKRAAGGGRAVTYALVMEMQLVMGFFATAFCTVGMIVNKDF  245

Query  730  Q  732
            Q
Sbjct  246  Q  246



>ref|XP_006859063.1| hypothetical protein AMTR_s00068p00197770 [Amborella trichopoda]
 gb|ERN20530.1| hypothetical protein AMTR_s00068p00197770 [Amborella trichopoda]
Length=376

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 117/335 (35%), Positives = 196/335 (59%), Gaps = 12/335 (4%)
 Frame = +1

Query  73    NCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanr  252
             NC  L +G I   +L R YF+HGG  +WLS+ + + GFP LL+PI++S+    +    + 
Sbjct  37    NCAALVLGSISASMLSRFYFMHGGSSRWLSTWVQSIGFPLLLMPIYLSHLTGHSPRPFS-  95

Query  253   rrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKH  432
                L TP L  +   LGLL+G++++LY++G+SY+ V+ +SLL STQLAF A+F++ +VK 
Sbjct  96    ---LFTPKLLYACFGLGLLIGINNFLYSWGISYISVTTASLLLSTQLAFNAIFSFVLVKQ  152

Query  433   KLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEY  612
             K++  S+N +VL+T  S++L L  + D P+G +   Y LGF  T+  A L    +  +E 
Sbjct  153   KISFPSMNCIVLLTSSSILLALSSSQDMPKGVTKFQYILGFLSTLGAAGLFAIYLPLMEM  212

Query  613   AHVH-AGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAR-EFDLGTEKYYM  786
              +     +  T  L+M++Q ++S+ + LF T+ M+ +  F+ + +EA  +F+LG   Y +
Sbjct  213   VYKKLTSIKFTYALVMEMQLVMSISATLFATIGMVGDGAFREMREEANGKFELGRLSYIL  272

Query  787   IVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLA  966
              V    I+ Q   M + G+IF +++L+ GI  S L+ +  V   +   + FS +K +S  
Sbjct  273   TVVGGVISWQFCFMATTGLIFLTTSLMCGICMSALLPLIVVAGAVIFKDDFSGEKWISTV  332

Query  967   ICIWGFASYFYGDYKTARKKPPPPPVTGDDEEHQE  1071
             +C+WGF SY YG+ K  ++      V G   E+ E
Sbjct  333   LCMWGFFSYLYGERKKNQE------VVGLKRENGE  361



>ref|XP_009759913.1| PREDICTED: probable purine permease 4 [Nicotiana sylvestris]
Length=399

 Score =   190 bits (483),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 112/320 (35%), Positives = 189/320 (59%), Gaps = 10/320 (3%)
 Frame = +1

Query  58    LVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqak  237
             L++ IN + L VG I   +L + YF H G  +W+S+ + +AGFP LL+PI++S+   ++ 
Sbjct  59    LLLGINYLCLFVGSISSTLLSKFYFNHKGASRWVSTWVQSAGFPFLLLPIYLSFYVFKST  118

Query  238   aaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAY  417
                       TP +   S  +G LLG ++ L+++G SYLPVS +SL+ S+QLAFT + + 
Sbjct  119   ERKPFTGF--TPKILSLSILIGFLLGFNNLLFSWGNSYLPVSTNSLVLSSQLAFTLITSV  176

Query  418   FIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIM  597
              IVK K+T+ ++N V+L+T  SV+L L  + D+P+G +   Y +GFF T+    L    +
Sbjct  177   IIVKQKITYANLNCVILLTLSSVLLALGSSHDKPKGLTKSKYLIGFFSTVGAGLLFALYL  236

Query  598   AGVE--YAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEARE-FDLG  768
               +E  Y  V+        +++++Q ++ + + +  T  M I+  F  + KE+   FDLG
Sbjct  237   PLMEKIYKKVYC-----YSMVVEMQIVMELAATVLATAGMTIDGGFSEMKKESTNVFDLG  291

Query  769   TEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSAD  948
              + Y++ V F  +  QL  MG+ G++F +S+L  GI  + L+AV  +  V+   ++FS  
Sbjct  292   AKAYWLTVIFNVVTWQLCFMGTAGMVFLTSSLTGGICMTALMAVNVLGGVLVYGDNFSDT  351

