BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27163_g1_i1 len=1768 path=[1746:0-1767]

Length=1768
                                                                      Score     E

ref|XP_007162296.1|  hypothetical protein PHAVU_001G140100g             385   2e-123   
ref|XP_007162295.1|  hypothetical protein PHAVU_001G140100g             384   3e-123   
gb|AES81437.2|  BZIP family transcription factor                        383   5e-123   
ref|XP_003625219.1|  Transcription factor, putative                     382   1e-122   
ref|XP_009798380.1|  PREDICTED: transcription factor HBP-1b(c38)-...    383   2e-122   
ref|XP_003554196.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    382   4e-122   
ref|XP_006604382.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    381   5e-122   
emb|CDP10109.1|  unnamed protein product                                379   8e-122   
ref|XP_003521195.1|  PREDICTED: transcription factor HBP-1b(c1)-like    380   1e-121   
gb|KHN07408.1|  Transcription factor HBP-1b(c1)                         377   3e-121   
gb|ABN08651.1|  cAMP response element binding (CREB) protein            379   4e-121   Medicago truncatula
ref|XP_010312148.1|  PREDICTED: transcription factor HBP-1b(c38)-...    377   7e-121   
ref|XP_009602906.1|  PREDICTED: transcription factor HBP-1b(c38)-...    378   1e-120   
gb|KHN15531.1|  Transcription factor HBP-1b(c1)                         379   1e-120   
ref|XP_003537178.2|  PREDICTED: transcription factor HBP-1b(c1)-l...    379   1e-120   
ref|XP_006588910.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    378   2e-120   
ref|XP_010257393.1|  PREDICTED: transcription factor HBP-1b(c38)-...    375   2e-120   
gb|AAY15214.1|  TGA10 transcription factor                              374   4e-119   Nicotiana tabacum [American tobacco]
ref|XP_009611363.1|  PREDICTED: transcription factor HBP-1b(c38)-...    370   2e-117   
ref|XP_010265827.1|  PREDICTED: transcription factor TGA2-like          365   2e-116   
ref|XP_004136740.1|  PREDICTED: transcription factor HBP-1b(c1)-like    363   3e-116   
ref|XP_006575222.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    365   7e-116   
ref|XP_009626969.1|  PREDICTED: transcription factor HBP-1b(c38)-...    363   3e-115   
ref|XP_010057941.1|  PREDICTED: transcription factor TGA2               363   3e-115   
ref|XP_009611364.1|  PREDICTED: transcription factor HBP-1b(c38)-...    364   4e-115   
ref|XP_011020273.1|  PREDICTED: transcription factor TGA2-like          364   5e-115   
ref|XP_006485023.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    363   7e-115   
ref|XP_006485024.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    363   7e-115   
ref|XP_006437046.1|  hypothetical protein CICLE_v10031361mg             363   7e-115   
ref|XP_002308062.2|  hypothetical protein POPTR_0006s05770g             364   8e-115   Populus trichocarpa [western balsam poplar]
ref|XP_010111398.1|  Transcription factor HBP-1b(c1)                    362   3e-114   
ref|XP_009357109.1|  PREDICTED: transcription factor HBP-1b(c38)-...    357   7e-112   
emb|CBI30045.3|  unnamed protein product                                353   9e-112   
ref|XP_010928452.1|  PREDICTED: transcription factor TGA2-like          353   1e-111   
ref|XP_007204568.1|  hypothetical protein PRUPE_ppa003825mg             356   2e-111   
ref|XP_009794164.1|  PREDICTED: transcription factor HBP-1b(c38)-...    354   3e-111   
gb|KHG19393.1|  hypothetical protein F383_24687                         350   3e-111   
ref|XP_008241036.1|  PREDICTED: transcription factor TGA2               354   3e-111   
gb|KDP24594.1|  hypothetical protein JCGZ_25510                         353   5e-111   
ref|XP_006575223.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    348   9e-111   
ref|XP_007028940.1|  BZIP transcription factor family protein           352   1e-110   
ref|XP_004497935.1|  PREDICTED: transcription factor HBP-1b(c1)-like    352   2e-110   
ref|XP_003519053.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    351   3e-110   
ref|XP_004309443.1|  PREDICTED: transcription factor HBP-1b(c1)-like    352   3e-110   
gb|KEH23667.1|  BZIP family transcription factor                        346   5e-110   
ref|XP_002275147.1|  PREDICTED: transcription factor TGA2               350   7e-110   Vitis vinifera
gb|KHG26518.1|  hypothetical protein F383_02381                         346   8e-110   
ref|XP_010943572.1|  PREDICTED: transcription factor HBP-1b(c38)-...    346   6e-109   
ref|XP_008367369.1|  PREDICTED: transcription factor HBP-1b(c38)-...    349   6e-109   
ref|XP_009794165.1|  PREDICTED: transcription factor HBP-1b(c38)-...    347   1e-108   
ref|XP_009391827.1|  PREDICTED: transcription factor HBP-1b(c38)-...    344   4e-108   
ref|XP_011075176.1|  PREDICTED: transcription factor HBP-1b(c38)        346   4e-108   
gb|KCW90292.1|  hypothetical protein EUGRSUZ_A02436                     341   5e-108   
ref|XP_009391826.1|  PREDICTED: transcription factor HBP-1b(c38)-...    343   5e-108   
ref|XP_006290099.1|  hypothetical protein CARUB_v10003744mg             343   6e-108   
ref|NP_850784.1|  bZIP transcription factor TGA10                       342   7e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009370244.1|  PREDICTED: transcription factor HBP-1b(c38)-...    343   1e-107   
ref|XP_002871233.1|  bZIP family transcription factor                   341   3e-107   
emb|CAC40649.1|  bZIP transcription factor                              340   3e-107   Arabidopsis thaliana [mouse-ear cress]
gb|AES81438.2|  BZIP family transcription factor                        341   4e-107   
ref|XP_006362280.1|  PREDICTED: transcription factor HBP-1b(c1)-like    343   4e-107   
ref|XP_003625220.1|  Transcription factor, putative                     340   9e-107   
ref|XP_010672705.1|  PREDICTED: transcription factor HBP-1b(c38)        345   9e-107   
ref|XP_009418243.1|  PREDICTED: transcription factor HBP-1b(c38)-...    340   1e-106   
ref|XP_008800656.1|  PREDICTED: transcription factor HBP-1b(c38)-...    338   4e-106   
ref|NP_001078538.1|  bZIP transcription factor TGA10                    338   4e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004249162.1|  PREDICTED: transcription factor TGA2-like          340   5e-106   
gb|KCW48077.1|  hypothetical protein EUGRSUZ_K01822                     339   5e-106   
ref|XP_004493558.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    339   8e-106   
ref|XP_004493559.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    339   8e-106   
gb|EPS58512.1|  hypothetical protein M569_16301                         333   9e-106   
ref|XP_010452628.1|  PREDICTED: transcription factor TGA2-like is...    336   5e-105   
ref|XP_008443080.1|  PREDICTED: transcription factor HBP-1b(c38) ...    337   2e-104   
ref|XP_008351787.1|  PREDICTED: transcription factor HBP-1b(c38)-...    337   2e-104   
gb|KGN59323.1|  hypothetical protein Csa_3G810480                       337   2e-104   
ref|XP_008795763.1|  PREDICTED: transcription factor HBP-1b(c38)        332   6e-104   
ref|XP_010038900.1|  PREDICTED: transcription factor HBP-1b(c38)-...    332   4e-103   
ref|XP_009122302.1|  PREDICTED: transcription factor TGA2 isoform X2    331   6e-103   
emb|CDX70061.1|  BnaA10g24100D                                          330   1e-102   
ref|XP_008443081.1|  PREDICTED: transcription factor HBP-1b(c38) ...    332   1e-102   
ref|XP_009418244.1|  PREDICTED: transcription factor TGA2-like is...    328   2e-102   
ref|XP_009418242.1|  PREDICTED: transcription factor TGA2-like is...    328   1e-101   
ref|XP_010928841.1|  PREDICTED: transcription factor HBP-1b(c38)-...    326   2e-101   
ref|XP_002322683.2|  hypothetical protein POPTR_0016s04970g             323   3e-101   Populus trichocarpa [western balsam poplar]
ref|XP_009122301.1|  PREDICTED: transcription factor TGA2 isoform X1    326   4e-101   
ref|XP_009391828.1|  PREDICTED: transcription factor HBP-1b(c38)-...    325   1e-100   
ref|XP_011078853.1|  PREDICTED: transcription factor HBP-1b(c38)-...    327   1e-100   
ref|XP_006850081.1|  hypothetical protein AMTR_s00022p00217850          325   2e-100   
emb|CDX98963.1|  BnaC09g48720D                                          324   2e-100   
ref|XP_008787290.1|  PREDICTED: transcription factor TGA2-like          323   2e-100   
ref|XP_010928842.1|  PREDICTED: transcription factor HBP-1b(c38)-...    317   8e-99    
ref|XP_010452626.1|  PREDICTED: transcription factor HBP-1b(c38)-...    320   1e-98    
ref|XP_010491266.1|  PREDICTED: transcription factor TGA2-like is...    319   2e-98    
ref|XP_010913925.1|  PREDICTED: transcription factor TGA2 isoform X3    315   4e-98    
ref|XP_010423290.1|  PREDICTED: transcription factor HBP-1b(c38)-...    318   4e-98    
ref|XP_010913923.1|  PREDICTED: transcription factor TGA2 isoform X1    316   2e-97    
gb|KFK25074.1|  hypothetical protein AALP_AA8G062800                    316   3e-97    
ref|XP_010913924.1|  PREDICTED: transcription factor TGA2 isoform X2    315   3e-97    
gb|KFK25075.1|  hypothetical protein AALP_AA8G062800                    315   5e-97    
ref|XP_010491265.1|  PREDICTED: transcription factor HBP-1b(c38)-...    315   7e-97    
ref|XP_010452627.1|  PREDICTED: transcription factor HBP-1b(c38)-...    315   8e-97    
ref|XP_010452624.1|  PREDICTED: transcription factor HBP-1b(c38)-...    315   8e-97    
gb|KEH16646.1|  BZIP family transcription factor                        315   1e-96    
ref|XP_009419169.1|  PREDICTED: transcription factor HBP-1b(c38)-...    314   1e-96    
ref|NP_001190244.1|  bZIP transcription factor TGA10                    314   2e-96    
ref|XP_010491267.1|  PREDICTED: transcription factor TGA2-like is...    314   2e-96    
ref|XP_006399160.1|  hypothetical protein EUTSA_v10014032mg             310   2e-96    
ref|XP_010423289.1|  PREDICTED: transcription factor HBP-1b(c38)-...    314   2e-96    
gb|EYU20711.1|  hypothetical protein MIMGU_mgv1a025325mg                315   3e-96    
ref|XP_009130967.1|  PREDICTED: transcription factor TGA2-like is...    313   5e-96    
ref|XP_008783086.1|  PREDICTED: transcription factor HBP-1b(c38)-...    308   2e-95    
ref|XP_007145660.1|  hypothetical protein PHAVU_007G257700g             312   3e-95    
dbj|BAB11142.1|  bZIP transcription factor-like protein                 306   4e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007145659.1|  hypothetical protein PHAVU_007G257700g             312   8e-95    
ref|XP_009130965.1|  PREDICTED: transcription factor TGA2-like is...    309   1e-94    
ref|XP_002532393.1|  Transcription factor HBP-1b(c1), putative          308   3e-94    Ricinus communis
ref|NP_001140874.1|  putative bZIP transcription factor superfami...    303   9e-94    Zea mays [maize]
ref|XP_002975942.1|  hypothetical protein SELMODRAFT_232668             301   3e-93    
gb|ACF88441.1|  unknown                                                 304   4e-93    Zea mays [maize]
gb|ACG39046.1|  DNA binding protein                                     303   5e-93    Zea mays [maize]
ref|XP_008651078.1|  PREDICTED: putative bZIP transcription facto...    304   5e-93    
ref|XP_004957190.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    306   5e-93    
ref|XP_002968543.1|  hypothetical protein SELMODRAFT_231160             298   1e-92    
ref|XP_008651077.1|  PREDICTED: putative bZIP transcription facto...    305   1e-92    
ref|XP_002969636.1|  hypothetical protein SELMODRAFT_231344             294   1e-90    
ref|XP_009391829.1|  PREDICTED: transcription factor TGA2-like is...    297   1e-90    
ref|NP_001170494.1|  uncharacterized protein LOC100384496               291   2e-89    Zea mays [maize]
ref|NP_001289788.1|  transcription factor TGA2                          295   7e-89    
ref|XP_010271664.1|  PREDICTED: transcription factor TGA2-like          295   9e-89    
ref|XP_009412198.1|  PREDICTED: transcription factor HBP-1b(c1)-like    288   4e-88    
ref|XP_008668491.1|  PREDICTED: uncharacterized protein LOC100384...    293   8e-88    
ref|XP_004498681.1|  PREDICTED: transcription factor TGA6-like is...    286   1e-87    
ref|XP_010557413.1|  PREDICTED: transcription factor TGA2 isoform X2    292   1e-87    
ref|XP_010557409.1|  PREDICTED: transcription factor TGA2 isoform X1    292   2e-87    
ref|XP_011088886.1|  PREDICTED: transcription factor TGA2 isoform X3    290   2e-87    
ref|XP_006644874.1|  PREDICTED: transcription factor HBP-1b(c1)-like    286   4e-87    
ref|XP_008383946.1|  PREDICTED: transcription factor HBP-1b(c38)-...    290   8e-87    
ref|XP_010520061.1|  PREDICTED: transcription factor HBP-1b(c38) ...    289   9e-87    
ref|XP_011088884.1|  PREDICTED: transcription factor TGA2 isoform X1    290   1e-86    
gb|ABP88233.1|  transcription factor bZIP98                             283   1e-86    Glycine max [soybeans]
ref|XP_010922090.1|  PREDICTED: transcription factor HBP-1b(c38)-...    289   1e-86    
ref|XP_008786824.1|  PREDICTED: transcription factor TGA2-like is...    289   1e-86    
ref|XP_008788487.1|  PREDICTED: transcription factor HBP-1b(c38)-...    288   1e-86    
ref|XP_008786823.1|  PREDICTED: transcription factor TGA2-like is...    289   1e-86    
ref|XP_004511049.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    288   1e-86    
ref|XP_008383943.1|  PREDICTED: transcription factor HBP-1b(c38)-...    291   1e-86    
ref|XP_008788486.1|  PREDICTED: transcription factor HBP-1b(c38)-...    288   2e-86    
ref|XP_010520059.1|  PREDICTED: transcription factor HBP-1b(c38) ...    288   2e-86    
dbj|BAG95936.1|  unnamed protein product                                290   2e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006465763.1|  PREDICTED: transcription factor TGA6-like is...    284   2e-86    
ref|XP_008228578.1|  PREDICTED: transcription factor TGA2 isoform X3    289   2e-86    
ref|XP_007205044.1|  hypothetical protein PRUPE_ppa004537mg             289   2e-86    
ref|XP_004498677.1|  PREDICTED: transcription factor TGA6-like is...    287   2e-86    
ref|NP_001063534.1|  Os09g0489500                                       290   2e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010686011.1|  PREDICTED: transcription factor TGA2 isoform X1    289   2e-86    
ref|XP_004498678.1|  PREDICTED: transcription factor TGA6-like is...    286   2e-86    
emb|CDP09298.1|  unnamed protein product                                283   2e-86    
gb|EEC84791.1|  hypothetical protein OsI_31848                          290   2e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_009419684.1|  PREDICTED: transcription factor HBP-1b(c38)-...    283   3e-86    
dbj|BAB72064.1|  bZIP transcription factor                              283   3e-86    Oryza sativa [red rice]
ref|XP_004498680.1|  PREDICTED: transcription factor TGA6-like is...    285   3e-86    
ref|XP_006347245.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    288   3e-86    
ref|XP_009384968.1|  PREDICTED: transcription factor HBP-1b(c38)-...    286   4e-86    
ref|XP_010904691.1|  PREDICTED: transcription factor HBP-1b(c38)-...    286   4e-86    
ref|XP_009794636.1|  PREDICTED: transcription factor TGA2-like          282   4e-86    
ref|XP_009371925.1|  PREDICTED: transcription factor HBP-1b(c38)-...    288   5e-86    
ref|XP_006826801.1|  hypothetical protein AMTR_s00010p00030830          286   5e-86    
ref|XP_006347244.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    288   5e-86    
ref|XP_008228563.1|  PREDICTED: transcription factor TGA2 isoform X1    289   7e-86    
ref|XP_010322437.1|  PREDICTED: transcription factor TGA2 isoform X4    285   7e-86    
ref|XP_003627926.1|  TGA transcription factor                           286   7e-86    
ref|XP_010238296.1|  PREDICTED: transcription factor TGA2-like          288   8e-86    
ref|XP_010904690.1|  PREDICTED: transcription factor HBP-1b(c38)-...    286   9e-86    
ref|XP_009364312.1|  PREDICTED: transcription factor TGA2-like          288   1e-85    
ref|XP_006661375.1|  PREDICTED: transcription factor TGA2-like          288   1e-85    
ref|XP_004498676.1|  PREDICTED: transcription factor TGA6-like is...    285   1e-85    
gb|EPS71573.1|  hypothetical protein M569_03185                         292   1e-85    
ref|XP_002276067.2|  PREDICTED: transcription factor TGA6 isoform X1    287   1e-85    Vitis vinifera
ref|XP_006347246.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    286   2e-85    
ref|XP_010245498.1|  PREDICTED: transcription factor TGA2-like is...    286   2e-85    
ref|XP_009371923.1|  PREDICTED: transcription factor HBP-1b(c38)-...    288   2e-85    
ref|XP_006605394.1|  PREDICTED: uncharacterized protein LOC100816...    281   2e-85    
ref|XP_010651889.1|  PREDICTED: transcription factor TGA6 isoform X2    286   2e-85    
ref|XP_006832856.1|  hypothetical protein AMTR_s00095p00059370          285   2e-85    
ref|XP_004307087.1|  PREDICTED: transcription factor HBP-1b(c1)-like    281   2e-85    
gb|AFK47127.1|  unknown                                                 285   2e-85    
gb|AEF30410.1|  putative TGA2-like protein 2                            281   2e-85    
ref|XP_006465757.1|  PREDICTED: transcription factor TGA6-like is...    285   3e-85    
gb|KHN37699.1|  Transcription factor HBP-1b(c1)                         284   3e-85    
ref|XP_010322436.1|  PREDICTED: transcription factor TGA2 isoform X3    285   3e-85    
ref|XP_006465760.1|  PREDICTED: transcription factor TGA6-like is...    285   3e-85    
ref|XP_010313245.1|  PREDICTED: transcription factor HBP-1b(c38)        280   3e-85    
ref|XP_011088885.1|  PREDICTED: transcription factor TGA2 isoform X2    285   3e-85    
ref|XP_007133721.1|  hypothetical protein PHAVU_011G203400g             285   3e-85    
ref|XP_006356348.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    280   3e-85    
ref|XP_004241320.1|  PREDICTED: transcription factor TGA2 isoform X1    286   3e-85    
ref|XP_010322435.1|  PREDICTED: transcription factor TGA2 isoform X2    286   3e-85    
ref|XP_008787873.1|  PREDICTED: transcription factor TGA6-like is...    285   3e-85    
ref|XP_008787881.1|  PREDICTED: transcription factor TGA6-like is...    284   4e-85    
ref|XP_010686014.1|  PREDICTED: transcription factor TGA2 isoform X3    285   4e-85    
ref|XP_009419682.1|  PREDICTED: transcription factor HBP-1b(c38)-...    284   5e-85    
ref|XP_010686013.1|  PREDICTED: transcription factor TGA2 isoform X2    286   5e-85    
ref|XP_008383945.1|  PREDICTED: transcription factor HBP-1b(c38)-...    286   5e-85    
gb|ADW40546.1|  bZIP transcription factor                               280   5e-85    
ref|XP_011007183.1|  PREDICTED: transcription factor TGA2 isoform X1    285   5e-85    
ref|XP_009419683.1|  PREDICTED: transcription factor HBP-1b(c38)-...    284   5e-85    
ref|XP_004970302.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    285   5e-85    
ref|NP_001237963.1|  bZIP transcription factor bZIP99                   284   5e-85    
ref|XP_007028142.1|  Transcription factor HBP-1b(c1) isoform 8          279   5e-85    
gb|EYU45341.1|  hypothetical protein MIMGU_mgv1a009902mg                280   6e-85    
ref|XP_008231625.1|  PREDICTED: transcription factor TGA2-like          280   6e-85    
ref|XP_010557921.1|  PREDICTED: transcription factor TGA6               280   6e-85    
ref|XP_004142384.1|  PREDICTED: transcription factor HBP-1b(c1)-like    280   7e-85    
ref|XP_003546706.1|  PREDICTED: transcription factor HBP-1b(c1) i...    284   7e-85    
ref|XP_008391112.1|  PREDICTED: transcription factor TGA2-like is...    285   7e-85    
ref|XP_008350323.1|  PREDICTED: transcription factor HBP-1b(c38)-...    283   7e-85    
gb|KDO57728.1|  hypothetical protein CISIN_1g038233mg                   280   7e-85    
ref|XP_008787868.1|  PREDICTED: transcription factor TGA6-like is...    285   8e-85    
ref|XP_011007200.1|  PREDICTED: transcription factor TGA2 isoform X2    285   8e-85    
ref|XP_004303596.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    283   9e-85    
ref|XP_006594375.1|  PREDICTED: transcription factor HBP-1b(c1) i...    284   9e-85    
ref|XP_010659087.1|  PREDICTED: transcription factor TGA2 isoform X1    284   9e-85    
ref|XP_007028137.1|  Transcription factor HBP-1b(c1) isoform 3          279   9e-85    
ref|XP_002263159.2|  PREDICTED: transcription factor TGA2 isoform X2    284   1e-84    Vitis vinifera
ref|XP_009627416.1|  PREDICTED: transcription factor HBP-1b(c38)-...    279   1e-84    
ref|XP_009803516.1|  PREDICTED: transcription factor HBP-1b(c38)-...    279   1e-84    
gb|AAT28675.1|  bZIP transcription factor                               284   1e-84    Oryza sativa Japonica Group [Japonica rice]
gb|EPS67211.1|  hypothetical protein M569_07557                         279   1e-84    
gb|KGN52332.1|  hypothetical protein Csa_5G624430                       280   1e-84    
ref|XP_008804825.1|  PREDICTED: transcription factor TGA2               278   1e-84    
gb|EEC71673.1|  hypothetical protein OsI_04142                          283   1e-84    Oryza sativa Indica Group [Indian rice]
ref|XP_009338082.1|  PREDICTED: transcription factor HBP-1b(c38)-...    283   1e-84    
ref|XP_006855016.1|  hypothetical protein AMTR_s00031p00017860          283   2e-84    
ref|XP_008446973.1|  PREDICTED: transcription factor TGA2-like is...    278   2e-84    
ref|XP_008228573.1|  PREDICTED: transcription factor TGA2 isoform X2    284   2e-84    
ref|XP_010095986.1|  Transcription factor HBP-1b(c1)                    280   2e-84    
ref|XP_006424250.1|  hypothetical protein CICLE_v100284281mg            282   2e-84    
ref|XP_006288172.1|  hypothetical protein CARUB_v10001409mg             278   2e-84    
ref|XP_011075851.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    278   2e-84    
ref|XP_010055972.1|  PREDICTED: transcription factor HBP-1b(c38)-...    283   2e-84    
ref|XP_001779430.1|  predicted protein                                  278   2e-84    
ref|XP_011000921.1|  PREDICTED: transcription factor TGA2-like is...    284   2e-84    
ref|XP_008391110.1|  PREDICTED: transcription factor TGA2-like is...    285   2e-84    
gb|AFO63289.1|  bZIP10                                                  282   2e-84    
gb|AGI17587.1|  transcription factor TGA2                               281   2e-84    
ref|XP_011000920.1|  PREDICTED: transcription factor TGA2-like is...    283   3e-84    
gb|EYU20805.1|  hypothetical protein MIMGU_mgv1a006646mg                281   3e-84    
ref|XP_006417705.1|  hypothetical protein EUTSA_v10007490mg             283   3e-84    
ref|XP_009779356.1|  PREDICTED: transcription factor TGA2               283   3e-84    
ref|XP_010907586.1|  PREDICTED: transcription factor TGA2-like          283   4e-84    
ref|XP_006417704.1|  hypothetical protein EUTSA_v10007490mg             283   4e-84    
emb|CDP06929.1|  unnamed protein product                                283   4e-84    
ref|XP_010673023.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    277   4e-84    
ref|XP_002458658.1|  hypothetical protein SORBIDRAFT_03g037560          282   5e-84    Sorghum bicolor [broomcorn]
ref|XP_002513027.1|  Transcription factor HBP-1b(c1), putative          281   5e-84    Ricinus communis
ref|XP_006605392.1|  PREDICTED: uncharacterized protein LOC100816...    280   5e-84    
ref|XP_007203875.1|  hypothetical protein PRUPE_ppa005279mg             282   5e-84    
ref|XP_009371924.1|  PREDICTED: transcription factor HBP-1b(c38)-...    283   5e-84    
ref|XP_006598094.1|  PREDICTED: transcription factor HBP-1b(c1) i...    283   5e-84    
ref|XP_006644064.1|  PREDICTED: transcription factor HBP-1b(c38)-...    277   6e-84    
ref|XP_011084590.1|  PREDICTED: transcription factor HBP-1b(c38)-...    277   6e-84    
ref|XP_004165289.1|  PREDICTED: transcription factor HBP-1b(c1)-like    277   6e-84    
gb|KHG21339.1|  hypothetical protein F383_27590                         281   7e-84    
ref|XP_002970901.1|  hypothetical protein SELMODRAFT_231689             276   7e-84    
ref|XP_008445387.1|  PREDICTED: transcription factor TGA2-like          277   7e-84    
ref|XP_006605391.1|  PREDICTED: uncharacterized protein LOC100816...    280   8e-84    
gb|KDO44924.1|  hypothetical protein CISIN_1g015258mg                   278   9e-84    
ref|XP_011020425.1|  PREDICTED: transcription factor TGA2-like is...    281   1e-83    
ref|XP_011020421.1|  PREDICTED: transcription factor TGA2-like is...    281   1e-83    
ref|XP_011020430.1|  PREDICTED: transcription factor TGA2-like is...    280   1e-83    
ref|XP_006487952.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    282   1e-83    
ref|XP_006421095.1|  hypothetical protein CICLE_v10005080mg             279   1e-83    
ref|XP_006487950.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    282   1e-83    
ref|XP_010247478.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    281   1e-83    
ref|XP_006487951.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    282   1e-83    
ref|XP_006487948.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    282   1e-83    
ref|XP_007028143.1|  TGACG motif-binding factor 6 isoform 1             281   1e-83    
ref|XP_003632741.1|  PREDICTED: transcription factor HBP-1b(c38)        280   1e-83    
gb|KHN37272.1|  Transcription factor HBP-1b(c1)                         276   2e-83    
ref|XP_006384820.1|  bZIP family transcription factor family protein    281   2e-83    
gb|KDP40547.1|  hypothetical protein JCGZ_24546                         280   2e-83    
gb|EYU18627.1|  hypothetical protein MIMGU_mgv1a006504mg                280   2e-83    
ref|NP_001049945.1|  Os03g0318600                                       276   2e-83    
gb|KDO44920.1|  hypothetical protein CISIN_1g015258mg                   278   2e-83    
ref|XP_010907104.1|  PREDICTED: transcription factor TGA2-like is...    280   2e-83    
ref|XP_008651318.1|  PREDICTED: uncharacterized protein LOC100279...    276   2e-83    
gb|KHG29238.1|  hypothetical protein F383_00102                         280   2e-83    
ref|XP_006649994.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    276   2e-83    
gb|KHN08879.1|  Transcription factor HBP-1b(c1)                         278   2e-83    
ref|XP_002313591.1|  bZIP family transcription factor family protein    280   3e-83    
ref|XP_010912287.1|  PREDICTED: transcription factor TGA2-like is...    280   3e-83    
ref|XP_010067716.1|  PREDICTED: transcription factor TGA2               275   3e-83    
gb|KDP29380.1|  hypothetical protein JCGZ_18301                         280   3e-83    
ref|NP_001042751.1|  Os01g0279900                                       275   3e-83    
gb|ACU78078.1|  TGA1a-related protein 6                                 275   3e-83    
ref|XP_008651325.1|  PREDICTED: uncharacterized protein LOC100279...    275   3e-83    
ref|XP_010673022.1|  PREDICTED: transcription factor HBP-1b(c38)-...    278   4e-83    
ref|XP_002303938.2|  hypothetical protein POPTR_0003s19410g             280   4e-83    
ref|NP_001132337.1|  putative bZIP transcription factor superfami...    275   4e-83    
ref|XP_007142625.1|  hypothetical protein PHAVU_007G003600g             279   4e-83    
ref|XP_009393095.1|  PREDICTED: transcription factor HBP-1b(c1)-like    275   4e-83    
ref|XP_006603764.1|  PREDICTED: bZIP transcription factor bZIP96 ...    279   5e-83    
ref|XP_010673021.1|  PREDICTED: transcription factor HBP-1b(c38)-...    278   5e-83    
ref|XP_006603762.1|  PREDICTED: bZIP transcription factor bZIP96 ...    279   5e-83    
ref|XP_008651321.1|  PREDICTED: uncharacterized protein LOC100279...    274   5e-83    
emb|CDX95068.1|  BnaC05g06030D                                          279   6e-83    
ref|XP_010520066.1|  PREDICTED: transcription factor TGA6-like is...    275   6e-83    
gb|KHG27506.1|  hypothetical protein F383_06803                         275   6e-83    
ref|XP_008651323.1|  PREDICTED: uncharacterized protein LOC100279...    274   6e-83    
gb|ABS01351.1|  basic leucine zipper protein                            278   6e-83    
gb|KDO58071.1|  hypothetical protein CISIN_1g036039mg                   280   6e-83    
ref|XP_008391111.1|  PREDICTED: transcription factor TGA2-like is...    281   6e-83    
ref|XP_004958749.1|  PREDICTED: transcription factor HBP-1b(c38)-...    275   7e-83    
ref|XP_007150072.1|  hypothetical protein PHAVU_005G124100g             279   7e-83    
ref|XP_008651324.1|  PREDICTED: uncharacterized protein LOC100279...    274   7e-83    
ref|XP_004958748.1|  PREDICTED: transcription factor HBP-1b(c38)-...    275   8e-83    
ref|XP_004967673.1|  PREDICTED: transcription factor HBP-1b(c38)-...    274   8e-83    
emb|CBI27049.3|  unnamed protein product                                278   8e-83    
ref|XP_009772597.1|  PREDICTED: transcription factor TGA2-like is...    279   8e-83    
ref|XP_003564436.1|  PREDICTED: transcription factor HBP-1b(c1)         279   9e-83    
ref|XP_008651314.1|  PREDICTED: uncharacterized protein LOC100279...    275   9e-83    
ref|XP_010912286.1|  PREDICTED: transcription factor TGA2-like is...    279   9e-83    
ref|XP_006592767.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    276   1e-82    
emb|CDY08443.1|  BnaA05g26790D                                          274   1e-82    
ref|XP_002457410.1|  hypothetical protein SORBIDRAFT_03g006790          274   1e-82    
ref|XP_003624994.1|  TGA transcription factor                           276   1e-82    
ref|XP_007162093.1|  hypothetical protein PHAVU_001G123300g             278   1e-82    
ref|XP_010647867.1|  PREDICTED: transcription factor TGA2-like          278   1e-82    
ref|XP_008801024.1|  PREDICTED: transcription factor TGA4-like is...    274   1e-82    
ref|XP_004291604.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    280   1e-82    
ref|NP_001030998.1|  bZIP transcription factor family protein           275   1e-82    
ref|XP_009343743.1|  PREDICTED: transcription factor TGA2-like          280   1e-82    
ref|XP_004493401.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    278   2e-82    
gb|AHN63210.1|  transcription factor TGA2                               278   2e-82    
ref|XP_009372782.1|  PREDICTED: transcription factor TGA2-like          273   2e-82    
ref|NP_001105448.1|  octopine synthase binding factor3                  278   2e-82    
ref|XP_008801022.1|  PREDICTED: transcription factor TGA1-like is...    274   2e-82    
ref|XP_010458068.1|  PREDICTED: transcription factor TGA2-like          278   2e-82    
ref|XP_008801023.1|  PREDICTED: transcription factor HBP-1b(c38)-...    274   2e-82    
ref|XP_006592766.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    277   2e-82    
ref|XP_009772593.1|  PREDICTED: transcription factor TGA2-like is...    279   2e-82    
gb|KHN32878.1|  TGACG-sequence-specific DNA-binding protein TGA-2.1     278   2e-82    
ref|XP_008788459.1|  PREDICTED: transcription factor TGA2-like          274   2e-82    
gb|ACN31945.1|  unknown                                                 277   2e-82    
ref|XP_011000427.1|  PREDICTED: transcription factor HBP-1b(c38)-...    273   2e-82    
ref|NP_001105735.1|  LOC542756                                          273   2e-82    
gb|KDP33129.1|  hypothetical protein JCGZ_13576                         278   3e-82    
gb|EMS58753.1|  Transcription factor HBP-1b(c1)                         277   3e-82    
ref|XP_009146627.1|  PREDICTED: transcription factor TGA6 isoform X1    273   3e-82    
ref|XP_009148091.1|  PREDICTED: transcription factor TGA2 isoform X2    277   3e-82    
ref|XP_008801019.1|  PREDICTED: transcription factor HBP-1b(c38)-...    274   3e-82    
ref|XP_009772596.1|  PREDICTED: transcription factor TGA2-like is...    278   3e-82    
ref|XP_007015831.1|  BZIP transcription factor family protein iso...    274   3e-82    
ref|XP_009613715.1|  PREDICTED: transcription factor TGA2-like is...    277   4e-82    
ref|XP_008801021.1|  PREDICTED: transcription factor TGA4-like is...    274   4e-82    
ref|XP_006594935.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    278   4e-82    
gb|AES81212.2|  leucine zipper transcription factor                     275   4e-82    
ref|XP_009623543.1|  PREDICTED: transcription factor TGA2-like is...    278   4e-82    
ref|XP_011075425.1|  PREDICTED: transcription factor HBP-1b(c38)-...    277   4e-82    
gb|AFK49203.1|  unknown                                                 276   4e-82    
ref|XP_010498795.1|  PREDICTED: transcription factor TGA6-like is...    271   4e-82    
ref|XP_009146628.1|  PREDICTED: transcription factor TGA6 isoform X2    271   4e-82    
ref|XP_006594931.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    277   4e-82    
ref|XP_010498764.1|  PREDICTED: transcription factor TGA6-like is...    272   4e-82    
ref|XP_006407351.1|  hypothetical protein EUTSA_v10021187mg             271   5e-82    
ref|XP_006407352.1|  hypothetical protein EUTSA_v10021187mg             271   5e-82    
ref|XP_009148090.1|  PREDICTED: transcription factor TGA2 isoform X1    277   5e-82    
ref|XP_004146772.1|  PREDICTED: transcription factor HBP-1b(c1)-like    272   5e-82    
ref|XP_003624993.1|  TGA transcription factor                           276   5e-82    
gb|ABN09201.1|  TGA transcription factor 2                              272   5e-82    
gb|AHF20184.1|  bzip transcription factor                               276   5e-82    
ref|XP_008801018.1|  PREDICTED: transcription factor TGA4-like is...    274   5e-82    
ref|XP_006399172.1|  hypothetical protein EUTSA_v10014082mg             272   5e-82    
ref|XP_006594934.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    277   6e-82    
gb|ACF80806.1|  unknown                                                 274   6e-82    
ref|XP_006592765.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    277   6e-82    
ref|XP_009623541.1|  PREDICTED: transcription factor TGA2-like is...    278   6e-82    
ref|XP_009389638.1|  PREDICTED: transcription factor TGA2-like is...    276   6e-82    
gb|AGD98703.1|  bZIP transcription factor family protein 5              271   6e-82    
ref|XP_003539469.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    277   6e-82    
ref|XP_010464986.1|  PREDICTED: transcription factor TGA6 isoform X4    271   7e-82    
ref|XP_010932613.1|  PREDICTED: transcription factor TGA2-like          275   7e-82    
ref|XP_010488718.1|  PREDICTED: transcription factor TGA2-like          277   7e-82    
ref|NP_001141940.1|  putative bZIP transcription factor superfami...    272   7e-82    
gb|ABR46137.1|  bZIP transcription factor TGA2                          271   7e-82    
ref|XP_009613713.1|  PREDICTED: transcription factor TGA2-like is...    277   7e-82    
gb|EEC70410.1|  hypothetical protein OsI_01405                          273   7e-82    
emb|CDX93571.1|  BnaA06g04770D                                          276   8e-82    
gb|EEE54337.1|  hypothetical protein OsJ_01313                          273   8e-82    
ref|XP_009623542.1|  PREDICTED: transcription factor TGA2-like is...    277   8e-82    
ref|XP_010534337.1|  PREDICTED: transcription factor TGA6-like is...    271   9e-82    
ref|NP_001078141.1|  transcription factor TGA6                          270   9e-82    
ref|NP_196313.1|  OCS-element binding factor 5                          271   1e-81    
dbj|BAO45899.1|  basic leucine zipper protein                           275   1e-81    
ref|XP_010464983.1|  PREDICTED: transcription factor TGA6 isoform X2    271   1e-81    
ref|NP_566415.3|  transcription factor TGA6                             271   1e-81    
ref|XP_008458585.1|  PREDICTED: transcription factor TGA6-like is...    276   1e-81    
dbj|BAB03134.1|  leucine zipper transcription factor HBP-1b             271   1e-81    
ref|XP_009613714.1|  PREDICTED: transcription factor TGA2-like is...    277   1e-81    
ref|XP_008458583.1|  PREDICTED: transcription factor TGA6-like is...    276   1e-81    
sp|Q41558.2|HBP1C_WHEAT  RecName: Full=Transcription factor HBP-1...    276   1e-81    
ref|XP_006484430.1|  PREDICTED: transcription factor PERIANTHIA-like    270   1e-81    
emb|CDM84630.1|  unnamed protein product                                276   1e-81    
ref|XP_006368634.1|  hypothetical protein POPTR_0001s06700g             275   1e-81    
gb|EYU26706.1|  hypothetical protein MIMGU_mgv1a007923mg                273   1e-81    
emb|CDY06309.1|  BnaA09g48940D                                          276   1e-81    
ref|XP_010475624.1|  PREDICTED: transcription factor TGA2-like          276   1e-81    
ref|XP_008461530.1|  PREDICTED: transcription factor HBP-1b(c38)-...    276   1e-81    
emb|CDY00762.1|  BnaC03g37460D                                          271   1e-81    
ref|XP_010228695.1|  PREDICTED: transcription factor TGA2-like is...    270   1e-81    
ref|XP_003596814.1|  BZIP transcription factor                          276   1e-81    
ref|XP_009118380.1|  PREDICTED: transcription factor TGA2-like is...    276   1e-81    
ref|XP_009361886.1|  PREDICTED: transcription factor TGA2-like          271   1e-81    
ref|XP_009118381.1|  PREDICTED: transcription factor TGA2-like is...    276   1e-81    
ref|XP_008375358.1|  PREDICTED: transcription factor TGA2-like          271   2e-81    
ref|XP_010423270.1|  PREDICTED: transcription factor TGA2               271   2e-81    
ref|NP_196312.1|  transcription factor TGA2                             271   2e-81    
ref|XP_008446977.1|  PREDICTED: transcription factor TGA2-like is...    270   2e-81    
ref|XP_004228505.1|  PREDICTED: transcription factor HBP-1b(c38)-...    271   2e-81    
ref|XP_010228694.1|  PREDICTED: transcription factor TGA2-like is...    270   2e-81    
ref|XP_003558037.1|  PREDICTED: transcription factor TGA2-like is...    271   2e-81    
ref|XP_003562427.1|  PREDICTED: transcription factor HBP-1b(c38)        271   2e-81    
ref|XP_010498804.1|  PREDICTED: transcription factor TGA6-like is...    271   2e-81    
ref|XP_010912288.1|  PREDICTED: transcription factor TGA2-like is...    275   2e-81    
tpg|DAA57189.1|  TPA: LOW QUALITY PROTEIN: putative bZIP transcri...    270   2e-81    
gb|ABR46126.1|  bZIP transcription factor TGA2                          270   2e-81    
ref|XP_002871242.1|  bZIP transcription factor TGA2                     270   2e-81    
gb|KEH38981.1|  BZIP family transcription factor                        276   2e-81    
gb|EMT32868.1|  putative Transcription factor HBP-1b(c1)                275   2e-81    
ref|NP_563810.2|  bZIP transcription factor family protein              275   2e-81    
dbj|BAB72061.1|  bZIP transcription factor                              270   2e-81    
gb|KHG28384.1|  Transcription factor HBP-1b                             270   2e-81    
ref|NP_974293.1|  transcription factor TGA6                             270   2e-81    
ref|XP_011079069.1|  PREDICTED: transcription factor HBP-1b(c38)-...    275   2e-81    
ref|XP_004951577.1|  PREDICTED: transcription factor TGA2-like is...    275   3e-81    
ref|XP_010464987.1|  PREDICTED: transcription factor TGA6 isoform X5    271   3e-81    
ref|XP_010486922.1|  PREDICTED: transcription factor TGA6 isoform X3    271   3e-81    
gb|KDO70045.1|  hypothetical protein CISIN_1g018357mg                   271   3e-81    
ref|XP_006299748.1|  hypothetical protein CARUB_v10015943mg             268   3e-81    
dbj|BAJ94197.1|  predicted protein                                      274   4e-81    
ref|XP_011000426.1|  PREDICTED: transcription factor HBP-1b(c38)-...    274   4e-81    
gb|ACF79461.1|  unknown                                                 274   4e-81    
gb|EPS70828.1|  hypothetical protein M569_03931                         274   4e-81    
emb|CDY22689.1|  BnaC08g43230D                                          273   5e-81    
ref|XP_009135220.1|  PREDICTED: transcription factor TGA6-like          270   5e-81    
dbj|BAD44579.1|  bZip transcription factor TGA6 / AtbZip45              269   5e-81    
ref|XP_010031514.1|  PREDICTED: transcription factor HBP-1b(c38) ...    274   5e-81    
ref|XP_010907103.1|  PREDICTED: transcription factor TGA2-like is...    274   5e-81    
ref|XP_010905948.1|  PREDICTED: transcription factor TGA4-like is...    271   5e-81    
emb|CDM83014.1|  unnamed protein product                                269   6e-81    
ref|XP_001779456.1|  predicted protein                                  268   6e-81    
ref|XP_006432426.1|  hypothetical protein CICLE_v100010812mg            270   6e-81    
ref|XP_006303631.1|  hypothetical protein CARUB_v10011576mg             274   7e-81    
ref|XP_007015829.1|  BZIP transcription factor family protein iso...    275   7e-81    
ref|XP_002311449.2|  PERIANTHIA family protein                          273   7e-81    
gb|EPS74256.1|  hypothetical protein M569_00501                         268   7e-81    
emb|CAA49525.1|  ocs-element binding factor 5                           269   8e-81    
ref|NP_001030678.1|  transcription factor TGA6                          270   8e-81    
ref|XP_010905949.1|  PREDICTED: transcription factor TGA4-like is...    270   9e-81    
ref|XP_002871243.1|  ocs-element binding factor 5                       269   9e-81    
ref|XP_006662738.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    273   9e-81    
ref|XP_004984573.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    269   9e-81    
dbj|BAJ90602.1|  predicted protein                                      269   9e-81    
ref|XP_008243192.1|  PREDICTED: transcription factor HBP-1b(c38)        273   1e-80    
ref|NP_001065772.1|  Os11g0152700                                       273   1e-80    
ref|XP_004139481.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    273   1e-80    
ref|XP_009414219.1|  PREDICTED: transcription factor HBP-1b(c38)-...    271   1e-80    
gb|KGN59439.1|  hypothetical protein Csa_3G819960                       273   1e-80    
ref|XP_004136637.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    273   1e-80    
ref|XP_009420514.1|  PREDICTED: transcription factor TGA2-like          273   2e-80    
ref|XP_004956461.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    270   2e-80    
dbj|BAE99654.1|  bZip protein AtbZip21                                  273   2e-80    
gb|ADK74339.1|  bZIP transcription factor                               272   2e-80    
ref|XP_002450285.1|  hypothetical protein SORBIDRAFT_05g003240          273   2e-80    
ref|XP_010423272.1|  PREDICTED: transcription factor TGA5-like is...    268   2e-80    
ref|XP_004956460.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    270   2e-80    
dbj|BAJ95134.1|  predicted protein                                      268   2e-80    
ref|XP_009389639.1|  PREDICTED: transcription factor TGA2-like is...    272   2e-80    
ref|XP_010423276.1|  PREDICTED: transcription factor TGA5-like is...    267   2e-80    
ref|XP_010230791.1|  PREDICTED: transcription factor HBP-1b(c38)        268   2e-80    
ref|XP_010534328.1|  PREDICTED: transcription factor TGA6-like is...    268   2e-80    
ref|XP_002323247.1|  DNA-binding protein VBP1                           272   2e-80    
ref|XP_009414215.1|  PREDICTED: transcription factor HBP-1b(c38)-...    272   2e-80    
ref|XP_010491292.1|  PREDICTED: transcription factor TGA5               268   2e-80    
ref|XP_004249310.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    271   3e-80    
ref|XP_006362551.1|  PREDICTED: transcription factor PERIANTHIA-like    270   3e-80    
ref|XP_009401076.1|  PREDICTED: transcription factor TGA1-like is...    268   3e-80    
ref|XP_001770560.1|  predicted protein                                  268   3e-80    
ref|XP_009120759.1|  PREDICTED: transcription factor TGA6-like is...    267   4e-80    
ref|XP_006351371.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    271   4e-80    
ref|NP_001060695.1|  Os07g0687700                                       267   4e-80    
ref|XP_009120767.1|  PREDICTED: transcription factor TGA6-like is...    266   4e-80    
gb|KDP29258.1|  hypothetical protein JCGZ_16647                         271   4e-80    
ref|XP_002892453.1|  T27G7.2                                            275   4e-80    
ref|XP_006658160.1|  PREDICTED: transcription factor HBP-1b(c38)-...    267   4e-80    
sp|P23923.1|HBP1B_WHEAT  RecName: Full=Transcription factor HBP-1...    267   4e-80    
emb|CDY52616.1|  BnaCnng22950D                                          267   5e-80    
ref|XP_006432427.1|  hypothetical protein CICLE_v100010812mg            271   5e-80    
dbj|BAK06846.1|  predicted protein                                      273   5e-80    
gb|AAF22906.1|AC006932_23  T27G7.2                                      275   5e-80    



>ref|XP_007162296.1| hypothetical protein PHAVU_001G140100g [Phaseolus vulgaris]
 gb|ESW34290.1| hypothetical protein PHAVU_001G140100g [Phaseolus vulgaris]
Length=482

 Score =   385 bits (988),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 212/417 (51%), Positives = 271/417 (65%), Gaps = 42/417 (10%)
 Frame = -2

Query  1326  NSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMFPSEPMHV------  1165
             +S AYD+GELDQAF  +L+ Q             ++GMR P TLN+FPS+PMHV      
Sbjct  67    DSGAYDLGELDQAFFLYLDGQADPSTVQDQRQNSSSGMR-PPTLNIFPSKPMHVEPSSSK  125

Query  1164  --------------------------NP------SPTALegsgsgsesrrsstssgggrg  1081
                                       NP      +P   +     S  +  ++SS     
Sbjct  126   SKANIELVSPQTSGSKRPSEPSMELANPRNEGASAPQPPKAVKRESNRKGPTSSSEQEGP  185

Query  1080  gTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEng  901
              T + KTLRRLAQNREAARK R+RKKAYVQQLE+SR++L QLEQ +  A+ +G      G
Sbjct  186   KTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESSRVRLNQLEQDLQRARTQGM-FLGGG  244

Query  900   nvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVD  721
              ++G     P+++  I+ E A FDVEYARW+EE HRI CELR AV E  L ENEL+ +VD
Sbjct  245   ALLGGEQSLPVAMNTISSEAAMFDVEYARWVEEHHRIVCELRAAVQE-HLPENELRLFVD  303

Query  720   ACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VT  544
              C AHY Q+ +L +++AK+DV HLVSGM  TP ERCF+WIGGFRPS L+K+I+SQ+E +T
Sbjct  304   NCLAHYDQVMNLKSLVAKTDVFHLVSGMWKTPAERCFMWIGGFRPSELIKIILSQIEPLT  363

Query  543   EQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITN  364
             EQQ LG+ GL+QST EAEEALSQG+E L+ ++SD I+SD+L YP N+ + M QMA A+  
Sbjct  364   EQQILGICGLQQSTHEAEEALSQGLEALNQSLSDTIASDSLSYPPNMANYMGQMAVAMNK  423

Query  363   LYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
             L TL  FVRQADNLR QTI RL+ +LT  Q ARCFL + ++FHRLR LS+LWL RPR
Sbjct  424   LSTLEGFVRQADNLRHQTIHRLHQLLTTRQAARCFLAIAEYFHRLRALSSLWLARPR  480



>ref|XP_007162295.1| hypothetical protein PHAVU_001G140100g [Phaseolus vulgaris]
 gb|ESW34289.1| hypothetical protein PHAVU_001G140100g [Phaseolus vulgaris]
Length=483

 Score =   384 bits (987),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 212/417 (51%), Positives = 271/417 (65%), Gaps = 42/417 (10%)
 Frame = -2

Query  1326  NSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMFPSEPMHV------  1165
             +S AYD+GELDQAF  +L+ Q             ++GMR P TLN+FPS+PMHV      
Sbjct  68    DSGAYDLGELDQAFFLYLDGQADPSTVQDQRQNSSSGMR-PPTLNIFPSKPMHVEPSSSK  126

Query  1164  --------------------------NP------SPTALegsgsgsesrrsstssgggrg  1081
                                       NP      +P   +     S  +  ++SS     
Sbjct  127   SKANIELVSPQTSGSKRPSEPSMELANPRNEGASAPQPPKAVKRESNRKGPTSSSEQEGP  186

Query  1080  gTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEng  901
              T + KTLRRLAQNREAARK R+RKKAYVQQLE+SR++L QLEQ +  A+ +G      G
Sbjct  187   KTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESSRVRLNQLEQDLQRARTQGM-FLGGG  245

Query  900   nvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVD  721
              ++G     P+++  I+ E A FDVEYARW+EE HRI CELR AV E  L ENEL+ +VD
Sbjct  246   ALLGGEQSLPVAMNTISSEAAMFDVEYARWVEEHHRIVCELRAAVQE-HLPENELRLFVD  304

Query  720   ACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VT  544
              C AHY Q+ +L +++AK+DV HLVSGM  TP ERCF+WIGGFRPS L+K+I+SQ+E +T
Sbjct  305   NCLAHYDQVMNLKSLVAKTDVFHLVSGMWKTPAERCFMWIGGFRPSELIKIILSQIEPLT  364

Query  543   EQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITN  364
             EQQ LG+ GL+QST EAEEALSQG+E L+ ++SD I+SD+L YP N+ + M QMA A+  
Sbjct  365   EQQILGICGLQQSTHEAEEALSQGLEALNQSLSDTIASDSLSYPPNMANYMGQMAVAMNK  424

Query  363   LYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
             L TL  FVRQADNLR QTI RL+ +LT  Q ARCFL + ++FHRLR LS+LWL RPR
Sbjct  425   LSTLEGFVRQADNLRHQTIHRLHQLLTTRQAARCFLAIAEYFHRLRALSSLWLARPR  481



>gb|AES81437.2| BZIP family transcription factor [Medicago truncatula]
Length=464

 Score =   383 bits (983),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 209/428 (49%), Positives = 275/428 (64%), Gaps = 29/428 (7%)
 Frame = -2

Query  1398  NQTCFGTVQAAPSSSSFPALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNN  1219
             NQ  FG +Q++ S S      NKD S AYD+GELDQA   +LN Q              +
Sbjct  42    NQISFGMMQSSSSPSVLGNYINKD-SGAYDLGELDQALFLYLNGQTDPSSVQDQKQNSTS  100

Query  1218  GMRLPNTLNMFPSEPMHVNPS-----------------------PTALegsgsgsesrrs  1108
             GMR P TLN+FPS+PMHV PS                       P         +  +  
Sbjct  101   GMR-PPTLNIFPSQPMHVEPSSSNSKASMDLVSPQTSGSKKGSEPPKAVKPREKNHGKGP  159

Query  1107  stssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQA  928
             ++SS      T + K LRRLAQNREAARK R+RKKAY+QQLE+SR+KL Q+EQ++  A+ 
Sbjct  160   TSSSEHEGPKTPDPKILRRLAQNREAARKSRLRKKAYIQQLESSRIKLNQMEQELHHARN  219

Query  927   RGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLS  748
             +G        + G       S+  I+ E A FDVEYARW+EE HR+ CELR AV E  + 
Sbjct  220   QGMFFGGGAMLGGEQGLP--SMNTISSEAAMFDVEYARWLEEHHRLVCELRAAVHE-HIP  276

Query  747   ENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKV  568
             ENEL+ +VD   A Y Q+  L +++AK+D+ HLVSGM  TP+ERCF+WIGGF+PS L+K+
Sbjct  277   ENELRMFVDKFLAQYDQVAQLKSLVAKADIFHLVSGMWVTPIERCFMWIGGFKPSELIKI  336

Query  567   IMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCM  391
             I+SQ+E +TEQQ +G+ GL+QSTQ+ E+ALSQG+E L+ T+S+ I+SD+L YP N+ + M
Sbjct  337   IVSQIEPLTEQQIMGIYGLQQSTQQGEDALSQGLEALNQTLSETITSDSLSYPPNMTNYM  396

Query  390   TQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSAL  211
              QMA A+  L TL +FVR+ADNLR QTI RL  ILT  Q ARCFL + ++FHR+R LS+L
Sbjct  397   DQMARAMNKLSTLESFVREADNLRHQTIHRLNQILTTRQAARCFLAMAEYFHRMRALSSL  456

Query  210   WLGRPRQD  187
             WL RPRQ+
Sbjct  457   WLARPRQE  464



>ref|XP_003625219.1| Transcription factor, putative [Medicago truncatula]
Length=465

 Score =   382 bits (982),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 211/431 (49%), Positives = 276/431 (64%), Gaps = 34/431 (8%)
 Frame = -2

Query  1398  NQTCFGTVQAAPSSSSFPALGN---KDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdq  1228
             NQ  FG +Q   SSSS   LGN     +S AYD+GELDQA   +LN Q            
Sbjct  42    NQISFGMMQ---SSSSPSVLGNYIRNKDSGAYDLGELDQALFLYLNGQTDPSSVQDQKQN  98

Query  1227  QNNGMRLPNTLNMFPSEPMHVNPS-----------------------PTALegsgsgses  1117
               +GMR P TLN+FPS+PMHV PS                       P         +  
Sbjct  99    STSGMR-PPTLNIFPSQPMHVEPSSSNSKASMDLVSPQTSGSKKGSEPPKAVKPREKNHG  157

Query  1116  rrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVAL  937
             +  ++SS      T + K LRRLAQNREAARK R+RKKAY+QQLE+SR+KL Q+EQ++  
Sbjct  158   KGPTSSSEHEGPKTPDPKILRRLAQNREAARKSRLRKKAYIQQLESSRIKLNQMEQELHH  217

Query  936   AQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDEL  757
             A+ +G        + G       S+  I+ E A FDVEYARW+EE HR+ CELR AV E 
Sbjct  218   ARNQGMFFGGGAMLGGEQGLP--SMNTISSEAAMFDVEYARWLEEHHRLVCELRAAVHE-  274

Query  756   MLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLL  577
              + ENEL+ +VD   A Y Q+  L +++AK+D+ HLVSGM  TP+ERCF+WIGGF+PS L
Sbjct  275   HIPENELRMFVDKFLAQYDQVAQLKSLVAKADIFHLVSGMWVTPIERCFMWIGGFKPSEL  334

Query  576   LKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLP  400
             +K+I+SQ+E +TEQQ +G+ GL+QSTQ+ E+ALSQG+E L+ T+S+ I+SD+L YP N+ 
Sbjct  335   IKIIVSQIEPLTEQQIMGIYGLQQSTQQGEDALSQGLEALNQTLSETITSDSLSYPPNMT  394

Query  399   SCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTL  220
             + M QMA A+  L TL +FVR+ADNLR QTI RL  ILT  Q ARCFL + ++FHR+R L
Sbjct  395   NYMDQMARAMNKLSTLESFVREADNLRHQTIHRLNQILTTRQAARCFLAMAEYFHRMRAL  454

Query  219   SALWLGRPRQD  187
             S+LWL RPRQ+
Sbjct  455   SSLWLARPRQE  465



>ref|XP_009798380.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nicotiana sylvestris]
Length=501

 Score =   383 bits (983),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 215/442 (49%), Positives = 283/442 (64%), Gaps = 43/442 (10%)
 Frame = -2

Query  1401  NNQTCFGTVQAAPSSSSFPA-LGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQ  1225
             +NQ  FG  Q   SSSS P    NKDNS AYD+GELDQA   +L+ Q         H   
Sbjct  66    SNQISFGLFQQHSSSSSNPGNFINKDNSGAYDLGELDQALFLYLDGQEPSSIQDQRH---  122

Query  1224  NNGMRLPNTLNMFPSEPMHVN--------------------------------PSPTAL-  1144
             N+G+R P TLN+FPS+PMH+                                 PS + L 
Sbjct  123   NSGVRPP-TLNIFPSQPMHIEPSSTKANNGLVSQATSGSNKSSQPSMAKTDIVPSASGLE  181

Query  1143  --egsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRM  970
               + +      +  ++SS      T + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+
Sbjct  182   PPKTAKREGIRKGPTSSSEQDAPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESSRI  241

Query  969   KLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRI  790
             +L QLEQ++  A+++G  +     +        +++  I+ + A FD+EYARW+EE HR+
Sbjct  242   RLAQLEQEIQRARSQGFYVG-GNALQAGEQALAVNMANISSDAAIFDLEYARWLEEHHRL  300

Query  789   TCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCF  610
              CELR AV E  L ENEL+ YV+ C  HY ++ +L  MLAKSDV HLVSG+  TP ERCF
Sbjct  301   MCELRNAVQE-HLQENELRIYVENCITHYDEIMNLKCMLAKSDVFHLVSGLWKTPAERCF  359

Query  609   IWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIIS  433
             +W+G FRPS LLK+I+SQ+E +TE Q +G+ GL+QSTQEAE+ALSQG+E+L+ ++SD I+
Sbjct  360   LWMGDFRPSELLKIILSQIEPLTENQLMGICGLQQSTQEAEDALSQGLESLNQSLSDTIA  419

Query  432   SDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLI  253
             SDAL  P N+ + M QMA A+  L T+  F+RQADNLR QTI RL+ ILT  Q ARCFL 
Sbjct  420   SDALACPQNMANYMGQMALAMNKLSTVEGFLRQADNLRHQTIHRLHQILTTRQAARCFLA  479

Query  252   VTDFFHRLRTLSALWLGRPRQD  187
             + ++FHRLR LS+LWL RPRQ+
Sbjct  480   IGEYFHRLRALSSLWLARPRQE  501



>ref|XP_003554196.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Glycine 
max]
 gb|KHN26367.1| Transcription factor HBP-1b(c1) [Glycine soja]
Length=490

 Score =   382 bits (980),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 219/440 (50%), Positives = 281/440 (64%), Gaps = 42/440 (10%)
 Frame = -2

Query  1389  CFGTVQAAPSSSSFPALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMR  1210
              FG +Q++ S SS P      +S AYD+GELDQAF  +L+ Q             ++GMR
Sbjct  54    SFGMMQSSSSFSSIPGNYLSKDSGAYDLGELDQAFFLYLDGQADPSSVQDQRQNSSSGMR  113

Query  1209  LPNTLNMFPSEPMHV--------------------------------NP------SPTAL  1144
              P TLN+FPS+PMHV                                NP      +P   
Sbjct  114   -PPTLNIFPSKPMHVEPSSSKAKANIELVSPQTSGSKRPSEPSMELANPRNETASAPQPP  172

Query  1143  egsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKL  964
             +     S  +  ++SS      T + KTLRRLAQNREAARK R+RKKAYVQQLE+SR++L
Sbjct  173   KPVKRESNRKGPTSSSEHEGPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESSRIRL  232

Query  963   IQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITC  784
              QLEQ++  A+ +       G ++G   G P+++  I+ E A FDVEYARW EE HRI C
Sbjct  233   NQLEQELQRARTQ-GMFLGGGALLGGEQGLPVTMNTISTEAAMFDVEYARWQEEHHRIVC  291

Query  783   ELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIW  604
             ELR AV E  L ENEL+ +VD C AHY Q+ +L +++AK+DV HLVSG   TP ERCF+W
Sbjct  292   ELRAAVQE-HLPENELRLFVDNCLAHYDQVMNLKSLVAKTDVFHLVSGTWKTPAERCFMW  350

Query  603   IGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSD  427
             IGGFRPS L+K+I+ Q+E +TEQQ LG+ GL+QSTQEAEEALSQG+E L+ ++SD I+SD
Sbjct  351   IGGFRPSELIKIIVRQIEPLTEQQILGICGLQQSTQEAEEALSQGLEALNQSLSDTITSD  410

Query  426   ALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVT  247
             +L YP N+ + M QMA A+  L TL  FVRQADN R QTI RL+ ILT  Q ARCFL + 
Sbjct  411   SLSYPPNMANYMGQMAVAMNKLSTLEGFVRQADNQRHQTIHRLHQILTTRQAARCFLAIA  470

Query  246   DFFHRLRTLSALWLGRPRQD  187
             ++FHRLR LS+LWL RPRQ+
Sbjct  471   EYFHRLRALSSLWLARPRQE  490



>ref|XP_006604382.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X2 [Glycine 
max]
Length=491

 Score =   381 bits (979),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 222/442 (50%), Positives = 284/442 (64%), Gaps = 45/442 (10%)
 Frame = -2

Query  1389  CFGTVQAAPSSSSFPA--LGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNG  1216
              FG +Q++ S SS P   L +KD S AYD+GELDQAF  +L+ Q             ++G
Sbjct  54    SFGMMQSSSSFSSIPGNYLRSKD-SGAYDLGELDQAFFLYLDGQADPSSVQDQRQNSSSG  112

Query  1215  MRLPNTLNMFPSEPMHV--------------------------------NP------SPT  1150
             MR P TLN+FPS+PMHV                                NP      +P 
Sbjct  113   MR-PPTLNIFPSKPMHVEPSSSKAKANIELVSPQTSGSKRPSEPSMELANPRNETASAPQ  171

Query  1149  ALegsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRM  970
               +     S  +  ++SS      T + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+
Sbjct  172   PPKPVKRESNRKGPTSSSEHEGPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESSRI  231

Query  969   KLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRI  790
             +L QLEQ++  A+ +       G ++G   G P+++  I+ E A FDVEYARW EE HRI
Sbjct  232   RLNQLEQELQRARTQ-GMFLGGGALLGGEQGLPVTMNTISTEAAMFDVEYARWQEEHHRI  290

Query  789   TCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCF  610
              CELR AV E  L ENEL+ +VD C AHY Q+ +L +++AK+DV HLVSG   TP ERCF
Sbjct  291   VCELRAAVQE-HLPENELRLFVDNCLAHYDQVMNLKSLVAKTDVFHLVSGTWKTPAERCF  349

Query  609   IWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIIS  433
             +WIGGFRPS L+K+I+ Q+E +TEQQ LG+ GL+QSTQEAEEALSQG+E L+ ++SD I+
Sbjct  350   MWIGGFRPSELIKIIVRQIEPLTEQQILGICGLQQSTQEAEEALSQGLEALNQSLSDTIT  409

Query  432   SDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLI  253
             SD+L YP N+ + M QMA A+  L TL  FVRQADN R QTI RL+ ILT  Q ARCFL 
Sbjct  410   SDSLSYPPNMANYMGQMAVAMNKLSTLEGFVRQADNQRHQTIHRLHQILTTRQAARCFLA  469

Query  252   VTDFFHRLRTLSALWLGRPRQD  187
             + ++FHRLR LS+LWL RPRQ+
Sbjct  470   IAEYFHRLRALSSLWLARPRQE  491



>emb|CDP10109.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   379 bits (973),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 214/433 (49%), Positives = 274/433 (63%), Gaps = 46/433 (11%)
 Frame = -2

Query  1362  SSSSFPALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMFP  1183
             SSS+ P      ++ AYD+GELDQA   +L+ Q             N+GMR P TLN+FP
Sbjct  5     SSSAIPGNFISKDTGAYDLGELDQALFLYLDGQEPSAIQEQRQ---NSGMR-PPTLNIFP  60

Query  1182  SEPMHV--------------------------------NP------SPTALegsgsgses  1117
             S+PMHV                                NP      +P   +        
Sbjct  61    SQPMHVDPSSAKASTGLVSNSPSSSGSKRSSEPSMELSNPRNDVASAPEPAKAVKREGNR  120

Query  1116  rrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVAL  937
             R  ++SS      T + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  
Sbjct  121   RGPTSSSEQEGPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLTQLEQEIQR  180

Query  936   AQARGARITEngnvvgvghgHPLSLTKITP--EGAAFDVEYARWIEEEHRITCELRKAVD  763
             A+++G        ++G     P  +  I+   +   FD+EY+RW+EE HR+ CELR AV 
Sbjct  181   ARSQGIYFGGAAALLGGDQSMPAPMGNISSVADATVFDMEYSRWLEEHHRLMCELRNAVQ  240

Query  762   ELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPS  583
             E  L ENEL+ +VD C AHY ++ +L +M+AKSDV HLVSGM  TP ERCF+W+GGFRPS
Sbjct  241   E-HLPENELRLFVDNCLAHYDEVMNLKSMIAKSDVFHLVSGMWKTPAERCFMWMGGFRPS  299

Query  582   LLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSN  406
              L+K+IMSQ+E +TEQQ L + GL+QSTQEAEEALSQG+E L+ ++SD I+SDAL  PSN
Sbjct  300   ELIKIIMSQIEPLTEQQLLAICGLQQSTQEAEEALSQGLEALNQSLSDTIASDALSCPSN  359

Query  405   LPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLR  226
             + + M QMA A+  L TL  FVRQADNLR QTI RL+ ILT  Q ARCFL + ++FHRLR
Sbjct  360   MANYMGQMALAMNKLSTLEGFVRQADNLRHQTIHRLHQILTTRQAARCFLAIAEYFHRLR  419

Query  225   TLSALWLGRPRQD  187
              LS+LWL RPRQ+
Sbjct  420   ALSSLWLARPRQE  432



>ref|XP_003521195.1| PREDICTED: transcription factor HBP-1b(c1)-like [Glycine max]
Length=491

 Score =   380 bits (977),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 224/442 (51%), Positives = 285/442 (64%), Gaps = 45/442 (10%)
 Frame = -2

Query  1389  CFGTVQAAPSSSSFPA--LGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNG  1216
              FG +Q++ SSSS P   LG+KD S AYD+GELDQAF  +L+ Q             ++G
Sbjct  54    SFGLMQSSSSSSSIPGNYLGSKD-SGAYDLGELDQAFFLYLDGQADPSSVQDQRQNSSSG  112

Query  1215  MRLPNTLNMFP------------------------------SEPMH--VNP------SPT  1150
             MR P TLN+FP                              SEP     NP      +P 
Sbjct  113   MR-PPTLNIFPSKPMHVEPSSSKSKANIELVSPQTSGSKRPSEPSMELANPRNETASAPQ  171

Query  1149  ALegsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRM  970
               +        +  ++SS      T + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+
Sbjct  172   PPKPVKREGNRKGPTSSSEHEGPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESSRI  231

Query  969   KLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRI  790
             +L QLEQ++  A+ +       G ++G   G P+++  I+ E A FDVEYARW EE HRI
Sbjct  232   RLNQLEQELQRARTQ-GMFLGGGALLGGEQGLPVTMNTISTEAAMFDVEYARWQEENHRI  290

Query  789   TCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCF  610
              CELR AV E  L ENEL+ +VD C AHY Q+ +L +++AK+DV HLVSGM  TP ERCF
Sbjct  291   VCELRAAVQE-HLPENELRLFVDNCLAHYDQVMNLKSLVAKTDVFHLVSGMWKTPAERCF  349

Query  609   IWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIIS  433
             +WIGGFRPS L+K+I+SQ+E +TEQQ LG+ GL+QSTQEAEEALSQG+E L+ ++SD I+
Sbjct  350   MWIGGFRPSELIKIIVSQIEPLTEQQILGICGLQQSTQEAEEALSQGLEALNQSLSDTIT  409

Query  432   SDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLI  253
             SD+L YP N+ + M QMA A+  L TL  FVRQADNLR QTI RL+ ILT  Q ARCFL 
Sbjct  410   SDSLSYPPNMANYMGQMAVAMNKLSTLEGFVRQADNLRHQTIHRLHQILTTRQAARCFLA  469

Query  252   VTDFFHRLRTLSALWLGRPRQD  187
             + ++FHRLR LS+LWL RPRQ+
Sbjct  470   IAEYFHRLRALSSLWLARPRQE  491



>gb|KHN07408.1| Transcription factor HBP-1b(c1) [Glycine soja]
Length=434

 Score =   377 bits (969),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 216/424 (51%), Positives = 274/424 (65%), Gaps = 43/424 (10%)
 Frame = -2

Query  1341  LGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMFP-------  1183
             LG+KD S AYD+GELDQAF  +L+ Q             ++GMR P TLN+FP       
Sbjct  15    LGSKD-SGAYDLGELDQAFFLYLDGQADPSSVQDQRQNSSSGMR-PPTLNIFPSKPMHVE  72

Query  1182  -----------------------SEPMH--VNP------SPTALegsgsgsesrrsstss  1096
                                    SEP     NP      +P   +        +  ++SS
Sbjct  73    PSSSKSKANIELVSPQTSGSKRPSEPSMELANPRNETASAPQPPKPVKREGNRKGPTSSS  132

Query  1095  gggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGAR  916
                   T + KTLRRLAQNREAARK R+RKKAYVQQLE+SR++L QLEQ++  A+ +   
Sbjct  133   EHEGPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESSRIRLNQLEQELQRARTQ-GM  191

Query  915   ITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENEL  736
                 G ++G   G P+++  I+ E A FDVEYARW EE HRI CELR AV E  L ENEL
Sbjct  192   FLGGGALLGGEQGLPVTMNTISTEAAMFDVEYARWQEENHRIVCELRAAVQE-HLPENEL  250

Query  735   KRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQ  556
             + +VD C AHY Q+ +L +++AK+DV HLVSGM  TP ERCF+WIGGFRPS L+K+I+SQ
Sbjct  251   RLFVDNCLAHYDQVMNLKSLVAKTDVFHLVSGMWKTPAERCFMWIGGFRPSELIKIIVSQ  310

Query  555   LE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMA  379
             +E +TEQQ LG+ GL+QSTQEAEEALSQG+E L+ ++SD I+SD+L YP N+ + M QMA
Sbjct  311   IEPLTEQQILGICGLQQSTQEAEEALSQGLEALNQSLSDTITSDSLSYPPNMANYMGQMA  370

Query  378   AAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGR  199
              A+  L TL  FVRQADNLR QTI RL+ ILT  Q ARCFL + ++FHRLR LS+LWL R
Sbjct  371   VAMNKLSTLEGFVRQADNLRHQTIHRLHQILTTRQAARCFLAIAEYFHRLRALSSLWLAR  430

Query  198   PRQD  187
             PRQ+
Sbjct  431   PRQE  434



>gb|ABN08651.1| cAMP response element binding (CREB) protein [Medicago truncatula]
Length=476

 Score =   379 bits (972),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 211/442 (48%), Positives = 277/442 (63%), Gaps = 45/442 (10%)
 Frame = -2

Query  1398  NQTCFGTVQAAPSSSSFPALGN---KDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdq  1228
             NQ  FG +Q   SSSS   LGN     +S AYD+GELDQA   +LN Q            
Sbjct  42    NQISFGMMQ---SSSSPSVLGNYIRNKDSGAYDLGELDQALFLYLNGQTDPSSVQDQKQN  98

Query  1227  QNNGMRLPNTLNMFPSEPMHVNPSPTALegsgsgsesrrsstssgggrggTLNAKT----  1060
               +GMR P TLN+FPS+PMHV PS +  + S      + S +  G      + A+T    
Sbjct  99    STSGMR-PPTLNIFPSQPMHVEPSSSNSKASMDLVSPQTSGSKKGSEPPKAVKARTKIII  157

Query  1059  ------------------------------LRRLAQNREAARKCRIRKKAYVQQLETSRM  970
                                           LRRLAQNREAARK R+RKKAY+QQLE+SR+
Sbjct  158   LNQYPREKNHGKGPTSSSEHEGPKTPDPKILRRLAQNREAARKSRLRKKAYIQQLESSRI  217

Query  969   KLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRI  790
             KL Q+EQ++  A+ +G        + G       S+  I+ E A FDVEYARW+EE HR+
Sbjct  218   KLNQMEQELHHARNQGMFFGGGAMLGGEQGLP--SMNTISSEAAMFDVEYARWLEEHHRL  275

Query  789   TCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCF  610
              CELR AV E  + ENEL+ +VD   A Y Q+  L +++AK+D+ HLVSGM  TP+ERCF
Sbjct  276   VCELRAAVHE-HIPENELRMFVDKFLAQYDQVAQLKSLVAKADIFHLVSGMWVTPIERCF  334

Query  609   IWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIIS  433
             +WIGGF+PS L+K+I+SQ+E +TEQQ +G+ GL+QSTQ+ E+ALSQG+E L+ T+S+ I+
Sbjct  335   MWIGGFKPSELIKIIVSQIEPLTEQQIMGIYGLQQSTQQGEDALSQGLEALNQTLSETIT  394

Query  432   SDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLI  253
             SD+L YP N+ + M QMA A+  L TL +FVR+ADNLR QTI RL  ILT  Q ARCFL 
Sbjct  395   SDSLSYPPNMTNYMDQMARAMNKLSTLESFVREADNLRHQTIHRLNQILTTRQAARCFLA  454

Query  252   VTDFFHRLRTLSALWLGRPRQD  187
             + ++FHR+R LS+LWL RPRQ+
Sbjct  455   MAEYFHRMRALSSLWLARPRQE  476



>ref|XP_010312148.1| PREDICTED: transcription factor HBP-1b(c38)-like [Solanum lycopersicum]
Length=459

 Score =   377 bits (969),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 212/434 (49%), Positives = 273/434 (63%), Gaps = 34/434 (8%)
 Frame = -2

Query  1401  NNQTCFGTVQAAPSSSSFPALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQN  1222
             N+Q  FG   A P +     +  ++N  AYD+GELDQA   +L+ Q         H Q N
Sbjct  31    NHQISFGLSSANPGN----FINKENNGGAYDLGELDQALFLYLDGQDPSSSSIQDHRQNN  86

Query  1221  NGMRLPNTLNMFPSEPMHVNPSPTALegsgsgsesrrsstssgggrg-------------  1081
              GMR P TLN+FPS+PMH+ PS T    +   S++   S  S                  
Sbjct  87    YGMRPP-TLNIFPSQPMHIEPSSTKANNNEQVSQATNGSKKSSQPSMDKSEPPKVTKGEG  145

Query  1080  --------------gTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQV  943
                            T + KTLRRLAQNREAARK RIRKKAYVQQLETSR++L QLE ++
Sbjct  146   SRKVSTSSPEQDAPKTSDPKTLRRLAQNREAARKSRIRKKAYVQQLETSRIRLTQLEHEI  205

Query  942   ALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVD  763
               A+++G  +  N  + G      ++ T I+ + A FD+EYARW+EE HR+ CELR AV 
Sbjct  206   QRARSQGFHVGGNVLLGGDQGFQLINRTNISSDAAVFDLEYARWLEEHHRLICELRNAVH  265

Query  762   ELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPS  583
             E  L E+EL+ YV+ C  HY  + +L  MLAKSDV HLVSG+  +P ERCF+WIG FRPS
Sbjct  266   EEQLQEDELRIYVENCVVHYDNIMNLKGMLAKSDVFHLVSGLWKSPAERCFLWIGDFRPS  325

Query  582   LLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISD-IISSDALFYPS  409
              +LK+IM Q+E +TE Q LGM GL++STQEAE+ALSQG+ETL+ ++SD II+SDAL   +
Sbjct  326   EILKIIMCQIEALTENQLLGMCGLQKSTQEAEDALSQGLETLNQSLSDTIIASDALILGN  385

Query  408   NLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRL  229
             N  +    MA AI  L T+  F+RQADNLR QTI RL+ ILT  Q ARCF+ + D+FHRL
Sbjct  386   NNENMGNYMALAINQLSTVEAFLRQADNLRHQTIHRLHQILTTRQAARCFIAIGDYFHRL  445

Query  228   RTLSALWLGRPRQD  187
             R LS+LWL RPR +
Sbjct  446   RALSSLWLTRPRHE  459



>ref|XP_009602906.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nicotiana tomentosiformis]
Length=502

 Score =   378 bits (971),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 217/442 (49%), Positives = 281/442 (64%), Gaps = 43/442 (10%)
 Frame = -2

Query  1401  NNQTCFGTVQAAPSSSSFPA-LGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQ  1225
             +NQ  FG +Q   SSSS P    NKDNS AYD+GELDQA   +L+ Q             
Sbjct  67    SNQISFGLLQQQSSSSSNPGNFINKDNSGAYDLGELDQALFLYLDGQEPSSIQDQRQ---  123

Query  1224  NNGMRLPNTLNMFPSEPMHVNPS-----------------------------------PT  1150
             N+GMR P TLN+FPS+PMH+ PS                                   P 
Sbjct  124   NSGMR-PPTLNIFPSQPMHIEPSSTKANNGLVSQSTSGSKKSSQPSMAKTDIIPSASGPE  182

Query  1149  ALegsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRM  970
               + +      +  ++SS      T + KTLRRLAQNREAARK R+RKKAYVQQLETSR+
Sbjct  183   PPKTAKREGIRKGPTSSSEQDAPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLETSRI  242

Query  969   KLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRI  790
             +L QLEQ++  A+++G        +     G  +++  I+ + A FD+EYARW+EE HR+
Sbjct  243   RLAQLEQEIQRARSQGF-YAGGSALQAGDQGLAVNMANISSDAAIFDLEYARWLEEHHRL  301

Query  789   TCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCF  610
              CELR AV E  L ENEL+ YV+ C  HY ++ +L  MLAKSDV HLVSG+  TP ERCF
Sbjct  302   MCELRNAVQE-HLQENELRIYVENCITHYDEIMNLKCMLAKSDVFHLVSGLWKTPAERCF  360

Query  609   IWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIIS  433
             +W+G FRPS LLK+I+SQ+E +TE Q +G+ GL+QSTQEAE+ALSQG+E+L+ +ISD I+
Sbjct  361   LWMGDFRPSELLKIILSQIEPLTENQLMGICGLQQSTQEAEDALSQGLESLNQSISDTIA  420

Query  432   SDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLI  253
             SDAL  P N+ + M QMA A+  L T+  F+RQADNLR Q I RL+ ILT  Q ARCFL 
Sbjct  421   SDALACPQNMANYMGQMALAMNKLSTVEGFLRQADNLRHQMIHRLHQILTTRQAARCFLS  480

Query  252   VTDFFHRLRTLSALWLGRPRQD  187
             + ++FHRLR LS+LWL RPRQ+
Sbjct  481   IGEYFHRLRALSSLWLARPRQE  502



>gb|KHN15531.1| Transcription factor HBP-1b(c1) [Glycine soja]
Length=517

 Score =   379 bits (972),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 213/446 (48%), Positives = 282/446 (63%), Gaps = 46/446 (10%)
 Frame = -2

Query  1401  NNQTCFGTVQAAPSSSSFPALGN--KDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdq  1228
             + Q  FG +   PSSS     GN    +S AYD+GELDQAF  +L  Q            
Sbjct  76    DQQISFGMM---PSSSLASIPGNFLSKDSGAYDLGELDQAFFLYLEGQADPSSVQDQKQN  132

Query  1227  QNNGMRLPNTLNMFPSEPMHV--------------------------------NP-----  1159
              ++GMR P TLN+FPS+PMH                                 NP     
Sbjct  133   SSSGMRPPPTLNIFPSQPMHAVPPSNSKVNMGLPSTQTSTGSKRQPESSMAKPNPHTEAP  192

Query  1158  -SPTALegsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLE  982
              +P   +        + +++SS      T + KTLRRLAQNREAARK R+RKKAYVQQLE
Sbjct  193   SAPEPPKAVKREGNRKGTTSSSEQEAPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLE  252

Query  981   TSRMKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEE  802
             +SR+KL Q+EQ++  ++A+G  +     ++G   G P++++ I+ E A FDVEYARW+EE
Sbjct  253   SSRIKLNQIEQELQRSRAQGI-LMGGNTLLGGEQGFPMAMSGISSEAAMFDVEYARWLEE  311

Query  801   EHRITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPV  622
              HRI CELR A+ E  L ENEL+ YVD C AHY Q+ +L +M+AK DV HLV GM  TP 
Sbjct  312   HHRIVCELRAALQE-HLHENELRLYVDNCLAHYDQVMNLKSMVAKIDVFHLVFGMWKTPA  370

Query  621   ERCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTIS  445
             ERCF+WIGGFRPS L+K+I+ Q+E +TEQQ LG+ GL+QSTQEAEEALSQG++ L+ ++S
Sbjct  371   ERCFMWIGGFRPSELIKIILGQIEPLTEQQILGICGLQQSTQEAEEALSQGLDALNQSLS  430

Query  444   DIISSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVAR  265
             + I+SD+L+ P N+ + M QM  A+  L TL +FVRQADNLR QTI RL+ +LT  Q AR
Sbjct  431   ETITSDSLWCPPNMNNYMGQMVVAMNKLSTLESFVRQADNLRHQTIHRLHQLLTTRQAAR  490

Query  264   CFLIVTDFFHRLRTLSALWLGRPRQD  187
             C + ++++FHRLR LS+LW   PRQD
Sbjct  491   CLVAISEYFHRLRALSSLWSTHPRQD  516



>ref|XP_003537178.2| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Glycine 
max]
Length=517

 Score =   379 bits (972),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 213/446 (48%), Positives = 281/446 (63%), Gaps = 46/446 (10%)
 Frame = -2

Query  1401  NNQTCFGTVQAAPSSSSFPALGN--KDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdq  1228
             + Q  FG +   PSSS     GN    +S AYD+GELDQAF  +L  Q            
Sbjct  76    DQQISFGMM---PSSSLASIPGNFLSKDSGAYDLGELDQAFFLYLEGQADPSSVQDQKQN  132

Query  1227  QNNGMRLPNTLNMFPSEPMHV--------------------------------NP-----  1159
              ++GMR P TLN+FPS+PMH                                 NP     
Sbjct  133   SSSGMRPPPTLNIFPSQPMHAVPPSNSKVNMGLPSTQTSTGSKRQPESSMAKPNPHTEAP  192

Query  1158  -SPTALegsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLE  982
              +P   +        + +++SS      T + KTLRRLAQNREAARK R+RKKAYVQQLE
Sbjct  193   SAPEPPKAVKREGNRKGTTSSSEQEAPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLE  252

Query  981   TSRMKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEE  802
             +SR+KL Q+EQ++  ++A+G  +     ++G   G P++++ I+ E A FDVEYARW+EE
Sbjct  253   SSRIKLNQIEQELQRSRAQGI-LMGGNTLLGGEQGFPMAMSGISSEAAMFDVEYARWLEE  311

Query  801   EHRITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPV  622
              HRI CELR A+ E  L ENEL+ YVD C AHY Q+  L +M+AK DV HLV GM  TP 
Sbjct  312   HHRIVCELRAALQE-HLHENELRLYVDNCLAHYDQVMSLKSMVAKIDVFHLVFGMWKTPA  370

Query  621   ERCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTIS  445
             ERCF+WIGGFRPS L+K+I+ Q+E +TEQQ LG+ GL+QSTQEAEEALSQG++ L+ ++S
Sbjct  371   ERCFMWIGGFRPSELIKIILGQIEPLTEQQILGICGLQQSTQEAEEALSQGLDALNQSLS  430

Query  444   DIISSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVAR  265
             + I+SD+L+ P N+ + M QM  A+  L TL +FVRQADNLR QTI RL+ +LT  Q AR
Sbjct  431   ETITSDSLWCPPNMNNYMGQMVVAMNKLSTLESFVRQADNLRHQTIHRLHQLLTTRQAAR  490

Query  264   CFLIVTDFFHRLRTLSALWLGRPRQD  187
             C + ++++FHRLR LS+LW   PRQD
Sbjct  491   CLVAISEYFHRLRALSSLWSTHPRQD  516



>ref|XP_006588910.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X2 [Glycine 
max]
Length=515

 Score =   378 bits (971),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 212/444 (48%), Positives = 278/444 (63%), Gaps = 44/444 (10%)
 Frame = -2

Query  1401  NNQTCFGTVQAAPSSSSFPALGN--KDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdq  1228
             + Q  FG +   PSSS     GN    +S AYD+GELDQAF  +L  Q            
Sbjct  76    DQQISFGMM---PSSSLASIPGNFLSKDSGAYDLGELDQAFFLYLEGQADPSSVQDQKQN  132

Query  1227  QNNGMRLPNTLNMFPSEPMH-VNPSPTALegsgsgsesrrsstssgggrggTLNA-----  1066
              ++GMR P TLN+FPS+PMH V PS + +      +++   S           N      
Sbjct  133   SSSGMRPPPTLNIFPSQPMHAVPPSNSKVNMGLPSTQTSTGSKRQPESSMAKPNPHTEAP  192

Query  1065  ------------------------------KTLRRLAQNREAARKCRIRKKAYVQQLETS  976
                                           KTLRRLAQNREAARK R+RKKAYVQQLE+S
Sbjct  193   SAPEPPKAREGNRKGTTSSSEQEAPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESS  252

Query  975   RMKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEH  796
             R+KL Q+EQ++  ++A+G  +     ++G   G P++++ I+ E A FDVEYARW+EE H
Sbjct  253   RIKLNQIEQELQRSRAQGI-LMGGNTLLGGEQGFPMAMSGISSEAAMFDVEYARWLEEHH  311

Query  795   RITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVER  616
             RI CELR A+ E  L ENEL+ YVD C AHY Q+  L +M+AK DV HLV GM  TP ER
Sbjct  312   RIVCELRAALQE-HLHENELRLYVDNCLAHYDQVMSLKSMVAKIDVFHLVFGMWKTPAER  370

Query  615   CFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDI  439
             CF+WIGGFRPS L+K+I+ Q+E +TEQQ LG+ GL+QSTQEAEEALSQG++ L+ ++S+ 
Sbjct  371   CFMWIGGFRPSELIKIILGQIEPLTEQQILGICGLQQSTQEAEEALSQGLDALNQSLSET  430

Query  438   ISSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCF  259
             I+SD+L+ P N+ + M QM  A+  L TL +FVRQADNLR QTI RL+ +LT  Q ARC 
Sbjct  431   ITSDSLWCPPNMNNYMGQMVVAMNKLSTLESFVRQADNLRHQTIHRLHQLLTTRQAARCL  490

Query  258   LIVTDFFHRLRTLSALWLGRPRQD  187
             + ++++FHRLR LS+LW   PRQD
Sbjct  491   VAISEYFHRLRALSSLWSTHPRQD  514



>ref|XP_010257393.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nelumbo nucifera]
Length=428

 Score =   375 bits (963),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 213/432 (49%), Positives = 275/432 (64%), Gaps = 46/432 (11%)
 Frame = -2

Query  1365  PSSSSFPALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMF  1186
             P+SS    L +  ++ AYD+GELDQA   +L  Q             + G+R P TLN+F
Sbjct  4     PTSSFSGNLISGKDTGAYDLGELDQALFLYLEGQDHSSLQEQRQ---SPGIR-PPTLNIF  59

Query  1185  PSEPMHVNP----------SPTALegsgsgsesrrs------------------------  1108
             PS+PMHV P          SPTA       S                             
Sbjct  60    PSQPMHVEPSPTKGSAVFVSPTATNTGPKRSSEPTMELSNPKNDKASGPEPAKTAKREVN  119

Query  1107  ----stssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVA  940
                 ++SS      T + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++ 
Sbjct  120   RKGPTSSSEQEGPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLTQLEQELQ  179

Query  939   LAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDE  760
              A+A+G  +   G  +    G PL +T ++ + A FD+EYARW+EE HR+ C+LR AV E
Sbjct  180   RARAQG--VLFGGGALLEDQGTPLGITNLSSDAAMFDMEYARWLEEHHRLMCDLRAAVQE  237

Query  759   LMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSL  580
               L ENEL+ +VD C AHY Q+ +L +M+ KSDV H+VSG+  TP ERCF+W+GGFRPS 
Sbjct  238   -HLPENELRLFVDNCLAHYNQIINLKSMIVKSDVFHIVSGLWKTPAERCFMWMGGFRPSE  296

Query  579   LLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNL  403
             ++K++++ +E +TEQQ LG+ GL+QSTQEAEEALSQG+E LH ++SD I+SDAL  PSN+
Sbjct  297   IIKILLNHMEPLTEQQILGICGLQQSTQEAEEALSQGLEALHQSLSDTIASDALNCPSNM  356

Query  402   PSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRT  223
              + M QMA AI  L TL  FVRQADNLR QT+ RL+ ILT  Q ARCFL + ++FHRLR 
Sbjct  357   ANYMGQMAIAINKLSTLEGFVRQADNLRQQTLYRLHQILTTRQAARCFLAIAEYFHRLRA  416

Query  222   LSALWLGRPRQD  187
             LS+LWL RPR D
Sbjct  417   LSSLWLARPRLD  428



>gb|AAY15214.1| TGA10 transcription factor [Nicotiana tabacum]
Length=506

 Score =   374 bits (961),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 216/444 (49%), Positives = 282/444 (64%), Gaps = 51/444 (11%)
 Frame = -2

Query  1389  CFGTVQAAPSSSSFP-ALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGM  1213
              FG +Q   SSS+ P +L +KD++ AYD+GELDQA   +L+ Q             N+GM
Sbjct  71    SFGMMQQ--SSSAIPGSLISKDSAGAYDLGELDQALFQYLDGQEPSSIQEQRQ---NSGM  125

Query  1212  RLPNTLNMFPS-----EPMHVN---------------------------------PS---  1156
             R P TLN+FPS     EP   N                                 PS   
Sbjct  126   R-PPTLNIFPSQPMHVEPSTTNKMNTGLVSPAISGSKRSSQPSMELSNNLKNNDAPSASG  184

Query  1155  PTALegsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETS  976
             P   + +      +  ++SS      T + KTLRRLAQNREAARK R+RKKAYVQQLE+S
Sbjct  185   PEPPKAAKREGNRKGPTSSSEQDAPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESS  244

Query  975   RMKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEH  796
             R++L QLEQ++  A+A+G       +++G     P++L  ++ + A FD+EYARW+EE H
Sbjct  245   RIRLTQLEQELQRARAQGYYFG-GNSLLGGEQNLPVNLANMSSDAAVFDMEYARWLEEHH  303

Query  795   RITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVER  616
             R+ CELR AV E    ENEL+ YVD C  HY ++ +L +ML KSDV HLVSGM  TP ER
Sbjct  304   RLMCELRNAVQE-HFPENELRIYVDNCVTHYDEIMNLKSMLTKSDVFHLVSGMWKTPAER  362

Query  615   CFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDI  439
             CF+W+GGFRPS LLK+I+SQ+E +TEQQ +G+ GL+QSTQEAE+ALSQG+E L+H++SD 
Sbjct  363   CFMWMGGFRPSELLKIILSQIEPLTEQQLMGICGLQQSTQEAEDALSQGLEALNHSLSDT  422

Query  438   ISSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCF  259
             I+SDAL  P N+ + M QMA A+  L TL  FVRQADNLR QTI RL+ +LT  Q ARCF
Sbjct  423   IASDALSCPQNMANYMGQMALAMNKLSTLEGFVRQADNLRHQTIHRLHQLLTTRQAARCF  482

Query  258   LIVTDFFHRLRTLSALWLGRPRQD  187
             L + ++FHRLR LS+LW  RPRQ+
Sbjct  483   LAIAEYFHRLRALSSLWHARPRQE  506



>ref|XP_009611363.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Nicotiana 
tomentosiformis]
Length=506

 Score =   370 bits (950),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 213/443 (48%), Positives = 283/443 (64%), Gaps = 49/443 (11%)
 Frame = -2

Query  1389  CFGTVQAAPSSSSFP-ALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGM  1213
              FG +Q   SSS+ P +L +KD++ AYD+GELDQA   +L+ Q             N+GM
Sbjct  71    SFGMMQQ--SSSAIPGSLISKDSAGAYDLGELDQALFQYLDGQDPSSIQEQRQ---NSGM  125

Query  1212  RLP-----------------NTLN------------------MFPSEPMHVNPSPTAL--  1144
             R P                 NT+N                  M  S  +  N +P+A   
Sbjct  126   RPPTLNIFPSQPMHVEPSTTNTMNTGLVSPAMSGSKRSSQPSMELSNNLKNNDAPSASGP  185

Query  1143  ---egsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSR  973
                + +      +  ++SS      T + KTLRRLAQNREAARK R+RKKAYVQQLE+SR
Sbjct  186   EPPKAAKREGNRKGPTSSSEQDGPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESSR  245

Query  972   MKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHR  793
             ++L QLEQ++  A+A+G       +++G     P+++  ++ + A FD+EYARW+EE HR
Sbjct  246   IRLTQLEQELQRARAQGYYFG-GNSLLGGEKNLPVNMGNMSSDAAVFDMEYARWLEEHHR  304

Query  792   ITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERC  613
             + CELR AV E    ENEL+ YVD C  HY ++ +L +MLAKSDV HLVSGM  TP ERC
Sbjct  305   LMCELRNAVQE-HFPENELRIYVDNCVTHYDEIMNLKSMLAKSDVFHLVSGMWKTPAERC  363

Query  612   FIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDII  436
             F+W+GGFRPS LLK+I+SQ+E +TEQQ +G+ GL+QSTQEAE+ALSQG+E L+H++SD I
Sbjct  364   FMWMGGFRPSELLKIILSQIEPLTEQQLMGICGLQQSTQEAEDALSQGLEALNHSLSDTI  423

Query  435   SSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFL  256
             +SDAL  P N+ + M QMA A+  L TL  FVRQADNLR QTI RL+ +LT  Q ARCFL
Sbjct  424   ASDALSCPQNMANYMGQMALAMNKLSTLEGFVRQADNLRHQTIHRLHQLLTTRQAARCFL  483

Query  255   IVTDFFHRLRTLSALWLGRPRQD  187
              + ++FHRLR LS+LWL RPRQ+
Sbjct  484   AIAEYFHRLRALSSLWLARPRQE  506



>ref|XP_010265827.1| PREDICTED: transcription factor TGA2-like [Nelumbo nucifera]
Length=450