Query  949   KLLSLAICIWGFASYFYGDY  1008
             K++S  +C+WGF+SY YG Y
Sbjct  352   KIVSTLLCVWGFSSYLYGMY  371



>gb|EMS63809.1| Purine permease 3 [Triticum urartu]
Length=284

 Score =   187 bits (474),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 98/228 (43%), Positives = 147/228 (64%), Gaps = 6/228 (3%)
 Frame = +1

Query  307  LLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSV  486
            + G+D  LY +G++YLPVS SS+L STQLAFTA FA  +V+ + T +SVNAVVL++ G+ 
Sbjct  1    MTGLDDLLYAYGLAYLPVSTSSILISTQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAA  60

Query  487  VLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHV-HA---GVPVTNGLL  654
            +LG++  GDRP G +   Y+ GF MT+  AAL+G ++  +E +   HA   G  VT  L+
Sbjct  61   MLGMNAGGDRPAGVTRAQYSAGFGMTLGAAALYGLMLPVMELSQAKHAARTGAAVTYTLV  120

Query  655  MQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGS  834
            M++Q +I   +  F  V M++N DF AI +EAREF LG   YY+++  +AI  Q   +G+
Sbjct  121  MEMQIVIGFTATAFSAVGMLVNNDFHAIPREAREFGLGQIGYYLLLAASAIVYQFFFLGT  180

Query  835  LGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIW  978
            +G IF  SALL G+  ++L+ V +V +V+F  E F+  K  +   C+W
Sbjct  181  IGAIFYGSALLAGVIMTVLIPVTEVLAVLFFHEPFNGTK--ANRYCLW  226



>ref|XP_004959529.1| PREDICTED: purine permease 2-like [Setaria italica]
Length=259

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/238 (43%), Positives = 152/238 (64%), Gaps = 5/238 (2%)
 Frame = +1

Query  58   LVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqak  237
            L++ +NCV L VG  GG +L RLYF  GG R+WL++   TAG+P LL+    +    +  
Sbjct  22   LLVALNCVMLGVGVTGGQLLSRLYFNKGGHRQWLAAWFQTAGWPPLLI-AVAAAYAGRRA  80

Query  238  aaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAY  417
                 R +   P + +++A +GL++G D++LY +G+ +LPVS S++L STQL FT +FA+
Sbjct  81   RDRGARFLPTPPRIHLAAAGIGLIIGADNFLYAYGLEFLPVSTSAILISTQLIFTVLFAF  140

Query  418  FIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIM  597
             IV+ +LT  +VNAV L+T G+VVLGLH++ DR  G S   Y LGF +T+  A L+G IM
Sbjct  141  LIVRQRLTAPTVNAVALLTAGAVVLGLHVSSDRIAGVSRGQYWLGFVLTLGAAVLYGLIM  200

Query  598  AGVEYAHVHA---GVPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFD  762
              VE A+ HA   G  VT  L++++Q ++   +  FCTV MI+NKDF   S  + +FD
Sbjct  201  PLVELAYKHAADGGRAVTYALVVEIQLVMGFVATAFCTVGMIVNKDFHDPSG-SLQFD  257



>ref|XP_002465736.1| hypothetical protein SORBIDRAFT_01g044690 [Sorghum bicolor]
 gb|EER92734.1| hypothetical protein SORBIDRAFT_01g044690 [Sorghum bicolor]
Length=370

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 123/354 (35%), Positives = 189/354 (53%), Gaps = 27/354 (8%)
 Frame = +1

Query  64    IIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaa  243
             ++I   FL +   GG +LIR+YF+ GG+  WLS+ +  +G+P LL PI IS      +  
Sbjct  10    LVIISAFLVLLGAGGSLLIRVYFVQGGQSLWLSTMIQVSGWPLLLPPICISLLLRSRRRD  69

Query  244   a------nrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTA  405
                    +    L+ P L  + A LG+L  +  Y Y+ G   LP++ SSLL +TQLAF A
Sbjct  70    RDRDGGYSIADDLLQPRLVGAVAVLGVLFALACYAYSLGSQALPLTTSSLLQATQLAFNA  129

Query  406   VFAYFIVKHKLTHYSVNAVVLMTFGSVVLGL--HMAGDRPEGESDRS-YTLGFFMTIAGA  576
             + A+     + T +SVNAVVL+T G  VLG+    + +   GE  R+ Y  GF   +A A
Sbjct  130   LCAFVFAGIRFTPFSVNAVVLLTVGPAVLGVGPSSSDETVSGEGSRTAYWAGFTECMASA  189

Query  577   ALHGFIMAGVEYAHVH------------AGVPVTNGLLMQVQFIISMFSALFCTVAMIIN  720
             AL G ++   E A                G P +   +MQVQ ++     + C V M + 
Sbjct  190   ALMGLVVPLFEVAMSRYGRRTAPAGGAFTGAPPSYVTVMQVQAVMGAAGTVLCLVGMAVM  249

Query  721   KDFQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAV  900
             ++FQA+ +EA  F LG   Y +++ F  ++ QL  +G +G++  SS+LL GI  +LL+ +
Sbjct  250   EEFQAVPREAATFGLGETSYCLVLIFGTVSWQLCNLGIMGLVACSSSLLAGIMLALLLPL  309

Query  901   QQVFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTARKKPPPPPVTGDDEE  1062
              +V +V+FL E F   K ++L +C+WGF SY YG+    +K      +T D E 
Sbjct  310   SEVLAVVFLHEKFDGVKGVALVLCLWGFVSYLYGESAQNKK------LTKDPES  357



>ref|XP_004985415.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=389

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 125/310 (40%), Positives = 183/310 (59%), Gaps = 12/310 (4%)
 Frame = +1

Query  121   RLYFLHGGKRKWLSSCLLTAGFPCLLVPIFISYarnqakaaanrrrVLVTPWLFMSSAFL  300
             R+YF+HGG+R +LS+ L  +G+P LL PI +S      + +     +L+ P L  + A L
Sbjct  62    RVYFVHGGERLFLSTMLQLSGWPLLLPPICVS---LFRRRSQGVANLLLPPRLAGAGAVL  118

Query  301   GLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFG  480
             G    +  ++Y+ G   LP+S SSLL +TQLAFTAVFA+     + T +S NAVVL+T G
Sbjct  119   GAFYAISCFVYSLGSQALPLSTSSLLLATQLAFTAVFAFLFAGLRFTPFSANAVVLLTIG  178

Query  481   SVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHGFIMAGVEYAHVHAG--------VP  636
               VLG+     +P GES R+Y  GF   +A AAL G ++  VE A    G        VP
Sbjct  179   PAVLGVGPGSGKPAGESSRTYWTGFCEAVAAAALAGLVLPLVEVAMARYGRRTGPAARVP  238

Query  637   VTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISKEAREFDLGTEKYYMIVGFAAIALQ  816
                  +MQ+Q ++     + C + M I  DFQA+  EA  F LG   YY+++ + AI+ Q
Sbjct  239   PPYVTVMQMQAVMGAAGTMVCLLGMAIKSDFQALPNEAATFGLGKTNYYLVLIWDAISWQ  298

Query  817   LMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIFLPESFSADKLLSLAICIWGFASYF  996
             L+ +G +G+I  +S+LL GI  ++L+ + QV SVIFL E F   K ++L +C+WGFASY 
Sbjct  299   LLNLGIMGLITCASSLLAGIMIAVLLPLSQVLSVIFLHEKFDGPKGIALVLCLWGFASYL  358

Query  997   YGDYKTARKK  1026
             YG+ K  +K+
Sbjct  359   YGE-KVQKKR  367



>ref|XP_008651823.1| PREDICTED: purine permease 3 [Zea mays]
 tpg|DAA43786.1| TPA: hypothetical protein ZEAMMB73_889347 [Zea mays]
Length=391

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 132/334 (40%), Positives = 199/334 (60%), Gaps = 12/334 (4%)
 Frame = +1

Query  52    KALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPCLLVPIFIS-Yarn  228
              +L++I++   + +G  GG +L+R+YF+HGG+R +LS+ L  +G+P LL PI +S Y   
Sbjct  39    PSLLVILSACLVLMGA-GGPLLLRVYFVHGGERLFLSAMLQISGWPLLLPPICVSLYRSR  97

Query  229   qakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSISSLLSSTQLAFTAV  408
                 +     +L+ P L  ++A LG    +  +LY  G   LP+S SSLL +TQLAFTAV
Sbjct  98    SRSRSHGVASLLLPPRLAGAAAVLGAFYAISCFLYALGSQALPLSTSSLLLATQLAFTAV  157