 Score =   365 bits (938),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 217/446 (49%), Positives = 285/446 (64%), Gaps = 53/446 (12%)
 Frame = -2

Query  1401  NNQTCFGTVQAAPSSSSFPA--LGNKDNSEAYDVGELDQA-FLHFLNAqpqdqdpssshd  1231
             ++Q  FG +Q   S+SS P   +G+KD   AYDVGELDQA FL+F     + QD SS  +
Sbjct  17    HHQISFGMMQ---STSSVPGSLIGSKDTG-AYDVGELDQALFLYF-----EGQDHSSLQE  67

Query  1230  qQNNGMRLPNTLNMFPSEPMHVNP--------------------SPTALegsgsgsesrr  1111
             Q+ N +  P TLN+FPS+PMHV P                    S  A+E +    +S  
Sbjct  68    QRQNPVIRPPTLNIFPSQPMHVEPFTAKESVALISTTSSGSKRSSGPAMELANPRKDSAS  127

Query  1110  sstssgggrggTLNAK-----------------TLRRLAQNREAARKCRIRKKAYVQQLE  982
             ++      +   +N K                 TLRRLAQNREAARK R+RKKAYVQQLE
Sbjct  128   ATEPPKTVKREAVNRKGPTSSSEQEGPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLE  187

Query  981   TSRMKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEE  802
             +SR++L QLEQ++  A+ +G  I   G  +    G P  ++ ++ +   FD+EYARW+EE
Sbjct  188   SSRVRLNQLEQELQRARTQG--IFFAGGTLVGEPGIPAGISNLSSDATVFDMEYARWLEE  245

Query  801   EHRITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPV  622
              HR+ CELR AV E  L ENEL+ +VD C AHY  + +L +M+ KSDV H+VSG   TP 
Sbjct  246   NHRLMCELRAAVQE-HLPENELRLFVDNCLAHYDAIMNLKSMVVKSDVFHIVSGTWKTPA  304

Query  621   ERCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTIS  445
             ERCF+W+GGFRPS L+KV+M+ +E +TEQQ LG+ GL+QST EAEEALSQG+E L  ++S
Sbjct  305   ERCFMWMGGFRPSELIKVLMNHIEPLTEQQILGICGLQQSTHEAEEALSQGLEALRQSLS  364

Query  444   DIISSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVAR  265
             D I+SDAL  P N+ + M QMA A+  L T+  FVRQADNLR QT+ RL+ ILT  Q AR
Sbjct  365   DTIASDALSCPPNMANYMGQMAVAMNKLSTVEGFVRQADNLRQQTLHRLHQILTTRQAAR  424

Query  264   CFLIVTDFFHRLRTLSALWLGRPRQD  187
             CFL + ++FHRLR LS+LWL RPRQ+
Sbjct  425   CFLAIAEYFHRLRALSSLWLSRPRQE  450



>ref|XP_004136740.1| PREDICTED: transcription factor HBP-1b(c1)-like [Cucumis sativus]
 ref|XP_004164779.1| PREDICTED: transcription factor HBP-1b(c1)-like [Cucumis sativus]
Length=378

 Score =   363 bits (931),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 200/387 (52%), Positives = 255/387 (66%), Gaps = 11/387 (3%)
 Frame = -2

Query  1341  LGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMFPSEPMHVN  1162
             +G+KD     D+GELDQA   +L+ Q      +    Q ++GMR P TLN+FPS+PMHV+
Sbjct  1     MGSKDGG-GDDLGELDQALFLYLDGQEPSSTTTQDQRQ-SSGMR-PPTLNIFPSQPMHVD  57

Query  1161  PSPTALegsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLE  982
               P   E +  G  S               + KTLRRLAQNREAARK R+RKKAYVQQLE
Sbjct  58    SLPIKREPNKKGLTSSSEQEGPKTP-----DPKTLRRLAQNREAARKSRLRKKAYVQQLE  112

Query  981   TSRMKLIQLEQQVALAQARGA-RITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIE  805
              SR+KL QLEQ++  A+ +G         + G   G P     ++ + A FD+EY RW E
Sbjct  113   MSRIKLTQLEQELQRARNQGMFLGGGAAILGGPDQGLPSGFHNLSSDAAVFDIEYGRWQE  172

Query  804   EEHRITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTP  625
             E HR+ CELR AV E  L ENEL+ YVD+C AHY ++ +L  M+AKSD+ HLVSGM  TP
Sbjct  173   EHHRLMCELRAAVQE-HLPENELRLYVDSCLAHYDEVLNLKMMVAKSDIFHLVSGMWKTP  231

Query  624   VERCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTI  448
              ERCF+W+G FRPS L+K+IM Q+E +TE Q L +  L+QSTQE+EEALSQG+E L+ ++
Sbjct  232   AERCFMWMGDFRPSELIKIIMGQIEPLTEHQILNICALQQSTQESEEALSQGLEALNQSL  291

Query  447   SDIISSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVA  268
             SD I+SD+L  P N+ + M QM  AI  L TL  FVRQADNLR QT+ RL  +LT  Q A
Sbjct  292   SDTITSDSLSSPPNMANYMGQMTLAINKLSTLEGFVRQADNLRHQTVHRLQQMLTTRQAA  351

Query  267   RCFLIVTDFFHRLRTLSALWLGRPRQD  187
             RC L + ++FHRLR LS+LWL RPRQD
Sbjct  352   RCLLAIAEYFHRLRALSSLWLARPRQD  378



>ref|XP_006575222.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X2 [Glycine 
max]
Length=482

 Score =   365 bits (937),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 211/444 (48%), Positives = 274/444 (62%), Gaps = 43/444 (10%)
 Frame = -2

Query  1401  NNQTCFGTVQAAPSSSSFPALGN--KDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdq  1228
             + Q  FG +   PSSSS    GN    +S AYD+GELDQAF  +L+ Q            
Sbjct  42    DQQISFGML---PSSSSASIPGNFLSKDSGAYDLGELDQAFFLYLDGQADPSSVQDQKQN  98

Query  1227  QNNGMRLPNT------------------LNM-FPS-----------EPMHVNPSPTALeg  1138
              ++GMR P T                  +NM  PS           E     P P     
Sbjct  99    SSSGMRPPPTLNIFPSQPMHAVPPSNSKVNMGLPSTQTSTGSKRQPETSMAKPKPHTEAA  158

Query  1137  sgsgsesrrsstssgggrggTLNA------KTLRRLAQNREAARKCRIRKKAYVQQLETS  976
             +       R     G        A      KTLRRLAQNREAARK R+RKKAYVQQLE+S
Sbjct  159   AAPEPPKAREGNLKGTTSSSEQEAPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESS  218

Query  975   RMKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEH  796
             R+KL Q+EQ++  A+A+G  +     ++G   G  ++++ I+ E A FDVEYARW+EE H
Sbjct  219   RIKLNQIEQELQRARAQGILMGGGNALLGGEQGFHMAMSGISSEAAIFDVEYARWLEEHH  278

Query  795   RITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVER  616
             RI CELR  + E  L ENEL+ YVD C AHY Q+ +L +M+AK+DV HLV G+  TP ER
Sbjct  279   RIVCELRAVLQE-HLHENELRLYVDNCLAHYDQVMNLKSMVAKTDVFHLVFGVWKTPAER  337

Query  615   CFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDI  439
             CF+WIGGFRPS L+K+I+ Q+E +TEQQ LG+ GL+QSTQEAEEALSQG++ L+ ++S+ 
Sbjct  338   CFMWIGGFRPSELIKIILGQIEPLTEQQILGICGLQQSTQEAEEALSQGLDALNQSLSET  397

Query  438   ISSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCF  259
             I+SD+L+ P N+ + M QMA AI  L TL +FVRQADNLR QTI RL+ +LT  Q ARC 
Sbjct  398   ITSDSLWCPPNMTNYMGQMAVAINKLSTLESFVRQADNLRHQTIHRLHQLLTTRQAARCL  457

Query  258   LIVTDFFHRLRTLSALWLGRPRQD  187
             + ++++FHRLR LS+LW  RPRQD
Sbjct  458   VAISEYFHRLRALSSLWSTRPRQD  481



>ref|XP_009626969.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nicotiana tomentosiformis]
Length=467

 Score =   363 bits (932),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 213/447 (48%), Positives = 275/447 (62%), Gaps = 48/447 (11%)
 Frame = -2

Query  1398  NQTCFGTVQAAPSSSS-----FPALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpsssh  1234
             +Q  FG +Q + S+SS     F +         YD+GELDQAF  +L+ Q    +     
Sbjct  26    HQISFGMLQQSSSTSSVIPGNFISKDINTGGANYDLGELDQAFFLYLDGQDPSSNHLRE-  84

Query  1233  dqQNNGMRLPNTLNMFPSEPMHVNPSPT----ALegsgsgsesrrsstssgggrggTLNA  1066
                NN    P TLN+FPS+PMHV PS T     L  SGS   S+ S       +   L+A
Sbjct  85    ---NNSEMRPPTLNIFPSQPMHVEPSSTKANTGLVSSGSQKSSQPSIMELTNSKNDVLSA  141

Query  1065  --------------------------------KTLRRLAQNREAARKCRIRKKAYVQQLE  982
                                             KTLRRLAQNREAARK R+RKKAY+QQLE
Sbjct  142   ASGPEPKVAKREWNRKGLNSGSEKDAPKIPDHKTLRRLAQNREAARKSRLRKKAYIQQLE  201

Query  981   TSRMKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEE  802
             +SR++L QLEQ++  A+++G        ++G     P++   ++ + A FD+EYARW+EE
Sbjct  202   SSRVRLAQLEQELQRARSQGFHFG-GNALLGGDQTLPVNRGSMSSDAAVFDMEYARWVEE  260

Query  801   EHRITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPV  622
              HR+ CELR AV E  L ENEL+ YVD C  HY Q+ +L +MLAKSDV HLVSGM  TP 
Sbjct  261   HHRLICELRSAVVEEHLPENELRMYVDNCLTHYDQIMNLKSMLAKSDVFHLVSGMWKTPA  320

Query  621   ERCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTIS  445
             ERC IW+G FRPS L+K+I+SQ+E +TE+Q +G+ GL+QSTQEAE ALS G+E L+ ++S
Sbjct  321   ERCSIWMGDFRPSELIKIILSQIEPLTEEQFVGICGLQQSTQEAESALSLGLEALNQSLS  380

Query  444   DIISSDALFY-PSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVA  268
             D I SDAL   P N+ + M QMA AI  L TL  F RQA+NLR QTI RL+ ILT  Q A
Sbjct  381   DTIVSDALANCPQNMANYMGQMALAINKLSTLEGFFRQAENLRHQTIHRLHQILTSRQAA  440

Query  267   RCFLIVTDFFHRLRTLSALWLGRPRQD  187
             RCFL + ++FHRLR LS+LW+ RPRQ+
Sbjct  441   RCFLAIAEYFHRLRALSSLWVARPRQE  467



>ref|XP_010057941.1| PREDICTED: transcription factor TGA2 [Eucalyptus grandis]
Length=482

 Score =   363 bits (933),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 209/441 (47%), Positives = 275/441 (62%), Gaps = 49/441 (11%)
 Frame = -2

Query  1383  GTVQAAPSSS-SFPALGNKDNSE----AYDVGELDQAFLHFLNAqpqdqdpssshdqQNN  1219
             G +Q++PSSS +     +KD       AYD+GELDQA   +L+               N+
Sbjct  49    GMMQSSPSSSITVINCLSKDGGGGGGGAYDLGELDQALFLYLDGHDPQNVQDQKQ---NS  105

Query  1218  GMRLPNTLNMFPSEPMHVNPSPT-----ALegsgsgsesrrsstssgggrggTLNAKT--  1060
             GMR P TLN+FPS+PMHV+P P      AL  +         S      R    +A T  
Sbjct  106   GMR-PPTLNIFPSQPMHVDPLPKVSMGLALPQASGSKRPPEPSMELANARTEVASAPTEP  164

Query  1059  -----------------------------LRRLAQNREAARKCRIRKKAYVQQLETSRMK  967
                                          LRRLAQNREAARK R+RKKAY+QQLE+SRMK
Sbjct  165   PKTKREGNRKGASSASEQQEGPRTPDPKTLRRLAQNREAARKSRLRKKAYIQQLESSRMK  224

Query  966   LIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRIT  787
             L QLEQ++  A+++G  I   G  V    G P+ ++ I+ + A FD+EY RW+EE HR+ 
Sbjct  225   LSQLEQELQRARSQG--IYVGGGAVVGEQGLPVGISNISTDAAVFDMEYTRWLEEHHRLM  282

Query  786   CELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFI  607
             CELR AV E  L ENEL+ +VD   AHY +M +L +M+AKSDV HLVSGM  TP ERCF+
Sbjct  283   CELRAAVQE-HLPENELRLFVDNTLAHYNEMMNLKSMVAKSDVFHLVSGMWRTPAERCFM  341

Query  606   WIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISS  430
             W+G FRPS L+KV+++ +E +TEQQ LG+ GL+QSTQ AEEALSQG+E L+H++S+ I+S
Sbjct  342   WMGDFRPSELIKVVLNHIEPLTEQQILGICGLQQSTQGAEEALSQGLEALNHSLSETIAS  401

Query  429   DALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIV  250
             D+L  P N+ + M QMA A+  L TL  FVRQADNLR QT+ R+  ILT  Q ARC + +
Sbjct  402   DSLISPPNMANYMGQMAVAMNKLSTLEGFVRQADNLRHQTLHRMLQILTTRQAARCLIAI  461

Query  249   TDFFHRLRTLSALWLGRPRQD  187
             +++F+RLR LS+LWL RPRQ+
Sbjct  462   SEYFYRLRALSSLWLSRPRQE  482



>ref|XP_009611364.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Nicotiana 
tomentosiformis]
Length=503

 Score =   364 bits (934),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 212/443 (48%), Positives = 282/443 (64%), Gaps = 52/443 (12%)
 Frame = -2

Query  1389  CFGTVQAAPSSSSFP-ALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGM  1213
              FG +Q   SSS+ P +L +KD++ AYD+GELDQA   +L+ Q             N+GM
Sbjct  71    SFGMMQQ--SSSAIPGSLISKDSAGAYDLGELDQALFQYLDGQDPSSIQEQRQ---NSGM  125

Query  1212  RLP-----------------NTLN------------------MFPSEPMHVNPSPTAL--  1144
             R P                 NT+N                  M  S  +  N +P+A   
Sbjct  126   RPPTLNIFPSQPMHVEPSTTNTMNTGLVSPAMSGSKRSSQPSMELSNNLKNNDAPSASGP  185

Query  1143  ---egsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSR  973
                + +      +  ++SS      T + KTLRRLAQNREAARK R+RKKAYVQQLE+SR
Sbjct  186   EPPKAAKREGNRKGPTSSSEQDGPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESSR  245

Query  972   MKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHR  793
             ++L QLEQ++  A+A+G       +++G     P+++  ++   + FD+EYARW+EE HR
Sbjct  246   IRLTQLEQELQRARAQGYYFG-GNSLLGGEKNLPVNMGNMS---SVFDMEYARWLEEHHR  301

Query  792   ITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERC  613
             + CELR AV E    ENEL+ YVD C  HY ++ +L +MLAKSDV HLVSGM  TP ERC
Sbjct  302   LMCELRNAVQE-HFPENELRIYVDNCVTHYDEIMNLKSMLAKSDVFHLVSGMWKTPAERC  360

Query  612   FIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDII  436
             F+W+GGFRPS LLK+I+SQ+E +TEQQ +G+ GL+QSTQEAE+ALSQG+E L+H++SD I
Sbjct  361   FMWMGGFRPSELLKIILSQIEPLTEQQLMGICGLQQSTQEAEDALSQGLEALNHSLSDTI  420

Query  435   SSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFL  256
             +SDAL  P N+ + M QMA A+  L TL  FVRQADNLR QTI RL+ +LT  Q ARCFL
Sbjct  421   ASDALSCPQNMANYMGQMALAMNKLSTLEGFVRQADNLRHQTIHRLHQLLTTRQAARCFL  480

Query  255   IVTDFFHRLRTLSALWLGRPRQD  187
              + ++FHRLR LS+LWL RPRQ+
Sbjct  481   AIAEYFHRLRALSSLWLARPRQE  503



>ref|XP_011020273.1| PREDICTED: transcription factor TGA2-like [Populus euphratica]
 ref|XP_011020274.1| PREDICTED: transcription factor TGA2-like [Populus euphratica]
Length=517

 Score =   364 bits (935),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 213/445 (48%), Positives = 279/445 (63%), Gaps = 49/445 (11%)
 Frame = -2

Query  1401  NNQTCFGTVQAAPSSSSFPALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQN  1222
             ++Q  +G +Q++ SSSS P      ++ AYD+GELDQA   +L+ Q              
Sbjct  82    HHQIPYGIMQSS-SSSSIPGNFMSKDAGAYDLGELDQALFLYLDGQDPSTVNQDQRQS-G  139

Query  1221  NGMRLPNTLNMFPSEPMHVNP------SPTALegsgsgsesrrsstssgggrggTLNA--  1066
              GMR P TLN+FPS+PMHV P      S T L  S +G   + S  S        ++A  
Sbjct  140   AGMR-PPTLNIFPSQPMHVEPSKANTTSATGLVSSATGGSKKSSEPSMELASTRNVSAPG  198

Query  1065  -------------------------------KTLRRLAQNREAARKCRIRKKAYVQQLET  979
                                            KTLRRLAQNREAARK R+RKKAYVQQLE+
Sbjct  199   RDPAKAIKREGKRKGPTTSSSEQEGPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLES  258

Query  978   SRMKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEE  799
             SR+KL QLEQ++  A+A+G  +       G   G P+ +  I  + A FD+EYARW+EE 
Sbjct  259   SRIKLTQLEQELQRARAQGILLC-----GGGEQGLPVGIANINADAAFFDMEYARWLEEH  313

Query  798   HRITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVE  619
             HR+ CELR AV E  + ENEL+ +VD C AHY +M +L  M+AK+DV HLVSGM  TP E
Sbjct  314   HRLMCELRAAVQE-HIPENELRLFVDNCLAHYDEMMNLKIMVAKTDVFHLVSGMWKTPAE  372

Query  618   RCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISD  442
             RC +W+GGFRPS L+K+I+ Q+E +TEQQ LG+ GL+QSTQE E+ALSQG+E L+ ++SD
Sbjct  373   RCCMWMGGFRPSELIKIIVGQIEPLTEQQILGICGLQQSTQENEDALSQGLEALYQSLSD  432

Query  441   IISSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARC  262
              I+S++L YP N+ + M QMA A+  L TL  FVRQADNLR QTI RL+ +LT  Q ARC
Sbjct  433   TIASESLSYPPNMANYMGQMAVAMNKLSTLEGFVRQADNLRHQTIHRLHQLLTTRQAARC  492

Query  261   FLIVTDFFHRLRTLSALWLGRPRQD  187
              L + ++FHRLR LS+LWL RPR++
Sbjct  493   LLAIAEYFHRLRALSSLWLARPRRE  517



>ref|XP_006485023.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Citrus 
sinensis]
Length=486

 Score =   363 bits (931),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 219/448 (49%), Positives = 281/448 (63%), Gaps = 56/448 (13%)
 Frame = -2

Query  1389  CFGTVQAAPSSSSFPALGN--KDNSE-AYDVGELDQA-FLHFLNAqpqdqdpssshdqQN  1222
              FG +Q +PS    P  GN  KD+   AYD+GELDQA FL+     P           ++
Sbjct  48    AFGMMQQSPS---IPG-GNYIKDSGGGAYDLGELDQALFLYLDGQDPSTVHNHQDQRPES  103

Query  1221  NGMRLPNTLNMFPSEPMHVNPSP-------TALegsgsgsesrrsstssgggrggTLN--  1069
             +GMR P TLN+FPS+PMHV PS        TAL  S + + S+R S  S        N  
Sbjct  104   SGMR-PPTLNIFPSQPMHVEPSSTNNHKAATALVSSTTNNSSKRPSEPSMELANARNNAP  162

Query  1068  ------AKTLRR---------------------------LAQNREAARKCRIRKKAYVQQ  988
                   AK ++R                           LAQNREAARK R+RKKAYVQQ
Sbjct  163   SSGPETAKAIKREGNRKGPTSSNSEHEGPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQ  222

Query  987   LETSRMKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWI  808
             LE+SR+KL QLEQ++  A+ +G        ++G   G P+ ++ I+ E A FD+EYARW+
Sbjct  223   LESSRIKLTQLEQELQRARTQGMFFG---GILGGEQGLPVGISNISSEAAVFDMEYARWL  279

Query  807   EEEHRITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWT  628
             E  HR+ CELR AV E  L ENEL+ YVD C AHY ++ +L  M+AK+DV HLVSG+  +
Sbjct  280   EVHHRLMCELRAAVQE-HLPENELRLYVDNCLAHYDEIMNLKGMVAKTDVFHLVSGLWKS  338

Query  627   PVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHT  451
             P ERCF+W+GGFRPS L+KVI+SQ+E +TEQQ LG+ GL+QSTQEAE+ALSQG+E L+ +
Sbjct  339   PAERCFLWLGGFRPSELIKVILSQIEPLTEQQILGICGLQQSTQEAEDALSQGLEALNQS  398

Query  450   ISDIISSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQV  271
             I D I+SD+L  P N+ + M QMA A+  L TL  FVRQADNLR QTI RL  ILT  Q 
Sbjct  399   ILDTIASDSLSCPPNMANYMGQMAVAMNKLSTLEGFVRQADNLRHQTIHRLNQILTTRQA  458

Query  270   ARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             ARC L + ++FHRLR LS+LW+ RPRQ+
Sbjct  459   ARCLLAIAEYFHRLRALSSLWMARPRQE  486



>ref|XP_006485024.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X2 [Citrus 
sinensis]
Length=485

 Score =   363 bits (931),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 219/447 (49%), Positives = 281/447 (63%), Gaps = 55/447 (12%)
 Frame = -2

Query  1389  CFGTVQAAPSSSSFPALGN--KDNSE-AYDVGELDQAFLHFLNAqpqdqdpssshdqQNN  1219
              FG +Q +PS    P  GN  KD+   AYD+GELDQA   +L+ Q      +    +Q++
Sbjct  48    AFGMMQQSPS---IPG-GNYIKDSGGGAYDLGELDQALFLYLDGQDPSTVHNHQDQRQSS  103

Query  1218  GMRLPNTLNMFPS-----EPMHVN--PSPTALegsgsgsesrrsstssgggrggTLNA--  1066
             GMR P TLN+FPS     EP   N   + TAL  S + + S+R S  S        NA  
Sbjct  104   GMR-PPTLNIFPSQPMHVEPSSTNNHKAATALVSSTTNNSSKRPSEPSMELANARNNAPS  162

Query  1065  ---------------------------------KTLRRLAQNREAARKCRIRKKAYVQQL  985
                                              KTLRRLAQNREAARK R+RKKAYVQQL
Sbjct  163   SGPETAKAIKREGNRKGPTSSNSEHEGPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQL  222

Query  984   ETSRMKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIE  805
             E+SR+KL QLEQ++  A+ +G        ++G   G P+ ++ I+ E A FD+EYARW+E
Sbjct  223   ESSRIKLTQLEQELQRARTQGMFFG---GILGGEQGLPVGISNISSEAAVFDMEYARWLE  279

Query  804   EEHRITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTP  625
               HR+ CELR AV E  L ENEL+ YVD C AHY ++ +L  M+AK+DV HLVSG+  +P
Sbjct  280   VHHRLMCELRAAVQE-HLPENELRLYVDNCLAHYDEIMNLKGMVAKTDVFHLVSGLWKSP  338

Query  624   VERCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTI  448
              ERCF+W+GGFRPS L+KVI+SQ+E +TEQQ LG+ GL+QSTQEAE+ALSQG+E L+ +I
Sbjct  339   AERCFLWLGGFRPSELIKVILSQIEPLTEQQILGICGLQQSTQEAEDALSQGLEALNQSI  398

Query  447   SDIISSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVA  268
              D I+SD+L  P N+ + M QMA A+  L TL  FVRQADNLR QTI RL  ILT  Q A
Sbjct  399   LDTIASDSLSCPPNMANYMGQMAVAMNKLSTLEGFVRQADNLRHQTIHRLNQILTTRQAA  458

Query  267   RCFLIVTDFFHRLRTLSALWLGRPRQD  187
             RC L + ++FHRLR LS+LW+ RPRQ+
Sbjct  459   RCLLAIAEYFHRLRALSSLWMARPRQE  485



>ref|XP_006437046.1| hypothetical protein CICLE_v10031361mg [Citrus clementina]
 gb|ESR50286.1| hypothetical protein CICLE_v10031361mg [Citrus clementina]
Length=486

 Score =   363 bits (931),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 219/447 (49%), Positives = 281/447 (63%), Gaps = 55/447 (12%)
 Frame = -2

Query  1389  CFGTVQAAPSSSSFPALGN--KDNSE-AYDVGELDQAFLHFLNAqpqdqdpssshdqQNN  1219
              FG +Q +PS    P  GN  KD+   AYD+GELDQA   +L+ Q      +    +Q++
Sbjct  49    AFGMMQQSPS---IPG-GNYIKDSGGGAYDLGELDQALFLYLDGQDPSTVHNHQDQRQSS  104

Query  1218  GMRLPNTLNMFPS-----EPMHVN--PSPTALegsgsgsesrrsstssgggrggTLNA--  1066
             GMR P TLN+FPS     EP   N   + TAL  S + + S+R S  S        NA  
Sbjct  105   GMR-PPTLNIFPSQPMHVEPSSTNNHKAATALVSSTTNNSSKRPSEPSMELANARNNAPS  163

Query  1065  ---------------------------------KTLRRLAQNREAARKCRIRKKAYVQQL  985
                                              KTLRRLAQNREAARK R+RKKAYVQQL
Sbjct  164   SGPETAKAIKREGNRKGPTSSNSEHEGPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQL  223

Query  984   ETSRMKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIE  805
             E+SR+KL QLEQ++  A+ +G        ++G   G P+ ++ I+ E A FD+EYARW+E
Sbjct  224   ESSRIKLTQLEQELQRARTQGMFFG---GILGGEQGLPVGISNISSEAAVFDMEYARWLE  280

Query  804   EEHRITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTP  625
               HR+ CELR AV E  L ENEL+ YVD C AHY ++ +L  M+AK+DV HLVSG+  +P
Sbjct  281   VHHRLMCELRAAVQE-HLPENELRLYVDNCLAHYDEIMNLKGMVAKTDVFHLVSGLWKSP  339

Query  624   VERCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTI  448
              ERCF+W+GGFRPS L+KVI+SQ+E +TEQQ LG+ GL+QSTQEAE+ALSQG+E L+ +I
Sbjct  340   AERCFLWLGGFRPSELIKVILSQIEPLTEQQILGICGLQQSTQEAEDALSQGLEALNQSI  399

Query  447   SDIISSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVA  268
              D I+SD+L  P N+ + M QMA A+  L TL  FVRQADNLR QTI RL  ILT  Q A
Sbjct  400   LDTIASDSLSCPPNMANYMGQMAVAMNKLSTLEGFVRQADNLRHQTIHRLNQILTTRQAA  459

Query  267   RCFLIVTDFFHRLRTLSALWLGRPRQD  187
             RC L + ++FHRLR LS+LW+ RPRQ+
Sbjct  460   RCLLAIAEYFHRLRALSSLWMARPRQE  486



>ref|XP_002308062.2| hypothetical protein POPTR_0006s05770g, partial [Populus trichocarpa]
 gb|EEE91585.2| hypothetical protein POPTR_0006s05770g, partial [Populus trichocarpa]
Length=523

 Score =   364 bits (934),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 213/445 (48%), Positives = 279/445 (63%), Gaps = 49/445 (11%)
 Frame = -2

Query  1401  NNQTCFGTVQAAPSSSSFPALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQN  1222
             ++Q  +G +Q++ SSSS P      ++ AYD+GELDQA   +L+ Q              
Sbjct  88    HHQIPYGIMQSS-SSSSIPGNFMSKDAGAYDLGELDQALFLYLDGQDPSTVNQDQRQS-G  145

Query  1221  NGMRLPNTLNMFPSEPMHVNP------SPTALegsgsgsesrrsstssgggrggTLNA--  1066
              GMR P TLN+FPS+PMHV P      S T L  S +G   + S  S        ++A  
Sbjct  146   AGMR-PPTLNIFPSQPMHVEPSKANTTSATGLVSSATGGSKKSSEPSMELANTRNVSAPG  204

Query  1065  -------------------------------KTLRRLAQNREAARKCRIRKKAYVQQLET  979
                                            KTLRRLAQNREAARK R+RKKAYVQQLE+
Sbjct  205   REPAKAIKREGKRKGPTTSSSEQEGPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLES  264

Query  978   SRMKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEE  799
             SR+KL QLEQ++  A+A+G  +       G   G P+ +  I  + A FD+EYARW+EE 
Sbjct  265   SRIKLTQLEQELQRARAQGIFLC-----GGGEQGLPVGIANINSDAAFFDMEYARWLEEH  319

Query  798   HRITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVE  619
             HR+ CELR AV E  + ENEL+ +VD C AHY +M +L  M+AK+DV HLVSGM  TP E
Sbjct  320   HRLMCELRAAVQE-HIPENELRLFVDNCLAHYDEMMNLKIMVAKTDVFHLVSGMWKTPAE  378

Query  618   RCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISD  442
             RCF+W+GGFRPS L+K+I+ Q+E +TEQQ LG+ GL+QSTQE E+ALSQG+E L+ ++SD
Sbjct  379   RCFMWMGGFRPSELIKIIVGQIEPLTEQQILGICGLQQSTQENEDALSQGLEALNQSLSD  438

Query  441   IISSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARC  262
              I+S++L YP N+ + M QMA A+  L TL  FVRQADNLR QTI RL+ +LT  Q AR 
Sbjct  439   TIASESLSYPPNMANYMGQMAVAMNKLSTLEGFVRQADNLRHQTIHRLHQLLTTRQAARS  498

Query  261   FLIVTDFFHRLRTLSALWLGRPRQD  187
              L + ++FHRLR LS+LWL RPR++
Sbjct  499   LLAIAEYFHRLRALSSLWLARPRRE  523



>ref|XP_010111398.1| Transcription factor HBP-1b(c1) [Morus notabilis]
 gb|EXC30876.1| Transcription factor HBP-1b(c1) [Morus notabilis]
Length=518

 Score =   362 bits (929),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 214/438 (49%), Positives = 272/438 (62%), Gaps = 58/438 (13%)
 Frame = -2

Query  1341  LGN---KDNSE--AYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMFP--  1183
             +GN   KD+S   AYD+GELDQA   +L+ Q    +        N GMR P TLN+FP  
Sbjct  86    IGNFISKDSSSTGAYDLGELDQALFLYLDGQDHPSNHVQDQRY-NTGMR-PPTLNIFPSQ  143

Query  1182  ----------------------------SEPMHVN-----------------PSPTALeg  1138
                                         SEP ++                  P P   + 
Sbjct  144   PMHVEPSSTKASTGLVSPGNISSGSKRPSEPSNMELANNTTRNDTTAAASSVPEPAVNKA  203

Query  1137  sgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQ  958
                    +  ++SS      T + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL Q
Sbjct  204   IKREGNRKGPTSSSEQEGPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLTQ  263

Query  957   LEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCEL  778
             LEQ++  A+A+G      G ++G   G P+ ++ I+ + A FDVEYARW+EE HR+ CEL
Sbjct  264   LEQELQRARAQGMFFG--GALLGGEQGIPIGISNISSDAAVFDVEYARWLEENHRMMCEL  321

Query  777   RKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIG  598
             R AV E  L ENEL+ +VD C AHY QM  L +M+AK+DV H+VSGM  TP ERCF+WIG
Sbjct  322   RAAVHE-HLPENELRMFVDNCLAHYDQMLSLKSMVAKTDVFHIVSGMWKTPAERCFMWIG  380

Query  597   GFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDAL  421
             GFRPS L+K+I SQ+E +TEQQ LG+ GL+QSTQEAEEALSQG+E L+ ++SD I+SD+L
Sbjct  381   GFRPSELIKIIPSQIEPLTEQQILGICGLQQSTQEAEEALSQGLEALNQSLSDTITSDSL  440

Query  420   FYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDF  241
               P N+ + M QMA A+  L TL  FVRQADNLR QTI RL+ ILT  Q ARC L + ++
Sbjct  441   SCPPNMANYMGQMALAMNKLSTLEGFVRQADNLRHQTIHRLHQILTTRQAARCLLAIAEY  500

Query  240   FHRLRTLSALWLGRPRQD  187
             FHRLR LS+LWL R RQ+
Sbjct  501   FHRLRALSSLWLARTRQE  518



>ref|XP_009357109.1| PREDICTED: transcription factor HBP-1b(c38)-like [Pyrus x bretschneideri]
Length=537

 Score =   357 bits (915),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 176/296 (59%), Positives = 224/296 (76%), Gaps = 3/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLETSR+KL QLEQ++  A+++G      G V 
Sbjct  242   DPKTLRRLAQNREAARKSRLRKKAYVQQLETSRIKLTQLEQELQRARSQGMFFG-GGLVG  300

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G     P+ +  I+P+ A FD+EYARW+EE HR+ CELR AV E  L ENEL+ YVD C 
Sbjct  301   GEQQSLPVGINNISPDAAVFDMEYARWLEEHHRLMCELRAAVQE-HLQENELRLYVDNCL  359

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY ++ +L  M+AK+DV H+VSGM  TP ERCF+W+GGFRPS ++K+I++Q+E +TEQQ
Sbjct  360   AHYDEVLNLKGMVAKTDVFHIVSGMWKTPAERCFMWMGGFRPSEVIKIILNQIEPLTEQQ  419

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              LG+ GL+QSTQE EEALSQG+E L+ ++S+ I+SD+L  P N+ + M QMA A+  L T
Sbjct  420   LLGICGLQQSTQETEEALSQGLEALNQSLSETITSDSLSCPPNMANYMGQMAIAMNKLST  479

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  FVRQADNLR QTI RL  ILT  Q ARC L + ++FHRLR LS+LW+GRPRQD
Sbjct  480   LEGFVRQADNLRQQTIHRLQQILTTRQAARCLLAIAEYFHRLRALSSLWMGRPRQD  535


 Score = 55.8 bits (133),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 50/89 (56%), Gaps = 17/89 (19%)
 Frame = -2

Query  1386  FGTVQAAPSSSSFPALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpsss----------  1237
             +G +Q    SSS   L NKD   AYD+GELDQA   +L+ Q QD    S+          
Sbjct  84    YGMMQ----SSSMIFLSNKDGGAAYDLGELDQALFLYLDGQSQDHHNPSANHIHHQDQRH  139

Query  1236  --hdqQNNGMRLPNTLNMFPSEPMHVNPS  1156
                +  ++GMR P TLN+FPS+PMHV PS
Sbjct  140   LHQNNSSSGMR-PPTLNIFPSQPMHVEPS  167



>emb|CBI30045.3| unnamed protein product [Vitis vinifera]
Length=431

 Score =   353 bits (905),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 206/432 (48%), Positives = 270/432 (63%), Gaps = 45/432 (10%)
 Frame = -2

Query  1362  SSSSFPALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMF-  1186
             SSS+ P      +  AYD+GELDQA   +L+           H   N+ +R P TLN+F 
Sbjct  5     SSSAMPGNFLSKDPGAYDLGELDQALFLYLDGHDPSAIQEQRH---NSDIR-PPTLNIFP  60

Query  1185  --------------------------PSEPMH--VNPSPTA--------Legsgsgsesr  1114
                                       PSEP     NP   A         +        +
Sbjct  61    SQPMHVEPPIKASLGLVSPSTSGSKRPSEPSMELANPKNDANVSGPDQPAKAVKREGNRK  120

Query  1113  rsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALA  934
               ++SS      T + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A
Sbjct  121   GPTSSSEQEGPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLTQLEQELQRA  180

Query  933   QARGARITEngnvvgvg--hgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDE  760
             +A+G   T  G + G G     P+++T ++ + A FD+EY RW+EE HR+ CELR AV E
Sbjct  181   RAQGLIFTGGGLLGGGGGDQNAPVAVTNLSSDAAVFDMEYGRWLEEHHRLMCELRAAVQE  240

Query  759   LMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSL  580
               L EN+L+ +VD C AH+  M +L +M+AKSDV HLVSGM  TP ERCF+W+GGFRPS 
Sbjct  241   -HLPENDLRLFVDNCIAHFDGMMNLKSMVAKSDVFHLVSGMWKTPAERCFMWMGGFRPSE  299

Query  579   LLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNL  403
             ++K+I++Q+E +TEQQ LG+ GL+QSTQEAEEALSQG+E L+ ++SD I+SD+L  P N+
Sbjct  300   VIKIILNQIEPLTEQQILGICGLQQSTQEAEEALSQGLEALNQSLSDTIASDSLSAPPNM  359

Query  402   PSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRT  223
              + M QMA A+  L TL  FVRQADNLR QTI RL  +LT  Q ARC L + ++FHRLR 
Sbjct  360   ANYMGQMAIAMNKLSTLEGFVRQADNLRHQTIHRLQQVLTTRQAARCLLAMAEYFHRLRA  419

Query  222   LSALWLGRPRQD  187
             LS+LW+ RPRQ+
Sbjct  420   LSSLWMARPRQE  431



>ref|XP_010928452.1| PREDICTED: transcription factor TGA2-like [Elaeis guineensis]
Length=440

 Score =   353 bits (905),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 203/438 (46%), Positives = 268/438 (61%), Gaps = 55/438 (13%)
 Frame = -2

Query  1386  FGTVQAAPSSSSFPALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRL  1207
             FG +Q  PSSS+         + A+D+GELDQA   +LN Q                   
Sbjct  19    FGLIQ--PSSSTHGNFIKSKETGAFDLGELDQALFMYLNGQDSPSAQEQR----------  66

Query  1206  PNTLNMFPSEPMHVNP---------SPTA-----------------------------Le  1141
               TLN+FPS+PMHV P         SPT                              ++
Sbjct  67    -RTLNIFPSQPMHVEPSTKGGISFVSPTGSGTKKSSDQIMELGNPISDPPALPDTGKDIK  125

Query  1140  gsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLI  961
                    +R+  + S  G   T + KTLRRLAQNREAARK R+RKKAYVQQLE SR+KL 
Sbjct  126   AVVKKEGNRKGKSISEQGGPRTPDPKTLRRLAQNREAARKSRLRKKAYVQQLENSRIKLT  185

Query  960   QLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCE  781
             QLEQ++  A+A+G  +   G  +    G P  ++ ++ + A FD+EYA+W+EE HR  C 
Sbjct  186   QLEQELQRARAQG--LFFGGGALLGDQGFPPGISSLSSDAAMFDMEYAKWLEEHHRRMCN  243

Query  780   LRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWI  601
             LR AV E  L E EL+ +VD C AHY +M +L +++ KSDV HL++GM  TP ERCF+W+
Sbjct  244   LRAAVQE-HLPETELRMFVDNCVAHYEEMVNLKSIVIKSDVFHLIAGMWKTPAERCFMWM  302

Query  600   GGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDA  424
             G FRPS L+K+++S LE +TEQQ LG+ GL+QSTQE EEALSQG+E L+ ++SDI++SDA
Sbjct  303   GDFRPSELIKMLLSHLEPLTEQQILGVCGLQQSTQETEEALSQGLEALNQSLSDIVASDA  362

Query  423   LFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTD  244
             L  PSN+ + M QM  A++ L +L  FVRQADNLR QT  RL+ ILT  Q+ARC L + +
Sbjct  363   LSCPSNMANYMGQMVIAMSKLTSLEGFVRQADNLRQQTFHRLHQILTTRQMARCLLAIAE  422

Query  243   FFHRLRTLSALWLGRPRQ  190
             +FHRLR LS+LWL RPRQ
Sbjct  423   YFHRLRALSSLWLSRPRQ  440



>ref|XP_007204568.1| hypothetical protein PRUPE_ppa003825mg [Prunus persica]
 gb|EMJ05767.1| hypothetical protein PRUPE_ppa003825mg [Prunus persica]
Length=546

 Score =   356 bits (913),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 179/296 (60%), Positives = 225/296 (76%), Gaps = 3/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLETSR+KL QLEQ++  A+++G      G V 
Sbjct  251   DPKTLRRLAQNREAARKSRLRKKAYVQQLETSRIKLTQLEQELQRARSQGM-FFGGGIVG  309

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G   G PL +  I+ + A FD+EYARW EE HR+ CELR AV E  L ENEL+ +VD C 
Sbjct  310   GDQQGLPLGMNSISSDAAVFDIEYARWQEEHHRLMCELRAAVQE-HLPENELRLFVDNCL  368

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY ++ +L +M+AK+DV H+VSGM  TP ERCF+W+GGFRPS ++K+I++Q+E +TEQQ
Sbjct  369   AHYDEVMNLKSMVAKTDVFHIVSGMWKTPAERCFMWMGGFRPSEVIKIILNQIEPLTEQQ  428

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              LG+ GLRQSTQEAEEALSQG+E L+ ++SD I+SD+L  P N+ + M QMA A+  L T
Sbjct  429   LLGICGLRQSTQEAEEALSQGLEALNQSLSDTITSDSLSCPPNMANYMGQMAIAMNKLST  488

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  FVRQADNLR QTI RL  ILT  Q ARC L + ++FHRLR LS+LW+GRPRQD
Sbjct  489   LEGFVRQADNLRHQTIHRLQQILTTRQAARCLLAMAEYFHRLRALSSLWMGRPRQD  544



>ref|XP_009794164.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Nicotiana 
sylvestris]
Length=509

 Score =   354 bits (909),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 174/296 (59%), Positives = 225/296 (76%), Gaps = 3/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR++L QLEQ++  A+A+G       +++
Sbjct  216   DPKTLRRLAQNREAARKSRLRKKAYVQQLESSRIRLTQLEQELQRARAQGYYFG-GNSLL  274

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G     P+++  ++ + A FD+EYARW+EE HR+ CELR AV E    ENEL+ YVD C 
Sbjct  275   GGEQNLPVNMANMSSDAAVFDMEYARWLEEHHRLMCELRNAVQE-HFPENELRIYVDNCV  333

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
              HY ++ +L +ML KSDV HLVSGM  TP ERCF+W+GGFRPS LLK+I+SQ+E +TEQQ
Sbjct  334   THYDEIMNLKSMLTKSDVFHLVSGMWKTPAERCFMWMGGFRPSELLKIILSQIEPLTEQQ  393

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              +G+ GL+QSTQEAE+ALSQG+E L+H++SD I+SDAL  P N+ + M QMA A+  L T
Sbjct  394   LMGICGLQQSTQEAEDALSQGLEALNHSLSDTIASDALSCPQNMANYMGQMALAMNKLST  453

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  FVRQADNLR QTI RL+ +LT  Q ARCFL + ++FHRLR LS+LW  RPRQ+
Sbjct  454   LEGFVRQADNLRHQTIHRLHQLLTTRQAARCFLAIAEYFHRLRALSSLWHARPRQE  509


 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 4/65 (6%)
 Frame = -2

Query  1344  ALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMFPSEPMHV  1165
             +L +KD++ AYD+GELDQA   +L+ Q             N+GMR P TLN+FPS+PMHV
Sbjct  88    SLISKDSAGAYDLGELDQALFQYLDGQEPSSIQEQRQ---NSGMR-PPTLNIFPSQPMHV  143

Query  1164  NPSPT  1150
              PS T
Sbjct  144   EPSTT  148



>gb|KHG19393.1| hypothetical protein F383_24687 [Gossypium arboreum]
Length=391

 Score =   350 bits (898),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 224/296 (76%), Gaps = 3/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR++L QLEQ++  A+A+G      GN++
Sbjct  97    DPKTLRRLAQNREAARKSRLRKKAYVQQLESSRIRLTQLEQELQRARAQGM-FFGGGNML  155

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G   G P+ +  IT E A FD+EY RW+EE HR+ CELR AV E  L ENEL+ YVD C 
Sbjct  156   GGEQGLPVGINNITSEAAMFDMEYGRWVEEHHRLMCELRAAVQE-HLPENELRVYVDNCL  214

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AH+ ++ +L  M AK+DV HLVSGM  TP ERCF+WI GFRPS L+KVI++Q+E +TEQQ
Sbjct  215   AHFDEVMNLKGMAAKTDVFHLVSGMWKTPAERCFMWIAGFRPSHLIKVILNQIEPLTEQQ  274

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              +G+  L+QSTQEAEEALSQG+E L+ ++SDII+SD+L  P N+ + M QMA AI  L T
Sbjct  275   IMGICALQQSTQEAEEALSQGLEALNQSLSDIITSDSLSCPPNMSNYMGQMAIAINKLST  334

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  FVRQADNLR Q I RL+ ILT+ Q ARC L + ++FHRLR LS+LWL RPRQ+
Sbjct  335   LEGFVRQADNLRHQAIHRLHQILTIRQAARCLLAIAEYFHRLRALSSLWLARPRQE  390



>ref|XP_008241036.1| PREDICTED: transcription factor TGA2 [Prunus mume]
Length=520

 Score =   354 bits (909),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 179/296 (60%), Positives = 225/296 (76%), Gaps = 3/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLETSR+KL QLEQ++  A+++G      G V 
Sbjct  225   DPKTLRRLAQNREAARKSRLRKKAYVQQLETSRIKLTQLEQELQRARSQGM-FFGGGIVG  283

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G   G PL +  I+ + A FD+EYARW EE HR+ CELR AV E  L ENEL+ +VD C 
Sbjct  284   GDQQGLPLGMNSISSDAAVFDIEYARWQEEHHRLMCELRAAVQE-HLPENELRLFVDNCL  342

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY ++ +L +M+AK+DV H+VSGM  TP ERCF+W+GGFRPS ++K+I++Q+E +TEQQ
Sbjct  343   AHYDEVMNLKSMVAKTDVFHIVSGMWKTPAERCFMWMGGFRPSEVIKIILNQIEPLTEQQ  402

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              LG+ GLRQSTQEAEEALSQG+E L+ ++SD I+SD+L  P N+ + M QMA A+  L T
Sbjct  403   LLGICGLRQSTQEAEEALSQGLEALNQSLSDTITSDSLSCPPNMANYMGQMAIAMNKLST  462

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  FVRQADNLR QTI RL  ILT  Q ARC L + ++FHRLR LS+LW+GRPRQD
Sbjct  463   LEGFVRQADNLRHQTIHRLQQILTTRQAARCLLAMAEYFHRLRALSSLWMGRPRQD  518



>gb|KDP24594.1| hypothetical protein JCGZ_25510 [Jatropha curcas]
Length=507

 Score =   353 bits (907),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 176/296 (59%), Positives = 226/296 (76%), Gaps = 3/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR++L QLEQ++  A+A+       G ++
Sbjct  214   DPKTLRRLAQNREAARKSRLRKKAYVQQLESSRIRLTQLEQELQRARAQ-GLFFGGGGLM  272

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G   G P+ +  I+ + A FD+EYARW+EE HR+TCELR AV E  L ENEL+ +VD C 
Sbjct  273   GGDQGLPIGINNISSDAAVFDIEYARWLEEHHRLTCELRAAVQE-HLPENELRLFVDNCL  331

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY ++  L  M+AKSDV HLVSGM  TP ERCF+W+GGFRPS L+K+I++Q+E +TEQQ
Sbjct  332   AHYDEVISLKGMVAKSDVFHLVSGMWKTPAERCFMWMGGFRPSELIKIILNQIEPLTEQQ  391