Query  409   FAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYTLGFFMTIAGAALHG  588
             FA+  V  + T +S NAVVL+T G  VLG+     +P GE+ R+Y +GF   IA AAL G
Sbjct  158   FAFLFVGLRFTPFSANAVVLLTIGPAVLGVGPGSGKPAGEASRTYWIGFCEAIAAAALAG  217

Query  589   FIMAGVEYAHVHAG--------VPVTNGLLMQVQFIISMFSALFCTVAMIINKDFQAISK  744
              ++  VE A    G        VP     +MQ+Q ++     L C + M I  DFQA+  
Sbjct  218   LVLPLVEIATARYGRRTGPAARVPPPYATVMQMQAVMGAAGTLVCLLGMAIKSDFQAVPS  277

Query  745   EAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQVFSVIF  924
             EA  F LG   YY+++ + AI+ QL+ +G +G+I  +S+LL GI  ++L+ + ++ +VIF
Sbjct  278   EAATFGLGKTNYYLVLIWDAISWQLLNLGIVGLITCASSLLAGIMIAVLLPLSEILAVIF  337

Query  925   LPESFSADKLLSLAICIWGFASYFYGDYKTARKK  1026
             L E F   K ++L + +WGFASY YG+   A+KK
Sbjct  338   LHEKFDGPKGIALVLSLWGFASYLYGE--KAQKK  369



>ref|XP_008776064.1| PREDICTED: probable purine permease 5 [Phoenix dactylifera]
 ref|XP_008776065.1| PREDICTED: probable purine permease 5 [Phoenix dactylifera]
Length=350

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 123/338 (36%), Positives = 193/338 (57%), Gaps = 14/338 (4%)
 Frame = +1

Query  16    LEDMKKMKFLSFKALVIIINCVFLAVGQIGGVILIRLYFLHGGKRKWLSSCLLTAGFPC-  192
             LE  KK K LS+  L+I+ +   L V      +L RLY+ +GGK KW+ S    AG+P  
Sbjct  22    LETYKK-KPLSYWLLLILSSSAML-VAFPASSLLSRLYYANGGKSKWIISWTAVAGWPLT  79

Query  193   --LLVPIFISYarnqakaaanrrrVLVTPWLFMSSAFLGLLLGVDSYLYTFGMSYLPVSI  366
                L+P++I       K +     + ++ W  +    LG L   D+ +Y +  +YLP S 
Sbjct  80    ALFLIPMYIC-----GKISPTPLSLKLSLWYIL----LGFLSAADNLMYAWAYAYLPAST  130

Query  367   SSLLSSTQLAFTAVFAYFIVKHKLTHYSVNAVVLMTFGSVVLGLHMAGDRPEGESDRSYT  546
             +SLL+S+ L F+A+F YFIVK+KL   S+NA+V+++ G+V++ L    DR EG +DR YT
Sbjct  131   ASLLASSSLVFSALFGYFIVKNKLNLSSINAIVIISAGAVIIALDSESDRYEGITDRQYT  190

Query  547   LGFFMTIAGAALHGFIMAGVEYAHVHAGVPVTNGLLMQVQFIISMFSALFCTVAMIINKD  726
             +GF   I G+ALHG I A  E   V      +  ++++ Q ++S    +F T+ +I+N D
Sbjct  191   MGFIWDILGSALHGLIFALSELVFVKILGRRSFHVVLEQQVMVSFAGFVFTTIGLIVNND  250

Query  727   FQAISKEAREFDLGTEKYYMIVGFAAIALQLMVMGSLGVIFSSSALLLGIFTSLLVAVQQ  906
             FQ +  EA  F  G   Y M++ +AAI  QL V+GS  V+F +S +L G+  ++ V +  
Sbjct  251   FQGMRSEASSFKHGEVSYAMVLTWAAITFQLGVLGSTAVLFLASTVLAGVLNAVRVPLTS  310

Query  907   VFSVIFLPESFSADKLLSLAICIWGFASYFYGDYKTAR  1020
             + +VI   +  S  K+LSL I +WGF SY  G+  +++
Sbjct  311   IAAVILFHDPMSGFKILSLIITVWGFGSYIVGNSSSSK  348



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3423712266800