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              LG+ GL+QSTQEAEEALSQG+E L+ ++SD I+SD+L  P N+ + M QMA A+  L T
Sbjct  392   ILGICGLQQSTQEAEEALSQGLEALNQSLSDTIASDSLSCPPNMANYMGQMAVAMNKLST  451

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  FVRQADNLR QT+ RL+ ILT  Q ARCFL + ++FHRLR LS+LW+ RPRQ+
Sbjct  452   LEGFVRQADNLRHQTLHRLHQILTTRQAARCFLAIAEYFHRLRALSSLWMARPRQE  507



>ref|XP_006575223.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X3 [Glycine 
max]
Length=382

 Score =   348 bits (894),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 173/296 (58%), Positives = 227/296 (77%), Gaps = 2/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL Q+EQ++  A+A+G  +     ++
Sbjct  87    DPKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLNQIEQELQRARAQGILMGGGNALL  146

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G   G  ++++ I+ E A FDVEYARW+EE HRI CELR  + E  L ENEL+ YVD C 
Sbjct  147   GGEQGFHMAMSGISSEAAIFDVEYARWLEEHHRIVCELRAVLQE-HLHENELRLYVDNCL  205

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY Q+ +L +M+AK+DV HLV G+  TP ERCF+WIGGFRPS L+K+I+ Q+E +TEQQ
Sbjct  206   AHYDQVMNLKSMVAKTDVFHLVFGVWKTPAERCFMWIGGFRPSELIKIILGQIEPLTEQQ  265

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              LG+ GL+QSTQEAEEALSQG++ L+ ++S+ I+SD+L+ P N+ + M QMA AI  L T
Sbjct  266   ILGICGLQQSTQEAEEALSQGLDALNQSLSETITSDSLWCPPNMTNYMGQMAVAINKLST  325

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L +FVRQADNLR QTI RL+ +LT  Q ARC + ++++FHRLR LS+LW  RPRQD
Sbjct  326   LESFVRQADNLRHQTIHRLHQLLTTRQAARCLVAISEYFHRLRALSSLWSTRPRQD  381



>ref|XP_007028940.1| BZIP transcription factor family protein [Theobroma cacao]
 gb|EOY09442.1| BZIP transcription factor family protein [Theobroma cacao]
Length=482

 Score =   352 bits (902),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 177/296 (60%), Positives = 227/296 (77%), Gaps = 4/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR++L QLEQ++  A+A+G      G V+
Sbjct  189   DPKTLRRLAQNREAARKSRLRKKAYVQQLESSRIRLTQLEQELQRARAQGMFFG--GGVL  246

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G   G P+ +  I+ + A FD+EYARW+EE HR+ CELR AV E  L ENEL+ +VD C 
Sbjct  247   GGEQGLPVGINNISSDAAVFDIEYARWLEEHHRLMCELRAAVQE-HLPENELRIFVDNCL  305

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AH+ ++ +L +M+AK+DV HLVSGM  TP ERCF W+GGFRPS L+KVI++Q+E +TEQQ
Sbjct  306   AHFDELMNLKSMVAKTDVFHLVSGMWKTPAERCFTWMGGFRPSELIKVILNQIEPLTEQQ  365

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              +G+  L+QSTQEAEEALSQG+E L+ ++SDII+SD+L  P N+ + M QMA A+  L T
Sbjct  366   IMGICALQQSTQEAEEALSQGLEALNQSLSDIITSDSLSCPPNMTNYMGQMAIAMNKLAT  425

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  FVRQADNLR QTI RL+ ILT  Q ARCFL + ++FHRLR LS+LWL RPRQ+
Sbjct  426   LEGFVRQADNLRHQTIHRLHQILTTRQAARCFLAIAEYFHRLRALSSLWLARPRQE  481



>ref|XP_004497935.1| PREDICTED: transcription factor HBP-1b(c1)-like [Cicer arietinum]
Length=506

 Score =   352 bits (902),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 195/421 (46%), Positives = 267/421 (63%), Gaps = 43/421 (10%)
 Frame = -2

Query  1326  NSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQN-NGMRLPNTLNMFPSEPMHVNPSPT  1150
             +S  YD+GELDQAF  +L+ Q           + + +GM+ P TLN+FPS+PMHV P P+
Sbjct  88    DSSTYDLGELDQAFFLYLDGQADPSSLQDQRQESSFSGMKPPPTLNIFPSQPMHVAPPPS  147

Query  1149  ALegsgsgsesrrsstssgggrggTLN------------AKTLRRLAQNREA--------  1030
               + S      + S +         L             +K++ +   NR+         
Sbjct  148   NSKASMGLPSPQTSGSKKQSQPSVELANQRNETLSAPAPSKSIIKRENNRKGTTSSSEQE  207

Query  1029  -------------------ARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITE  907
                                ARK R+RKKAYVQQLETSR+KL QLEQ++  A+A+G  +  
Sbjct  208   GPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLETSRIKLNQLEQELQRARAQGM-LMG  266

Query  906   ngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRY  727
              G ++G   G P+S+  IT E A FD+EY RW+EE HR+ CELR AV E  L+ENEL+ Y
Sbjct  267   GGAILGGDQGMPISMNSITSEAAMFDMEYGRWLEEHHRLVCELRAAVQE-HLNENELRIY  325

Query  726   VDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-  550
             V+ C +HY Q+ +L  +LA++DV HLV GM  TP ERCF+WIGGFRPS L+KVI+SQ+E 
Sbjct  326   VENCLSHYDQVMNLKTILARTDVFHLVFGMWKTPAERCFMWIGGFRPSELIKVIISQIEP  385

Query  549   VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAI  370
             +TEQQ LG+ GL+QSTQ+AE+ALSQG++ L+ ++S  I+SD+L  P N+ + M QMA A+
Sbjct  386   LTEQQILGICGLQQSTQQAEDALSQGLDALNQSVSQTITSDSLSCPPNMTNYMGQMALAM  445

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L +L  FVRQADNLR QTI RL+ +LT+ Q ARC + ++++FHRLR LS+LWL RPRQ
Sbjct  446   NKLSSLEGFVRQADNLRHQTIHRLHQMLTIRQAARCLVAMSEYFHRLRALSSLWLTRPRQ  505

Query  189   D  187
             +
Sbjct  506   E  506



>ref|XP_003519053.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Glycine 
max]
 gb|KHM98984.1| Transcription factor HBP-1b(c1) [Glycine soja]
Length=484

 Score =   351 bits (900),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/296 (58%), Positives = 227/296 (77%), Gaps = 2/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL Q+EQ++  A+A+G  +     ++
Sbjct  189   DPKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLNQIEQELQRARAQGILMGGGNALL  248

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G   G  ++++ I+ E A FDVEYARW+EE HRI CELR  + E  L ENEL+ YVD C 
Sbjct  249   GGEQGFHMAMSGISSEAAIFDVEYARWLEEHHRIVCELRAVLQE-HLHENELRLYVDNCL  307

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY Q+ +L +M+AK+DV HLV G+  TP ERCF+WIGGFRPS L+K+I+ Q+E +TEQQ
Sbjct  308   AHYDQVMNLKSMVAKTDVFHLVFGVWKTPAERCFMWIGGFRPSELIKIILGQIEPLTEQQ  367

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              LG+ GL+QSTQEAEEALSQG++ L+ ++S+ I+SD+L+ P N+ + M QMA AI  L T
Sbjct  368   ILGICGLQQSTQEAEEALSQGLDALNQSLSETITSDSLWCPPNMTNYMGQMAVAINKLST  427

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L +FVRQADNLR QTI RL+ +LT  Q ARC + ++++FHRLR LS+LW  RPRQD
Sbjct  428   LESFVRQADNLRHQTIHRLHQLLTTRQAARCLVAISEYFHRLRALSSLWSTRPRQD  483


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 47/83 (57%), Gaps = 5/83 (6%)
 Frame = -2

Query  1401  NNQTCFGTVQAAPSSSSFPALGN--KDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdq  1228
             + Q  FG +   PSSSS    GN    +S AYD+GELDQAF  +L+ Q            
Sbjct  42    DQQISFGML---PSSSSASIPGNFLSKDSGAYDLGELDQAFFLYLDGQADPSSVQDQKQN  98

Query  1227  QNNGMRLPNTLNMFPSEPMHVNP  1159
              ++GMR P TLN+FPS+PMH  P
Sbjct  99    SSSGMRPPPTLNIFPSQPMHAVP  121



>ref|XP_004309443.1| PREDICTED: transcription factor HBP-1b(c1)-like [Fragaria vesca 
subsp. vesca]
Length=536

 Score =   352 bits (904),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 209/455 (46%), Positives = 282/455 (62%), Gaps = 61/455 (13%)
 Frame = -2

Query  1386  FGTVQAAPSSSSFPA---LGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshd-----  1231
             + T+Q  PSSS+ P+   +G+  +S AYD+GELDQA   +L+ Q Q+             
Sbjct  85    YATMQ--PSSSNIPSVNFIGSSKDSGAYDLGELDQALFLYLDGQQQEHHHHHQAPHHVQD  142

Query  1230  ---qQNNGMRLPNTLNMF------------------------------PSEP--------  1174
                Q ++GMR P TLN+F                              PSEP        
Sbjct  143   QRHQTSSGMR-PPTLNIFPSQPMHVEPSSTKGVSTAGIVSSATSGSKRPSEPSMELANPR  201

Query  1173  -----MHVNPSPTALegsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIR  1009
                      P   A      G+    +++SS      T + KTLRRLAQNREAARK R+R
Sbjct  202   KIDAAAPSGPPEPAKTIKREGNRKGPTTSSSEQEGPKTPDPKTLRRLAQNREAARKSRLR  261

Query  1008  KKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFD  829
             KKAYVQQLE+SR+KL QLEQ++  A+ +G  I   G +VG   G P+ +  I+ + A FD
Sbjct  262   KKAYVQQLESSRIKLTQLEQELQRARTQG--IFFGGGLVGAEQGVPVGINNISSDAAVFD  319

Query  828   VEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHL  649
             +EYARW+EE HR+ CELR AV E  L ENEL+ +VD C AHY ++ +L +M+AK+DV H+
Sbjct  320   IEYARWLEEHHRLMCELRAAVQE-HLPENELRLFVDNCLAHYDEVMNLKSMVAKTDVFHI  378

Query  648   VSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQG  472
              SGM  TP ERCF+W+GGFRPS ++K+I++Q+E +TEQQ + +  L+QST EAE+AL+QG
Sbjct  379   FSGMWKTPAERCFMWMGGFRPSEVIKIIVTQIEPLTEQQLMAICSLQQSTSEAEDALTQG  438

Query  471   METLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYH  292
             +E L+ ++SD I+SD+L  P N+ + M QMA A+  L TL  FVRQADNLR+QTI RL  
Sbjct  439   LEALNQSLSDTIASDSLSMPPNMANYMGQMALAMNKLSTLEGFVRQADNLRLQTIHRLQT  498

Query  291   ILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             +LT  Q ARC L + ++FHRLR LS+LW+GRPRQD
Sbjct  499   LLTTRQSARCLLAIAEYFHRLRALSSLWMGRPRQD  533



>gb|KEH23667.1| BZIP family transcription factor [Medicago truncatula]
Length=363

 Score =   346 bits (887),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 183/364 (50%), Positives = 243/364 (67%), Gaps = 27/364 (7%)
 Frame = -2

Query  1206  PNTLNMFPSEPMHVNPS-----------------------PTALegsgsgsesrrsstss  1096
             P TLN+FPS+PMHV PS                       P         +  +  ++SS
Sbjct  3     PPTLNIFPSQPMHVEPSSSNSKASMDLVSPQTSGSKKGSEPPKAVKPREKNHGKGPTSSS  62

Query  1095  gggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGAR  916
                   T + K LRRLAQNREAARK R+RKKAY+QQLE+SR+KL Q+EQ++  A+ +G  
Sbjct  63    EHEGPKTPDPKILRRLAQNREAARKSRLRKKAYIQQLESSRIKLNQMEQELHHARNQGMF  122

Query  915   ITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENEL  736
                   + G       S+  I+ E A FDVEYARW+EE HR+ CELR AV E  + ENEL
Sbjct  123   FGGGAMLGGEQGLP--SMNTISSEAAMFDVEYARWLEEHHRLVCELRAAVHE-HIPENEL  179

Query  735   KRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQ  556
             + +VD   A Y Q+  L +++AK+D+ HLVSGM  TP+ERCF+WIGGF+PS L+K+I+SQ
Sbjct  180   RMFVDKFLAQYDQVAQLKSLVAKADIFHLVSGMWVTPIERCFMWIGGFKPSELIKIIVSQ  239

Query  555   LE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMA  379
             +E +TEQQ +G+ GL+QSTQ+ E+ALSQG+E L+ T+S+ I+SD+L YP N+ + M QMA
Sbjct  240   IEPLTEQQIMGIYGLQQSTQQGEDALSQGLEALNQTLSETITSDSLSYPPNMTNYMDQMA  299

Query  378   AAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGR  199
              A+  L TL +FVR+ADNLR QTI RL  ILT  Q ARCFL + ++FHR+R LS+LWL R
Sbjct  300   RAMNKLSTLESFVREADNLRHQTIHRLNQILTTRQAARCFLAMAEYFHRMRALSSLWLAR  359

Query  198   PRQD  187
             PRQ+
Sbjct  360   PRQE  363



>ref|XP_002275147.1| PREDICTED: transcription factor TGA2 [Vitis vinifera]
Length=491

 Score =   350 bits (898),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 202/417 (48%), Positives = 264/417 (63%), Gaps = 45/417 (11%)
 Frame = -2

Query  1317  AYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMF----------------  1186
             AYD+GELDQA   +L+           H   N+ +R P TLN+F                
Sbjct  80    AYDLGELDQALFLYLDGHDPSAIQEQRH---NSDIR-PPTLNIFPSQPMHVEPPIKASLG  135

Query  1185  -----------PSEPMH--VNPSPTA--------LegsgsgsesrrsstssgggrggTLN  1069
                        PSEP     NP   A         +        +  ++SS      T +
Sbjct  136   LVSPSTSGSKRPSEPSMELANPKNDANVSGPDQPAKAVKREGNRKGPTSSSEQEGPKTPD  195

Query  1068  AKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvvg  889
              KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+A+G   T  G + G
Sbjct  196   PKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLTQLEQELQRARAQGLIFTGGGLLGG  255

Query  888   vg--hgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
              G     P+++T ++ + A FD+EY RW+EE HR+ CELR AV E  L EN+L+ +VD C
Sbjct  256   GGGDQNAPVAVTNLSSDAAVFDMEYGRWLEEHHRLMCELRAAVQE-HLPENDLRLFVDNC  314

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AH+  M +L +M+AKSDV HLVSGM  TP ERCF+W+GGFRPS ++K+I++Q+E +TEQ
Sbjct  315   IAHFDGMMNLKSMVAKSDVFHLVSGMWKTPAERCFMWMGGFRPSEVIKIILNQIEPLTEQ  374

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q LG+ GL+QSTQEAEEALSQG+E L+ ++SD I+SD+L  P N+ + M QMA A+  L 
Sbjct  375   QILGICGLQQSTQEAEEALSQGLEALNQSLSDTIASDSLSAPPNMANYMGQMAIAMNKLS  434

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             TL  FVRQADNLR QTI RL  +LT  Q ARC L + ++FHRLR LS+LW+ RPRQ+
Sbjct  435   TLEGFVRQADNLRHQTIHRLQQVLTTRQAARCLLAMAEYFHRLRALSSLWMARPRQE  491



>gb|KHG26518.1| hypothetical protein F383_02381 [Gossypium arboreum]
Length=381

 Score =   346 bits (887),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 174/296 (59%), Positives = 226/296 (76%), Gaps = 3/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR++L QLEQ++  A+ +G      GN++
Sbjct  87    DPKTLRRLAQNREAARKSRLRKKAYVQQLESSRIRLTQLEQELQRARTQGM-FFGGGNIL  145

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G   G P+ +  I+P+ A FD+EY RW+EE HR+ CELR AV E  L ENEL+ +VD C 
Sbjct  146   GGDQGLPVGINNISPDAALFDMEYTRWLEEHHRLMCELRAAVQE-HLPENELRIFVDNCL  204

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AH  Q+ +L +M+AK+DV HLVSGM  TP ERCF+W+GGFRPS L+KVI++Q+E +TEQQ
Sbjct  205   AHLDQVMNLKSMVAKTDVFHLVSGMWKTPAERCFMWMGGFRPSDLIKVILNQIEPLTEQQ  264

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              +G+  L+QSTQEAEEAL+QG+E L+ ++SDII+SD+L  P N+ + M QMA AI  L T
Sbjct  265   IMGICALQQSTQEAEEALTQGLEALNQSVSDIITSDSLSCPPNMANYMGQMAVAINKLST  324

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             +  FVRQADNLR Q I RL+ ILT+ Q ARC L + ++FHRLR LS+LWL RPR+D
Sbjct  325   IEGFVRQADNLRHQAILRLHQILTIRQAARCLLAIAEYFHRLRALSSLWLARPRED  380



>ref|XP_010943572.1| PREDICTED: transcription factor HBP-1b(c38)-like [Elaeis guineensis]
Length=442

 Score =   346 bits (887),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 174/296 (59%), Positives = 225/296 (76%), Gaps = 4/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE SR+KL QLEQ++  A+A+G      G ++
Sbjct  150   DPKTLRRLAQNREAARKSRLRKKAYVQQLENSRIKLTQLEQELQRARAQGFFFG--GALL  207

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G   G P S++ ++ + A FD+EYARW+EE HR  CELR AV E  L ENEL+ +V+ C 
Sbjct  208   GEQGGFPPSISALSSDAAMFDMEYARWLEEHHRRMCELRAAVQE-HLPENELRMFVENCL  266

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY +M +L +++ KSDV HL+SGM  TP ERCF+W+GGFRPS L+K+++S +E +TEQQ
Sbjct  267   AHYDEMINLKSLVIKSDVFHLISGMWKTPAERCFLWMGGFRPSELIKMLLSHIEPLTEQQ  326

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              LG+ GL+QSTQE EEALSQG+E LH ++ D ++SDAL  PSN+ + M QMA A+  L T
Sbjct  327   ILGVCGLQQSTQETEEALSQGLEALHQSLLDTVTSDALSCPSNMANYMGQMAIAMNKLTT  386

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  FVRQADNLR QT+ RL+HILT  Q+ARC L + ++FHRLR LS+LWL RPRQ+
Sbjct  387   LEGFVRQADNLRHQTLHRLHHILTTRQMARCLLAIAEYFHRLRALSSLWLARPRQE  442



>ref|XP_008367369.1| PREDICTED: transcription factor HBP-1b(c38)-like [Malus domestica]
Length=542

 Score =   349 bits (896),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 173/296 (58%), Positives = 221/296 (75%), Gaps = 3/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLETSR+KL QLEQ++  A+++       G V 
Sbjct  247   DPKTLRRLAQNREAARKSRLRKKAYVQQLETSRIKLTQLEQELQRARSQ-GMFFGGGJVG  305

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G     P+ +   + + A FD+EYARW+EE HR+ CELR AV E  L ENEL+ YVD C 
Sbjct  306   GEQQSLPVGINNTSSDAAVFDMEYARWLEEHHRLMCELRAAVQE-HLPENELRLYVDNCL  364

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY ++ +L  M+AK+DV H+VSGM  TP ERCF+W+GGFRPS ++K+I++Q+E +TEQQ
Sbjct  365   AHYDEVLNLKGMVAKTDVFHIVSGMWKTPAERCFMWMGGFRPSEVIKIILNQIEPLTEQQ  424

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              LG+ GL+QSTQE EEALSQG+E L+ ++S+ I+SD+L  P N+ + M QMA A+  L T
Sbjct  425   LLGICGLQQSTQETEEALSQGLEALNQSLSETITSDSLSCPPNMANYMGQMAIAMNKLST  484

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  FVRQADNLR QTI RL  ILT  Q ARC L + ++FHRLR LS+LW+GRPRQD
Sbjct  485   LEGFVRQADNLRQQTIYRLQQILTTRQAARCLLAIAEYFHRLRALSSLWMGRPRQD  540


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 54/92 (59%), Gaps = 18/92 (20%)
 Frame = -2

Query  1386  FGTVQAAPSSSSFPA---LGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpsss-------  1237
             +G +Q+  SS++ PA   + NKD   AYD+GELDQA   +L+ Q QD    S+       
Sbjct  84    YGMMQS--SSANIPAGNFISNKDGGAAYDLGELDQALFLYLDGQSQDHHNPSANHVHHQD  141

Query  1236  -----hdqQNNGMRLPNTLNMFPSEPMHVNPS  1156
                   +  ++GMR P TLN+FPS+PMHV PS
Sbjct  142   QRHLHQNNSSSGMR-PPTLNIFPSQPMHVEPS  172



>ref|XP_009794165.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Nicotiana 
sylvestris]
Length=506

 Score =   347 bits (891),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 173/296 (58%), Positives = 224/296 (76%), Gaps = 6/296 (2%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR++L QLEQ++  A+A+G       +++
Sbjct  216   DPKTLRRLAQNREAARKSRLRKKAYVQQLESSRIRLTQLEQELQRARAQGYYFG-GNSLL  274

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G     P+++  ++   + FD+EYARW+EE HR+ CELR AV E    ENEL+ YVD C 
Sbjct  275   GGEQNLPVNMANMS---SVFDMEYARWLEEHHRLMCELRNAVQE-HFPENELRIYVDNCV  330

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
              HY ++ +L +ML KSDV HLVSGM  TP ERCF+W+GGFRPS LLK+I+SQ+E +TEQQ
Sbjct  331   THYDEIMNLKSMLTKSDVFHLVSGMWKTPAERCFMWMGGFRPSELLKIILSQIEPLTEQQ  390

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              +G+ GL+QSTQEAE+ALSQG+E L+H++SD I+SDAL  P N+ + M QMA A+  L T
Sbjct  391   LMGICGLQQSTQEAEDALSQGLEALNHSLSDTIASDALSCPQNMANYMGQMALAMNKLST  450

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  FVRQADNLR QTI RL+ +LT  Q ARCFL + ++FHRLR LS+LW  RPRQ+
Sbjct  451   LEGFVRQADNLRHQTIHRLHQLLTTRQAARCFLAIAEYFHRLRALSSLWHARPRQE  506


 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 4/65 (6%)
 Frame = -2

Query  1344  ALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMFPSEPMHV  1165
             +L +KD++ AYD+GELDQA   +L+ Q             N+GMR P TLN+FPS+PMHV
Sbjct  88    SLISKDSAGAYDLGELDQALFQYLDGQEPSSIQEQRQ---NSGMR-PPTLNIFPSQPMHV  143

Query  1164  NPSPT  1150
              PS T
Sbjct  144   EPSTT  148



>ref|XP_009391827.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=440

 Score =   344 bits (882),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 192/411 (47%), Positives = 256/411 (62%), Gaps = 46/411 (11%)
 Frame = -2

Query  1317  AYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMFPSEPMHVNP-------  1159
             AYD+GELDQA   +L+ Q     P+              TLN+FPS+PMHV P       
Sbjct  42    AYDLGELDQALFMYLDGQDHSSSPAQEQR---------QTLNIFPSQPMHVEPSTKGGMS  92

Query  1158  --SPTALegsgsg------------------------sesrrsstssgggrggTLNAKTL  1057
               SP +     S                         + S +     G     T + KTL
Sbjct  93    LDSPASSGSKKSSDQAMELGDTKNDLPLLPERGKDSKAASVKEGNGKGTSGSKTSDPKTL  152

Query  1056  RRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvvgvghg  877
             RRLAQNREAARK R+RKKAY+QQLETSR+KL  LEQ++  A+++G  ++  G  +    G
Sbjct  153   RRLAQNREAARKSRLRKKAYIQQLETSRIKLTHLEQELQRARSQG--LSFGGGALLEDQG  210

Query  876   HPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFAHYAQ  697
              P  +  ++ + A FD+EY RW+EE HR+ CELR AV E    EN L+ +VD+C AH+ Q
Sbjct  211   LPAVVGGLSADAAMFDMEYMRWLEEHHRLMCELRAAVQEHQ-PENHLRMFVDSCLAHHDQ  269

Query  696   MTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMI  520
             M +L  ++ +SDV HL+SG+  TP ERCF+W+GGFRPS L+K+++S +E +TE+Q LG+ 
Sbjct  270   MVNLKNIVIRSDVFHLISGVWMTPAERCFMWMGGFRPSELIKMLLSHMEPLTEEQILGVC  329

Query  519   GLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYTLHTFV  340
             GL+QSTQE EEALSQG+E L+ ++SD I+SDAL YPSN+   M QMA A+  L TL  F+
Sbjct  330   GLQQSTQETEEALSQGLEALNQSLSDTITSDALSYPSNVADYMGQMAMAMNKLTTLEGFI  389

Query  339   RQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             RQADNLR QT+ RLY ILT  Q+AR  L + ++ HRLR LS+LWL RPR +
Sbjct  390   RQADNLRQQTLHRLYQILTTRQMARSLLAIAEYCHRLRALSSLWLARPRHE  440



>ref|XP_011075176.1| PREDICTED: transcription factor HBP-1b(c38) [Sesamum indicum]
Length=506

 Score =   346 bits (887),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 206/454 (45%), Positives = 278/454 (61%), Gaps = 53/454 (12%)
 Frame = -2

Query  1401  NNQTCFGTVQAAPSSSSFPALG-------NKDNSEAYDVGELDQAFLHFLNAqpqdqdps  1243
             +NQ  FG +Q++ SSS+ P  G       +KD   AYD+GELDQA   +L++Q       
Sbjct  57    SNQISFGMMQSSSSSSAAPIPGPAGTFTISKDGG-AYDLGELDQALFLYLDSQDHQSAQD  115

Query  1242  sshdqQNNGMRLPNT--------LNMFPSEPMHVNPS-----------------------  1156
                   N+GM  P+T        +++ PS      PS                       
Sbjct  116   QQRQN-NSGMMRPHTLNIFPSQPMHVHPSPTTTSKPSSTAGLVSPATSASKRSSEPSMEL  174

Query  1155  ----------PTALegsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRK  1006
                       P   +        +  ++SS      T + KTLRRLAQNREAARK R+RK
Sbjct  175   SNPRNDVASAPQPAKAVKREGNRKGPTSSSEQEGPKTPDPKTLRRLAQNREAARKSRLRK  234

Query  1005  KAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDV  826
             KAYVQQLE+SR++L QLEQ++  A+++G  +  N  + G      +++  +  + A FD+
Sbjct  235   KAYVQQLESSRVRLTQLEQEIQRARSQGFYVGGNAVLGGDQGMS-VAMGNMNSDTAVFDM  293

Query  825   EYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLV  646
             EYARW+EE HR+  ELR AV E  L ENEL+ +VD C AHY QM +L +M+AKSDV HL+
Sbjct  294   EYARWLEEHHRLMVELRNAVHE-HLPENELRIFVDNCLAHYDQMINLKSMIAKSDVFHLI  352

Query  645   SGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGM  469
             SG   TP ERCF+W+GGFRPS L+K+I+SQ+E +TEQQ +G+ G++QSTQEAEEALSQG+
Sbjct  353   SGTWKTPAERCFMWMGGFRPSELIKIILSQIEALTEQQLVGICGVQQSTQEAEEALSQGL  412

Query  468   ETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHI  289
             E L+ ++S+ I+SD+L  P N+ + M QMA AI  L TL  FVRQADNLR QT+ RL+ I
Sbjct  413   EALNTSLSETITSDSLTIPPNMNTYMGQMALAINKLSTLEGFVRQADNLRQQTLHRLHQI  472

Query  288   LTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             LT  Q ARCFL + ++F RLR LS+LWL RPRQ+
Sbjct  473   LTTRQAARCFLAIAEYFPRLRALSSLWLARPRQE  506



>gb|KCW90292.1| hypothetical protein EUGRSUZ_A02436 [Eucalyptus grandis]
Length=376

 Score =   341 bits (875),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 170/296 (57%), Positives = 223/296 (75%), Gaps = 4/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAY+QQLE+SRMKL QLEQ++  A+++G  I   G  V
Sbjct  84    DPKTLRRLAQNREAARKSRLRKKAYIQQLESSRMKLSQLEQELQRARSQG--IYVGGGAV  141

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
                 G P+ ++ I+ + A FD+EY RW+EE HR+ CELR AV E  L ENEL+ +VD   
Sbjct  142   VGEQGLPVGISNISTDAAVFDMEYTRWLEEHHRLMCELRAAVQE-HLPENELRLFVDNTL  200

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY +M +L +M+AKSDV HLVSGM  TP ERCF+W+G FRPS L+KV+++ +E +TEQQ
Sbjct  201   AHYNEMMNLKSMVAKSDVFHLVSGMWRTPAERCFMWMGDFRPSELIKVVLNHIEPLTEQQ  260

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              LG+ GL+QSTQ AEEALSQG+E L+H++S+ I+SD+L  P N+ + M QMA A+  L T
Sbjct  261   ILGICGLQQSTQGAEEALSQGLEALNHSLSETIASDSLISPPNMANYMGQMAVAMNKLST  320

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  FVRQADNLR QT+ R+  ILT  Q ARC + ++++F+RLR LS+LWL RPRQ+
Sbjct  321   LEGFVRQADNLRHQTLHRMLQILTTRQAARCLIAISEYFYRLRALSSLWLSRPRQE  376



>ref|XP_009391826.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=441

 Score =   343 bits (881),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 191/412 (46%), Positives = 256/412 (62%), Gaps = 47/412 (11%)
 Frame = -2

Query  1317  AYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMFPSEPMHVNP-------  1159
             AYD+GELDQA   +L+ Q     P+              TLN+FPS+PMHV P       
Sbjct  42    AYDLGELDQALFMYLDGQDHSSSPAQEQR---------QTLNIFPSQPMHVEPSTKGGMS  92

Query  1158  --SPTALegsgsg-------------------------sesrrsstssgggrggTLNAKT  1060
               SP +     S                          +  ++     G     T + KT
Sbjct  93    LDSPASSGSKKSSDQAMELGDTKNDLPLLPERGKDSKAASVKKEGNGKGTSGSKTSDPKT  152

Query  1059  LRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvvgvgh  880
             LRRLAQNREAARK R+RKKAY+QQLETSR+KL  LEQ++  A+++G  ++  G  +    
Sbjct  153   LRRLAQNREAARKSRLRKKAYIQQLETSRIKLTHLEQELQRARSQG--LSFGGGALLEDQ  210

Query  879   gHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFAHYA  700
             G P  +  ++ + A FD+EY RW+EE HR+ CELR AV E    EN L+ +VD+C AH+ 
Sbjct  211   GLPAVVGGLSADAAMFDMEYMRWLEEHHRLMCELRAAVQEHQ-PENHLRMFVDSCLAHHD  269

Query  699   QMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGM  523
             QM +L  ++ +SDV HL+SG+  TP ERCF+W+GGFRPS L+K+++S +E +TE+Q LG+
Sbjct  270   QMVNLKNIVIRSDVFHLISGVWMTPAERCFMWMGGFRPSELIKMLLSHMEPLTEEQILGV  329

Query  522   IGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYTLHTF  343
              GL+QSTQE EEALSQG+E L+ ++SD I+SDAL YPSN+   M QMA A+  L TL  F
Sbjct  330   CGLQQSTQETEEALSQGLEALNQSLSDTITSDALSYPSNVADYMGQMAMAMNKLTTLEGF  389

Query  342   VRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             +RQADNLR QT+ RLY ILT  Q+AR  L + ++ HRLR LS+LWL RPR +
Sbjct  390   IRQADNLRQQTLHRLYQILTTRQMARSLLAIAEYCHRLRALSSLWLARPRHE  441



>ref|XP_006290099.1| hypothetical protein CARUB_v10003744mg [Capsella rubella]
 gb|EOA22997.1| hypothetical protein CARUB_v10003744mg [Capsella rubella]
Length=421

 Score =   343 bits (879),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 195/402 (49%), Positives = 259/402 (64%), Gaps = 22/402 (5%)
 Frame = -2

Query  1338  GNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdq---------QNNGMRLP-NTLNM  1189
             GN  N + YD+GE+D +   +L+ Q     PS++            QN  MR P +TLN+
Sbjct  23    GNFMNKDGYDIGEIDPSLFLYLDGQGHHDPPSTAPSSLPHHYHHTTQNLAMRPPTSTLNI  82

Query  1188  FPSEPMHVNPSPTALegsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIR  1009
             FPS+PMH+ P P++        +   SS           + KTLRRLAQNREAARK R+R
Sbjct  83    FPSQPMHIEPPPSSTPNKEGNRKGPASSDHDIPKSS---DPKTLRRLAQNREAARKSRLR  139

Query  1008  KKAYVQQLETSRMKLIQLEQQVALAQARGARIT-EngnvvgvghgHPLSLTKITP-EGAA  835
             KKAYVQQLE+ R+KL QLEQ++  A+++G               G P+    I+  E A 
Sbjct  140   KKAYVQQLESCRIKLTQLEQEIQRARSQGVFFGGSLIGGDQQQGGLPIGSGSISSAEAAV  199

Query  834   FDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVL  655
             FD+EYARW+EE+ R+  ELR A  E  L+ENEL+ +VD C AHY  + +L AM+AK+DV 
Sbjct  200   FDMEYARWLEEQQRLLTELRVATQE-HLAENELRMFVDTCLAHYDHLINLKAMVAKTDVF  258

Query  654   HLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALS  478
             HL+SG   TP ERCF+W+GGFRPS ++KVI++Q+E +TEQQ +G+ GL+QSTQEAEEALS
Sbjct  259   HLISGAWKTPAERCFLWMGGFRPSEIIKVIVNQIEPLTEQQIVGICGLQQSTQEAEEALS  318

Query  477   QGMETLHHTISDIISSDALF-----YPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQ  313
             QG+E L+ ++SD I SD+L       P +L + M+ M+ A+  L  L  FV QADNLR Q
Sbjct  319   QGLEALNQSLSDSIVSDSLSPASAPLPPHLSNFMSHMSLALNKLSALEGFVLQADNLRHQ  378

Query  312   TIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             TI RL  +LT  Q ARC L V ++FHRL+ LS+LWL RPRQD
Sbjct  379   TIHRLNQLLTTRQEARCLLAVAEYFHRLQALSSLWLARPRQD  420



>ref|NP_850784.1| bZIP transcription factor TGA10 [Arabidopsis thaliana]
 gb|AED91072.1| bZIP transcription factor TGA10 [Arabidopsis thaliana]
Length=417

 Score =   342 bits (878),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 196/399 (49%), Positives = 259/399 (65%), Gaps = 19/399 (5%)
 Frame = -2

Query  1338  GNKDNSEAYDVGELDQAFLHFLNAqpqdqdpsss-------hdqQNNGMRLP-NTLNMFP  1183
             GN  N + YD+GE+D +   +L+ Q     PS++       H  QN  MR P +TLN+FP
Sbjct  22    GNFMNKDGYDIGEIDPSLFLYLDGQGHHDPPSTAPSPLHHHHTTQNLAMRPPTSTLNIFP  81

Query  1182  SEPMHVNPSPTALegsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKK  1003
             S+PMH+ P P++        +   SS           + KTLRRLAQNREAARK R+RKK
Sbjct  82    SQPMHIEPPPSSTHNKEGNRKGLASSDHDIPKSS---DPKTLRRLAQNREAARKSRLRKK  138

Query  1002  AYVQQLETSRMKLIQLEQQVALAQARGARIT-EngnvvgvghgHPLSLTKITPEGAAFDV  826
             AYVQQLE+ R+KL QLEQ++  A+++G               G P+    I+ E A FD+
Sbjct  139   AYVQQLESCRIKLTQLEQEIQRARSQGVFFGGSLIGGDQQQGGLPIGPGNISSEAAVFDM  198

Query  825   EYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLV  646
             EYARW+EE+ R+  ELR A  E  LSENEL+ +VD C AHY  + +L AM+AK+DV HL+
Sbjct  199   EYARWLEEQQRLLNELRVATQE-HLSENELRMFVDTCLAHYDHLINLKAMVAKTDVFHLI  257

Query  645   SGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGM  469
             SG   TP ERCF+W+GGFRPS ++KVI++Q+E +TEQQ +G+ GL+QSTQEAEEALSQG+
Sbjct  258   SGAWKTPAERCFLWMGGFRPSEIIKVIVNQIEPLTEQQIVGICGLQQSTQEAEEALSQGL  317

Query  468   ETLHHTISDIISSD-----ALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQ  304
             E L+ ++SD I SD     +   P +L + M+ M+ A+  L  L  FV QADNLR QTI 
Sbjct  318   EALNQSLSDSIVSDSLPPASAPLPPHLSNFMSHMSLALNKLSALEGFVLQADNLRHQTIH  377

Query  303   RLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             RL  +LT  Q ARC L V ++FHRL+ LS+LWL RPRQD
Sbjct  378   RLNQLLTTRQEARCLLAVAEYFHRLQALSSLWLARPRQD  416



>ref|XP_009370244.1| PREDICTED: transcription factor HBP-1b(c38)-like [Pyrus x bretschneideri]
Length=445

 Score =   343 bits (879),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/296 (57%), Positives = 221/296 (75%), Gaps = 3/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLETSR+KL QLEQ++  A+++G      G V 
Sbjct  150   DPKTLRRLAQNREAARKSRLRKKAYVQQLETSRIKLTQLEQELQRARSQGMYFG-GGLVG  208

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G     P+ +  I+ + A FD+EYARW+EE HR+ CELR AV E  L ENEL+ +VD C 
Sbjct  209   GEQQNLPVGINNISSDAAVFDMEYARWLEEHHRLMCELRAAVQE-HLPENELRLFVDNCL  267

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY ++ +L  M+AK+DV H+VSGM  +P ERCF+W+GGFRPS ++K+I++Q+E +T+QQ
Sbjct  268   AHYEEVLNLKGMVAKTDVFHIVSGMWKSPAERCFMWMGGFRPSDVIKIILNQMEPLTDQQ  327

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              LG+ GL+QSTQE EEALSQG+E L+ ++S+ I+SD+L  P N+ + M  MA A+  L T
Sbjct  328   LLGICGLQQSTQETEEALSQGLEALNQSLSETITSDSLSCPPNMANYMGHMAIAMNKLST  387

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  FVRQADNLR QTI RL  ILT  Q ARC L + ++FHRLR LS+LW+ RPRQD
Sbjct  388   LEGFVRQADNLRQQTIHRLQQILTTRQAARCLLAIAEYFHRLRALSSLWMARPRQD  443



>ref|XP_002871233.1| bZIP family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47492.1| bZIP family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=418

 Score =   341 bits (874),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 195/399 (49%), Positives = 259/399 (65%), Gaps = 19/399 (5%)
 Frame = -2

Query  1338  GNKDNSEAYDVGELDQAFLHFLNAqpqdqdpsss-------hdqQNNGMRLPNTLNMFPS  1180
             GN  N + YD+GE+D +   +L+ Q     PS++       H  QN  MR P+TLN+FPS
Sbjct  23    GNFMNKDGYDIGEIDPSLFLYLDGQGHHDPPSTAPPLPHHHHTTQNLAMRPPSTLNIFPS  82

Query  1179  EPMHVNPSPTALegsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKA  1000
             +PMH+ P P++        +   SS           + KTLRRLAQNREAARK R+RKKA
Sbjct  83    QPMHIEPPPSSTHNKEGNRKGLASSDHDIPKSS---DPKTLRRLAQNREAARKSRLRKKA  139

Query  999   YVQQLETSRMKLIQLEQQVALAQARGARIT-EngnvvgvghgHPLSLTKITP-EGAAFDV  826
             YVQQLE+ R+KL QLEQ++  A+++G               G P+    I+  E A FD+
Sbjct  140   YVQQLESCRIKLTQLEQEIQRARSQGVFFGGSLIGGDQQQGGLPIGPGNISSAEAAVFDM  199

Query  825   EYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLV  646
             EYARW+EE+ R+  ELR A  E  L+ENEL+ +VD C AHY  + +L AM+AK+DV HL+
Sbjct  200   EYARWLEEQQRLLNELRVATQE-HLAENELRMFVDTCLAHYDHLINLKAMVAKTDVFHLI  258

Query  645   SGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGM  469
             SG   TP ERCF+W+GGFRPS ++KVI++Q+E +TEQQ +G+ GL+QSTQEAEEALSQG+
Sbjct  259   SGAWKTPAERCFLWMGGFRPSEIIKVIVNQIEPLTEQQIVGICGLQQSTQEAEEALSQGL  318

Query  468   ETLHHTISDIISSD-----ALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQ  304
             E L+ ++SD I SD     +   P +L + M+ M+ A+  L  L  FV QADNLR QTI 
Sbjct  319   EALNQSLSDSIVSDSLPPASAPLPPHLSNFMSHMSLALNKLSALEGFVLQADNLRHQTIH  378

Query  303   RLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             RL  +LT  Q ARC L V ++FHRL+ LS+LWL RPRQD
Sbjct  379   RLNQLLTTRQEARCLLAVAEYFHRLQALSSLWLARPRQD  417



>emb|CAC40649.1| bZIP transcription factor [Arabidopsis thaliana]
Length=417

 Score =   340 bits (873),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 196/399 (49%), Positives = 258/399 (65%), Gaps = 19/399 (5%)
 Frame = -2

Query  1338  GNKDNSEAYDVGELDQAFLHFLNAqpqdqdpsss-------hdqQNNGMRLP-NTLNMFP  1183
             GN  N + YD+GE+D +   +L+ Q     PS++       H  QN  MR P +TLN+FP
Sbjct  22    GNFMNKDGYDIGEIDPSLFLYLDGQGHHDPPSTAPSPLHHHHTTQNLAMRPPTSTLNIFP  81

Query  1182  SEPMHVNPSPTALegsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKK  1003
             S+PMH+ P P++        +   SS           + KTLRRLAQNREAARK R+RKK
Sbjct  82    SQPMHIEPPPSSTHNKEGNRKGLASSDHDIPKSS---DPKTLRRLAQNREAARKSRLRKK  138

Query  1002  AYVQQLETSRMKLIQLEQQVALAQARGARIT-EngnvvgvghgHPLSLTKITPEGAAFDV  826
             AYVQQLE+ R+KL QLEQ++  A+++G               G P+    I+ E A FD+
Sbjct  139   AYVQQLESCRIKLTQLEQEIQRARSQGVFFGGSLIGGDQQQGGLPIGPGNISSEAAVFDM  198

Query  825   EYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLV  646
             EYARW+EE+ R+  ELR A  E  LSENEL+ +VD C AHY  + +L AM+AK+DV HL+
Sbjct  199   EYARWLEEQQRLLNELRVATQE-HLSENELRMFVDTCLAHYDHLINLKAMVAKTDVFHLI  257

Query  645   SGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGM  469
             SG   TP ERCF+W+GGFRPS ++KVI++Q+E +TEQQ +G+ GL+QSTQEAEEALSQG+
Sbjct  258   SGAWKTPAERCFLWMGGFRPSEIIKVIVNQIEPLTEQQIVGICGLQQSTQEAEEALSQGL  317

Query  468   ETLHHTISDIISSD-----ALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQ  304
             E L+ ++SD I SD     +   P +L + M+ M  A+  L  L  FV QADNLR QTI 
Sbjct  318   EALNQSLSDSIVSDSLPPASAPLPPHLSNFMSHMFLALNKLSALEGFVLQADNLRHQTIH  377

Query  303   RLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             RL  +LT  Q ARC L V ++FHRL+ LS+LWL RPRQD
Sbjct  378   RLNQLLTTRQEARCLLAVAEYFHRLQALSSLWLARPRQD  416



>gb|AES81438.2| BZIP family transcription factor [Medicago truncatula]
Length=438

 Score =   341 bits (875),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 252/427 (59%), Gaps = 53/427 (12%)
 Frame = -2

Query  1398  NQTCFGTVQAAPSSSSFPALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNN  1219
             NQ  FG +Q++ S S      NKD S AYD+GELDQA   +LN Q              +
Sbjct  42    NQISFGMMQSSSSPSVLGNYINKD-SGAYDLGELDQALFLYLNGQTDPSSVQDQKQNSTS  100

Query  1218  GMRLPNTLNMFPSEPMHVNPS-----------------------PTALegsgsgsesrrs  1108
             GMR P TLN+FPS+PMHV PS                       P         +  +  
Sbjct  101   GMR-PPTLNIFPSQPMHVEPSSSNSKASMDLVSPQTSGSKKGSEPPKAVKPREKNHGKGP  159

Query  1107  stssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQA  928
             ++SS      T + K LRRLAQNREAARK R+RKKAY+QQLE+SR+KL Q+EQ++  A+ 
Sbjct  160   TSSSEHEGPKTPDPKILRRLAQNREAARKSRLRKKAYIQQLESSRIKLNQMEQELHHARN  219

Query  927   RGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLS  748
             +G        + G       S+  I+ E A FDVEYARW+EE HR+ CELR AV E  + 
Sbjct  220   QGMFFGGGAMLGGEQGLP--SMNTISSEAAMFDVEYARWLEEHHRLVCELRAAVHE-HIP  276

Query  747   ENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKV  568
             ENEL+ +VD   A Y Q+  L +++AK+D+ HLVSGM  TP+ERCF+WIGGF+PS L+K 
Sbjct  277   ENELRMFVDKFLAQYDQVAQLKSLVAKADIFHLVSGMWVTPIERCFMWIGGFKPSELIK-  335

Query  567   IMSQLEVTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMT  388
                                      E+ALSQG+E L+ T+S+ I+SD+L YP N+ + M 
Sbjct  336   ------------------------GEDALSQGLEALNQTLSETITSDSLSYPPNMTNYMD  371

Query  387   QMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALW  208
             QMA A+  L TL +FVR+ADNLR QTI RL  ILT  Q ARCFL + ++FHR+R LS+LW
Sbjct  372   QMARAMNKLSTLESFVREADNLRHQTIHRLNQILTTRQAARCFLAMAEYFHRMRALSSLW  431

Query  207   LGRPRQD  187
             L RPRQ+
Sbjct  432   LARPRQE  438



>ref|XP_006362280.1| PREDICTED: transcription factor HBP-1b(c1)-like [Solanum tuberosum]
Length=488

 Score =   343 bits (879),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 172/296 (58%), Positives = 221/296 (75%), Gaps = 5/296 (2%)
 Frame = -2

Query  1065  KTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvvgv  886
             KTLRRLAQNREAARK RIRKKAY+QQLE+SR++L QLEQ++  A+++G        ++G 
Sbjct  195   KTLRRLAQNREAARKSRIRKKAYIQQLESSRIRLAQLEQELQRARSQGFHFA-GNALLGG  253

Query  885   ghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFAH  706
               G P ++  +T + A FD+EY+RW+EE HR+ CELR AV E    EN+L+ YV+ C  H
Sbjct  254   DQGLPNNIGNMTSDAAVFDMEYSRWLEEHHRLMCELRNAVTE-HFPENDLRIYVENCVTH  312

Query  705   YAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQAL  529
             Y +M +L +ML KSDV HL+SGM  TP ERCFIW+G FRPS L+K+I+SQ+E +TEQQ +
Sbjct  313   YDEMMNLKSMLVKSDVFHLISGMWKTPAERCFIWMGDFRPSELIKIILSQIEPLTEQQFV  372

Query  528   GMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFY--PSNLPSCMTQMAAAITNLYT  355
             G+ GL+QSTQEAEEALSQG+E L+ ++SD I SDAL    P N+ + M QMA AI  L T
Sbjct  373   GICGLQQSTQEAEEALSQGLENLNQSVSDTIVSDALLANCPQNMANYMGQMALAINKLST  432

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             +  FVRQADNLR QTI RL+ ILT  Q ARCFL + ++FHRLR LS+LW+ RPRQ+
Sbjct  433   IEGFVRQADNLRHQTIHRLHQILTSRQAARCFLAIAEYFHRLRALSSLWVARPRQE  488



>ref|XP_003625220.1| Transcription factor, putative [Medicago truncatula]
Length=439

 Score =   340 bits (872),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 196/430 (46%), Positives = 253/430 (59%), Gaps = 58/430 (13%)
 Frame = -2

Query  1398  NQTCFGTVQAAPSSSSFPALGN---KDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdq  1228
             NQ  FG +Q   SSSS   LGN     +S AYD+GELDQA   +LN Q            
Sbjct  42    NQISFGMMQ---SSSSPSVLGNYIRNKDSGAYDLGELDQALFLYLNGQTDPSSVQDQKQN  98

Query  1227  QNNGMRLPNTLNMFPSEPMHVNPS-----------------------PTALegsgsgses  1117
               +GMR P TLN+FPS+PMHV PS                       P         +  
Sbjct  99    STSGMR-PPTLNIFPSQPMHVEPSSSNSKASMDLVSPQTSGSKKGSEPPKAVKPREKNHG  157

Query  1116  rrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVAL  937
             +  ++SS      T + K LRRLAQNREAARK R+RKKAY+QQLE+SR+KL Q+EQ++  
Sbjct  158   KGPTSSSEHEGPKTPDPKILRRLAQNREAARKSRLRKKAYIQQLESSRIKLNQMEQELHH  217

Query  936   AQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDEL  757
             A+ +G        + G       S+  I+ E A FDVEYARW+EE HR+ CELR AV E 
Sbjct  218   ARNQGMFFGGGAMLGGEQGLP--SMNTISSEAAMFDVEYARWLEEHHRLVCELRAAVHE-  274

Query  756   MLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLL  577
              + ENEL+ +VD   A Y Q+  L +++AK+D+ HLVSGM  TP+ERCF+WIGGF+PS L
Sbjct  275   HIPENELRMFVDKFLAQYDQVAQLKSLVAKADIFHLVSGMWVTPIERCFMWIGGFKPSEL  334

Query  576   LKVIMSQLEVTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPS  397
             +K                          E+ALSQG+E L+ T+S+ I+SD+L YP N+ +
Sbjct  335   IK-------------------------GEDALSQGLEALNQTLSETITSDSLSYPPNMTN  369

Query  396   CMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLS  217
              M QMA A+  L TL +FVR+ADNLR QTI RL  ILT  Q ARCFL + ++FHR+R LS
Sbjct  370   YMDQMARAMNKLSTLESFVREADNLRHQTIHRLNQILTTRQAARCFLAMAEYFHRMRALS  429

Query  216   ALWLGRPRQD  187
             +LWL RPRQ+
Sbjct  430   SLWLARPRQE  439



>ref|XP_010672705.1| PREDICTED: transcription factor HBP-1b(c38) [Beta vulgaris subsp. 
vulgaris]
Length=577

 Score =   345 bits (884),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 172/296 (58%), Positives = 222/296 (75%), Gaps = 4/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR++L QLEQ+  L +AR   I   G + 
Sbjct  285   DPKTLRRLAQNREAARKSRLRKKAYVQQLESSRIRLAQLEQE--LQRARAQGIFFGGGLG  342

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G   G P+ ++ I+ + A FD+EY RW+EE HR+TCELR AV E  + E+ELK YVD C 
Sbjct  343   GADQGIPVGVSNISSDAAVFDLEYTRWLEENHRLTCELRAAVQE-HIPESELKLYVDNCL  401

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY  + +L +M+AK+DV HLVSGM  TP ERCF+W+GGFRPS L+K+I+ Q+E +++QQ
Sbjct  402   AHYDVVMNLKSMVAKTDVFHLVSGMWKTPAERCFMWMGGFRPSELIKIILHQIEPLSDQQ  461

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              + M GL+QSTQEAEEALSQG+E L  ++SD+I+SD L  P N+ + M QMA A+  L T
Sbjct  462   LMSMCGLQQSTQEAEEALSQGLEALQQSLSDVIASDTLSCPPNMTNYMGQMALAMNKLST  521

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             +  FVRQAD+LR QT  RL+ ILT  Q ARCFL + ++FHRLR LS+LW+ RPRQD
Sbjct  522   MENFVRQADSLRHQTFHRLHQILTTRQAARCFLTIAEYFHRLRALSSLWMARPRQD  577



>ref|XP_009418243.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=447

 Score =   340 bits (872),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 189/395 (48%), Positives = 250/395 (63%), Gaps = 31/395 (8%)
 Frame = -2

Query  1317  AYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMFPSEPMHVNPSPTALeg  1138
             AYD+GELDQA    L+ Q              +G     TLN+FPS+PMHV  S    + 
Sbjct  66    AYDLGELDQALFFSLDEQDHSI----------SGQEQRQTLNIFPSQPMHVQTSTKGGKS  115

Query  1137  sgsgsesrrssts-----------------sgggrggTLNAKTLRRLAQNREAARKCRIR  1009
               S + S    +S                     +   +  KTLRRLAQNREAARK R+R
Sbjct  116   LASPATSGSKKSSDQTMELGNSPNDLPELPEKSSKDTKVVVKTLRRLAQNREAARKSRLR  175

Query  1008  KKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFD  829
             KKAY+QQLE+SR KL QLEQ++   +ARG  +   G  +    G P     ++ + A FD
Sbjct  176   KKAYIQQLESSRNKLSQLEQEIQ--RARGQGLLYGGGALLEDQGLPTFAGGLSSDAAVFD  233

Query  828   VEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHL  649
             +EY RW+EE HR+ CELR AV+E    EN+L+ +VD+C AHY  M +L +++ KSDV HL
Sbjct  234   MEYTRWLEEHHRLMCELRAAVEEQQ-PENKLQMFVDSCLAHYDHMAYLKSIVTKSDVFHL  292

Query  648   VSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQG  472
             +SG+  TP ERCF+W+GGFRPS L+K++   +E +TEQQ LG+ GL+QSTQE EEALSQG
Sbjct  293   ISGVWMTPAERCFMWMGGFRPSELIKMLSRHIEPLTEQQILGVCGLQQSTQETEEALSQG  352

Query  471   METLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYH  292
             +E L+ ++SD I+SDAL   S++ + M QMA A+  L TL  F+RQADNLR  T+ RLY 
Sbjct  353   LEALNLSLSDTITSDALSCLSHMDNYMGQMAVAVNKLATLEGFIRQADNLRQHTLHRLYQ  412

Query  291   ILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             ILT  Q+ARC L + ++FHRLR LS+LWL RPR +
Sbjct  413   ILTTRQMARCLLAIAEYFHRLRALSSLWLARPRHE  447



>ref|XP_008800656.1| PREDICTED: transcription factor HBP-1b(c38)-like [Phoenix dactylifera]
Length=442

 Score =   338 bits (868),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 170/296 (57%), Positives = 220/296 (74%), Gaps = 4/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE SR+KL QLEQ++   +A+G  +   G ++
Sbjct  150   DPKTLRRLAQNREAARKSRLRKKAYVQQLENSRIKLTQLEQELQRTRAQG--LFFGGALL  207

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G     P S++ ++ + A FD+EY RW EE HR  CELR AV E  L ENEL+ +V+ C 
Sbjct  208   GDQGSFPPSISSLSSDAAMFDMEYGRWQEEHHRRMCELRAAVQE-HLPENELRMFVENCL  266

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY  M +L +++ KSDV HL+SGM  TP ERCF+W+GGFRPS L+K+++S +E +TEQQ
Sbjct  267   AHYDDMINLKSLVIKSDVFHLISGMWKTPAERCFLWMGGFRPSELIKMLLSHIEPLTEQQ  326

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              LG+ GL+QSTQE EEALSQG+E LH ++ D ++SDAL  PSN+ + M QMA A+  L T
Sbjct  327   ILGVCGLQQSTQETEEALSQGLEALHQSLLDTVTSDALSCPSNMANYMGQMAIAMNKLTT  386

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  FVRQADNLR QT+ RL+ ILT  Q+ARC L + ++FHRLR LS+LWL RPRQ+
Sbjct  387   LEGFVRQADNLRQQTLHRLHQILTTRQMARCLLAIAEYFHRLRALSSLWLARPRQE  442



>ref|NP_001078538.1| bZIP transcription factor TGA10 [Arabidopsis thaliana]
 gb|AED91073.1| bZIP transcription factor TGA10 [Arabidopsis thaliana]
Length=418

 Score =   338 bits (866),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 196/400 (49%), Positives = 259/400 (65%), Gaps = 20/400 (5%)
 Frame = -2

Query  1338  GNKDNSEAYDVGELDQAFLHFLNAqpqdqdpsss-------hdqQNNGMRLP-NTLNMFP  1183
             GN  N + YD+GE+D +   +L+ Q     PS++       H  QN  MR P +TLN+FP
Sbjct  22    GNFMNKDGYDIGEIDPSLFLYLDGQGHHDPPSTAPSPLHHHHTTQNLAMRPPTSTLNIFP  81

Query  1182  SEPMHVNPSPTALegsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKK  1003
             S+PMH+ P P++        +   SS           + KTLRRLAQNREAARK R+RKK
Sbjct  82    SQPMHIEPPPSSTHNKEGNRKGLASSDHDIPKSS---DPKTLRRLAQNREAARKSRLRKK  138

Query  1002  AYVQQLETSRMKLIQLEQQVALAQARGARIT-EngnvvgvghgHPLSLTKITP-EGAAFD  829
             AYVQQLE+ R+KL QLEQ++  A+++G               G P+    I+  E A FD
Sbjct  139   AYVQQLESCRIKLTQLEQEIQRARSQGVFFGGSLIGGDQQQGGLPIGPGNISSAEAAVFD  198

Query  828   VEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHL  649
             +EYARW+EE+ R+  ELR A  E  LSENEL+ +VD C AHY  + +L AM+AK+DV HL
Sbjct  199   MEYARWLEEQQRLLNELRVATQE-HLSENELRMFVDTCLAHYDHLINLKAMVAKTDVFHL  257

Query  648   VSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQG  472
             +SG   TP ERCF+W+GGFRPS ++KVI++Q+E +TEQQ +G+ GL+QSTQEAEEALSQG
Sbjct  258   ISGAWKTPAERCFLWMGGFRPSEIIKVIVNQIEPLTEQQIVGICGLQQSTQEAEEALSQG  317

Query  471   METLHHTISDIISSD-----ALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTI  307
             +E L+ ++SD I SD     +   P +L + M+ M+ A+  L  L  FV QADNLR QTI
Sbjct  318   LEALNQSLSDSIVSDSLPPASAPLPPHLSNFMSHMSLALNKLSALEGFVLQADNLRHQTI  377

Query  306   QRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
              RL  +LT  Q ARC L V ++FHRL+ LS+LWL RPRQD
Sbjct  378   HRLNQLLTTRQEARCLLAVAEYFHRLQALSSLWLARPRQD  417



>ref|XP_004249162.1| PREDICTED: transcription factor TGA2-like [Solanum lycopersicum]
Length=487

 Score =   340 bits (871),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 172/296 (58%), Positives = 222/296 (75%), Gaps = 6/296 (2%)
 Frame = -2

Query  1065  KTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvvgv  886
             KTLRRLAQNREAARK RIRKKAY+QQLE+SR++L QLEQ++  A+++G      G ++G 
Sbjct  195   KTLRRLAQNREAARKSRIRKKAYIQQLESSRIRLAQLEQELQRARSQGFHFA--GTLLGG  252

Query  885   ghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFAH  706
               G P ++  +T E AAFD+EY+RW+EE HR+ CELR AV E    EN+L+ YV+ C  H
Sbjct  253   DQGLPNNIANMTSEAAAFDMEYSRWLEEHHRLMCELRNAVTE-HFPENDLRIYVENCVTH  311

Query  705   YAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQAL  529
             Y +M +L ++L K+DV HL+SGM  TP ERCFIW+G FRPS L+K+I+SQ+E +TEQQ +
Sbjct  312   YDEMMNLKSILLKTDVFHLISGMWRTPAERCFIWMGDFRPSELIKIILSQIEPLTEQQFV  371

Query  528   GMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFY--PSNLPSCMTQMAAAITNLYT  355
             G+ GL+QSTQEAEEALSQG+E L+ ++SD I SDAL    P N+ + M QMA AI  L T
Sbjct  372   GICGLQQSTQEAEEALSQGLENLNQSVSDTIVSDALLANCPQNMANYMGQMAIAINKLST  431

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             +  FVRQADNLR QTI RL+ ILT  Q ARCFL + ++FHRLR LS+LW+ RPR +
Sbjct  432   IEGFVRQADNLRHQTIHRLHQILTSRQAARCFLAIAEYFHRLRALSSLWVARPRHE  487



>gb|KCW48077.1| hypothetical protein EUGRSUZ_K01822 [Eucalyptus grandis]
Length=472

 Score =   339 bits (870),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 197/413 (48%), Positives = 259/413 (63%), Gaps = 43/413 (10%)
 Frame = -2

Query  1335  NKDNSEAYDVGELDQAFLHFLNAqpqdqdp--ssshdqQNNGMRLPNTLNMFPSEPMH--  1168
             +K+N+ AYD+GELDQA   +L+   +  +        +QN GM  P TLN+FPS+PMH  
Sbjct  44    SKENNGAYDLGELDQALFLYLDGGQETPNVLHHHQDQRQNTGMMRPPTLNIFPSQPMHEE  103

Query  1167  ---------VNPSPT-------------------------ALegsgsgsesrrsstssgg  1090
                      V+PS                           A      G+    +S SS  
Sbjct  104   PSARVNTGMVSPSTNVPRRQLEHSMELGDPNNDSSTGPEPAKPIKREGNRKGSTSGSSEL  163

Query  1089  grggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARIT  910
                 T + KTLRRLAQNREAARK R+RKKAYVQQLETSR+KL +LEQ++  A+A+G  + 
Sbjct  164   EGPRTPDPKTLRRLAQNREAARKSRLRKKAYVQQLETSRVKLNELEQEIQRARAQGMFLG  223

Query  909   EngnvvgvghgHPLSLTKITPEGAA-FDVEYARWIEEEHRITCELRKAVDELMLSENELK  733
                     G    +  + I+ E AA FD+EYARW+EE HR  CEL+ AV E  L +++L+
Sbjct  224   GAAVGGDQGLH--VGGSNISSEAAAVFDIEYARWLEEHHRRRCELQAAVQE-HLPDSDLR  280

Query  732   RYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQL  553
              +VD C AH+ +M +L AMLAKSDV HLVSGM  +P ERCF+WIGGFRPS L+K++ S +
Sbjct  281   LFVDNCLAHFDEMLNLRAMLAKSDVFHLVSGMWMSPAERCFMWIGGFRPSELIKMVFSHI  340

Query  552   E-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAA  376
             E ++EQQ +G+ GL+QS QEAEE L+QG E L+H++SD I+SD L  P N+ + M  MA 
Sbjct  341   EPLSEQQIMGICGLQQSMQEAEEVLTQGQEALNHSLSDTIASDPLTSPPNMANFMGHMAV  400

Query  375   AITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLS  217
             AI  L  L +FVRQADNLR QT+ RL+ +LT  Q ARCFL + ++FHRLRTLS
Sbjct  401   AINKLTALESFVRQADNLRHQTLHRLHQLLTARQAARCFLAIAEYFHRLRTLS  453



>ref|XP_004493558.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Cicer 
arietinum]
Length=480

 Score =   339 bits (870),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 168/296 (57%), Positives = 224/296 (76%), Gaps = 3/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             +AKTLRRLAQNREAARK R+RKKAY+QQLE+SR++L Q+EQ++  A+ +G      G ++
Sbjct  187   DAKTLRRLAQNREAARKSRLRKKAYIQQLESSRIRLNQMEQELTHARNQGMFFG-GGAIM  245

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G   G P+S+  I+ + A FDVEY RW+EE H + CELR AV E  LSENEL+ +VD   
Sbjct  246   GGEQGIPISMNSISSDAAMFDVEYGRWLEEHHHLVCELRAAVQE-HLSENELRMFVDKFL  304

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
               Y Q+ +L +++AK+D+ HLVSGM  TP ERCF+WIGGF+PS L+KVI+ Q+E ++EQQ
Sbjct  305   TQYDQVMNLKSLVAKADIFHLVSGMWMTPAERCFMWIGGFKPSELIKVIVGQIEPLSEQQ  364

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              +G+ GL+QSTQEAEEALSQG+E L+ ++S+ I+SD+L YP N+ + M QMA A+  L T
Sbjct  365   IMGICGLQQSTQEAEEALSQGLEVLNQSLSNTITSDSLSYPPNMNNYMEQMAMAMNKLST  424

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L +FVRQAD LR QTI RL  ILT  Q ARCF+ + ++FHR+R LS+LWL RPRQ+
Sbjct  425   LESFVRQADLLRHQTIHRLNQILTTHQAARCFIAMAEYFHRMRALSSLWLARPRQE  480


 Score = 63.5 bits (153),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = -2

Query  1401  NNQTCFGTVQAAPSSSSFPA--LGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdq  1228
             +NQ  FG +Q++ S  S P   + NKD S AYD+GELDQA   +LN Q            
Sbjct  35    HNQISFGMMQSS-SPPSVPGTYIRNKD-SGAYDLGELDQALFLYLNGQTDPSKVQDQKQM  92

Query  1227  QN-NGMRLPNTLNMFPSEPMHVNPS  1156
              + +GMR P TLN+FPS+PMHV+PS
Sbjct  93    NSTSGMR-PPTLNIFPSQPMHVDPS  116



>ref|XP_004493559.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X2 [Cicer 
arietinum]
Length=479

 Score =   339 bits (869),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 168/296 (57%), Positives = 224/296 (76%), Gaps = 3/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             +AKTLRRLAQNREAARK R+RKKAY+QQLE+SR++L Q+EQ++  A+ +G      G ++
Sbjct  186   DAKTLRRLAQNREAARKSRLRKKAYIQQLESSRIRLNQMEQELTHARNQGMFFG-GGAIM  244

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G   G P+S+  I+ + A FDVEY RW+EE H + CELR AV E  LSENEL+ +VD   
Sbjct  245   GGEQGIPISMNSISSDAAMFDVEYGRWLEEHHHLVCELRAAVQE-HLSENELRMFVDKFL  303

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
               Y Q+ +L +++AK+D+ HLVSGM  TP ERCF+WIGGF+PS L+KVI+ Q+E ++EQQ
Sbjct  304   TQYDQVMNLKSLVAKADIFHLVSGMWMTPAERCFMWIGGFKPSELIKVIVGQIEPLSEQQ  363

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              +G+ GL+QSTQEAEEALSQG+E L+ ++S+ I+SD+L YP N+ + M QMA A+  L T
Sbjct  364   IMGICGLQQSTQEAEEALSQGLEVLNQSLSNTITSDSLSYPPNMNNYMEQMAMAMNKLST  423

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L +FVRQAD LR QTI RL  ILT  Q ARCF+ + ++FHR+R LS+LWL RPRQ+
Sbjct  424   LESFVRQADLLRHQTIHRLNQILTTHQAARCFIAMAEYFHRMRALSSLWLARPRQE  479


 Score = 63.5 bits (153),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 49/83 (59%), Gaps = 3/83 (4%)
 Frame = -2

Query  1401  NNQTCFGTVQAAPSSSSFPALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQN  1222
             +NQ  FG +Q++ S  S P      +S AYD+GELDQA   +LN Q             +
Sbjct  35    HNQISFGMMQSS-SPPSVPGTYINKDSGAYDLGELDQALFLYLNGQTDPSKVQDQKQMNS  93

Query  1221  -NGMRLPNTLNMFPSEPMHVNPS  1156
              +GMR P TLN+FPS+PMHV+PS
Sbjct  94    TSGMR-PPTLNIFPSQPMHVDPS  115



>gb|EPS58512.1| hypothetical protein M569_16301, partial [Genlisea aurea]
Length=316

 Score =   333 bits (854),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 166/296 (56%), Positives = 220/296 (74%), Gaps = 2/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLETSRM+L QLEQ++  A+++G  +     +V
Sbjct  22    DPKTLRRLAQNREAARKSRLRKKAYVQQLETSRMRLTQLEQELQRARSQGLYLGGQAALV  81

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G   G P+S+  +  +   FD+EYARW EE HRI  ELRKAV +  + EN+L+ +VD C 
Sbjct  82    GGDQGLPVSMANMNSDATLFDMEYARWQEEHHRIVEELRKAVSD-QVPENDLRIFVDNCV  140

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
              HY  + +L  M+AKSDV HL+SGM  TP ERCF+WIGGFRPS L+K++  ++E +TE Q
Sbjct  141   GHYDHVLNLKGMIAKSDVFHLLSGMWKTPAERCFMWIGGFRPSELIKIVAREVEEMTEHQ  200

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              +G+ GL+Q+TQ+AE+ALSQG++TL+ ++S  I +D+L  P N+ S M+QMA AIT L T
Sbjct  201   LMGICGLQQTTQDAEDALSQGLDTLNQSLSQAIIADSLAVPPNMNSYMSQMALAITKLST  260

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  F+ QAD+LR QT+ RL+ ILT  Q ARCFL + ++FHRLR LS+LWL RPRQD
Sbjct  261   LEAFITQADSLRHQTLHRLHQILTTRQSARCFLAMAEYFHRLRALSSLWLARPRQD  316



>ref|XP_010452628.1| PREDICTED: transcription factor TGA2-like isoform X5 [Camelina 
sativa]
Length=440

 Score =   336 bits (861),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 191/417 (46%), Positives = 262/417 (63%), Gaps = 34/417 (8%)
 Frame = -2

Query  1338  GNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshd--------qQNNGMRLP-NTLNMF  1186
             GN  N + YD+GE+D +   +L+ Q      +++           QN  MR P +TLN+F
Sbjct  24    GNFMNKDGYDIGEIDPSLFLYLDGQGHHDPSTTASSPLSHHHHTAQNLAMRPPTSTLNIF  83

Query  1185  PSEPMHVNPSPTALegsgsgsesrrsstssg-----------------ggrggTLNAKTL  1057
             PS+PMH+ P P++   + +      +  S                        + + KTL
Sbjct  84    PSQPMHIEPPPSSTPNTDNARLVPAAQPSGSLRPSFEPSMDLTNHSQFQPPQASKSIKTL  143

Query  1056  RRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvvgvghg  877
             RRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  A+++G     +        G
Sbjct  144   RRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQEIQRARSQGVFFGGSLIGDQHQGG  203

Query  876   HPLSLTKITP-EGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFAHYA  700
              P+    ++  E A FD+EYARW+EE+ R+  ELR A  E  L+ENEL+ +VDAC AHY 
Sbjct  204   LPIGPGNVSSAEAAVFDMEYARWLEEQQRLLTELRVATQE-HLAENELRMFVDACLAHYD  262

Query  699   QMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQALGM  523
              + +L AM+AK+DV HL+SG   TP ERCF+W+GGFRPS ++KVI++Q+E +TEQQ +G+
Sbjct  263   HLINLKAMVAKTDVFHLISGAWKTPAERCFLWMGGFRPSEIIKVIVNQIEPLTEQQIVGI  322

Query  522   IGLRQSTQEAEEALSQGMETLHHTISDIISSD-----ALFYPSNLPSCMTQMAAAITNLY  358
              GL+QSTQEAEEALSQG+E L+ ++SD I SD     +   P +L + M+ M+ A+  L 
Sbjct  323   CGLQQSTQEAEEALSQGLEALNQSLSDSIVSDSLPPASAPLPPHLSNFMSHMSLALNKLS  382

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
              L +FV QADNLR QTI RL  +LT  Q ARC L V ++FHRL+ LS+LWL RPRQD
Sbjct  383   ALESFVLQADNLRHQTIHRLNQLLTTRQEARCLLAVAEYFHRLQALSSLWLARPRQD  439



>ref|XP_008443080.1| PREDICTED: transcription factor HBP-1b(c38) isoform X1 [Cucumis 
melo]
Length=519

 Score =   337 bits (864),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/297 (57%), Positives = 212/297 (71%), Gaps = 3/297 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGA-RITEngnv  895
             + KTLRRLAQNREAARK R+RKKAYVQQLE SR+KL QLEQ++  A+ +G         +
Sbjct  224   DPKTLRRLAQNREAARKSRLRKKAYVQQLEMSRIKLTQLEQELQRARNQGMFLGGGAAIL  283

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
              G   G P     ++ + A FD+EY RW EE HR+ CELR AV E  L ENEL+ YVD+C
Sbjct  284   GGPDQGLPSGFHNLSSDAAVFDIEYGRWQEEHHRLMCELRAAVQE-HLPENELRLYVDSC  342

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++ +L  M+AKSD+ HLVSGM  TP ERCF+W+G FRPS L+K+IM Q+E +TE 
Sbjct  343   LAHYDEVLNLKMMVAKSDIFHLVSGMWKTPAERCFMWMGDFRPSELIKIIMGQIEPLTEH  402

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q L +  L+QSTQE+EEALSQG+E L+ ++SD I+SD+L  P N+ + M QM  AI  L 
Sbjct  403   QILNICALQQSTQESEEALSQGLEALNQSLSDTITSDSLSSPPNMANYMGQMTLAINKLS  462

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             TL  FVRQADNLR QT+ RL  +LT  Q ARC L + ++FHRLR LS+LWL RPRQD
Sbjct  463   TLEGFVRQADNLRHQTVHRLQQMLTTRQAARCLLAIAEYFHRLRALSSLWLARPRQD  519



>ref|XP_008351787.1| PREDICTED: transcription factor HBP-1b(c38)-like [Malus domestica]
Length=536

 Score =   337 bits (865),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/296 (57%), Positives = 219/296 (74%), Gaps = 3/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLETSR+KL QLEQ++  A+++G  +   G V 
Sbjct  241   DPKTLRRLAQNREAARKSRLRKKAYVQQLETSRIKLTQLEQELQRARSQGMFLG-GGLVG  299

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G     P+ +  I+ + A FD+EYARW+EE HR+ CELR AV E  L ENEL+ +VD C 
Sbjct  300   GEQQNLPVGINNISSDAAVFDMEYARWLEEHHRLMCELRAAVQE-HLPENELRLFVDNCL  358

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY ++ +L  M+AK+DV H+VSGM  +P ERCF+W+GGFRPS ++K+I++Q+E +TEQQ
Sbjct  359   AHYDEVLNLKGMVAKTDVFHIVSGMWKSPAERCFMWMGGFRPSDVIKIILNQIEPLTEQQ  418

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              LG+ GL+QSTQE EEALSQG+E L+ ++S+ I+SD+L  P N+ + M  MA A+  L T
Sbjct  419   LLGICGLQQSTQETEEALSQGLEALNQSLSETITSDSLSCPPNMANYMGHMAIAMNKLST  478

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
                FV QADNLR Q I RL  ILT  Q ARC L + ++FHRLR LS+LW+ RPRQD
Sbjct  479   XEXFVIQADNLRQQAIHRLQQILTTRQAARCLLAIAEYFHRLRALSSLWMARPRQD  534


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 53/94 (56%), Gaps = 18/94 (19%)
 Frame = -2

Query  1386  FGTVQAAPSSSSFPA---LGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpsss-------  1237
             +G +Q+  SSS+ PA   + NKD   AYD GELDQA   +L+ Q QD    S        
Sbjct  79    YGMMQS--SSSNIPAGNFISNKDGXAAYDXGELDQALFLYLDGQSQDHHNPSVNHVHHQD  136

Query  1236  -----hdqQNNGMRLPNTLNMFPSEPMHVNPSPT  1150
                   +  ++GMR P TLN+FPS+PMHV PS T
Sbjct  137   QRHPHQNNSSSGMR-PPTLNIFPSQPMHVEPSST  169



>gb|KGN59323.1| hypothetical protein Csa_3G810480 [Cucumis sativus]
Length=518

 Score =   337 bits (863),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/297 (57%), Positives = 212/297 (71%), Gaps = 3/297 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGA-RITEngnv  895
             + KTLRRLAQNREAARK R+RKKAYVQQLE SR+KL QLEQ++  A+ +G         +
Sbjct  223   DPKTLRRLAQNREAARKSRLRKKAYVQQLEMSRIKLTQLEQELQRARNQGMFLGGGAAIL  282

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
              G   G P     ++ + A FD+EY RW EE HR+ CELR AV E  L ENEL+ YVD+C
Sbjct  283   GGPDQGLPSGFHNLSSDAAVFDIEYGRWQEEHHRLMCELRAAVQE-HLPENELRLYVDSC  341

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++ +L  M+AKSD+ HLVSGM  TP ERCF+W+G FRPS L+K+IM Q+E +TE 
Sbjct  342   LAHYDEVLNLKMMVAKSDIFHLVSGMWKTPAERCFMWMGDFRPSELIKIIMGQIEPLTEH  401

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q L +  L+QSTQE+EEALSQG+E L+ ++SD I+SD+L  P N+ + M QM  AI  L 
Sbjct  402   QILNICALQQSTQESEEALSQGLEALNQSLSDTITSDSLSSPPNMANYMGQMTLAINKLS  461

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             TL  FVRQADNLR QT+ RL  +LT  Q ARC L + ++FHRLR LS+LWL RPRQD
Sbjct  462   TLEGFVRQADNLRHQTVHRLQQMLTTRQAARCLLAIAEYFHRLRALSSLWLARPRQD  518



>ref|XP_008795763.1| PREDICTED: transcription factor HBP-1b(c38) [Phoenix dactylifera]
Length=429

 Score =   332 bits (852),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 197/438 (45%), Positives = 261/438 (60%), Gaps = 66/438 (15%)
 Frame = -2

Query  1386  FGTVQAAPSSSSFPALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRL  1207
             FG +Q  PSSS+         + AYD+GELDQ    +LN               ++    
Sbjct  19    FGLIQ--PSSSTHGNSIRSKETGAYDLGELDQDLSMYLN-----------WQDPSSAQEQ  65

Query  1206  PNTLNMFPSEPMHV-----------------------------NP--SPTAL-------e  1141
               TLN+FPS+PMHV                             NP   P AL       +
Sbjct  66    RQTLNIFPSQPMHVEPSIRGGISFVSPTSSGSKKSSDQIMELGNPRSDPPALPDPGKDTK  125

Query  1140  gsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLI  961
                    +R+ ++ S  G   T + KTLRRLAQNREAARK R+RKKAYVQQLE  R++L 
Sbjct  126   AVVKKEGNRKGTSISEQGEPRTPDPKTLRRLAQNREAARKSRLRKKAYVQQLENCRIRLT  185

Query  960   QLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCE  781
             Q+EQ++  A+A+G+       +                + A FD+E+ARW+EE HR  CE
Sbjct  186   QIEQELQRARAQGSFFGGGALLGDQ-------------DVAMFDMEFARWLEEHHRRMCE  232

Query  780   LRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWI  601
             L+ AV E  L ENEL+ +V+ C  HY +M +L +++ KSDV HL++GM  TP ERCF+W+
Sbjct  233   LQAAVQE-HLPENELRLFVENCLVHYDEMMNLKSIVIKSDVFHLIAGMWKTPAERCFMWM  291

Query  600   GGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDA  424
             GGFRPS L+K+++S LE +TEQQ LG+ GL+QS QE EEALSQG+E L+ ++SDI++SDA
Sbjct  292   GGFRPSELIKMLLSHLEPLTEQQILGVCGLQQSAQETEEALSQGLEALNQSLSDIVTSDA  351

Query  423   LFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTD  244
             L  PSN+   M QMA A+  L +L  FVRQADNLR QT  RL+ ILT  Q+ARC L + +
Sbjct  352   LSCPSNMAHYMGQMAIAMNKLTSLEGFVRQADNLRQQTFHRLHQILTTRQMARCLLAIAE  411

Query  243   FFHRLRTLSALWLGRPRQ  190
             +FHRLR LS+LWL RPRQ
Sbjct  412   YFHRLRALSSLWLSRPRQ  429



>ref|XP_010038900.1| PREDICTED: transcription factor HBP-1b(c38)-like [Eucalyptus 
grandis]
Length=481

 Score =   332 bits (851),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 191/413 (46%), Positives = 253/413 (61%), Gaps = 43/413 (10%)
 Frame = -2

Query  1335  NKDNSEAYDVGELDQAFLHFLNAqpqdqdp--ssshdqQNNGMRLPNTLNMFPSEPMHVN  1162
             +K+N+ AYD+GELDQA   +L+   +  +        +QN GM  P TLN+FPS+PMH  
Sbjct  44    SKENNGAYDLGELDQALFLYLDGGQETPNVLHHHQDQRQNTGMMRPPTLNIFPSQPMHEE  103

Query  1161  P---------SPTALegsgsgsesrrsstssgggrggTLNAKTLRR--------------  1051
             P         SP+          S      +     G   AK ++R              
Sbjct  104   PSARVNTGMVSPSTNVPRRQLEHSMELGDPNNDSSTGPEPAKPIKREGNRKGSTSGSSEL  163

Query  1050  -------------LAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARIT  910
                          LAQNREAARK R+RKKAYVQQLETSR+KL +LEQ++  A+A+G  + 
Sbjct  164   EGPRTPDPKTLRRLAQNREAARKSRLRKKAYVQQLETSRVKLNELEQEIQRARAQGMFLG  223

Query  909   EngnvvgvghgHPLSLTKITPEGAA-FDVEYARWIEEEHRITCELRKAVDELMLSENELK  733
                     G    +  + I+ E AA FD+EYARW+EE HR  CEL+ AV E  L +++L+
Sbjct  224   GAAVGGDQGLH--VGGSNISSEAAAVFDIEYARWLEEHHRRRCELQAAVQE-HLPDSDLR  280

Query  732   RYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQL  553
              +VD C AH+ +M +L AMLAKSDV HLVSGM  +P ERCF+WIGGFRPS L+K++ S +
Sbjct  281   LFVDNCLAHFDEMLNLRAMLAKSDVFHLVSGMWMSPAERCFMWIGGFRPSELIKMVFSHI  340

Query  552   E-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAA  376
             E ++EQQ +G+ GL+QS QEAEE L+QG E L+H++SD I+SD L  P N+ + M  MA 
Sbjct  341   EPLSEQQIMGICGLQQSMQEAEEVLTQGQEALNHSLSDTIASDPLTSPPNMANFMGHMAV  400

Query  375   AITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLS  217
             AI  L  L +FVRQADNLR QT+ RL+ +LT  Q ARCFL + ++FHRLRTLS
Sbjct  401   AINKLTALESFVRQADNLRHQTLHRLHQLLTARQAARCFLAIAEYFHRLRTLS  453



>ref|XP_009122302.1| PREDICTED: transcription factor TGA2 isoform X2 [Brassica rapa]
Length=450

 Score =   331 bits (848),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 198/429 (46%), Positives = 262/429 (61%), Gaps = 46/429 (11%)
 Frame = -2

Query  1338  GNKDNSEAYDVGELDQAFLHFLNAqpqdqdpsss-----hdqQNNGMRLP-NTLNMFPSE  1177
             GN  N + YD+GE+D +   +L+ Q     PS++     H  QN  MR P +TLN+FPS+
Sbjct  22    GNFMNKDGYDLGEIDPSLFLYLDGQGHHDQPSTAPLPHHHTTQNLAMRPPTSTLNIFPSK  81

Query  1176  PMHVNP-----SPTALegsgsgsesrrsstssgggrggTL--------------------  1072
             PMH+ P     +P A+  SGS   S   S          L                    
Sbjct  82    PMHIEPPPSSSTPNAVAPSGSTRPSSEPSMDLTNHSQFQLPQPSKSIKKEGNRKGLASSD  141

Query  1071  -------NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARI  913
                    + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  A+++G   
Sbjct  142   HDTPKSSDPKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQEIQRARSQGVFY  201

Query  912   T-EngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENEL  736
                         G P+     + E A FD+EY RW+EE+ R+  ELR A  E  L+ENEL
Sbjct  202   GGSLIGGDQQQGGMPIGPGYTSSEAAVFDMEYTRWLEEQQRLLTELRVATQE-HLAENEL  260

Query  735   KRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQ  556
             + +VD C AHY  + +L AM+AK+DV HL+SG   TP ERCF+W+GGFRPS ++KVI++Q
Sbjct  261   RMFVDTCLAHYDHLINLKAMVAKTDVFHLISGAWKTPAERCFLWMGGFRPSEIIKVIVNQ  320

Query  555   LE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALF-----YPSNLPSC  394
             +E +TEQQ +G+ GL+QST EAEEALSQG+E L+ ++SD I SD+L       P +L + 
Sbjct  321   IEPLTEQQIVGICGLQQSTHEAEEALSQGLEALNQSLSDSIVSDSLSPASAQLPPHLSNF  380

Query  393   MTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSA  214
             M+ M+ A+  L +L  FV QADNLR QTI RL  +LT  Q ARC L V ++FHRL+ LS+
Sbjct  381   MSHMSLALNKLSSLEGFVLQADNLRHQTIHRLNQLLTTRQEARCILAVAEYFHRLQALSS  440

Query  213   LWLGRPRQD  187
             LWL RPRQD
Sbjct  441   LWLARPRQD  449



>emb|CDX70061.1| BnaA10g24100D [Brassica napus]
Length=451

 Score =   330 bits (846),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 201/438 (46%), Positives = 268/438 (61%), Gaps = 47/438 (11%)
 Frame = -2

Query  1362  SSSSFPALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpsss-----hdqQNNGMRLP-N  1201
             S+S+  + GN  N + YD+GE+D +   +L+ Q     PS++     H  QN  MR P +
Sbjct  14    SASATSSNGNFMNKDGYDLGEIDPSLFLYLDGQGHHDQPSTAPLPHHHTTQNLAMRPPTS  73

Query  1200  TLNMFPSEPMHVNP-----SPTALegsgsgsesrrsstssgggrggTL------------  1072
             TLN+FPS+PMH+ P     +P A+  SGS   S   S          L            
Sbjct  74    TLNIFPSKPMHIEPPPSSSTPNAVAPSGSTRPSSEPSMDLTNHSQFQLPQPSKSIKKEGN  133

Query  1071  ---------------NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVAL  937
                            + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  
Sbjct  134   RKGLASSDHDTPKSSDPKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQEIQR  193

Query  936   AQARGARIT-EngnvvgvghgHPLSLTKITP-EGAAFDVEYARWIEEEHRITCELRKAVD  763
             A+++G               G P+     +  E A FD+EY RW+EE+ R+  ELR A  
Sbjct  194   ARSQGVFYGGSLMGGDQQQGGMPIGPGYTSSAEAAVFDMEYTRWLEEQQRLLTELRVATQ  253

Query  762   ELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPS  583
             E  L+ENEL+ +VD C AHY  + +L AM+AK+DV HL+SG   TP ERCF+W+GGFRPS
Sbjct  254   E-HLAENELRMFVDTCLAHYDHLINLKAMVAKTDVFHLISGAWKTPAERCFLWMGGFRPS  312

Query  582   LLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALF----  418
              ++KVI++Q+E +TEQQ +G+ GL+QSTQEAEEALSQG+E L+ ++SD I SD+L     
Sbjct  313   EIIKVIVNQIEPLTEQQIVGICGLQQSTQEAEEALSQGLEALNQSLSDSIVSDSLSPASA  372

Query  417   -YPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDF  241
               P +L + M+ M+ A+  L +L  FV QADNLR QTI RL  +LT  Q ARC L V ++
Sbjct  373   QLPPHLSNFMSHMSLALNKLSSLEGFVLQADNLRHQTIHRLNQLLTTRQEARCILAVAEY  432

Query  240   FHRLRTLSALWLGRPRQD  187
             FHRL+ LS+LWL RPRQD
Sbjct  433   FHRLQALSSLWLARPRQD  450



>ref|XP_008443081.1| PREDICTED: transcription factor HBP-1b(c38) isoform X2 [Cucumis 
melo]
Length=519

 Score =   332 bits (851),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/295 (57%), Positives = 210/295 (71%), Gaps = 3/295 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGA-RITEngnv  895
             + KTLRRLAQNREAARK R+RKKAYVQQLE SR+KL QLEQ++  A+ +G         +
Sbjct  224   DPKTLRRLAQNREAARKSRLRKKAYVQQLEMSRIKLTQLEQELQRARNQGMFLGGGAAIL  283

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
              G   G P     ++ + A FD+EY RW EE HR+ CELR AV E  L ENEL+ YVD+C
Sbjct  284   GGPDQGLPSGFHNLSSDAAVFDIEYGRWQEEHHRLMCELRAAVQE-HLPENELRLYVDSC  342

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++ +L  M+AKSD+ HLVSGM  TP ERCF+W+G FRPS L+K+IM Q+E +TE 
Sbjct  343   LAHYDEVLNLKMMVAKSDIFHLVSGMWKTPAERCFMWMGDFRPSELIKIIMGQIEPLTEH  402

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q L +  L+QSTQE+EEALSQG+E L+ ++SD I+SD+L  P N+ + M QM  AI  L 
Sbjct  403   QILNICALQQSTQESEEALSQGLEALNQSLSDTITSDSLSSPPNMANYMGQMTLAINKLS  462

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
             TL  FVRQADNLR QT+ RL  +LT  Q ARC L + ++FHRLR LS+LWL RPR
Sbjct  463   TLEGFVRQADNLRHQTVHRLQQMLTTRQAARCLLAIAEYFHRLRALSSLWLARPR  517



>ref|XP_009418244.1| PREDICTED: transcription factor TGA2-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=411

 Score =   328 bits (840),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 188/417 (45%), Positives = 247/417 (59%), Gaps = 53/417 (13%)
 Frame = -2

Query  1317  AYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMFPSEP------------  1174
             AYD+GELDQA    L+ Q              +G     TLN+FPS+P            
Sbjct  8     AYDLGELDQALFFSLDEQDHSI----------SGQEQRQTLNIFPSQPMHVQTSTKGGKS  57

Query  1173  ----------------MHVNPSPTALegsgsgsesrrsstssgggrggTL----------  1072
                             M +  SP  L      S           G   +           
Sbjct  58    LASPATSGSKKSSDQTMELGNSPNDLPELPEKSSKDTKVVVKKDGSRKSTCVAESEGPKT  117

Query  1071  -NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
              + KTLRRLAQNREAARK R+RKKAY+QQLE+SR KL QLEQ++   +ARG  +   G  
Sbjct  118   TDPKTLRRLAQNREAARKSRLRKKAYIQQLESSRNKLSQLEQEIQ--RARGQGLLYGGGA  175

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
             +    G P     ++ + A FD+EY RW+EE HR+ CELR AV+E    EN+L+ +VD+C
Sbjct  176   LLEDQGLPTFAGGLSSDAAVFDMEYTRWLEEHHRLMCELRAAVEEQQ-PENKLQMFVDSC  234

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  M +L +++ KSDV HL+SG+  TP ERCF+W+GGFRPS L+K++   +E +TEQ
Sbjct  235   LAHYDHMAYLKSIVTKSDVFHLISGVWMTPAERCFMWMGGFRPSELIKMLSRHIEPLTEQ  294

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q LG+ GL+QSTQE EEALSQG+E L+ ++SD I+SDAL   S++ + M QMA A+  L 
Sbjct  295   QILGVCGLQQSTQETEEALSQGLEALNLSLSDTITSDALSCLSHMDNYMGQMAVAVNKLA  354

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             TL  F+RQADNLR  T+ RLY ILT  Q+ARC L + ++FHRLR LS+LWL RPR +
Sbjct  355   TLEGFIRQADNLRQHTLHRLYQILTTRQMARCLLAIAEYFHRLRALSSLWLARPRHE  411



>ref|XP_009418242.1| PREDICTED: transcription factor TGA2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=469

 Score =   328 bits (840),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 188/417 (45%), Positives = 247/417 (59%), Gaps = 53/417 (13%)
 Frame = -2

Query  1317  AYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMFPSEP------------  1174
             AYD+GELDQA    L+ Q              +G     TLN+FPS+P            
Sbjct  66    AYDLGELDQALFFSLDEQDHSI----------SGQEQRQTLNIFPSQPMHVQTSTKGGKS  115

Query  1173  ----------------MHVNPSPTALegsgsgsesrrsstssgggrggTL----------  1072
                             M +  SP  L      S           G   +           
Sbjct  116   LASPATSGSKKSSDQTMELGNSPNDLPELPEKSSKDTKVVVKKDGSRKSTCVAESEGPKT  175

Query  1071  -NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
              + KTLRRLAQNREAARK R+RKKAY+QQLE+SR KL QLEQ++   +ARG  +   G  
Sbjct  176   TDPKTLRRLAQNREAARKSRLRKKAYIQQLESSRNKLSQLEQEIQ--RARGQGLLYGGGA  233

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
             +    G P     ++ + A FD+EY RW+EE HR+ CELR AV+E    EN+L+ +VD+C
Sbjct  234   LLEDQGLPTFAGGLSSDAAVFDMEYTRWLEEHHRLMCELRAAVEEQQ-PENKLQMFVDSC  292

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  M +L +++ KSDV HL+SG+  TP ERCF+W+GGFRPS L+K++   +E +TEQ
Sbjct  293   LAHYDHMAYLKSIVTKSDVFHLISGVWMTPAERCFMWMGGFRPSELIKMLSRHIEPLTEQ  352

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q LG+ GL+QSTQE EEALSQG+E L+ ++SD I+SDAL   S++ + M QMA A+  L 
Sbjct  353   QILGVCGLQQSTQETEEALSQGLEALNLSLSDTITSDALSCLSHMDNYMGQMAVAVNKLA  412

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             TL  F+RQADNLR  T+ RLY ILT  Q+ARC L + ++FHRLR LS+LWL RPR +
Sbjct  413   TLEGFIRQADNLRQHTLHRLYQILTTRQMARCLLAIAEYFHRLRALSSLWLARPRHE  469



>ref|XP_010928841.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Elaeis 
guineensis]
Length=443

 Score =   326 bits (836),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 192/444 (43%), Positives = 257/444 (58%), Gaps = 55/444 (12%)
 Frame = -2

Query  1398  NQTCFGTVQAAPSSSSFPA--LGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQ  1225
             +Q+ FG + ++ SSS+     +  KD +  YD GELDQA   +L+ Q             
Sbjct  15    HQSSFGMIHSSSSSSTMHGNFIMGKDVA-PYDFGELDQALFLYLDGQDHSSVQEQR----  69

Query  1224  NNGMRLPNTLNMFPSEPMHV-------------------------------------NPS  1156
                     TLN+FPS+PMHV                                      P 
Sbjct  70    -------QTLNIFPSQPMHVVSTSKGEASLMSPTSSSSKKSSEQSMELPDPRSDLAARPE  122

Query  1155  PTALegsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETS  976
             P     +    E      SS      T +A+TLRRLAQNREAARK R+RKKAYVQQLE+S
Sbjct  123   PQQNIKAVVKRERNGKGPSSEQEGPKTPDARTLRRLAQNREAARKSRLRKKAYVQQLESS  182

Query  975   RMKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEH  796
             +++L QLEQ++  A+ +G  I   G +         S + +  + A FD+EY RW+E+ H
Sbjct  183   KIRLTQLEQELQRARVQGLLIGSGGVIGDQSLAG--STSGLKTDAAMFDMEYGRWLEDHH  240

Query  795   RITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVER  616
             R+ CELR AV E  L ENEL+  VD C  HY  + +L +++A+SDV HL+SG+  TP ER
Sbjct  241   RLMCELRAAVQE-HLPENELRMLVDKCLGHYDAVVNLKSVMARSDVFHLISGIWMTPAER  299

Query  615   CFIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDI  439
             CF+WIGGFRPS L+K+++  +E +TEQQ LG+  L+QS  E EEALSQG+E L  ++SD 
Sbjct  300   CFMWIGGFRPSELIKIVLKHIEPLTEQQILGVCSLQQSVHETEEALSQGLEALFRSLSDT  359

Query  438   ISSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCF  259
             + SDAL  PSN+ + + QM  A+  L  L  FVRQADNLR QT+ RL+ IL+  Q ARCF
Sbjct  360   VVSDALSSPSNMGNYIGQMVVAMNKLSALEAFVRQADNLRQQTVHRLHLILSTLQAARCF  419

Query  258   LIVTDFFHRLRTLSALWLGRPRQD  187
             L + + FHRLR LS+LWL RPRQ+
Sbjct  420   LAMAEHFHRLRALSSLWLTRPRQE  443



>ref|XP_002322683.2| hypothetical protein POPTR_0016s04970g [Populus trichocarpa]
 gb|EEF04444.2| hypothetical protein POPTR_0016s04970g [Populus trichocarpa]
Length=374

 Score =   323 bits (829),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 165/296 (56%), Positives = 217/296 (73%), Gaps = 12/296 (4%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G      G ++
Sbjct  90    DPKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLTQLEQELQRARTQGI-FLGGGGLL  148

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G   G P++          FD+EYARW+EE HR+ CELR AV E  + ENEL+ +V  C 
Sbjct  149   GGEQGIPVAF---------FDMEYARWLEENHRLMCELRAAVQE-HIPENELRLFVGNCL  198

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY +M +L +++AK+DV HLVSGM  TP ERCF+W+G FRPS L+K+I+ Q+E +TEQQ
Sbjct  199   AHYDEMMNLKSVVAKTDVFHLVSGMWKTPAERCFMWMGDFRPSELIKIIVGQIEPLTEQQ  258

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              LG+ GL+QSTQE E+ALSQG+E L+ ++S+ I+S++L  P N+ + M QM  A+  L T
Sbjct  259   ILGIYGLQQSTQENEDALSQGLEALNQSLSNTIASESLICPPNMANYMGQMTVAMNKLST  318

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  FVRQADNLR QTI RL+ +LT  Q ARC L V ++FHRLR LS+LW+ RPRQ+
Sbjct  319   LEGFVRQADNLRHQTIHRLHQLLTTRQAARCLLAVAEYFHRLRALSSLWVARPRQE  374



>ref|XP_009122301.1| PREDICTED: transcription factor TGA2 isoform X1 [Brassica rapa]
Length=451

 Score =   326 bits (835),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 198/430 (46%), Positives = 262/430 (61%), Gaps = 47/430 (11%)
 Frame = -2

Query  1338  GNKDNSEAYDVGELDQAFLHFLNAqpqdqdpsss-----hdqQNNGMRLP-NTLNMFPSE  1177
             GN  N + YD+GE+D +   +L+ Q     PS++     H  QN  MR P +TLN+FPS+
Sbjct  22    GNFMNKDGYDLGEIDPSLFLYLDGQGHHDQPSTAPLPHHHTTQNLAMRPPTSTLNIFPSK  81

Query  1176  PMHVNP-----SPTALegsgsgsesrrsstssgggrggTL--------------------  1072
             PMH+ P     +P A+  SGS   S   S          L                    
Sbjct  82    PMHIEPPPSSSTPNAVAPSGSTRPSSEPSMDLTNHSQFQLPQPSKSIKKEGNRKGLASSD  141

Query  1071  -------NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARI  913
                    + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  A+++G   
Sbjct  142   HDTPKSSDPKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQEIQRARSQGVFY  201

Query  912   T-EngnvvgvghgHPLSLTKITP-EGAAFDVEYARWIEEEHRITCELRKAVDELMLSENE  739
                         G P+     +  E A FD+EY RW+EE+ R+  ELR A  E  L+ENE
Sbjct  202   GGSLIGGDQQQGGMPIGPGYTSSAEAAVFDMEYTRWLEEQQRLLTELRVATQE-HLAENE  260

Query  738   LKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMS  559
             L+ +VD C AHY  + +L AM+AK+DV HL+SG   TP ERCF+W+GGFRPS ++KVI++
Sbjct  261   LRMFVDTCLAHYDHLINLKAMVAKTDVFHLISGAWKTPAERCFLWMGGFRPSEIIKVIVN  320

Query  558   QLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALF-----YPSNLPS  397
             Q+E +TEQQ +G+ GL+QST EAEEALSQG+E L+ ++SD I SD+L       P +L +
Sbjct  321   QIEPLTEQQIVGICGLQQSTHEAEEALSQGLEALNQSLSDSIVSDSLSPASAQLPPHLSN  380

Query  396   CMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLS  217
              M+ M+ A+  L +L  FV QADNLR QTI RL  +LT  Q ARC L V ++FHRL+ LS
Sbjct  381   FMSHMSLALNKLSSLEGFVLQADNLRHQTIHRLNQLLTTRQEARCILAVAEYFHRLQALS  440

Query  216   ALWLGRPRQD  187
             +LWL RPRQD
Sbjct  441   SLWLARPRQD  450



>ref|XP_009391828.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=439

 Score =   325 bits (832),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/296 (55%), Positives = 217/296 (73%), Gaps = 6/296 (2%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAY+QQLETSR+KL  LEQ++  A+++G  ++  G  +
Sbjct  149   DPKTLRRLAQNREAARKSRLRKKAYIQQLETSRIKLTHLEQELQRARSQG--LSFGGGAL  206

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
                 G P  +  ++   A FD+EY RW+EE HR+ CELR AV E    EN L+ +VD+C 
Sbjct  207   LEDQGLPAVVGGLS--AAMFDMEYMRWLEEHHRLMCELRAAVQEHQ-PENHLRMFVDSCL  263

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AH+ QM +L  ++ +SDV HL+SG+  TP ERCF+W+GGFRPS L+K+++S +E +TE+Q
Sbjct  264   AHHDQMVNLKNIVIRSDVFHLISGVWMTPAERCFMWMGGFRPSELIKMLLSHMEPLTEEQ  323

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              LG+ GL+QSTQE EEALSQG+E L+ ++SD I+SDAL YPSN+   M QMA A+  L T
Sbjct  324   ILGVCGLQQSTQETEEALSQGLEALNQSLSDTITSDALSYPSNVADYMGQMAMAMNKLTT  383

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  F+RQADNLR QT+ RLY ILT  Q+AR  L + ++ HRLR LS+LWL RPR +
Sbjct  384   LEGFIRQADNLRQQTLHRLYQILTTRQMARSLLAIAEYCHRLRALSSLWLARPRHE  439



>ref|XP_011078853.1| PREDICTED: transcription factor HBP-1b(c38)-like [Sesamum indicum]
Length=528

 Score =   327 bits (839),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 165/296 (56%), Positives = 216/296 (73%), Gaps = 2/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLET RM+L QLEQ++  A+++G  +  +  + 
Sbjct  234   DPKTLRRLAQNREAARKSRLRKKAYVQQLETCRMRLTQLEQEIQRARSQGFHLGGSALLA  293

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G            +     FD+EYARW+EE HR+  ELR A+++  LSENEL+  VD+C 
Sbjct  294   GEQGLQVAMGNGNSDAANLFDMEYARWLEEHHRLMAELRHAMED-HLSENELRVLVDSCL  352

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             A Y Q+ +L  M+AKSDV HL+SGM  TP ERCF+WIGGFRPS L+KVI++Q+E +TEQQ
Sbjct  353   ALYDQVMNLKNMIAKSDVFHLLSGMWKTPAERCFMWIGGFRPSELIKVIVTQIEPLTEQQ  412

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              +G+ GL+QST+EAEEALSQG+E L+ +++  I+SD+L  P N+ + M QMA AI  L T
Sbjct  413   VVGVCGLQQSTREAEEALSQGLEALNQSLTHTITSDSLIIPPNMNTYMAQMALAINKLST  472

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  F+ QADNLR QT+ RL  ILT  Q ARCFL + ++FHRLR LS+LW+ RPRQ+
Sbjct  473   LEGFLHQADNLRQQTLHRLDQILTTRQAARCFLAIGEYFHRLRALSSLWVARPRQE  528



>ref|XP_006850081.1| hypothetical protein AMTR_s00022p00217850 [Amborella trichopoda]
 gb|ERN11662.1| hypothetical protein AMTR_s00022p00217850 [Amborella trichopoda]
Length=485

 Score =   325 bits (834),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/296 (55%), Positives = 216/296 (73%), Gaps = 4/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SRMKL QLE ++  A+A+G      G+ +
Sbjct  193   DPKTLRRLAQNREAARKSRLRKKAYVQQLESSRMKLNQLEHELQRARAQGMFFG--GSGM  250

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
                   P     ++ E A FD+EY RW+EE HR+ CELR AV E  L E+EL+ YVD C 
Sbjct  251   LGDQSLPCGSGNLSTEAAVFDMEYGRWLEEHHRLMCELRAAVSE-HLPESELRLYVDNCL  309

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
              HY +M  L +M+A++DV HLVSG+  TP ERCF+W+GGFRPS LLK+++ Q+E +TEQQ
Sbjct  310   GHYEEMMGLKSMVARADVFHLVSGIWKTPAERCFLWMGGFRPSDLLKMLVPQIEPLTEQQ  369

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              L M  L+QS+Q+AE+AL+QG+E LH ++S+ I+S +L  P+ + + M QMA A+  L  
Sbjct  370   FLAMCSLQQSSQQAEDALTQGIEALHKSLSETIASGSLTTPTIMANYMGQMALAMNKLAN  429

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  FVRQADNLR QT+Q+L+ ILT  Q ARCFL + ++FHRLR LS+LWL RP+Q+
Sbjct  430   LEGFVRQADNLRHQTLQQLHRILTTRQAARCFLAIGEYFHRLRALSSLWLARPKQE  485



>emb|CDX98963.1| BnaC09g48720D [Brassica napus]
Length=451

 Score =   324 bits (830),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 197/430 (46%), Positives = 262/430 (61%), Gaps = 47/430 (11%)
 Frame = -2

Query  1338  GNKDNSEAYDVGELDQAFLHFLNAqpqdqdpsss-----hdqQNNGMRLP-NTLNMFPSE  1177
             GN  N + YD+GE+D +   +L+ Q     PS++     H  QN  MR P +TLN+FPS+
Sbjct  22    GNFMNKDGYDLGEIDPSLFLYLDGQGHHDQPSTAPLPHHHTTQNLAMRPPTSTLNIFPSK  81

Query  1176  PMHVNP-----SPTALegsgsgsesrrsstssgggrggTL--------------------  1072
             PMH+ P     +P A+  SGS   S   S          L                    
Sbjct  82    PMHIEPPPSSSTPNAVAPSGSTRPSSEPSMDLTNHSQFQLPQPSKSIKKEGNRKGLASSD  141

Query  1071  -------NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARI  913
                    + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  A+++G   
Sbjct  142   HDTPKSSDPKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQEIQRARSQGVFY  201

Query  912   T-EngnvvgvghgHPLSLTKITP-EGAAFDVEYARWIEEEHRITCELRKAVDELMLSENE  739
                         G P+     +  E A FD+EY RW+EE+ R+  ELR A  E  L+ENE
Sbjct  202   GGSLMGGDQQQGGMPIGPGYTSSAEAAVFDMEYTRWLEEQQRLLTELRVATQE-HLAENE  260

Query  738   LKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMS  559
             L+ +VD C AHY  + +L AM+AK+DV HL+SG   TP ERCF+W+GGFRPS ++KVI++
Sbjct  261   LRMFVDTCLAHYDHLINLKAMVAKTDVFHLISGAWKTPAERCFLWMGGFRPSEIIKVIVN  320

Query  558   QLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALF-----YPSNLPS  397
             Q+E +TEQQ +G+ GL+QST EAEEALSQG+E L+ ++SD I SD+L       P +L +
Sbjct  321   QIEPLTEQQIVGICGLQQSTHEAEEALSQGLEALNQSLSDSIVSDSLSPASAQLPPHLSN  380

Query  396   CMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLS  217
              M+ M+ A+  L +L  FV QADNLR QTI RL  +LT  Q ARC L V ++FHRL+ LS
Sbjct  381   FMSHMSLALNKLSSLEGFVLQADNLRHQTIHRLNQLLTTRQEARCILAVAEYFHRLQALS  440

Query  216   ALWLGRPRQD  187
             +LWL RPRQ+
Sbjct  441   SLWLARPRQE  450



>ref|XP_008787290.1| PREDICTED: transcription factor TGA2-like [Phoenix dactylifera]
Length=411

 Score =   323 bits (827),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 191/427 (45%), Positives = 254/427 (59%), Gaps = 55/427 (13%)
 Frame = -2

Query  1359  SSSFPALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMFPS  1180
             +SS  +  +KD +  YD+GELD A   +L+AQ                     TLN+FPS
Sbjct  4     ASSMSSTMSKDVA-PYDLGELDPALFLYLDAQDHSSVQEQR-----------QTLNIFPS  51

Query  1179  EPMHVNPSP-----------------------------------TALegsgsgsesrrss  1105
             +PMHV P+P                                   T ++       +R+ +
Sbjct  52    QPMHVVPTPKGEMSLLSPTSSSSKQSIDLANPISDDVAALPEPQTDVKAVVKREGNRKGT  111

Query  1104  tssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQAR  925
              SS      T +AKTLRRLAQNREAARK R+RKKAY+QQLETS+M+L QLEQ++  A+A+
Sbjct  112   ASSDQEGPRTPDAKTLRRLAQNREAARKSRLRKKAYIQQLETSKMRLSQLEQELQRARAQ  171

Query  924   GARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSE  745
             G  +   G + G       +        A FD+EY RW+E+ HR+ C+LR AV E    +
Sbjct  172   GLLVGGGGVISGDQGLAGGN------AAAMFDMEYGRWLEDHHRLMCDLRTAVQE-HSPD  224

Query  744   NELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVI  565
             NEL+  V  C  HY  MT L +++A+ DV HL+SGM  TP ERCF+WIGGFRPS ++K+ 
Sbjct  225   NELRMLVQNCLGHYDAMTSLKSIIARCDVFHLLSGMWKTPAERCFMWIGGFRPSEIIKIA  284

Query  564   MSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMT  388
             +   E +TEQQ LG+ GL+QS  E EEALSQG+E L+ ++SD + SDAL  PSN+ + M 
Sbjct  285   LRHTEPLTEQQILGVCGLQQSLHETEEALSQGLEALYRSLSDTVISDALNCPSNMANYMG  344

Query  387   QMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALW  208
             QMA A+  L  L  FVRQADNLR QT+ RL+ +LT  Q ARCFL + + FHRLR+LS+LW
Sbjct  345   QMAVAVNKLSALEGFVRQADNLRQQTLHRLHQMLTPSQAARCFLAMAEHFHRLRSLSSLW  404

Query  207   LGRPRQD  187
             L RPRQ+
Sbjct  405   LARPRQE  411



>ref|XP_010928842.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Elaeis 
guineensis]
Length=364

 Score =   317 bits (812),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 158/296 (53%), Positives = 210/296 (71%), Gaps = 4/296 (1%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             +A+TLRRLAQNREAARK R+RKKAYVQQLE+S+++L QLEQ++  A+ +G  I   G + 
Sbjct  72    DARTLRRLAQNREAARKSRLRKKAYVQQLESSKIRLTQLEQELQRARVQGLLIGSGGVIG  131

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
                     S + +  + A FD+EY RW+E+ HR+ CELR AV E  L ENEL+  VD C 
Sbjct  132   DQSLAG--STSGLKTDAAMFDMEYGRWLEDHHRLMCELRAAVQE-HLPENELRMLVDKCL  188

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
              HY  + +L +++A+SDV HL+SG+  TP ERCF+WIGGFRPS L+K+++  +E +TEQQ
Sbjct  189   GHYDAVVNLKSVMARSDVFHLISGIWMTPAERCFMWIGGFRPSELIKIVLKHIEPLTEQQ  248

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              LG+  L+QS  E EEALSQG+E L  ++SD + SDAL  PSN+ + + QM  A+  L  
Sbjct  249   ILGVCSLQQSVHETEEALSQGLEALFRSLSDTVVSDALSSPSNMGNYIGQMVVAMNKLSA  308

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  FVRQADNLR QT+ RL+ IL+  Q ARCFL + + FHRLR LS+LWL RPRQ+
Sbjct  309   LEAFVRQADNLRQQTVHRLHLILSTLQAARCFLAMAEHFHRLRALSSLWLTRPRQE  364



>ref|XP_010452626.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X3 [Camelina 
sativa]
Length=461

 Score =   320 bits (819),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 164/301 (54%), Positives = 216/301 (72%), Gaps = 7/301 (2%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  A+++G     +    
Sbjct  161   DPKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQEIQRARSQGVFFGGSLIGD  220

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
                 G P+    ++ E A FD+EYARW+EE+ R+  ELR A  E  L+ENEL+ +VDAC 
Sbjct  221   QHQGGLPIGPGNVSSEAAVFDMEYARWLEEQQRLLTELRVATQE-HLAENELRMFVDACL  279

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY  + +L AM+AK+DV HL+SG   TP ERCF+W+GGFRPS ++KVI++Q+E +TEQQ
Sbjct  280   AHYDHLINLKAMVAKTDVFHLISGAWKTPAERCFLWMGGFRPSEIIKVIVNQIEPLTEQQ  339

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSD-----ALFYPSNLPSCMTQMAAAI  370
              +G+ GL+QSTQEAEEALSQG+E L+ ++SD I SD     +   P +L + M+ M+ A+
Sbjct  340   IVGICGLQQSTQEAEEALSQGLEALNQSLSDSIVSDSLPPASAPLPPHLSNFMSHMSLAL  399

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L  L +FV QADNLR QTI RL  +LT  Q ARC L V ++FHRL+ LS+LWL RPRQ
Sbjct  400   NKLSALESFVLQADNLRHQTIHRLNQLLTTRQEARCLLAVAEYFHRLQALSSLWLARPRQ  459

Query  189   D  187
             D
Sbjct  460   D  460



>ref|XP_010491266.1| PREDICTED: transcription factor TGA2-like isoform X2 [Camelina 
sativa]
Length=464

 Score =   319 bits (818),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 197/440 (45%), Positives = 261/440 (59%), Gaps = 58/440 (13%)
 Frame = -2

Query  1338  GNKDNSEAYDVGELDQAFLHFLNAqpqdqdpsss--------hdqQNNGMRLP-NTLNMF  1186
             GN  N + YD+GE+D +   +L+ Q      S++        H  QN  MR P +TLN+F
Sbjct  26    GNFMNKDGYDIGEIDPSLFLYLDGQGHHDPSSTAPSPLSHHHHTTQNLAMRPPTSTLNIF  85

Query  1185  P----------------------------------SEPM-------HVNPSPTALegsgs  1129
             P                                  SEP        H  P P A   S  
Sbjct  86    PSQPMHIEPPPSSTPNTDNARLVPAAQPSGSLRPSSEPSMDLTNHSHFQP-PLASNKSIK  144

Query  1128  gsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQ  949
                +R+   SS      + + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ
Sbjct  145   KEGNRKGPASSDHDIPKSSDPKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQ  204

Query  948   QVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKA  769
             ++  A+++G     +        G P+    ++ E A FD+EYARW+EE+ R+  ELR A
Sbjct  205   EIQRARSQGVFFGGSLIGDQHQGGLPIGPGNVSSEAAVFDMEYARWLEEQQRLLTELRVA  264

Query  768   VDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFR  589
               E  L+ENEL+ +VDAC AHY  + +L AM+AK+DV HL+SG   TP ERCF+W+GGFR
Sbjct  265   TQE-HLAENELRMFVDACLAHYDHLINLKAMVAKTDVFHLISGAWKTPAERCFLWMGGFR  323

Query  588   PSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSD-----  427
             PS ++KVI++Q+E +TEQQ +G+ GL+QSTQEAEEALSQG+E L+ ++SD I SD     
Sbjct  324   PSEIIKVIVNQIEPLTEQQIVGICGLQQSTQEAEEALSQGLEALNQSLSDSIVSDSLPPA  383

Query  426   ALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVT  247
             +   P +L + M+ M+ A+  L  L  FV QADNLR QTI RL  +LT  Q ARC L V 
Sbjct  384   SAPLPPHLSNFMSHMSLALNKLSALEGFVLQADNLRHQTIHRLNQLLTTRQEARCLLAVA  443

Query  246   DFFHRLRTLSALWLGRPRQD  187
             ++FHRL+ LS+LWL RPRQD
Sbjct  444   EYFHRLQALSSLWLARPRQD  463



>ref|XP_010913925.1| PREDICTED: transcription factor TGA2 isoform X3 [Elaeis guineensis]
Length=362

 Score =   315 bits (807),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 162/296 (55%), Positives = 210/296 (71%), Gaps = 8/296 (3%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             +AKTLRRLAQNREAARK R+RKKAY+QQLETS+++L Q+EQ++  A+A      +   V 
Sbjct  74    DAKTLRRLAQNREAARKSRLRKKAYIQQLETSKIRLTQIEQELQRARA------QGLLVG  127

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G G            + A FD+EY RW+E+ HR+ C+LR AV E    ++EL+  VD C 
Sbjct  128   GGGLLGGDQGLTGGNDAAMFDMEYGRWLEDHHRLMCDLRAAVQE-HSPDDELRMLVDNCV  186

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY  MT+L +++A+SDV HL+SGM  TP ERCF+WIGGFRPS ++K+ +   E +TEQQ
Sbjct  187   AHYDAMTNLKSLIARSDVFHLISGMWKTPAERCFMWIGGFRPSEVIKIAIRHTEPLTEQQ  246

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              L + GL+QS  E EEALSQG+E L+ ++SD I SDAL  PSN+ + M QMA AI  L T
Sbjct  247   ILAVCGLQQSVHETEEALSQGLEALYRSLSDTIISDALNCPSNMANYMGQMAVAINKLST  306

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  FVRQAD LR QTI +LY +LT+ Q ARCFL + + FHRLR+LS+LWL RPRQ+
Sbjct  307   LEGFVRQADILRQQTIHKLYQMLTIRQAARCFLAMAEHFHRLRSLSSLWLARPRQE  362



>ref|XP_010423290.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Camelina 
sativa]
Length=462

 Score =   318 bits (816),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 164/301 (54%), Positives = 215/301 (71%), Gaps = 7/301 (2%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  A+++G     +    
Sbjct  162   DPKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQEIQRARSQGVFFGGSLIGD  221

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
                 G P+    ++ E A FD+EYARW+EE+ R+  ELR A  E  L+ENEL+ +VDAC 
Sbjct  222   QHQGGLPIGPGNVSSEAAVFDMEYARWLEEQQRLLTELRVATQE-HLAENELRMFVDACL  280

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY  + +L AM+AK+DV HL+SG   TP ERCF+W+GGFRPS ++KVI++Q+E +TEQQ
Sbjct  281   AHYDHLINLKAMVAKTDVFHLISGAWKTPAERCFLWMGGFRPSEIIKVIVNQIEPLTEQQ  340

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSD-----ALFYPSNLPSCMTQMAAAI  370
              +G+ GL+QSTQEAEEALSQG+E L+ ++SD I SD     +   P +L + M+ M+ A+
Sbjct  341   IVGICGLQQSTQEAEEALSQGLEALNQSLSDSIVSDSLPPASAPLPPHLSNFMSHMSLAL  400

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L  L  FV QADNLR QTI RL  +LT  Q ARC L V ++FHRL+ LS+LWL RPRQ
Sbjct  401   NKLSALEGFVLQADNLRHQTIHRLNQLLTTRQEARCLLAVAEYFHRLQALSSLWLARPRQ  460

Query  189   D  187
             D
Sbjct  461   D  461



>ref|XP_010913923.1| PREDICTED: transcription factor TGA2 isoform X1 [Elaeis guineensis]
Length=440

 Score =   316 bits (810),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 162/296 (55%), Positives = 210/296 (71%), Gaps = 8/296 (3%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             +AKTLRRLAQNREAARK R+RKKAY+QQLETS+++L Q+EQ++  A+A      +   V 
Sbjct  152   DAKTLRRLAQNREAARKSRLRKKAYIQQLETSKIRLTQIEQELQRARA------QGLLVG  205

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G G            + A FD+EY RW+E+ HR+ C+LR AV E    ++EL+  VD C 
Sbjct  206   GGGLLGGDQGLTGGNDAAMFDMEYGRWLEDHHRLMCDLRAAVQE-HSPDDELRMLVDNCV  264

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY  MT+L +++A+SDV HL+SGM  TP ERCF+WIGGFRPS ++K+ +   E +TEQQ
Sbjct  265   AHYDAMTNLKSLIARSDVFHLISGMWKTPAERCFMWIGGFRPSEVIKIAIRHTEPLTEQQ  324

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              L + GL+QS  E EEALSQG+E L+ ++SD I SDAL  PSN+ + M QMA AI  L T
Sbjct  325   ILAVCGLQQSVHETEEALSQGLEALYRSLSDTIISDALNCPSNMANYMGQMAVAINKLST  384

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  FVRQAD LR QTI +LY +LT+ Q ARCFL + + FHRLR+LS+LWL RPRQ+
Sbjct  385   LEGFVRQADILRQQTIHKLYQMLTIRQAARCFLAMAEHFHRLRSLSSLWLARPRQE  440



>gb|KFK25074.1| hypothetical protein AALP_AA8G062800 [Arabis alpina]
Length=461

 Score =   316 bits (810),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 165/302 (55%), Positives = 214/302 (71%), Gaps = 8/302 (3%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARIT-Engnv  895
             + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  A+++G          
Sbjct  160   DPKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQEIQRARSQGVFYGGSLIGG  219

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                  G  +    I+ E A FD+EYARW+EE+ R+  ELR A  E  L+ENEL+ +VD C
Sbjct  220   DQQQGGMNIGPGNISSEAAVFDMEYARWMEEQQRLLNELRVATQE-HLAENELRMFVDTC  278

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  + +L AM+AK+DV HL+SG   TP ERCF+W+GGFRPS ++KVI+SQ+E +TEQ
Sbjct  279   LAHYDHLINLKAMVAKTDVFHLISGAWKTPAERCFLWMGGFRPSEIIKVIVSQIEPLTEQ  338

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALF-----YPSNLPSCMTQMAAA  373
             Q +G+ GL+QSTQEAEEALSQG+E L+ ++SD I SD+L       P +L + M+ M+ A
Sbjct  339   QIVGICGLQQSTQEAEEALSQGLEALNQSLSDSIVSDSLSPASAQLPPHLSNFMSHMSLA  398

Query  372   ITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
             +  L +L  FV QADNLR QTI RL  +LT  Q ARC L V ++FHRL+ LS+LWL RPR
Sbjct  399   LNKLSSLEGFVLQADNLRHQTIHRLNQLLTTRQEARCILAVAEYFHRLQALSSLWLARPR  458

Query  192   QD  187
             QD
Sbjct  459   QD  460



>ref|XP_010913924.1| PREDICTED: transcription factor TGA2 isoform X2 [Elaeis guineensis]
Length=435

 Score =   315 bits (808),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 162/296 (55%), Positives = 213/296 (72%), Gaps = 8/296 (3%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             +AKTLRRLAQNREAARK R+RKKAY+QQLETS+++L Q+EQ++  A+A+G  +   G + 
Sbjct  147   DAKTLRRLAQNREAARKSRLRKKAYIQQLETSKIRLTQIEQELQRARAQGLLVGGGGLLG  206

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G       +      + A FD+EY RW+E+ HR+ C+LR AV E    ++EL+  VD C 
Sbjct  207   GDQGLTGGN------DAAMFDMEYGRWLEDHHRLMCDLRAAVQE-HSPDDELRMLVDNCV  259

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY  MT+L +++A+SDV HL+SGM  TP ERCF+WIGGFRPS ++K+ +   E +TEQQ
Sbjct  260   AHYDAMTNLKSLIARSDVFHLISGMWKTPAERCFMWIGGFRPSEVIKIAIRHTEPLTEQQ  319

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              L + GL+QS  E EEALSQG+E L+ ++SD I SDAL  PSN+ + M QMA AI  L T
Sbjct  320   ILAVCGLQQSVHETEEALSQGLEALYRSLSDTIISDALNCPSNMANYMGQMAVAINKLST  379

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
             L  FVRQAD LR QTI +LY +LT+ Q ARCFL + + FHRLR+LS+LWL RPRQ+
Sbjct  380   LEGFVRQADILRQQTIHKLYQMLTIRQAARCFLAMAEHFHRLRSLSSLWLARPRQE  435



>gb|KFK25075.1| hypothetical protein AALP_AA8G062800 [Arabis alpina]
Length=462

 Score =   315 bits (808),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 165/305 (54%), Positives = 218/305 (71%), Gaps = 13/305 (4%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARG----ARITEn  904
             + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  A+++G      +   
Sbjct  160   DPKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQEIQRARSQGVFYGGSLIGG  219

Query  903   gnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYV  724
                 G  +  P +++  + E A FD+EYARW+EE+ R+  ELR A  E  L+ENEL+ +V
Sbjct  220   DQQQGGMNIGPGNIS--SAEAAVFDMEYARWMEEQQRLLNELRVATQE-HLAENELRMFV  276

Query  723   DACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-V  547
             D C AHY  + +L AM+AK+DV HL+SG   TP ERCF+W+GGFRPS ++KVI+SQ+E +
Sbjct  277   DTCLAHYDHLINLKAMVAKTDVFHLISGAWKTPAERCFLWMGGFRPSEIIKVIVSQIEPL  336

Query  546   TEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALF-----YPSNLPSCMTQM  382
             TEQQ +G+ GL+QSTQEAEEALSQG+E L+ ++SD I SD+L       P +L + M+ M
Sbjct  337   TEQQIVGICGLQQSTQEAEEALSQGLEALNQSLSDSIVSDSLSPASAQLPPHLSNFMSHM  396

Query  381   AAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLG  202
             + A+  L +L  FV QADNLR QTI RL  +LT  Q ARC L V ++FHRL+ LS+LWL 
Sbjct  397   SLALNKLSSLEGFVLQADNLRHQTIHRLNQLLTTRQEARCILAVAEYFHRLQALSSLWLA  456

Query  201   RPRQD  187
             RPRQD
Sbjct  457   RPRQD  461



>ref|XP_010491265.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Camelina 
sativa]
Length=465

 Score =   315 bits (808),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 197/441 (45%), Positives = 261/441 (59%), Gaps = 59/441 (13%)
 Frame = -2

Query  1338  GNKDNSEAYDVGELDQAFLHFLNAqpqdqdpsss--------hdqQNNGMRLP-NTLNMF  1186
             GN  N + YD+GE+D +   +L+ Q      S++        H  QN  MR P +TLN+F
Sbjct  26    GNFMNKDGYDIGEIDPSLFLYLDGQGHHDPSSTAPSPLSHHHHTTQNLAMRPPTSTLNIF  85

Query  1185  P----------------------------------SEPM-------HVNPSPTALegsgs  1129
             P                                  SEP        H  P P A   S  
Sbjct  86    PSQPMHIEPPPSSTPNTDNARLVPAAQPSGSLRPSSEPSMDLTNHSHFQP-PLASNKSIK  144

Query  1128  gsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQ  949
                +R+   SS      + + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ
Sbjct  145   KEGNRKGPASSDHDIPKSSDPKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQ  204

Query  948   QVALAQARGARITEngnvvgvghgHPLSLTKITP-EGAAFDVEYARWIEEEHRITCELRK  772
             ++  A+++G     +        G P+    ++  E A FD+EYARW+EE+ R+  ELR 
Sbjct  205   EIQRARSQGVFFGGSLIGDQHQGGLPIGPGNVSSAEAAVFDMEYARWLEEQQRLLTELRV  264

Query  771   AVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGF  592
             A  E  L+ENEL+ +VDAC AHY  + +L AM+AK+DV HL+SG   TP ERCF+W+GGF
Sbjct  265   ATQE-HLAENELRMFVDACLAHYDHLINLKAMVAKTDVFHLISGAWKTPAERCFLWMGGF  323

Query  591   RPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSD----  427
             RPS ++KVI++Q+E +TEQQ +G+ GL+QSTQEAEEALSQG+E L+ ++SD I SD    
Sbjct  324   RPSEIIKVIVNQIEPLTEQQIVGICGLQQSTQEAEEALSQGLEALNQSLSDSIVSDSLPP  383

Query  426   -ALFYPSNLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIV  250
              +   P +L + M+ M+ A+  L  L  FV QADNLR QTI RL  +LT  Q ARC L V
Sbjct  384   ASAPLPPHLSNFMSHMSLALNKLSALEGFVLQADNLRHQTIHRLNQLLTTRQEARCLLAV  443

Query  249   TDFFHRLRTLSALWLGRPRQD  187
              ++FHRL+ LS+LWL RPRQD
Sbjct  444   AEYFHRLQALSSLWLARPRQD  464



>ref|XP_010452627.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X4 [Camelina 
sativa]
Length=461

 Score =   315 bits (807),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 216/302 (72%), Gaps = 8/302 (3%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  A+++G     +    
Sbjct  160   DPKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQEIQRARSQGVFFGGSLIGD  219

Query  891   gvghgHPLSLTKITP-EGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                 G P+    ++  E A FD+EYARW+EE+ R+  ELR A  E  L+ENEL+ +VDAC
Sbjct  220   QHQGGLPIGPGNVSSAEAAVFDMEYARWLEEQQRLLTELRVATQE-HLAENELRMFVDAC  278

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  + +L AM+AK+DV HL+SG   TP ERCF+W+GGFRPS ++KVI++Q+E +TEQ
Sbjct  279   LAHYDHLINLKAMVAKTDVFHLISGAWKTPAERCFLWMGGFRPSEIIKVIVNQIEPLTEQ  338

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSD-----ALFYPSNLPSCMTQMAAA  373
             Q +G+ GL+QSTQEAEEALSQG+E L+ ++SD I SD     +   P +L + M+ M+ A
Sbjct  339   QIVGICGLQQSTQEAEEALSQGLEALNQSLSDSIVSDSLPPASAPLPPHLSNFMSHMSLA  398

Query  372   ITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
             +  L  L +FV QADNLR QTI RL  +LT  Q ARC L V ++FHRL+ LS+LWL RPR
Sbjct  399   LNKLSALESFVLQADNLRHQTIHRLNQLLTTRQEARCLLAVAEYFHRLQALSSLWLARPR  458

Query  192   QD  187
             QD
Sbjct  459   QD  460



>ref|XP_010452624.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Camelina 
sativa]
 ref|XP_010452625.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Camelina 
sativa]
Length=462

 Score =   315 bits (807),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 216/302 (72%), Gaps = 8/302 (3%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  A+++G     +    
Sbjct  161   DPKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQEIQRARSQGVFFGGSLIGD  220

Query  891   gvghgHPLSLTKITP-EGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                 G P+    ++  E A FD+EYARW+EE+ R+  ELR A  E  L+ENEL+ +VDAC
Sbjct  221   QHQGGLPIGPGNVSSAEAAVFDMEYARWLEEQQRLLTELRVATQE-HLAENELRMFVDAC  279

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  + +L AM+AK+DV HL+SG   TP ERCF+W+GGFRPS ++KVI++Q+E +TEQ
Sbjct  280   LAHYDHLINLKAMVAKTDVFHLISGAWKTPAERCFLWMGGFRPSEIIKVIVNQIEPLTEQ  339

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSD-----ALFYPSNLPSCMTQMAAA  373
             Q +G+ GL+QSTQEAEEALSQG+E L+ ++SD I SD     +   P +L + M+ M+ A
Sbjct  340   QIVGICGLQQSTQEAEEALSQGLEALNQSLSDSIVSDSLPPASAPLPPHLSNFMSHMSLA  399

Query  372   ITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
             +  L  L +FV QADNLR QTI RL  +LT  Q ARC L V ++FHRL+ LS+LWL RPR
Sbjct  400   LNKLSALESFVLQADNLRHQTIHRLNQLLTTRQEARCLLAVAEYFHRLQALSSLWLARPR  459

Query  192   QD  187
             QD
Sbjct  460   QD  461



>gb|KEH16646.1| BZIP family transcription factor [Medicago truncatula]
Length=471

 Score =   315 bits (807),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 187/377 (50%), Positives = 244/377 (65%), Gaps = 45/377 (12%)
 Frame = -2

Query  1335  NKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNN---GMRLPNTLNMFPSEPMHV  1165
             NKD+S AYD+GELDQAF  +L+ Q Q    +    +QN+   GM+ P TLN+FPS+PMHV
Sbjct  86    NKDSS-AYDLGELDQAFFLYLDGQAQADPSNVPDQRQNSSSSGMKPPPTLNIFPSQPMHV  144

Query  1164  -------------------------------------NPS-PTALegsgsgsesrrssts  1099
                                                  NPS P   +     +  + +++S
Sbjct  145   APPPSNSKVSMGLTSPITSGSKKPSQPSMELANQRNENPSAPAPPKPVKKENNRKGTTSS  204

Query  1098  sgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGA  919
             S      T + KTLRRLAQNREAARK R+RKKAYVQQLETSR+KL QLEQ++  A+A+G 
Sbjct  205   SEHEGPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLETSRIKLNQLEQELQRARAQGV  264

Query  918   RITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENE  739
              +   G V+G   G P+SL  I+ E A FDVEY RW+EE HR+ CELR A+DE  L ENE
Sbjct  265   -LMGGGAVLGGDQGIPISLNSISSEAAMFDVEYGRWLEEHHRLVCELRAALDE-HLHENE  322

Query  738   LKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMS  559
             L+ YV+ C AHY Q+ +L  +LA++DV HLV GM  TP ERCF+WIGGFRPS L+K+I+S
Sbjct  323   LRLYVENCLAHYDQVINLKNILARTDVFHLVFGMWKTPAERCFMWIGGFRPSELIKIIVS  382

Query  558   QLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQM  382
             Q+E +TE Q LG+ GL+QSTQEAEEALSQG++ L+ ++S+ I+SD+L  P N+ + M QM
Sbjct  383   QIEPLTEHQILGICGLQQSTQEAEEALSQGLDALNQSLSETITSDSLSNPPNMANYMGQM  442

Query  381   AAAITNLYTLHTFVRQA  331
             A A+  L TL +FVRQ 
Sbjct  443   ALAMNKLSTLESFVRQG  459



>ref|XP_009419169.1| PREDICTED: transcription factor HBP-1b(c38)-like [Musa acuminata 
subsp. malaccensis]
Length=445

 Score =   314 bits (804),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 191/421 (45%), Positives = 250/421 (59%), Gaps = 58/421 (14%)
 Frame = -2

Query  1335  NKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMFPSEPMHV---  1165
             NK+ S +YD+GELDQA   FL+ Q +            +     +TLN+FPS PMHV   
Sbjct  41    NKE-SGSYDLGELDQALFMFLDGQDRS----------TSAQEQKHTLNIFPSRPMHVDPR  89

Query  1164  ----------------NPSPTALegsgsgsesrrsstssgggrggTL-------------  1072
                              PS  A++   + S            +   L             
Sbjct  90    TKGGISSASPASSGGSKPSEQAMDLGNAESYLPALPEHGEDTKAAILKKEGNRKGISGSD  149

Query  1071  -------NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARI  913
                    + KT RRLAQNREAARK R+RKKAY+QQLE+SR+KL QLEQ++  A+A+G   
Sbjct  150   HRRLKTPDPKTSRRLAQNREAARKSRLRKKAYIQQLESSRIKLSQLEQELQKARAQGILF  209

Query  912   TEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELK  733
                    G        +     + A FD+EYARW+EE HR+ CELR+AV E    E EL+
Sbjct  210   G------GGAALVDAGVGGFNSDEATFDMEYARWVEEHHRLMCELRRAVQE-QSPETELR  262

Query  732   RYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQL  553
               VD C AHY QM HL   + KSDV HL+SGM  TP ERCF+W+GGFRPS L+K+++  +
Sbjct  263   MLVDICLAHYDQMMHLKGAVIKSDVFHLISGMWMTPAERCFMWMGGFRPSELIKMLLRHI  322

Query  552   E-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAA  376
             E +TEQQ LG+ G++QSTQE EEALSQG+E L+ ++SD I+SD L Y SN+ + M QM  
Sbjct  323   EPLTEQQILGVCGMQQSTQETEEALSQGLEALNKSLSDTIASDELSYTSNMANYMGQMTV  382

Query  375   AITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRP  196
             A+  L TL +FVR+AD+LR Q + RLY ILT  Q+ARC L + ++FHRLR+LS+LWL RP
Sbjct  383   AMNKLTTLESFVREADHLRQQALHRLYQILTTRQMARCLLAIAEYFHRLRSLSSLWLSRP  442

Query  195   R  193
             R
Sbjct  443   R  443



>ref|NP_001190244.1| bZIP transcription factor TGA10 [Arabidopsis thaliana]
 gb|ADO95299.1| bZIP65 [Arabidopsis thaliana]
 gb|AED91074.1| bZIP transcription factor TGA10 [Arabidopsis thaliana]
Length=460

 Score =   314 bits (804),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 165/302 (55%), Positives = 213/302 (71%), Gaps = 8/302 (3%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARIT-Engnv  895
             + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  A+++G          
Sbjct  159   DPKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQEIQRARSQGVFFGGSLIGG  218

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                  G P+    I+ E A FD+EYARW+EE+ R+  ELR A  E  LSENEL+ +VD C
Sbjct  219   DQQQGGLPIGPGNISSEAAVFDMEYARWLEEQQRLLNELRVATQE-HLSENELRMFVDTC  277

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  + +L AM+AK+DV HL+SG   TP ERCF+W+GGFRPS ++KVI++Q+E +TEQ
Sbjct  278   LAHYDHLINLKAMVAKTDVFHLISGAWKTPAERCFLWMGGFRPSEIIKVIVNQIEPLTEQ  337

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSD-----ALFYPSNLPSCMTQMAAA  373
             Q +G+ GL+QSTQEAEEALSQG+E L+ ++SD I SD     +   P +L + M+ M+ A
Sbjct  338   QIVGICGLQQSTQEAEEALSQGLEALNQSLSDSIVSDSLPPASAPLPPHLSNFMSHMSLA  397

Query  372   ITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
             +  L  L  FV QADNLR QTI RL  +LT  Q ARC L V ++FHRL+ LS+LWL RPR
Sbjct  398   LNKLSALEGFVLQADNLRHQTIHRLNQLLTTRQEARCLLAVAEYFHRLQALSSLWLARPR  457

Query  192   QD  187
             QD
Sbjct  458   QD  459



>ref|XP_010491267.1| PREDICTED: transcription factor TGA2-like isoform X3 [Camelina 
sativa]
Length=464

 Score =   314 bits (805),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 215/302 (71%), Gaps = 8/302 (3%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  A+++G     +    
Sbjct  163   DPKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQEIQRARSQGVFFGGSLIGD  222

Query  891   gvghgHPLSLTKITP-EGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                 G P+    ++  E A FD+EYARW+EE+ R+  ELR A  E  L+ENEL+ +VDAC
Sbjct  223   QHQGGLPIGPGNVSSAEAAVFDMEYARWLEEQQRLLTELRVATQE-HLAENELRMFVDAC  281

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  + +L AM+AK+DV HL+SG   TP ERCF+W+GGFRPS ++KVI++Q+E +TEQ
Sbjct  282   LAHYDHLINLKAMVAKTDVFHLISGAWKTPAERCFLWMGGFRPSEIIKVIVNQIEPLTEQ  341

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSD-----ALFYPSNLPSCMTQMAAA  373
             Q +G+ GL+QSTQEAEEALSQG+E L+ ++SD I SD     +   P +L + M+ M+ A
Sbjct  342   QIVGICGLQQSTQEAEEALSQGLEALNQSLSDSIVSDSLPPASAPLPPHLSNFMSHMSLA  401

Query  372   ITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
             +  L  L  FV QADNLR QTI RL  +LT  Q ARC L V ++FHRL+ LS+LWL RPR
Sbjct  402   LNKLSALEGFVLQADNLRHQTIHRLNQLLTTRQEARCLLAVAEYFHRLQALSSLWLARPR  461

Query  192   QD  187
             QD
Sbjct  462   QD  463



>ref|XP_006399160.1| hypothetical protein EUTSA_v10014032mg [Eutrema salsugineum]
 gb|ESQ40613.1| hypothetical protein EUTSA_v10014032mg [Eutrema salsugineum]
Length=339

 Score =   310 bits (793),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 162/302 (54%), Positives = 211/302 (70%), Gaps = 8/302 (3%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARIT-Engnv  895
             + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  A+++G          
Sbjct  39    DPKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQEIQRARSQGVFFGGSLIGG  98

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                  G  +    I+ E A FD+EY RW+EE+ R+  ELR A  E  L+ENEL+ +VD C
Sbjct  99    DQQQGGLAIGHGNISSEAAVFDMEYTRWLEEQQRLLNELRVATQE-HLAENELRMFVDTC  157

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  + +L AM+AK+DV HL+SG   TP ERCF+W+GGFRPS ++KVI++Q+E +TEQ
Sbjct  158   LAHYDHLINLKAMVAKTDVFHLLSGAWKTPAERCFLWMGGFRPSEIIKVIVNQIEPLTEQ  217

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALF-----YPSNLPSCMTQMAAA  373
             Q +G+ GL+QSTQEAEEALSQG+E L+ ++SD I SD+L       P +L + M+ M+ A
Sbjct  218   QIVGICGLQQSTQEAEEALSQGLEALNQSLSDSIVSDSLSPASTQLPPHLSNFMSHMSLA  277

Query  372   ITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
             +  L  L   V QADNLR QTI RL  +LT  Q ARC L V ++FHRL+ LS+LWL RPR
Sbjct  278   LNKLSALEGLVLQADNLRHQTIHRLNQLLTTRQEARCILAVAEYFHRLQALSSLWLARPR  337

Query  192   QD  187
             QD
Sbjct  338   QD  339



>ref|XP_010423289.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Camelina 
sativa]
Length=463

 Score =   314 bits (804),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 215/302 (71%), Gaps = 8/302 (3%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  A+++G     +    
Sbjct  162   DPKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQEIQRARSQGVFFGGSLIGD  221

Query  891   gvghgHPLSLTKITP-EGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                 G P+    ++  E A FD+EYARW+EE+ R+  ELR A  E  L+ENEL+ +VDAC
Sbjct  222   QHQGGLPIGPGNVSSAEAAVFDMEYARWLEEQQRLLTELRVATQE-HLAENELRMFVDAC  280

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  + +L AM+AK+DV HL+SG   TP ERCF+W+GGFRPS ++KVI++Q+E +TEQ
Sbjct  281   LAHYDHLINLKAMVAKTDVFHLISGAWKTPAERCFLWMGGFRPSEIIKVIVNQIEPLTEQ  340

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSD-----ALFYPSNLPSCMTQMAAA  373
             Q +G+ GL+QSTQEAEEALSQG+E L+ ++SD I SD     +   P +L + M+ M+ A
Sbjct  341   QIVGICGLQQSTQEAEEALSQGLEALNQSLSDSIVSDSLPPASAPLPPHLSNFMSHMSLA  400

Query  372   ITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
             +  L  L  FV QADNLR QTI RL  +LT  Q ARC L V ++FHRL+ LS+LWL RPR
Sbjct  401   LNKLSALEGFVLQADNLRHQTIHRLNQLLTTRQEARCLLAVAEYFHRLQALSSLWLARPR  460

Query  192   QD  187
             QD
Sbjct  461   QD  462



>gb|EYU20711.1| hypothetical protein MIMGU_mgv1a025325mg [Erythranthe guttata]
Length=514

 Score =   315 bits (807),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 160/297 (54%), Positives = 215/297 (72%), Gaps = 9/297 (3%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR++L QLEQ +  A+++G  +  N  + 
Sbjct  221   DPKTLRRLAQNREAARKSRLRKKAYVQQLESSRLRLTQLEQDIHRARSQGLMLGGNAVLA  280

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G      LSL  +  + A FD+EYARW+EE HR+  ELR AV+E  L ENEL+ +V+ C 
Sbjct  281   GDQG---LSLN-LNSDAALFDMEYARWLEEHHRVMVELRNAVEE-ELPENELRMFVENCL  335

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
              HY QM  L  M+ KSDV H+ +G+  +P ERCF+W+GGFRPS L+K+IM ++E +TE Q
Sbjct  336   VHYDQMMRLKNMITKSDVFHIFTGIWKSPAERCFMWMGGFRPSHLIKIIMREIEPMTEGQ  395

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALF---YPSNLPSCMTQMAAAITN  364
              +G+ G++QSTQEAEEALS G++ L+ ++S+ + SD+L    +P N+ + M+ MA AI  
Sbjct  396   MMGIYGVQQSTQEAEEALSHGLDALNQSLSETLISDSLLLNCFPQNINNYMSHMALAINK  455

Query  363   LYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
             L TL  FVRQADNLR QT+ R++ ILT  Q ARCFL + ++FHRLR LS+LWL RPR
Sbjct  456   LSTLEGFVRQADNLRQQTLHRVHQILTTRQSARCFLAIGEYFHRLRALSSLWLSRPR  512



>ref|XP_009130967.1| PREDICTED: transcription factor TGA2-like isoform X2 [Brassica 
rapa]
Length=454

 Score =   313 bits (801),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 161/302 (53%), Positives = 211/302 (70%), Gaps = 8/302 (3%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARIT-Engnv  895
             + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  A+++G          
Sbjct  153   DPKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLSQLEQEIQRARSQGVFFGGSLIGG  212

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                  G P      + E A FD+EY RW+EE+ R+  ELR A  E  L+ENEL+ +VD C
Sbjct  213   DQQQGGLPTGPGNTSSEAAVFDMEYTRWLEEQQRLLTELRMATQE-HLAENELRMFVDNC  271

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AH+  + +L AM+AK+DV HL+SG   TP ERCF+W+GGFRPS ++KVI++Q+E +TEQ
Sbjct  272   LAHHDHLINLKAMVAKTDVFHLISGAWKTPAERCFLWMGGFRPSEIIKVIVNQIEQLTEQ  331

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALF-----YPSNLPSCMTQMAAA  373
             Q +G+ GL+QST EAEEALSQG+E L+ ++SD I SD+L      +P +L + M+ M+ A
Sbjct  332   QIVGICGLQQSTHEAEEALSQGLEALNQSLSDSIVSDSLSPASAQFPPHLSNFMSHMSLA  391

Query  372   ITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
             +  L  L  FV QADNLR QTI RL  +LT  Q ARC L V ++FHRL+ LS+LWL RPR
Sbjct  392   LNKLSALEGFVLQADNLRHQTIHRLNQLLTTRQEARCILAVAEYFHRLQALSSLWLARPR  451

Query  192   QD  187
             QD
Sbjct  452   QD  453



>ref|XP_008783086.1| PREDICTED: transcription factor HBP-1b(c38)-like [Phoenix dactylifera]
Length=357

 Score =   308 bits (789),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 158/298 (53%), Positives = 206/298 (69%), Gaps = 5/298 (2%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             +AKTLRRLAQNREAARK R+RKKAYVQQLE+S+M+L QLE ++  A+A+G  +       
Sbjct  61    DAKTLRRLAQNREAARKSRLRKKAYVQQLESSKMRLAQLEHELQRARAQGFLVGSGSLPA  120

Query  891   gvghgHPL---SLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVD  721
             G   G  L   S   +  + A FDVEY +W+ + HR+ CE+R A+ E  L ENEL+  VD
Sbjct  121   GSTGGGGLPDGSTGGLNADAAMFDVEYGKWLVDHHRLMCEMRAAMQE-HLPENELRMLVD  179

Query  720   ACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VT  544
              C  HY  +  L +++A+SD  HL SGM  TP ERCF+WIGGFRPS L+K+++  +E +T
Sbjct  180   KCLLHYDAVMSLKSVMARSDAFHLYSGMWMTPAERCFMWIGGFRPSELIKIVLRHIEPLT  239

Query  543   EQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITN  364
             EQQ +G+ GL+QS  E EEALSQG+E L  ++SD I SDAL  PS++ + ++QM  A+  
Sbjct  240   EQQIVGVCGLQQSVHETEEALSQGLEALFRSLSDTIISDALGSPSDVGNYISQMVVAMNK  299

Query  363   LYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
             L  L  FVRQADNLR QT+ RL  IL+  Q ARCFL + + FHRLR LS+LWL RPRQ
Sbjct  300   LSALEAFVRQADNLRQQTVHRLQLILSTHQAARCFLAMAEHFHRLRALSSLWLTRPRQ  357



>ref|XP_007145660.1| hypothetical protein PHAVU_007G257700g [Phaseolus vulgaris]
 gb|ESW17654.1| hypothetical protein PHAVU_007G257700g [Phaseolus vulgaris]
Length=488

 Score =   312 bits (799),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 183/394 (46%), Positives = 244/394 (62%), Gaps = 44/394 (11%)
 Frame = -2

Query  1401  NNQTCFGTVQAAPSSSSFPALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQN  1222
             + +  FG + ++ SS S PA     +S AYD+GELDQAF  +L+               +
Sbjct  68    DQEISFGMMPSS-SSHSIPANYLSKDSGAYDLGELDQAFFLYLD---DPSSVQDQRQNSS  123

Query  1221  NGMRLPNTLNMFPSEPMHV-------------------------------NP------SP  1153
             +GMR P TLN+FPS+PMH                                NP      +P
Sbjct  124   SGMRPPPTLNIFPSQPMHAVPPSNSKVTMELPSTQTSGSKRPPGSSIAKPNPHTEAPSAP  183

Query  1152  TALegsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSR  973
                +        + +++SS      T + KTLRRLAQNREAARK R+RKKAYVQQLE+SR
Sbjct  184   EPPKVVKREGNRKGATSSSEQEAPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESSR  243

Query  972   MKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHR  793
             +KL QLEQ++  A+A+G  +     ++G   G P+++  I+ E A FDVEYARW+EE  R
Sbjct  244   IKLNQLEQELQRARAQGI-LMGGNALLGGEQGFPMAMNGISSEAAMFDVEYARWLEEHQR  302

Query  792   ITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERC  613
             I CELR AV E  L ENEL+ YVD C AHY Q+ +L  ++AK+DV HLV GM  TP ERC
Sbjct  303   IVCELRGAVQE-HLHENELRLYVDNCLAHYDQVMNLKTIVAKTDVFHLVFGMWKTPAERC  361

Query  612   FIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDII  436
             F+WIGGFRPS L+K+I+ Q+E +TEQQ LG+ GL+QSTQEAEEALSQG++ L+ ++SD I
Sbjct  362   FMWIGGFRPSELIKIILGQIEPLTEQQILGICGLQQSTQEAEEALSQGLDALNQSLSDTI  421

Query  435   SSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQ  334
             +SD+L+ P N+ + M QMA A+  L TL +F RQ
Sbjct  422   TSDSLWCPPNMTNYMGQMAVAMNKLSTLESFARQ  455



>dbj|BAB11142.1| bZIP transcription factor-like protein [Arabidopsis thaliana]
Length=313

 Score =   306 bits (783),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 163/301 (54%), Positives = 209/301 (69%), Gaps = 18/301 (6%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  A+++G          
Sbjct  24    DPKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQEIQRARSQGVFFG------  77

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
                    L       E A FD+EYARW+EE+ R+  ELR A  E  LSENEL+ +VD C 
Sbjct  78    -----GSLIGGDQQQEAAVFDMEYARWLEEQQRLLNELRVATQE-HLSENELRMFVDTCL  131

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY  + +L AM+AK+DV HL+SG   TP ERCF+W+GGFRPS ++KVI++Q+E +TEQQ
Sbjct  132   AHYDHLINLKAMVAKTDVFHLISGAWKTPAERCFLWMGGFRPSEIIKVIVNQIEPLTEQQ  191

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSD-----ALFYPSNLPSCMTQMAAAI  370
              +G+ GL+QSTQEAEEALSQG+E L+ ++SD I SD     +   P +L + M+ M+ A+
Sbjct  192   IVGICGLQQSTQEAEEALSQGLEALNQSLSDSIVSDSLPPASAPLPPHLSNFMSHMSLAL  251

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L  L  FV QADNLR QTI RL  +LT  Q ARC L V ++FHRL+ LS+LWL RPRQ
Sbjct  252   NKLSALEGFVLQADNLRHQTIHRLNQLLTTRQEARCLLAVAEYFHRLQALSSLWLARPRQ  311

Query  189   D  187
             D
Sbjct  312   D  312



>ref|XP_007145659.1| hypothetical protein PHAVU_007G257700g [Phaseolus vulgaris]
 gb|ESW17653.1| hypothetical protein PHAVU_007G257700g [Phaseolus vulgaris]
Length=530

 Score =   312 bits (799),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 183/394 (46%), Positives = 244/394 (62%), Gaps = 44/394 (11%)
 Frame = -2

Query  1401  NNQTCFGTVQAAPSSSSFPALGNKDNSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQN  1222
             + +  FG + ++ SS S PA     +S AYD+GELDQAF  +L+               +
Sbjct  110   DQEISFGMMPSS-SSHSIPANYLSKDSGAYDLGELDQAFFLYLD---DPSSVQDQRQNSS  165

Query  1221  NGMRLPNTLNMFPSEPMHV-------------------------------NP------SP  1153
             +GMR P TLN+FPS+PMH                                NP      +P
Sbjct  166   SGMRPPPTLNIFPSQPMHAVPPSNSKVTMELPSTQTSGSKRPPGSSIAKPNPHTEAPSAP  225

Query  1152  TALegsgsgsesrrsstssgggrggTLNAKTLRRLAQNREAARKCRIRKKAYVQQLETSR  973
                +        + +++SS      T + KTLRRLAQNREAARK R+RKKAYVQQLE+SR
Sbjct  226   EPPKVVKREGNRKGATSSSEQEAPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESSR  285

Query  972   MKLIQLEQQVALAQARGARITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHR  793
             +KL QLEQ++  A+A+G  +     ++G   G P+++  I+ E A FDVEYARW+EE  R
Sbjct  286   IKLNQLEQELQRARAQGI-LMGGNALLGGEQGFPMAMNGISSEAAMFDVEYARWLEEHQR  344

Query  792   ITCELRKAVDELMLSENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERC  613
             I CELR AV E  L ENEL+ YVD C AHY Q+ +L  ++AK+DV HLV GM  TP ERC
Sbjct  345   IVCELRGAVQE-HLHENELRLYVDNCLAHYDQVMNLKTIVAKTDVFHLVFGMWKTPAERC  403

Query  612   FIWIGGFRPSLLLKVIMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDII  436
             F+WIGGFRPS L+K+I+ Q+E +TEQQ LG+ GL+QSTQEAEEALSQG++ L+ ++SD I
Sbjct  404   FMWIGGFRPSELIKIILGQIEPLTEQQILGICGLQQSTQEAEEALSQGLDALNQSLSDTI  463

Query  435   SSDALFYPSNLPSCMTQMAAAITNLYTLHTFVRQ  334
             +SD+L+ P N+ + M QMA A+  L TL +F RQ
Sbjct  464   TSDSLWCPPNMTNYMGQMAVAMNKLSTLESFARQ  497



>ref|XP_009130965.1| PREDICTED: transcription factor TGA2-like isoform X1 [Brassica 
rapa]
Length=455

 Score =   309 bits (792),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 161/305 (53%), Positives = 214/305 (70%), Gaps = 13/305 (4%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARG----ARITEn  904
             + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  A+++G      +   
Sbjct  153   DPKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLSQLEQEIQRARSQGVFFGGSLIGG  212

Query  903   gnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYV  724
                 G     P + +  + E A FD+EY RW+EE+ R+  ELR A  E  L+ENEL+ +V
Sbjct  213   DQQQGGLPTGPGNTS--SAEAAVFDMEYTRWLEEQQRLLTELRMATQE-HLAENELRMFV  269

Query  723   DACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-V  547
             D C AH+  + +L AM+AK+DV HL+SG   TP ERCF+W+GGFRPS ++KVI++Q+E +
Sbjct  270   DNCLAHHDHLINLKAMVAKTDVFHLISGAWKTPAERCFLWMGGFRPSEIIKVIVNQIEQL  329

Query  546   TEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALF-----YPSNLPSCMTQM  382
             TEQQ +G+ GL+QST EAEEALSQG+E L+ ++SD I SD+L      +P +L + M+ M
Sbjct  330   TEQQIVGICGLQQSTHEAEEALSQGLEALNQSLSDSIVSDSLSPASAQFPPHLSNFMSHM  389

Query  381   AAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLG  202
             + A+  L  L  FV QADNLR QTI RL  +LT  Q ARC L V ++FHRL+ LS+LWL 
Sbjct  390   SLALNKLSALEGFVLQADNLRHQTIHRLNQLLTTRQEARCILAVAEYFHRLQALSSLWLA  449

Query  201   RPRQD  187
             RPRQD
Sbjct  450   RPRQD  454



>ref|XP_002532393.1| Transcription factor HBP-1b(c1), putative [Ricinus communis]
 gb|EEF29978.1| Transcription factor HBP-1b(c1), putative [Ricinus communis]
Length=469

 Score =   308 bits (790),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 181/371 (49%), Positives = 232/371 (63%), Gaps = 44/371 (12%)
 Frame = -2

Query  1326  NSEAYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMFPSEPMH-VNPSPT  1150
             ++ AYD+GELDQA   +L+   QD        Q N GMR P TLN+FPS+PMH V PS  
Sbjct  102   DAGAYDLGELDQALFLYLDG--QDPSAVQDQRQSNTGMR-PPTLNIFPSQPMHVVEPSSA  158

Query  1149  ALegsgsgsesrrsstssgggrggTLNAK-------------------------------  1063
                  G  S +   S           NA+                               
Sbjct  159   KTNTPGLVSSATSGSKRPSEPSMELANARNDVASAPEPAKTLKREGNRKGPTTSSSEQEG  218

Query  1062  -------TLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEn  904
                    TLRRLAQNREAARK R+RKKAYVQQLE+SR++L QLEQ++  A+A+G      
Sbjct  219   PKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESSRIRLTQLEQELQRARAQGLFFGGG  278

Query  903   gnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYV  724
             GN++    G P+ +  I+ + A FD+EYARW+EE HR+TCELR AV E  L ENEL+ +V
Sbjct  279   GNLLAGDQGLPVGINNISSDAAVFDMEYARWVEEHHRLTCELRAAVQE-HLPENELRLFV  337

Query  723   DACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-V  547
             D C AHY ++ +L +M+AKSDV HLVSGM  TP ERCF+W+GGFRPS L+KVI++Q+E +
Sbjct  338   DNCLAHYDEVMNLKSMVAKSDVFHLVSGMWKTPAERCFMWMGGFRPSELIKVILNQIEPL  397

Query  546   TEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAIT  367
             TEQQ LG+ GL+QSTQEAEEALSQG+E L+ ++SD I+SD+L  P N+ + M QMA A+ 
Sbjct  398   TEQQILGICGLQQSTQEAEEALSQGLEALNQSLSDTIASDSLSCPPNMANYMGQMAVAMN  457

Query  366   NLYTLHTFVRQ  334
              L TL  FVRQ
Sbjct  458   KLSTLEGFVRQ  468



>ref|NP_001140874.1| putative bZIP transcription factor superfamily protein [Zea mays]
 gb|ACF84857.1| unknown [Zea mays]
 tpg|DAA62036.1| TPA: putative bZIP transcription factor superfamily protein [Zea 
mays]
 gb|AIB05091.1| bZIP transcription factor, partial [Zea mays]
Length=356

 Score =   303 bits (777),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 155/298 (52%), Positives = 213/298 (71%), Gaps = 6/298 (2%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEn---g  901
             + KTLRRLAQNREAARK R+RKKAY+QQLE+SR++L QLEQ++  A+A+G     +    
Sbjct  55    DPKTLRRLAQNREAARKSRLRKKAYIQQLESSRIRLAQLEQELHTARAQGVFFPNSGILA  114

Query  900   nvvgvghgHPLS-LTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYV  724
             +    G G P+  +  ++ E A FDVEY RW EE +R+  ELR A+ +  L E EL+ YV
Sbjct  115   DQGVAGKGVPIGGIDGLSSEAAMFDVEYGRWQEEHYRLMYELRAALQQ-HLPEGELQMYV  173

Query  723   DACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-V  547
             ++C AH+ +M  +     K DV HL+SG+  +P ERCF+W+GGFRPS ++K+++S +E +
Sbjct  174   ESCLAHHDEMVGIKEGAIKGDVFHLISGVWRSPAERCFLWLGGFRPSEVIKMLLSHVEPL  233

Query  546   TEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAIT  367
             TEQQ +G+ GL+QS  E EEALSQG+E L+ ++SD + SDAL  PSN+ + M QMA A+ 
Sbjct  234   TEQQIVGVYGLQQSALETEEALSQGLEALYQSLSDTVVSDALSCPSNVSNYMGQMAVAMN  293

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
              L TL  FVRQA+NLR QT+ RL+ +LT  Q+AR  L V+D+FHRLRTLS+LW+ RPR
Sbjct  294   KLSTLEGFVRQAENLRQQTLHRLHQVLTTRQMARSLLAVSDYFHRLRTLSSLWVTRPR  351



>ref|XP_002975942.1| hypothetical protein SELMODRAFT_232668 [Selaginella moellendorffii]
 gb|EFJ22847.1| hypothetical protein SELMODRAFT_232668 [Selaginella moellendorffii]
Length=308

 Score =   301 bits (770),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 154/293 (53%), Positives = 209/293 (71%), Gaps = 6/293 (2%)
 Frame = -2

Query  1065  KTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvvgv  886
             + LRRLAQNREAARK R+RKKAYVQQLE+SRMKL QLEQ++  A+ +G  +   G    +
Sbjct  21    QALRRLAQNREAARKSRLRKKAYVQQLESSRMKLNQLEQELQRARQQGFYVGAGGYGEHL  80

Query  885   ghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFAH  706
                +      + P  AAFD++YARW+EE+HR  CELR A+    +++NEL+  VD   AH
Sbjct  81    AGAN----APLNPGAAAFDMDYARWLEEQHRQLCELRSALQS-HVADNELRVLVDNGLAH  135

Query  705   YAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQAL  529
             Y ++  + ++ AK+DV HLVSGM  +P ERCF+W+GGFRPS LLK+++ QLE +TEQQ +
Sbjct  136   YDEIFRMKSVAAKADVFHLVSGMWKSPAERCFMWMGGFRPSELLKILIPQLEPLTEQQLM  195

Query  528   GMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYTLH  349
             G+  L+QS+Q+AE+ALSQGME L  ++SD ++S +L   SN+ + M QMA A+  L TL 
Sbjct  196   GICNLQQSSQQAEDALSQGMEALQQSLSDTLASGSLGASSNVANYMGQMAMAMGKLGTLE  255

Query  348   TFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              FVRQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LW  RPR+
Sbjct  256   NFVRQADNLRQQTLQQMHRILTTRQAARGLLAMGDYFARLRALSSLWSARPRE  308



>gb|ACF88441.1| unknown [Zea mays]
 gb|ACN28595.1| unknown [Zea mays]
 tpg|DAA62037.1| TPA: putative bZIP transcription factor superfamily protein [Zea 
mays]
Length=406

 Score =   304 bits (778),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 155/298 (52%), Positives = 213/298 (71%), Gaps = 6/298 (2%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEn---g  901
             + KTLRRLAQNREAARK R+RKKAY+QQLE+SR++L QLEQ++  A+A+G     +    
Sbjct  105   DPKTLRRLAQNREAARKSRLRKKAYIQQLESSRIRLAQLEQELHTARAQGVFFPNSGILA  164

Query  900   nvvgvghgHPLS-LTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYV  724
             +    G G P+  +  ++ E A FDVEY RW EE +R+  ELR A+ +  L E EL+ YV
Sbjct  165   DQGVAGKGVPIGGIDGLSSEAAMFDVEYGRWQEEHYRLMYELRAALQQ-HLPEGELQMYV  223

Query  723   DACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-V  547
             ++C AH+ +M  +     K DV HL+SG+  +P ERCF+W+GGFRPS ++K+++S +E +
Sbjct  224   ESCLAHHDEMVGIKEGAIKGDVFHLISGVWRSPAERCFLWLGGFRPSEVIKMLLSHVEPL  283

Query  546   TEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAIT  367
             TEQQ +G+ GL+QS  E EEALSQG+E L+ ++SD + SDAL  PSN+ + M QMA A+ 
Sbjct  284   TEQQIVGVYGLQQSALETEEALSQGLEALYQSLSDTVVSDALSCPSNVSNYMGQMAVAMN  343

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
              L TL  FVRQA+NLR QT+ RL+ +LT  Q+AR  L V+D+FHRLRTLS+LW+ RPR
Sbjct  344   KLSTLEGFVRQAENLRQQTLHRLHQVLTTRQMARSLLAVSDYFHRLRTLSSLWVTRPR  401



>gb|ACG39046.1| DNA binding protein [Zea mays]
Length=407

 Score =   303 bits (777),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 155/298 (52%), Positives = 213/298 (71%), Gaps = 6/298 (2%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEn---g  901
             + KTLRRLAQNREAARK R+RKKAY+QQLE+SR++L QLEQ++  A+A+G     +    
Sbjct  106   DPKTLRRLAQNREAARKSRLRKKAYIQQLESSRIRLAQLEQELHTARAQGVFFPNSGILA  165

Query  900   nvvgvghgHPLS-LTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYV  724
             +    G G P+  +  ++ E A FDVEY RW EE +R+  ELR A+ +  L E EL+ YV
Sbjct  166   DQGVAGKGVPIGGIDGLSSEAAMFDVEYGRWQEEHYRLMYELRAALQQ-HLPEGELQMYV  224

Query  723   DACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-V  547
             ++C AH+ +M  +     K DV HL+SG+  +P ERCF+W+GGFRPS ++K+++S +E +
Sbjct  225   ESCLAHHDEMVGIKEGAIKGDVFHLISGVWRSPAERCFLWLGGFRPSEVIKMLLSHVEPL  284

Query  546   TEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAIT  367
             TEQQ +G+ GL+QS  E EEALSQG+E L+ ++SD + SDAL  PSN+ + M QMA A+ 
Sbjct  285   TEQQIVGVYGLQQSALETEEALSQGLEALYQSLSDTVVSDALSCPSNVSNYMGQMAVAMN  344

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
              L TL  FVRQA+NLR QT+ RL+ +LT  Q+AR  L V+D+FHRLRTLS+LW+ RPR
Sbjct  345   KLSTLEGFVRQAENLRQQTLHRLHQVLTTRQMARSLLAVSDYFHRLRTLSSLWVTRPR  402



>ref|XP_008651078.1| PREDICTED: putative bZIP transcription factor superfamily protein 
isoform X2 [Zea mays]
Length=416

 Score =   304 bits (778),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 155/298 (52%), Positives = 213/298 (71%), Gaps = 6/298 (2%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEn---g  901
             + KTLRRLAQNREAARK R+RKKAY+QQLE+SR++L QLEQ++  A+A+G     +    
Sbjct  115   DPKTLRRLAQNREAARKSRLRKKAYIQQLESSRIRLAQLEQELHTARAQGVFFPNSGILA  174

Query  900   nvvgvghgHPLS-LTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYV  724
             +    G G P+  +  ++ E A FDVEY RW EE +R+  ELR A+ +  L E EL+ YV
Sbjct  175   DQGVAGKGVPIGGIDGLSSEAAMFDVEYGRWQEEHYRLMYELRAALQQ-HLPEGELQMYV  233

Query  723   DACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-V  547
             ++C AH+ +M  +     K DV HL+SG+  +P ERCF+W+GGFRPS ++K+++S +E +
Sbjct  234   ESCLAHHDEMVGIKEGAIKGDVFHLISGVWRSPAERCFLWLGGFRPSEVIKMLLSHVEPL  293

Query  546   TEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAIT  367
             TEQQ +G+ GL+QS  E EEALSQG+E L+ ++SD + SDAL  PSN+ + M QMA A+ 
Sbjct  294   TEQQIVGVYGLQQSALETEEALSQGLEALYQSLSDTVVSDALSCPSNVSNYMGQMAVAMN  353

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
              L TL  FVRQA+NLR QT+ RL+ +LT  Q+AR  L V+D+FHRLRTLS+LW+ RPR
Sbjct  354   KLSTLEGFVRQAENLRQQTLHRLHQVLTTRQMARSLLAVSDYFHRLRTLSSLWVTRPR  411



>ref|XP_004957190.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Setaria italica]
Length=497

 Score =   306 bits (784),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 156/298 (52%), Positives = 214/298 (72%), Gaps = 6/298 (2%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEn---g  901
             + KTLRRLAQNREAARK R+RKKAY+QQLE+SR++L QLEQ++  A+A+G     +    
Sbjct  191   DPKTLRRLAQNREAARKSRLRKKAYIQQLESSRIRLAQLEQELHTARAQGVFFPNSGLLA  250

Query  900   nvvgvghgHPLS-LTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYV  724
             +    G G P+  +  ++ E A FDVEY RW EE +R+  ELR A+ +  L E EL+ YV
Sbjct  251   DQGVAGKGVPIGGIDGLSSEAAMFDVEYGRWQEEHYRLMYELRAALQQ-HLPEGELQMYV  309

Query  723   DACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-V  547
             ++C AH+ +M  +     K DV HL+SG+  +P ERCF+W+GGFRPS ++K+++S +E +
Sbjct  310   ESCLAHHDEMVGIKESAIKGDVFHLISGVWRSPAERCFLWLGGFRPSEVIKMLLSHVEPL  369

Query  546   TEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAIT  367
             TEQQ +G+ GL+QS  E EEALSQG++ L+ ++SD + SDAL  PSN+ + M QMAAA+ 
Sbjct  370   TEQQIVGVYGLQQSALETEEALSQGLDALYQSLSDTVVSDALSCPSNVANYMGQMAAAMN  429

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
              L TL  FVRQA+NLR QT+ RL+ ILT  Q+AR  L V+D+FHRLRTLS+LW+ RPR
Sbjct  430   KLSTLEGFVRQAENLRQQTLHRLHQILTTRQMARSLLAVSDYFHRLRTLSSLWVTRPR  487



>ref|XP_002968543.1| hypothetical protein SELMODRAFT_231160 [Selaginella moellendorffii]
 gb|EFJ30797.1| hypothetical protein SELMODRAFT_231160 [Selaginella moellendorffii]
Length=297

 Score =   298 bits (764),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 205/296 (69%), Gaps = 31/296 (10%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AK LRRLAQNREAARK R+RKKAYVQQLE+SRMKL QLEQ++  A+A           
Sbjct  32    LDAKALRRLAQNREAARKSRLRKKAYVQQLESSRMKLNQLEQELQRARA-----------  80

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                               AAFD++YARW+EE+HR  CELR A+    +++NEL+  VD  
Sbjct  81    ------------------AAFDMDYARWLEEQHRQLCELRSALQS-HVADNELRVLVDNG  121

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  + ++ AK+DV HLVSGM  +P ERCF+W+GGFRPS LLK+++ QLE +TEQ
Sbjct  122   LAHYDEIFRMKSVAAKADVFHLVSGMWKSPAERCFMWMGGFRPSELLKILIPQLEPLTEQ  181

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AE+ALSQGME L  ++SD ++S +L   SN+ + M QMA A+  L 
Sbjct  182   QLMGICNLQQSSQQAEDALSQGMEALQQSLSDTLASGSLGASSNVANYMGQMAMAMGKLG  241

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
             TL  FVRQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LW  RPR+
Sbjct  242   TLENFVRQADNLRQQTLQQMHRILTTRQAARGLLAMGDYFARLRALSSLWSARPRE  297



>ref|XP_008651077.1| PREDICTED: putative bZIP transcription factor superfamily protein 
isoform X1 [Zea mays]
 tpg|DAA62038.1| TPA: putative bZIP transcription factor superfamily protein [Zea 
mays]
Length=486

 Score =   305 bits (780),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 155/298 (52%), Positives = 213/298 (71%), Gaps = 6/298 (2%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEn---g  901
             + KTLRRLAQNREAARK R+RKKAY+QQLE+SR++L QLEQ++  A+A+G     +    
Sbjct  185   DPKTLRRLAQNREAARKSRLRKKAYIQQLESSRIRLAQLEQELHTARAQGVFFPNSGILA  244

Query  900   nvvgvghgHPLS-LTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYV  724
             +    G G P+  +  ++ E A FDVEY RW EE +R+  ELR A+ +  L E EL+ YV
Sbjct  245   DQGVAGKGVPIGGIDGLSSEAAMFDVEYGRWQEEHYRLMYELRAALQQ-HLPEGELQMYV  303

Query  723   DACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-V  547
             ++C AH+ +M  +     K DV HL+SG+  +P ERCF+W+GGFRPS ++K+++S +E +
Sbjct  304   ESCLAHHDEMVGIKEGAIKGDVFHLISGVWRSPAERCFLWLGGFRPSEVIKMLLSHVEPL  363

Query  546   TEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAIT  367
             TEQQ +G+ GL+QS  E EEALSQG+E L+ ++SD + SDAL  PSN+ + M QMA A+ 
Sbjct  364   TEQQIVGVYGLQQSALETEEALSQGLEALYQSLSDTVVSDALSCPSNVSNYMGQMAVAMN  423

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
              L TL  FVRQA+NLR QT+ RL+ +LT  Q+AR  L V+D+FHRLRTLS+LW+ RPR
Sbjct  424   KLSTLEGFVRQAENLRQQTLHRLHQVLTTRQMARSLLAVSDYFHRLRTLSSLWVTRPR  481



>ref|XP_002969636.1| hypothetical protein SELMODRAFT_231344 [Selaginella moellendorffii]
 gb|EFJ29724.1| hypothetical protein SELMODRAFT_231344 [Selaginella moellendorffii]
Length=318

 Score =   294 bits (753),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 209/296 (71%), Gaps = 10/296 (3%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L++KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  +    N 
Sbjct  32    LDSKTLRRLAQNREAARKSRLRKKAYVQQLESSRVKLNQLEQELQRARQQGFYLGGYSND  91

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                      S    +   AAFD+EY RW+EE+ R   ELR ++ +  +S++EL+  VDA 
Sbjct  92    Q--------SHAAASSGAAAFDMEYGRWLEEQQRQMTELRTSL-QAHVSDDELRVLVDAA  142

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              +HY ++  L    AKSDV HLVSGM  TP ERCF+W+GGFRPS LLK+++ QLE +TEQ
Sbjct  143   MSHYDEIFRLKTAAAKSDVFHLVSGMWKTPAERCFMWMGGFRPSELLKILIPQLEPLTEQ  202

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AE+ALSQGME L  +++D +++ +L   SN+ + M QMA A+  L 
Sbjct  203   QLMGICNLQQSSQQAEDALSQGMEALQQSLADTLATGSLGAASNVANYMGQMAMAMGKLG  262

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
             TL  FVRQADNLR QT+Q+++ ILT  Q AR FL + D+F RLR LS+LW  RPR+
Sbjct  263   TLENFVRQADNLRHQTLQQMHRILTTRQAARAFLAIGDYFGRLRALSSLWAARPRE  318



>ref|XP_009391829.1| PREDICTED: transcription factor TGA2-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=416

 Score =   297 bits (761),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 177/414 (43%), Positives = 238/414 (57%), Gaps = 76/414 (18%)
 Frame = -2

Query  1317  AYDVGELDQAFLHFLNAqpqdqdpssshdqQNNGMRLPNTLNMFPSEPMHVNP-------  1159
             AYD+GELDQA   +L+ Q     P+              TLN+FPS+PMHV P       
Sbjct  42    AYDLGELDQALFMYLDGQDHSSSPAQEQR---------QTLNIFPSQPMHVEPSTKGGMS  92

Query  1158  --SPTALegsgsg-------------------------sesrrsstssgggrggTLNAKT  1060
               SP +     S                          +  ++     G     T + KT
Sbjct  93    LDSPASSGSKKSSDQAMELGDTKNDLPLLPERGKDSKAASVKKEGNGKGTSGSKTSDPKT  152

Query  1059  LRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvvgvgh  880
             LRRLAQNREAARK R+RKKAY+QQLETSR+KL  LEQ++  A+++G              
Sbjct  153   LRRLAQNREAARKSRLRKKAYIQQLETSRIKLTHLEQELQRARSQG--------------  198

Query  879   gHPLSLTKITPEGAAFDVEYARWIEEEH--RITCELRKAVDELMLSENELKRYVDACFAH  706
                     ++  G A        +E++    +   L  AV E    EN L+ +VD+C AH
Sbjct  199   --------LSFGGGAL-------LEDQGLPAVVGGLSAAVQEHQ-PENHLRMFVDSCLAH  242

Query  705   YAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQAL  529
             + QM +L  ++ +SDV HL+SG+  TP ERCF+W+GGFRPS L+K+++S +E +TE+Q L
Sbjct  243   HDQMVNLKNIVIRSDVFHLISGVWMTPAERCFMWMGGFRPSELIKMLLSHMEPLTEEQIL  302

Query  528   GMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYTLH  349
             G+ GL+QSTQE EEALSQG+E L+ ++SD I+SDAL YPSN+   M QMA A+  L TL 
Sbjct  303   GVCGLQQSTQETEEALSQGLEALNQSLSDTITSDALSYPSNVADYMGQMAMAMNKLTTLE  362

Query  348   TFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
              F+RQADNLR QT+ RLY ILT  Q+AR  L + ++ HRLR LS+LWL RPR +
Sbjct  363   GFIRQADNLRQQTLHRLYQILTTRQMARSLLAIAEYCHRLRALSSLWLARPRHE  416



>ref|NP_001170494.1| uncharacterized protein LOC100384496 [Zea mays]
 gb|ACR33863.1| unknown [Zea mays]
Length=329

 Score =   291 bits (745),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 155/299 (52%), Positives = 208/299 (70%), Gaps = 7/299 (2%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEn----  904
             + KTLRRLAQNREAARK R+RKKAY+QQLE+SR++L QLEQ++   +A       N    
Sbjct  23    DPKTLRRLAQNREAARKSRLRKKAYIQQLESSRIRLAQLEQELHTTRAHQGVFFPNGGIL  82

Query  903   gnvvgvghgHPLS-LTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRY  727
                  VG G P+  +  ++ E A FDVEY RW EE +R+  ELR A+ +  L E EL+ Y
Sbjct  83    AGQSVVGKGVPIGGIDSLSSEAAMFDVEYGRWQEEHYRLMYELRAALQQ-HLPEGELQMY  141

Query  726   VDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-  550
             V++C AH+ +M  +     K DV HL+SG+  +P ERCF+W+GGFRPS ++K+++S ++ 
Sbjct  142   VESCLAHHDEMLGIKEGAIKGDVFHLISGVWRSPAERCFLWLGGFRPSEVIKMLLSHVDP  201

Query  549   VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAI  370
             +TEQQ + + GL+QS  E EE LSQGME L+ ++SD I SDAL  PSN+   M QMAAA+
Sbjct  202   LTEQQIVAVYGLQQSALETEETLSQGMEALYQSLSDTILSDALSCPSNVAIYMGQMAAAM  261

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
               L TL  FVRQA+NLR QT+ RL+ ILT  Q+AR  L ++D+FHRLRTLS+LW+ RPR
Sbjct  262   NKLSTLKGFVRQAENLRQQTLHRLHQILTARQMARSLLAMSDYFHRLRTLSSLWVTRPR  320



>ref|NP_001289788.1| transcription factor TGA2 [Nelumbo nucifera]
 ref|XP_010244798.1| PREDICTED: transcription factor TGA2 [Nelumbo nucifera]
 ref|XP_010244803.1| PREDICTED: transcription factor TGA2 [Nelumbo nucifera]
 gb|AGA20434.1| bZIP protein [Nelumbo nucifera]
Length=488

 Score =   295 bits (755),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 149/297 (50%), Positives = 211/297 (71%), Gaps = 12/297 (4%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+++G  +   G  
Sbjct  176   LDAKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLTQLEQELQRARSQGLFLGAGGA-  234

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                      +   I+   A FD+EY+RW+E++ R   ELR  ++   LS+ +L+  +D  
Sbjct  235   ---------AGGNISSGAAIFDMEYSRWLEDDQRHLSELRTGLN-AHLSDGDLRVILDGY  284

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
               HY ++  L A+ AKSDV HLV+GM  TP ERCF+W+GGFRPS L+K++  QL+ +TEQ
Sbjct  285   LVHYDEIFRLKAVAAKSDVFHLVTGMWATPAERCFLWMGGFRPSELIKILTPQLDTLTEQ  344

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+ GL+QS+Q+AEEALSQG+E LH ++SD +++ AL   + + + M QMA A+  L 
Sbjct  345   QFMGICGLQQSSQQAEEALSQGLEQLHQSLSDTVATGALSDGTLVQNYMDQMAIALGKLS  404

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
              L  FVRQADNLR QT+ ++  ILT+ Q ARCFL + ++++RLR LS+LW+ RPR++
Sbjct  405   NLEGFVRQADNLRQQTLHQMRRILTIRQAARCFLAIGEYYNRLRALSSLWVSRPREN  461



>ref|XP_010271664.1| PREDICTED: transcription factor TGA2-like [Nelumbo nucifera]
Length=492

 Score =   295 bits (755),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 152/297 (51%), Positives = 214/297 (72%), Gaps = 8/297 (3%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLETSR+KL QLEQ++  A+++G  ++  G  
Sbjct  176   LDAKTLRRLAQNREAARKSRLRKKAYVQQLETSRIKLTQLEQELQRARSQGLFLSGAGGA  235

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
              G       S T I+   A FD+EYARW+E++ R   ELR A+ +  LS+ +L+  +D  
Sbjct  236   AGG------SGTIISSGAAMFDMEYARWLEDDQRHMSELRTAL-QARLSDGDLRIILDGY  288

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AKSDV HLV+GM  TP ERCF+W+GGFRPS L+K+++ QL+ +TEQ
Sbjct  289   LAHYDEIFRLKGIAAKSDVFHLVTGMWATPAERCFLWMGGFRPSELIKILLPQLDTLTEQ  348

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEALSQG+E L  +++D ++S +L   +++ + M QMA A++ L 
Sbjct  349   QFMGICSLQQSSQQAEEALSQGLEQLQQSLADTVASGSLSEGTHVGNYMDQMAMALSKLS  408

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
              L  FVRQADNLR QT+ ++  ILT+ Q ARCFL + +++ RLR LS+LW  RPR++
Sbjct  409   NLEGFVRQADNLRQQTLHQMRRILTIRQAARCFLAIGEYYVRLRALSSLWTSRPREN  465



>ref|XP_009412198.1| PREDICTED: transcription factor HBP-1b(c1)-like [Musa acuminata 
subsp. malaccensis]
Length=332

 Score =   288 bits (737),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 156/299 (52%), Positives = 205/299 (69%), Gaps = 15/299 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAYVQQLETSRMKL QLEQ++  A+ +G  I+ +G+ 
Sbjct  45    LDQKTLRRLAQNREAARKSRLRKKAYVQQLETSRMKLTQLEQELQRARQQGIFISSSGDQ  104

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                          +   GA AFDVEYARW+EE +R   ELR AV     SEN+L+  VD 
Sbjct  105   THA----------MGGNGALAFDVEYARWLEEHNRQINELRTAVTA-HASENDLRVIVDG  153

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY +   L  + AK+DV H++SGM  TP ERCF+W+GGFR S LLK++ SQLE +TE
Sbjct  154   IMAHYDEKFKLKGVAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLASQLEPLTE  213

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIIS--SDALFYPSNLPSCMTQMAAAIT  367
             QQ +G+  L+QS+Q+AE+ALSQGME L  ++++ ++          N+ + M QMA A+ 
Sbjct  214   QQVMGICNLQQSSQQAEDALSQGMEALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMG  273

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL +F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  274   KLGTLESFLRQADNLRQQTLQQMHRILTTRQSARALLAINDYFSRLRALSSLWLARPRE  332



>ref|XP_008668491.1| PREDICTED: uncharacterized protein LOC100384496 isoform X1 [Zea 
mays]
 tpg|DAA40398.1| TPA: putative bZIP transcription factor superfamily protein [Zea 
mays]
Length=503

 Score =   293 bits (749),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 155/299 (52%), Positives = 208/299 (70%), Gaps = 7/299 (2%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEn----  904
             + KTLRRLAQNREAARK R+RKKAY+QQLE+SR++L QLEQ++   +A       N    
Sbjct  197   DPKTLRRLAQNREAARKSRLRKKAYIQQLESSRIRLAQLEQELHTTRAHQGVFFPNGGIL  256

Query  903   gnvvgvghgHPLS-LTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRY  727
                  VG G P+  +  ++ E A FDVEY RW EE +R+  ELR A+ +  L E EL+ Y
Sbjct  257   AGQSVVGKGVPIGGIDSLSSEAAMFDVEYGRWQEEHYRLMYELRAALQQ-HLPEGELQMY  315

Query  726   VDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-  550
             V++C AH+ +M  +     K DV HL+SG+  +P ERCF+W+GGFRPS ++K+++S ++ 
Sbjct  316   VESCLAHHDEMLGIKEGAIKGDVFHLISGVWRSPAERCFLWLGGFRPSEVIKMLLSHVDP  375

Query  549   VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAI  370
             +TEQQ + + GL+QS  E EE LSQGME L+ ++SD I SDAL  PSN+   M QMAAA+
Sbjct  376   LTEQQIVAVYGLQQSALETEETLSQGMEALYQSLSDTILSDALSCPSNVAIYMGQMAAAM  435

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
               L TL  FVRQA+NLR QT+ RL+ ILT  Q+AR  L ++D+FHRLRTLS+LW+ RPR
Sbjct  436   NKLSTLKGFVRQAENLRQQTLHRLHQILTARQMARSLLAMSDYFHRLRTLSSLWVTRPR  494



>ref|XP_004498681.1| PREDICTED: transcription factor TGA6-like isoform X6 [Cicer arietinum]
 ref|XP_004498682.1| PREDICTED: transcription factor TGA6-like isoform X7 [Cicer arietinum]
 ref|XP_004498683.1| PREDICTED: transcription factor TGA6-like isoform X8 [Cicer arietinum]
 ref|XP_004498684.1| PREDICTED: transcription factor TGA6-like isoform X9 [Cicer arietinum]
Length=332

 Score =   286 bits (733),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 207/299 (69%), Gaps = 16/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+K  QLEQ++  A+ +G  I+ +G+  
Sbjct  45    DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKFTQLEQELQRARQQGIFISSSGDQA  104

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA AFDVEYARW+EE++R   ELR AV+    SE EL   +D  
Sbjct  105   H----------SMSGNGAMAFDVEYARWLEEQNRQINELRGAVNS-HASETELHMIMDGI  153

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++++QLE +T+Q
Sbjct  154   LAHYDEIFRLKGIAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTDQ  213

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDAL---FYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+QEAE+ALSQGME L  ++S+ +++  L       N+ + M QMA A+ 
Sbjct  214   QLVGITNLQQSSQEAEDALSQGMEALQQSLSETLTTGPLGSSSSSGNVANYMGQMAMAMG  273

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  274   KLGTLEGFIRQADNLRQQTLQQIHRILTTRQSARALLAIHDYFSRLRALSSLWLARPRE  332



>ref|XP_010557413.1| PREDICTED: transcription factor TGA2 isoform X2 [Tarenaya hassleriana]
Length=491

 Score =   292 bits (747),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 157/296 (53%), Positives = 202/296 (68%), Gaps = 17/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+++G  +      
Sbjct  183   LDAKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLTQLEQELQRARSQGLLLGGGCG-  241

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                      +   ITP  A FD+EY RW+EEE+R   E+R  V +  LS+++L+  VD  
Sbjct  242   --------PAGPGITPGAAIFDMEYGRWLEEENRHMSEIRTGV-QAHLSDSDLRVTVDGY  292

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AH+ ++  L A  AKSDV HLV+G   +P ERCFIWI GFRPS L+K+++ Q+E VTEQ
Sbjct  293   IAHFDELFRLKAAAAKSDVFHLVTGTWMSPAERCFIWIAGFRPSDLIKMVVGQMELVTEQ  352

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+ S+Q+AEEALSQG+E L H++ D ISS  L           QMA AI  L 
Sbjct  353   QMMGIYSLQHSSQQAEEALSQGLEQLQHSLIDHISSLPLL------DDFHQMALAIAKLS  406

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QTI +L  ILTV Q ARCFLI+ +++ RLR LS+LWL RPR+
Sbjct  407   NLEGFVRQADNLRQQTIHQLRRILTVRQAARCFLIIGEYYGRLRALSSLWLSRPRE  462



>ref|XP_010557409.1| PREDICTED: transcription factor TGA2 isoform X1 [Tarenaya hassleriana]
 ref|XP_010557410.1| PREDICTED: transcription factor TGA2 isoform X1 [Tarenaya hassleriana]
 ref|XP_010557411.1| PREDICTED: transcription factor TGA2 isoform X1 [Tarenaya hassleriana]
 ref|XP_010557412.1| PREDICTED: transcription factor TGA2 isoform X1 [Tarenaya hassleriana]
Length=495

 Score =   292 bits (747),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 157/296 (53%), Positives = 202/296 (68%), Gaps = 17/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+++G  +      
Sbjct  187   LDAKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLTQLEQELQRARSQGLLLGGGCG-  245

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                      +   ITP  A FD+EY RW+EEE+R   E+R  V +  LS+++L+  VD  
Sbjct  246   --------PAGPGITPGAAIFDMEYGRWLEEENRHMSEIRTGV-QAHLSDSDLRVTVDGY  296

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AH+ ++  L A  AKSDV HLV+G   +P ERCFIWI GFRPS L+K+++ Q+E VTEQ
Sbjct  297   IAHFDELFRLKAAAAKSDVFHLVTGTWMSPAERCFIWIAGFRPSDLIKMVVGQMELVTEQ  356

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+ S+Q+AEEALSQG+E L H++ D ISS  L           QMA AI  L 
Sbjct  357   QMMGIYSLQHSSQQAEEALSQGLEQLQHSLIDHISSLPLL------DDFHQMALAIAKLS  410

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QTI +L  ILTV Q ARCFLI+ +++ RLR LS+LWL RPR+
Sbjct  411   NLEGFVRQADNLRQQTIHQLRRILTVRQAARCFLIIGEYYGRLRALSSLWLSRPRE  466



>ref|XP_011088886.1| PREDICTED: transcription factor TGA2 isoform X3 [Sesamum indicum]
Length=438

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 150/296 (51%), Positives = 207/296 (70%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLE+SR++L QLEQ +  A+++G  +   G  
Sbjct  131   LDAKTLRRLAQNREAARKSRLRKKAYVQQLESSRIRLTQLEQDLQRARSQGLFLGGGGV-  189

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                      +   I+  GA FD+EYARW+E++HR   ELR A+ +  LS+ +L+  VD  
Sbjct  190   ---------AGGNISSGGAIFDMEYARWLEDDHRHMSELRTAL-QAHLSDGDLRVIVDGY  239

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AKSDV HL++GM  TP ERCF+W+GGFRPS L+K++++QL+ +TEQ
Sbjct  240   IAHYDEIFRLKGVAAKSDVFHLITGMWTTPAERCFLWMGGFRPSDLIKMLITQLDPLTEQ  299

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+ GL+QS+Q+AEEALSQG+E L  ++ D I++       ++   M  MA A+  L 
Sbjct  300   QVMGIYGLQQSSQQAEEALSQGLEQLQQSLIDTIAN------GSINDSMHHMAVALGKLS  353

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  354   NLEGFVRQADNLRQQTLHQLRRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  409



>ref|XP_006644874.1| PREDICTED: transcription factor HBP-1b(c1)-like [Oryza brachyantha]
Length=354

 Score =   286 bits (732),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 151/300 (50%), Positives = 207/300 (69%), Gaps = 16/300 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAY+Q LETSR+KL QLEQ++  A+ +G  I+  G+ 
Sbjct  66    LDHKTLRRLAQNREAARKSRLRKKAYIQNLETSRLKLTQLEQELQRARQQGIFISTTGDQ  125

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                          ++  GA AFD+EYARW+EE ++   ELR AV+    S+N+L+  VD 
Sbjct  126   SH----------SVSGNGALAFDMEYARWLEEHNKHINELRAAVNS-HASDNDLRSIVDN  174

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L  + AK+DV H++SGM  TP ERCF+W+GGFR S LLK++  QLE +TE
Sbjct  175   IMAHYDEIFKLKGVAAKADVFHVLSGMWKTPAERCFMWLGGFRSSELLKLLAGQLEPLTE  234

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDAL---FYPSNLPSCMTQMAAAI  370
             QQ  G+  L+QS+Q+AE+ALSQGME L  ++++ ++S +L       N+ + M QMA A+
Sbjct  235   QQLAGIANLQQSSQQAEDALSQGMEALQQSLAETLASGSLGPAGSSGNVANYMGQMAMAM  294

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L TL  F+RQADNLR+QT+Q++  ILT  Q AR  L ++D+F RLR LS+LWL RPR+
Sbjct  295   GKLGTLENFLRQADNLRLQTLQQMQRILTTRQSARALLAISDYFSRLRALSSLWLARPRE  354



>ref|XP_008383946.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X3 [Malus 
domestica]
 ref|XP_008383947.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X3 [Malus 
domestica]
 ref|XP_008383948.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X3 [Malus 
domestica]
Length=514

 Score =   290 bits (743),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 149/296 (50%), Positives = 203/296 (69%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ +  A+A+G  +   G  
Sbjct  208   LDAKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLTQLEQDLQRARAQGLFLGSCGG-  266

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                       L  I+   A FD+EY RW+E++HR   ELR  + +  LS+++L+  VD  
Sbjct  267   ---------GLGNISSGAAIFDMEYVRWLEDDHRQMSELRTGL-QAHLSDSDLRLVVDGY  316

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              +HY ++  L  M AKSDV HL++GM  TP ERCF+W+GGFRPS L+K++++QL+ +TEQ
Sbjct  317   VSHYDEIFQLKGMAAKSDVFHLITGMWTTPAERCFLWMGGFRPSELIKMLIAQLDPLTEQ  376

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEAL+QG+E LH ++ D I+   +         M QMA A+  L 
Sbjct  377   QFMGIYNLQQSSQQAEEALTQGLEQLHQSLIDTIAGGPVI------DGMQQMAVALGKLT  430

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADN R QT+ +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  431   NLEGFVRQADNFRQQTLHQLRRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  486



>ref|XP_010520061.1| PREDICTED: transcription factor HBP-1b(c38) isoform X2 [Tarenaya 
hassleriana]
Length=463

 Score =   289 bits (739),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 159/314 (51%), Positives = 214/314 (68%), Gaps = 22/314 (7%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARI--TEngn  898
             + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  A+A+G     T  G 
Sbjct  153   DTKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQEIQRARAQGVFFGGTLTGG  212

Query  897   vvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                  H  P +++  + E A FD+EY RW+EE+ R+  ELR AV+E  L ENEL+ +VD 
Sbjct  213   DQQGLHIGPGNIS--SAEAAVFDMEYGRWLEEQQRLLSELRAAVEE-QLPENELRMFVDN  269

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
                HY Q+ +L AM+AKSDV HLVSG   +P ERCF+W+GGFRPS ++KV+++++E +TE
Sbjct  270   VLGHYDQIVNLKAMVAKSDVFHLVSGAWKSPAERCFMWLGGFRPSEIIKVVVNRIEPLTE  329

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDII----------------SSDALFYPS  409
             QQ +G+ GL+QST EAEEALSQG+E L+ ++SD I                ++ A   P 
Sbjct  330   QQIVGICGLQQSTHEAEEALSQGLEALNQSLSDTIASDSLSASAVAAEATATAAAFPPPP  389

Query  408   NLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRL  229
               PS ++QM+ A+  L  L  FV QAD+LR QT+ RL+ +LT  Q AR  L + D+FHRL
Sbjct  390   PTPSYISQMSLALNKLSALENFVLQADHLRHQTVHRLHQLLTTHQAARSLLAIADYFHRL  449

Query  228   RTLSALWLGRPRQD  187
             + LS+LW+ RPRQD
Sbjct  450   QALSSLWMARPRQD  463



>ref|XP_011088884.1| PREDICTED: transcription factor TGA2 isoform X1 [Sesamum indicum]
Length=487

 Score =   290 bits (741),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 150/296 (51%), Positives = 208/296 (70%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLE+SR++L QLEQ +  A+++G  +   G  
Sbjct  180   LDAKTLRRLAQNREAARKSRLRKKAYVQQLESSRIRLTQLEQDLQRARSQGLFLGGGG--  237

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                     ++   I+  GA FD+EYARW+E++HR   ELR A+ +  LS+ +L+  VD  
Sbjct  238   --------VAGGNISSGGAIFDMEYARWLEDDHRHMSELRTAL-QAHLSDGDLRVIVDGY  288

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AKSDV HL++GM  TP ERCF+W+GGFRPS L+K++++QL+ +TEQ
Sbjct  289   IAHYDEIFRLKGVAAKSDVFHLITGMWTTPAERCFLWMGGFRPSDLIKMLITQLDPLTEQ  348

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+ GL+QS+Q+AEEALSQG+E L  ++ D I++       ++   M  MA A+  L 
Sbjct  349   QVMGIYGLQQSSQQAEEALSQGLEQLQQSLIDTIAN------GSINDSMHHMAVALGKLS  402

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  403   NLEGFVRQADNLRQQTLHQLRRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  458



>gb|ABP88233.1| transcription factor bZIP98, partial [Glycine max]
Length=300

 Score =   283 bits (724),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 151/298 (51%), Positives = 205/298 (69%), Gaps = 16/298 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+  G  I+ +G+  
Sbjct  13    DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQHGIFISSSGDQA  72

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA  FD EYARW+EE++R   EL+ AV+    S+ EL+  VD  
Sbjct  73    HT----------LSGNGAMQFDAEYARWLEEQNRQINELKAAVNS-HASDTELRMIVDGI  121

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK+++SQLE +TEQ
Sbjct  122   LAHYDEIFRLKGVAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLVSQLEPLTEQ  181

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDA---LFYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AE+ALSQGME L  ++++ +S+ A        N+ + M QMA A+ 
Sbjct  182   QLMGITNLQQSSQQAEDALSQGMEALQQSLAETLSTGAPASSGSSGNVANYMGQMAMAMG  241

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
              L TL  F++QADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR
Sbjct  242   KLGTLEGFIQQADNLRQQTLQQMHRILTTRQSARALLAIHDYFSRLRALSSLWLARPR  299



>ref|XP_010922090.1| PREDICTED: transcription factor HBP-1b(c38)-like [Elaeis guineensis]
Length=466

 Score =   289 bits (739),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/300 (51%), Positives = 210/300 (70%), Gaps = 16/300 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+ 
Sbjct  178   LDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLNQLEQELQRARQQGIFISSSGDQ  237

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                          +   GA AFD+EYARW+EE HR   ELR AV+    S+N+L+  VD+
Sbjct  238   SH----------SMGGNGALAFDMEYARWLEEHHRQINELRAAVNS-HASDNDLRAIVDS  286

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L ++ AK+DV H++SGM  TP ERCF+W+GGFR S LLK++ +QLE +TE
Sbjct  287   IMAHYDEIFRLKSVAAKADVFHMLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPLTE  346

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDAL---FYPSNLPSCMTQMAAAI  370
             QQ +G+  L+QS+Q+AE+ALSQGME L  ++++ ++S +L       N+ + M QMA A+
Sbjct  347   QQLVGICNLQQSSQQAEDALSQGMEALQQSLAETLASGSLGPTGSSGNVANYMGQMAMAM  406

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L TL  F+RQADNLR QT+Q++  ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  407   GKLGTLENFLRQADNLRQQTLQQMLRILTTRQSARALLAIHDYFSRLRALSSLWLARPRE  466



>ref|XP_008786824.1| PREDICTED: transcription factor TGA2-like isoform X2 [Phoenix 
dactylifera]
Length=468

 Score =   289 bits (739),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/300 (51%), Positives = 210/300 (70%), Gaps = 16/300 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             ++ KTLRRLAQNREAARK R+RKKAYVQQLE SR+KL QLEQ++  A+ +G  I+ +G+ 
Sbjct  180   MDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSGDQ  239

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                          +   GA AFD+EYARW+EE +R   ELR AV+    S+N+L+  VD+
Sbjct  240   SH----------SMGGNGALAFDMEYARWLEEHNRQINELRAAVNS-HASDNDLRTIVDS  288

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L ++ AK+DV H++SGM  TP ERCF+W+GGFR S LLK++ SQLE +TE
Sbjct  289   IMAHYDEIFRLKSVAAKADVFHMLSGMWKTPAERCFLWLGGFRSSELLKLLASQLEPLTE  348

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDAL---FYPSNLPSCMTQMAAAI  370
             QQ +G+  L+QS+Q+AE+ALSQGME L  ++++ +SS +L       N+ + M QMA A+
Sbjct  349   QQLMGICNLQQSSQQAEDALSQGMEALQQSLAETLSSGSLGPAGSSGNVANYMGQMAMAM  408

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L TL +F+RQADNLR QT+Q++  ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  409   GKLGTLESFLRQADNLRQQTLQQMIRILTTRQSARALLAIHDYFSRLRALSSLWLARPRE  468



>ref|XP_008788487.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Phoenix 
dactylifera]
Length=468

 Score =   288 bits (738),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/300 (51%), Positives = 210/300 (70%), Gaps = 16/300 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+ 
Sbjct  180   LDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISGSGDQ  239

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                          +   GA AFD+EYARW+EE+HR   ELR AV+    S+N+L+  VD+
Sbjct  240   TH----------SMGGNGALAFDMEYARWLEEQHRQINELRAAVNS-HASDNDLRAIVDS  288

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L ++ AK+DV H++SGM  TP ERCF+W+GGFR S LLK++ SQLE +TE
Sbjct  289   IMAHYDEIFRLKSVAAKADVFHMLSGMWKTPAERCFLWLGGFRSSELLKLLASQLEPLTE  348

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDAL---FYPSNLPSCMTQMAAAI  370
             QQ +G+  L+QS+Q+AE+ALSQGME L  ++++ ++S +L       N+ + M QMA A+
Sbjct  349   QQLVGICNLQQSSQQAEDALSQGMEALQQSLAETLASGSLGPTGSSGNVANYMGQMAMAM  408

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L TL  F+ QADNLR QT+Q++  ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  409   GKLGTLENFLHQADNLRQQTLQQMLRILTTRQSARALLAIHDYFSRLRALSSLWLARPRE  468



>ref|XP_008786823.1| PREDICTED: transcription factor TGA2-like isoform X1 [Phoenix 
dactylifera]
Length=470

 Score =   289 bits (739),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/300 (51%), Positives = 210/300 (70%), Gaps = 16/300 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             ++ KTLRRLAQNREAARK R+RKKAYVQQLE SR+KL QLEQ++  A+ +G  I+ +G+ 
Sbjct  182   MDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSGDQ  241

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                          +   GA AFD+EYARW+EE +R   ELR AV+    S+N+L+  VD+
Sbjct  242   SH----------SMGGNGALAFDMEYARWLEEHNRQINELRAAVNS-HASDNDLRTIVDS  290

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L ++ AK+DV H++SGM  TP ERCF+W+GGFR S LLK++ SQLE +TE
Sbjct  291   IMAHYDEIFRLKSVAAKADVFHMLSGMWKTPAERCFLWLGGFRSSELLKLLASQLEPLTE  350

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDAL---FYPSNLPSCMTQMAAAI  370
             QQ +G+  L+QS+Q+AE+ALSQGME L  ++++ +SS +L       N+ + M QMA A+
Sbjct  351   QQLMGICNLQQSSQQAEDALSQGMEALQQSLAETLSSGSLGPAGSSGNVANYMGQMAMAM  410

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L TL +F+RQADNLR QT+Q++  ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  411   GKLGTLESFLRQADNLRQQTLQQMIRILTTRQSARALLAIHDYFSRLRALSSLWLARPRE  470



>ref|XP_004511049.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Cicer arietinum]
Length=470

 Score =   288 bits (738),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 153/298 (51%), Positives = 205/298 (69%), Gaps = 16/298 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G   
Sbjct  183   DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGVFISSSGEQT  242

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA  FD EYARW+EE++R   ELR AV+    S+ EL+  VD  
Sbjct  243   H----------SLSGNGAMQFDAEYARWLEEQNRQINELRAAVNS-HASDTELRMIVDGI  291

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK+++SQLE +TEQ
Sbjct  292   LAHYDEIFRLKGVAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLVSQLEPLTEQ  351

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDA---LFYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AE+ALSQGME L  ++++ +S+ A        N+ + M QMA A+ 
Sbjct  352   QLMGITNLQQSSQQAEDALSQGMEALQQSLAETLSTGAPSSSGSSGNVANYMGQMAMAMG  411

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR
Sbjct  412   KLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAIHDYFSRLRALSSLWLARPR  469



>ref|XP_008383943.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Malus 
domestica]
Length=542

 Score =   291 bits (744),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/296 (50%), Positives = 203/296 (69%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ +  A+A+G  +   G  
Sbjct  236   LDAKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLTQLEQDLQRARAQGLFLGSCGG-  294

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                       L  I+   A FD+EY RW+E++HR   ELR  + +  LS+++L+  VD  
Sbjct  295   ---------GLGNISSGAAIFDMEYVRWLEDDHRQMSELRTGL-QAHLSDSDLRLVVDGY  344

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              +HY ++  L  M AKSDV HL++GM  TP ERCF+W+GGFRPS L+K++++QL+ +TEQ
Sbjct  345   VSHYDEIFQLKGMAAKSDVFHLITGMWTTPAERCFLWMGGFRPSELIKMLIAQLDPLTEQ  404

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEAL+QG+E LH ++ D I+   +         M QMA A+  L 
Sbjct  405   QFMGIYNLQQSSQQAEEALTQGLEQLHQSLIDTIAGGPVI------DGMQQMAVALGKLT  458

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADN R QT+ +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  459   NLEGFVRQADNFRQQTLHQLRRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  514



>ref|XP_008788486.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Phoenix 
dactylifera]
Length=470

 Score =   288 bits (738),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/300 (51%), Positives = 210/300 (70%), Gaps = 16/300 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+ 
Sbjct  182   LDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISGSGDQ  241

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                          +   GA AFD+EYARW+EE+HR   ELR AV+    S+N+L+  VD+
Sbjct  242   TH----------SMGGNGALAFDMEYARWLEEQHRQINELRAAVNS-HASDNDLRAIVDS  290

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L ++ AK+DV H++SGM  TP ERCF+W+GGFR S LLK++ SQLE +TE
Sbjct  291   IMAHYDEIFRLKSVAAKADVFHMLSGMWKTPAERCFLWLGGFRSSELLKLLASQLEPLTE  350

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDAL---FYPSNLPSCMTQMAAAI  370
             QQ +G+  L+QS+Q+AE+ALSQGME L  ++++ ++S +L       N+ + M QMA A+
Sbjct  351   QQLVGICNLQQSSQQAEDALSQGMEALQQSLAETLASGSLGPTGSSGNVANYMGQMAMAM  410

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L TL  F+ QADNLR QT+Q++  ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  411   GKLGTLENFLHQADNLRQQTLQQMLRILTTRQSARALLAIHDYFSRLRALSSLWLARPRE  470



>ref|XP_010520059.1| PREDICTED: transcription factor HBP-1b(c38) isoform X1 [Tarenaya 
hassleriana]
Length=466

 Score =   288 bits (738),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 159/314 (51%), Positives = 214/314 (68%), Gaps = 22/314 (7%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARI--TEngn  898
             + KTLRRLAQNREAARK R+RKKAYVQQLE+ R+KL QLEQ++  A+A+G     T  G 
Sbjct  156   DTKTLRRLAQNREAARKSRLRKKAYVQQLESCRIKLTQLEQEIQRARAQGVFFGGTLTGG  215

Query  897   vvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                  H  P +++  + E A FD+EY RW+EE+ R+  ELR AV+E  L ENEL+ +VD 
Sbjct  216   DQQGLHIGPGNIS--SAEAAVFDMEYGRWLEEQQRLLSELRAAVEE-QLPENELRMFVDN  272

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
                HY Q+ +L AM+AKSDV HLVSG   +P ERCF+W+GGFRPS ++KV+++++E +TE
Sbjct  273   VLGHYDQIVNLKAMVAKSDVFHLVSGAWKSPAERCFMWLGGFRPSEIIKVVVNRIEPLTE  332

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDII----------------SSDALFYPS  409
             QQ +G+ GL+QST EAEEALSQG+E L+ ++SD I                ++ A   P 
Sbjct  333   QQIVGICGLQQSTHEAEEALSQGLEALNQSLSDTIASDSLSASAVAAEATATAAAFPPPP  392

Query  408   NLPSCMTQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRL  229
               PS ++QM+ A+  L  L  FV QAD+LR QT+ RL+ +LT  Q AR  L + D+FHRL
Sbjct  393   PTPSYISQMSLALNKLSALENFVLQADHLRHQTVHRLHQLLTTHQAARSLLAIADYFHRL  452

Query  228   RTLSALWLGRPRQD  187
             + LS+LW+ RPRQD
Sbjct  453   QALSSLWMARPRQD  466



>dbj|BAG95936.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE69952.1| hypothetical protein OsJ_29832 [Oryza sativa Japonica Group]
Length=523

 Score =   290 bits (742),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/304 (49%), Positives = 207/304 (68%), Gaps = 14/304 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGA---------  919
             + KTLRRLAQNREAARK R+RKKAY+QQLE+SR++L QLEQ++  A+A+G          
Sbjct  202   DPKTLRRLAQNREAARKSRLRKKAYIQQLESSRIRLAQLEQELHTARAQGVFFPGSGGLI  261

Query  918   ---RITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLS  748
                   +   + G+          ++ E A FDVEY RW EE HR+  ELR A+ +  L 
Sbjct  262   GEGGSGKGVLLGGIDGVGGGGGGGLSSEAAMFDVEYGRWQEEHHRLMYELRAALQQ-QLP  320

Query  747   ENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKV  568
             E EL+ YV++C AH+ ++  +     + DV HL+SG+  +P ERCF+W+GGFRPS ++K+
Sbjct  321   EGELQVYVESCLAHHDEVAAIKDGAIRGDVFHLISGVWMSPAERCFLWLGGFRPSEVIKM  380

Query  567   IMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCM  391
             +++ +E +TEQQ +G+ GL+QS  E EEAL+QG++ L+ ++SD + SDAL  PSN+ + M
Sbjct  381   LVAHVEPLTEQQIVGVYGLQQSALETEEALTQGLDALYQSLSDTVVSDALSCPSNVANYM  440

Query  390   TQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSAL  211
              QMA AI  L TL  FVRQA+NLR QT+ RL  +LT  Q+AR  L V+D+FHRLRTLS+L
Sbjct  441   GQMAVAINKLSTLEGFVRQAENLRQQTLHRLQQVLTTRQMARSLLAVSDYFHRLRTLSSL  500

Query  210   WLGR  199
             W+ R
Sbjct  501   WVTR  504



>ref|XP_006465763.1| PREDICTED: transcription factor TGA6-like isoform X7 [Citrus 
sinensis]
Length=331

 Score =   284 bits (726),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 207/299 (69%), Gaps = 15/299 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+ 
Sbjct  44    LDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQ  103

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                          ++  GA AFDVEYARW+EE+++   ELR AV+    S+ EL+  VD 
Sbjct  104   AHS----------MSGNGAMAFDVEYARWLEEQNKQINELRSAVNS-HASDTELRMVVDG  152

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L A  AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++++QLE +TE
Sbjct  153   IMAHYDEIFRLKANAAKADVFHLLSGMWKTPAERCFMWLGGFRSSELLKLLVNQLEPLTE  212

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDI--ISSDALFYPSNLPSCMTQMAAAIT  367
             QQ +G+  L+QS+Q+AE+ALSQGME L  ++++     S       N+ + M QMA A+ 
Sbjct  213   QQLVGIGNLQQSSQQAEDALSQGMEALQQSLAETLSSGSLGSSGSGNVANYMGQMAMAMG  272

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LW+ RPR+
Sbjct  273   KLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAIHDYFSRLRALSSLWMARPRE  331



>ref|XP_008228578.1| PREDICTED: transcription factor TGA2 isoform X3 [Prunus mume]
Length=504

 Score =   289 bits (740),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/296 (51%), Positives = 202/296 (68%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLETSR+KL QLEQ +  A+A+          
Sbjct  198   LDAKTLRRLAQNREAARKSRLRKKAYVQQLETSRIKLTQLEQDLQRARAQ----------  247

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                  G    L  I+   A FD+EYARW+E++HR   ELR  + +  LS+++L+  VD  
Sbjct  248   GLFLGGCGGGLGNISSGAAIFDMEYARWLEDDHRHMSELRTGL-QAHLSDSDLRVIVDGY  306

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              +HY ++  L  + AKSDV HL++GM  TP ERCF+W+GGFRPS L+K++ +QL+ +TEQ
Sbjct  307   ISHYDEIFQLKGVAAKSDVFHLITGMWTTPAERCFLWMGGFRPSELIKMLTAQLDPLTEQ  366

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEAL+QG+E LH ++ D I+   +         M QMA A+  L 
Sbjct  367   QFMGIYSLQQSSQQAEEALTQGLEQLHQSLVDTIAGGPVI------DGMQQMAVALGKLT  420

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  421   NLEGFVRQADNLRQQTLHQLRRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  476



>ref|XP_007205044.1| hypothetical protein PRUPE_ppa004537mg [Prunus persica]
 gb|EMJ06243.1| hypothetical protein PRUPE_ppa004537mg [Prunus persica]
Length=504

 Score =   289 bits (740),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 151/296 (51%), Positives = 204/296 (69%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLETSR+KL QLEQ +  A+A+G  +   G  
Sbjct  198   LDAKTLRRLAQNREAARKSRLRKKAYVQQLETSRIKLTQLEQDLQRARAQGLFLGGCG--  255

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                       L  I+   A FD+EYARW+E++HR   ELR  + +  LS+++L+  VD  
Sbjct  256   --------GGLGNISSGAAIFDMEYARWLEDDHRHMSELRTGL-QAHLSDSDLRVIVDGY  306

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              +HY ++  L  + AKSDV HL++GM  TP ERCF+W+GGFRPS L+K++ +QL+ +TEQ
Sbjct  307   ISHYDEIFQLKGVAAKSDVFHLITGMWTTPAERCFLWMGGFRPSELIKMLTAQLDPLTEQ  366

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEAL+QG+E LH ++ D I+   +         M QMA A+  L 
Sbjct  367   QFMGIYSLQQSSQQAEEALTQGLEQLHQSLVDTIAGGPVI------DGMQQMAVALGKLT  420

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  421   NLEGFVRQADNLRQQTLHQLRRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  476



>ref|XP_004498677.1| PREDICTED: transcription factor TGA6-like isoform X2 [Cicer arietinum]
Length=433

 Score =   287 bits (734),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 207/299 (69%), Gaps = 16/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+K  QLEQ++  A+ +G  I+ +G+  
Sbjct  146   DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKFTQLEQELQRARQQGIFISSSGDQA  205

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA AFDVEYARW+EE++R   ELR AV+    SE EL   +D  
Sbjct  206   H----------SMSGNGAMAFDVEYARWLEEQNRQINELRGAVNS-HASETELHMIMDGI  254

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++++QLE +T+Q
Sbjct  255   LAHYDEIFRLKGIAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTDQ  314

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDAL---FYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+QEAE+ALSQGME L  ++S+ +++  L       N+ + M QMA A+ 
Sbjct  315   QLVGITNLQQSSQEAEDALSQGMEALQQSLSETLTTGPLGSSSSSGNVANYMGQMAMAMG  374

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  375   KLGTLEGFIRQADNLRQQTLQQIHRILTTRQSARALLAIHDYFSRLRALSSLWLARPRE  433



>ref|NP_001063534.1| Os09g0489500 [Oryza sativa Japonica Group]
 dbj|BAF25448.1| Os09g0489500 [Oryza sativa Japonica Group]
Length=521

 Score =   290 bits (741),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/304 (49%), Positives = 207/304 (68%), Gaps = 14/304 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGA---------  919
             + KTLRRLAQNREAARK R+RKKAY+QQLE+SR++L QLEQ++  A+A+G          
Sbjct  200   DPKTLRRLAQNREAARKSRLRKKAYIQQLESSRIRLAQLEQELHTARAQGVFFPGSGGLI  259

Query  918   ---RITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLS  748
                   +   + G+          ++ E A FDVEY RW EE HR+  ELR A+ +  L 
Sbjct  260   GEGGSGKGVLLGGIDGVGGGGGGGLSSEAAMFDVEYGRWQEEHHRLMYELRAALQQ-QLP  318

Query  747   ENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKV  568
             E EL+ YV++C AH+ ++  +     + DV HL+SG+  +P ERCF+W+GGFRPS ++K+
Sbjct  319   EGELQVYVESCLAHHDEVAAIKDGAIRGDVFHLISGVWMSPAERCFLWLGGFRPSEVIKM  378

Query  567   IMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCM  391
             +++ +E +TEQQ +G+ GL+QS  E EEAL+QG++ L+ ++SD + SDAL  PSN+ + M
Sbjct  379   LVAHVEPLTEQQIVGVYGLQQSALETEEALTQGLDALYQSLSDTVVSDALSCPSNVANYM  438

Query  390   TQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSAL  211
              QMA AI  L TL  FVRQA+NLR QT+ RL  +LT  Q+AR  L V+D+FHRLRTLS+L
Sbjct  439   GQMAVAINKLSTLEGFVRQAENLRQQTLHRLQQVLTTRQMARSLLAVSDYFHRLRTLSSL  498

Query  210   WLGR  199
             W+ R
Sbjct  499   WVTR  502



>ref|XP_010686011.1| PREDICTED: transcription factor TGA2 isoform X1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010686012.1| PREDICTED: transcription factor TGA2 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=514

 Score =   289 bits (740),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 151/297 (51%), Positives = 207/297 (70%), Gaps = 16/297 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ +  A+A+G  +   G  
Sbjct  203   LDAKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLAQLEQDLQRARAQGYFLGGGGGA  262

Query  894   vgvghgHPLSLTKITPEGAA-FDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                    P +L+     GAA FD+EYARW+E++HR T ELR A+ +  LS+ +L+  VD 
Sbjct  263   -------PANLSSDGAAGAAIFDMEYARWLEDDHRHTTELRGAL-QAHLSDGDLRIIVDG  314

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
                HY ++  L  + AKSD+ HL++GM  TP ERCF+W+GGFRPS L+K++ +QL+ +TE
Sbjct  315   YINHYDEIFRLKGVAAKSDIFHLITGMWTTPAERCFLWMGGFRPSELIKMLTAQLDPLTE  374

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNL  361
             QQ +G+  L+ S+Q+AEEALSQG+E L  ++ D I++      S +   M QMA A+  L
Sbjct  375   QQLMGIYSLQHSSQQAEEALSQGLEQLQQSLVDTIAT------STVTDGMHQMAIALGKL  428

Query  360   YTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L  F+RQADNLR QT+ +L  ILT+ Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  429   SNLEGFIRQADNLRQQTLHQLRRILTIRQAARCFLVIGEYYGRLRALSSLWSSRPRE  485



>ref|XP_004498678.1| PREDICTED: transcription factor TGA6-like isoform X3 [Cicer arietinum]
 ref|XP_004498679.1| PREDICTED: transcription factor TGA6-like isoform X4 [Cicer arietinum]
Length=423

 Score =   286 bits (733),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 207/299 (69%), Gaps = 16/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+K  QLEQ++  A+ +G  I+ +G+  
Sbjct  136   DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKFTQLEQELQRARQQGIFISSSGDQA  195

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA AFDVEYARW+EE++R   ELR AV+    SE EL   +D  
Sbjct  196   H----------SMSGNGAMAFDVEYARWLEEQNRQINELRGAVNS-HASETELHMIMDGI  244

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++++QLE +T+Q
Sbjct  245   LAHYDEIFRLKGIAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTDQ  304

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDAL---FYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+QEAE+ALSQGME L  ++S+ +++  L       N+ + M QMA A+ 
Sbjct  305   QLVGITNLQQSSQEAEDALSQGMEALQQSLSETLTTGPLGSSSSSGNVANYMGQMAMAMG  364

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  365   KLGTLEGFIRQADNLRQQTLQQIHRILTTRQSARALLAIHDYFSRLRALSSLWLARPRE  423



>emb|CDP09298.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   283 bits (724),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/301 (51%), Positives = 206/301 (68%), Gaps = 20/301 (7%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SRMKL QLEQ++  A+ +G  I+ +G+  
Sbjct  42    DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISSSGDQS  101

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA AFDVEYARW+EE +R   ELR AV+     + EL+  VD  
Sbjct  102   Q----------SMSGNGALAFDVEYARWLEEHNRRINELRGAVNS-HAGDGELRIIVDGI  150

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  +  + A  AK+DV H++SGM  TP ERCF+W+GGFR S LLK++++QLE +TEQ
Sbjct  151   LAHYDDIFRIKADAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQ  210

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPS-----NLPSCMTQMAAA  373
             Q L +  L+QS+Q+AE+ALSQGME L  ++++ ++      PS     N+ + M QMA A
Sbjct  211   QLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAGS--LGPSGGSTGNVANYMGQMAMA  268

Query  372   ITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
             +  L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L ++D+F RLR LS+LWL RPR
Sbjct  269   MGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAISDYFSRLRALSSLWLARPR  328

Query  192   Q  190
             +
Sbjct  329   E  329



>gb|EEC84791.1| hypothetical protein OsI_31848 [Oryza sativa Indica Group]
Length=523

 Score =   290 bits (741),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/304 (49%), Positives = 207/304 (68%), Gaps = 14/304 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGA---------  919
             + KTLRRLAQNREAARK R+RKKAY+QQLE+SR++L QLEQ++  A+A+G          
Sbjct  202   DPKTLRRLAQNREAARKSRLRKKAYIQQLESSRIRLAQLEQELHTARAQGVFFPGSGGLI  261

Query  918   ---RITEngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLS  748
                   +   + G+          ++ E A FDVEY RW EE HR+  ELR A+ +  L 
Sbjct  262   GEGGGGKGVLLGGIDGVGGGGGGGLSSEAAMFDVEYGRWQEEHHRLMYELRAALQQ-QLP  320

Query  747   ENELKRYVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKV  568
             E EL+ YV++C AH+ ++  +     + DV HL+SG+  +P ERCF+W+GGFRPS ++K+
Sbjct  321   EGELQVYVESCLAHHDEVAAIKDGAIRGDVFHLISGVWMSPAERCFLWLGGFRPSEVIKM  380

Query  567   IMSQLE-VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCM  391
             +++ +E +TEQQ +G+ GL+QS  E EEAL+QG++ L+ ++SD + SDAL  PSN+ + M
Sbjct  381   LVAHVEPLTEQQIVGVYGLQQSALETEEALTQGLDALYQSLSDTVVSDALSCPSNVANYM  440

Query  390   TQMAAAITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSAL  211
              QMA AI  L TL  FVRQA+NLR QT+ RL  +LT  Q+AR  L V+D+FHRLRTLS+L
Sbjct  441   GQMAVAINKLSTLEGFVRQAENLRQQTLHRLQQVLTTRQMARSLLAVSDYFHRLRTLSSL  500

Query  210   WLGR  199
             W+ R
Sbjct  501   WVTR  504



>ref|XP_009419684.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=332

 Score =   283 bits (725),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 152/301 (50%), Positives = 207/301 (69%), Gaps = 19/301 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+ 
Sbjct  45    LDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQKARQQGIFISNSGDQ  104

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                           +  GA  FDVEYARW+EE +R   ELR AV+    SEN+L+  VD 
Sbjct  105   SHA----------TSGNGALTFDVEYARWLEEHNRQISELRAAVNA-HASENDLRVIVDG  153

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L  + AK+DV H++SGM  TP ERCF+W+GGFR S LLK++ +QLE +TE
Sbjct  154   VMAHYDEIFRLKGIAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPLTE  213

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPS----NLPSCMTQMAAA  373
             QQ +G+  L+QS+Q+AE+ALSQGM+ L  ++S+ ++      PS    N+ + M QMA A
Sbjct  214   QQMMGICNLQQSSQQAEDALSQGMDALQQSLSETLAGS--LGPSGTSGNVANYMGQMAMA  271

Query  372   ITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
             +  L TL  F+ QADNLR QT+Q+++ ILT  Q AR  L ++D+F RLR LS+LWL RP+
Sbjct  272   MGKLGTLENFLHQADNLRQQTLQQMHRILTTRQSARALLAISDYFSRLRALSSLWLARPQ  331

Query  192   Q  190
             +
Sbjct  332   E  332



>dbj|BAB72064.1| bZIP transcription factor [Oryza sativa]
Length=332

 Score =   283 bits (725),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 148/300 (49%), Positives = 206/300 (69%), Gaps = 16/300 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAY+Q LE+SR+KL Q+EQ++  A+ +G  I+ + + 
Sbjct  44    LDHKTLRRLAQNREAARKSRLRKKAYIQNLESSRLKLTQIEQELQRARQQGIFISTSSDQ  103

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                           +  GA AFD+EYARW+EE ++   ELR AV+     +N+LK  VD+
Sbjct  104   SHSA----------SGNGALAFDMEYARWLEEHNKHINELRAAVNA-HAGDNDLKSTVDS  152

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L  + AK+DV H++SGM  TP ERCF+W+GGFR S LLK++  QLE +TE
Sbjct  153   IMAHYNEIFKLKGVAAKADVFHVLSGMWKTPAERCFMWLGGFRSSELLKLLAGQLEPLTE  212

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDAL---FYPSNLPSCMTQMAAAI  370
             QQ  G+  L+QS+Q+AE+ALSQGME L  ++++ ++S +L       N+ + M QMA A+
Sbjct  213   QQLAGIANLQQSSQQAEDALSQGMEALQQSLAETLASGSLGPAGSSGNVANYMGQMAMAM  272

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L TL  F+RQADNLR+QT+Q++  ILT  Q AR  L ++D+F RLR LS+LWL RPR+
Sbjct  273   GKLGTLENFLRQADNLRLQTLQQMQRILTTRQSARALLAISDYFSRLRALSSLWLARPRE  332



>ref|XP_004498680.1| PREDICTED: transcription factor TGA6-like isoform X5 [Cicer arietinum]
Length=389

 Score =   285 bits (729),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 207/299 (69%), Gaps = 16/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+K  QLEQ++  A+ +G  I+ +G+  
Sbjct  102   DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKFTQLEQELQRARQQGIFISSSGDQA  161

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA AFDVEYARW+EE++R   ELR AV+    SE EL   +D  
Sbjct  162   H----------SMSGNGAMAFDVEYARWLEEQNRQINELRGAVNS-HASETELHMIMDGI  210

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++++QLE +T+Q
Sbjct  211   LAHYDEIFRLKGIAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTDQ  270

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDAL---FYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+QEAE+ALSQGME L  ++S+ +++  L       N+ + M QMA A+ 
Sbjct  271   QLVGITNLQQSSQEAEDALSQGMEALQQSLSETLTTGPLGSSSSSGNVANYMGQMAMAMG  330

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  331   KLGTLEGFIRQADNLRQQTLQQIHRILTTRQSARALLAIHDYFSRLRALSSLWLARPRE  389



>ref|XP_006347245.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
isoform X2 [Solanum tuberosum]
Length=497

 Score =   288 bits (738),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/296 (49%), Positives = 206/296 (70%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAA+K RIRKKAYVQQLETSR++L QLEQ++  A ++G  +      
Sbjct  191   LDPKTLRRLAQNREAAKKSRIRKKAYVQQLETSRIRLSQLEQELQRASSQGIFLGGGTAA  250

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                        + I+   A FD+EY+RW++++HR   ELR A+ +  LS+ +L+  VD  
Sbjct  251   G----------SNISSGAAIFDMEYSRWLDDDHRHIAELRTAL-QAHLSDGDLRLIVDGY  299

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++ +L  + AKSDV HL++GM  TP ERCF+W+GGFRPS L+K+++ QL+ +TEQ
Sbjct  300   IAHYDEIFNLKGVAAKSDVFHLITGMWTTPAERCFLWMGGFRPSELIKMLIGQLDPLTEQ  359

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEALSQG+E L  ++ D +++      ++L   M  MA A+  L 
Sbjct  360   QVVGIYSLQQSSQQAEEALSQGLEQLQQSLIDTVAT------ASLHDGMHHMALALGKLS  413

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L+ ILTV Q ARCFL++ +++ RLR LS+LWL RPR+
Sbjct  414   NLEGFVRQADNLRQQTLHQLHRILTVRQAARCFLVIGEYYGRLRALSSLWLSRPRE  469



>ref|XP_009384968.1| PREDICTED: transcription factor HBP-1b(c38)-like [Musa acuminata 
subsp. malaccensis]
Length=448

 Score =   286 bits (733),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 153/301 (51%), Positives = 209/301 (69%), Gaps = 19/301 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+ 
Sbjct  161   LDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQ  220

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                          +   GA AFDVEYARW+++ +R   ELR AV+    SEN+L+  VD 
Sbjct  221   THA----------MGGNGALAFDVEYARWLDDHNRQISELRTAVNA-HASENDLRVIVDG  269

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
                HY ++  L  + AK+DV H++SGM  TP ERCF+W+GGFR S LLK++++QLE +TE
Sbjct  270   IMTHYEEIFRLKGVAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTE  329

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPS----NLPSCMTQMAAA  373
             QQ +G+  L+QS+Q+AE+ALSQGME L  ++++ ++      PS    N+ + M QMA A
Sbjct  330   QQLMGICNLQQSSQQAEDALSQGMEALQQSLAETLAGS--LGPSGSTGNVANYMGQMAMA  387

Query  372   ITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
             +  L TL TF+RQADNLR QT+Q++  ILT  Q AR  L ++D+F RLR LS+LWL RPR
Sbjct  388   MGKLGTLETFLRQADNLRQQTLQQMIRILTTRQSARALLAISDYFSRLRALSSLWLARPR  447

Query  192   Q  190
             +
Sbjct  448   E  448



>ref|XP_010904691.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Elaeis 
guineensis]
Length=429

 Score =   286 bits (732),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 153/300 (51%), Positives = 209/300 (70%), Gaps = 16/300 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAYVQQLE SR+KL QLEQ++  A+ +G  I+ +G+ 
Sbjct  141   LDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSGDQ  200

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                          +   GA AFD+EYARW+EE +R   ELR AV+    S+N+L+  VD+
Sbjct  201   SH----------SMGGNGALAFDMEYARWLEEHNRQINELRAAVNS-HASDNDLRTIVDS  249

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L  + AK+DV H++SGM  TP ERCF+W+GGFR S LLK++ +QLE +TE
Sbjct  250   IMAHYDEIFRLKGVAAKADVFHMLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPLTE  309

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDAL---FYPSNLPSCMTQMAAAI  370
             QQ +G+  L+QS+Q+AE+ALSQGME L  ++++ ++S +L       N+ + M QMA A+
Sbjct  310   QQLVGICNLQQSSQQAEDALSQGMEALQQSLAETLASGSLGPAGSSGNVANYMGQMAMAM  369

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L TL +F+RQADNLR QT+Q++  ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  370   GKLGTLESFLRQADNLRQQTLQQMIRILTTRQSARALLAIHDYFSRLRALSSLWLARPRE  429



>ref|XP_009794636.1| PREDICTED: transcription factor TGA2-like [Nicotiana sylvestris]
 gb|AAF06696.1|AF031487_1 bZIP transcription factor [Nicotiana tabacum]
Length=325

 Score =   282 bits (722),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 152/298 (51%), Positives = 205/298 (69%), Gaps = 15/298 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SRMKL QLEQ++  A+ +G  I+ +G+  
Sbjct  39    DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISGSGDQS  98

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA AFDVEYARW+EE++R   ELR AV+     + EL+  VD  
Sbjct  99    Q----------SMSGNGALAFDVEYARWLEEQNRRINELRGAVNS-HAGDGELRIIVDGI  147

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  +  +    AKSDV H++SGM  TP ERCF+W+GGFR S LLK++++QLE +TEQ
Sbjct  148   LAHYDDIFRIKGDAAKSDVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQ  207

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPS--NLPSCMTQMAAAITN  364
             Q L +  L+QS+Q+AE+ALSQGME L  ++++ ++       S  N+ + M QMA A+  
Sbjct  208   QLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAGSLGPSSSSGNVANYMGQMAMAMGK  267

Query  363   LYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
             L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L ++D+F RLR LS+LWL RPR+
Sbjct  268   LGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAISDYFSRLRALSSLWLARPRE  325



>ref|XP_009371925.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X3 [Pyrus 
x bretschneideri]
Length=510

 Score =   288 bits (738),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 150/296 (51%), Positives = 204/296 (69%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ +  A+A+G  +   G  
Sbjct  204   LDAKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLTQLEQDLQRARAQGLFLGGCGG-  262

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                       L  I+   A FD+EYARW+E++HR   ELR  + +  LS+++L+  VD  
Sbjct  263   ---------GLGNISSGAAIFDMEYARWLEDDHRHMSELRTGL-QAHLSDSDLRLVVDVY  312

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              +HY ++  L  M AKSDV HL++GM  TP ERCF+W+GGFRPS L+K++++QL+ +TEQ
Sbjct  313   VSHYDEIFQLKGMAAKSDVFHLITGMWTTPAERCFLWMGGFRPSELIKMLIAQLDPLTEQ  372

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+ EEAL+QG+E LH ++ D I+   +         M QMA A+  L 
Sbjct  373   QFMGIYNLQQSSQQGEEALTQGLEQLHQSLVDTIAGGPVI------DGMQQMAVALGKLT  426

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  427   NLEGFVRQADNLRQQTLHQLRRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  482



>ref|XP_006826801.1| hypothetical protein AMTR_s00010p00030830 [Amborella trichopoda]
 gb|ERM94038.1| hypothetical protein AMTR_s00010p00030830 [Amborella trichopoda]
Length=445

 Score =   286 bits (732),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 152/299 (51%), Positives = 205/299 (69%), Gaps = 16/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLETSR+KL QLEQ++  A+ +G  I   G+  
Sbjct  158   DQKTLRRLAQNREAARKSRLRKKAYVQQLETSRLKLQQLEQELQRARQQGIFIAGAGDQN  217

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         +   GA AFD+EYARW++E  R   +LR A++   + ENEL+  VDA 
Sbjct  218   H----------SMGGNGALAFDMEYARWLDEHQRQINDLRSAMNS-HVGENELRILVDAV  266

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
               HY ++  +     KSDV H++SGM  TP ERCF+W+GGFR S LLK+++S LE +TEQ
Sbjct  267   MQHYDEIFRIKGTGTKSDVFHMLSGMWKTPAERCFMWLGGFRSSELLKILLSHLEPLTEQ  326

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPS---NLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AE+ALSQGME L  ++++ ++S +L  P    N+ + M QMA A+ 
Sbjct  327   QLMGICNLQQSSQQAEDALSQGMEALQQSLAETLASGSLGPPGSSGNVANYMGQMAMAMG  386

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+L+ ILT  Q AR  L ++D+F RLR LS+LWL RPR+
Sbjct  387   KLGTLENFLRQADNLRQQTLQQLHRILTTRQSARALLAISDYFSRLRALSSLWLARPRE  445



>ref|XP_006347244.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
isoform X1 [Solanum tuberosum]
Length=503

 Score =   288 bits (737),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 146/296 (49%), Positives = 206/296 (70%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAA+K RIRKKAYVQQLETSR++L QLEQ++  A ++G  +      
Sbjct  197   LDPKTLRRLAQNREAAKKSRIRKKAYVQQLETSRIRLSQLEQELQRASSQGIFLGGGTAA  256

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                        + I+   A FD+EY+RW++++HR   ELR A+ +  LS+ +L+  VD  
Sbjct  257   G----------SNISSGAAIFDMEYSRWLDDDHRHIAELRTAL-QAHLSDGDLRLIVDGY  305

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++ +L  + AKSDV HL++GM  TP ERCF+W+GGFRPS L+K+++ QL+ +TEQ
Sbjct  306   IAHYDEIFNLKGVAAKSDVFHLITGMWTTPAERCFLWMGGFRPSELIKMLIGQLDPLTEQ  365

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEALSQG+E L  ++ D +++      ++L   M  MA A+  L 
Sbjct  366   QVVGIYSLQQSSQQAEEALSQGLEQLQQSLIDTVAT------ASLHDGMHHMALALGKLS  419

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L+ ILTV Q ARCFL++ +++ RLR LS+LWL RPR+
Sbjct  420   NLEGFVRQADNLRQQTLHQLHRILTVRQAARCFLVIGEYYGRLRALSSLWLSRPRE  475



>ref|XP_008228563.1| PREDICTED: transcription factor TGA2 isoform X1 [Prunus mume]
Length=531

 Score =   289 bits (739),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 151/296 (51%), Positives = 204/296 (69%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLETSR+KL QLEQ +  A+A+G  +   G  
Sbjct  225   LDAKTLRRLAQNREAARKSRLRKKAYVQQLETSRIKLTQLEQDLQRARAQGLFLGGCG--  282

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                       L  I+   A FD+EYARW+E++HR   ELR  + +  LS+++L+  VD  
Sbjct  283   --------GGLGNISSGAAIFDMEYARWLEDDHRHMSELRTGL-QAHLSDSDLRVIVDGY  333

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              +HY ++  L  + AKSDV HL++GM  TP ERCF+W+GGFRPS L+K++ +QL+ +TEQ
Sbjct  334   ISHYDEIFQLKGVAAKSDVFHLITGMWTTPAERCFLWMGGFRPSELIKMLTAQLDPLTEQ  393

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEAL+QG+E LH ++ D I+   +         M QMA A+  L 
Sbjct  394   QFMGIYSLQQSSQQAEEALTQGLEQLHQSLVDTIAGGPVI------DGMQQMAVALGKLT  447

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  448   NLEGFVRQADNLRQQTLHQLRRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  503



>ref|XP_010322437.1| PREDICTED: transcription factor TGA2 isoform X4 [Solanum lycopersicum]
Length=409

 Score =   285 bits (728),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 146/296 (49%), Positives = 204/296 (69%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAA+K RIRKKAYVQQLETSR++L QLEQ++  A ++G  +      
Sbjct  103   LDPKTLRRLAQNREAAKKSRIRKKAYVQQLETSRIRLSQLEQELQRASSQGIFLGGGTAA  162

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                        + I+   A FD+EY+RW++++HR   ELR A+ +  LS+ +L+  VD  
Sbjct  163   G----------SNISSGAAIFDMEYSRWLDDDHRHIAELRTAL-QAHLSDGDLRLIVDGY  211

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AKSDV HL++G   TP ERCF+W+GGFRPS L+K+++ QL+ +TEQ
Sbjct  212   LAHYDEIFSLKGVAAKSDVFHLITGTWTTPAERCFLWMGGFRPSELIKMLIGQLDPLTEQ  271

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEALSQG+E L  ++ D I++      ++L   M  MA A+  L 
Sbjct  272   QVVGIYSLQQSSQQAEEALSQGLEQLQQSLIDTIAT------ASLHDGMHHMALALGKLS  325

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L+ ILTV Q ARCFL++ +++ RLR LS+LWL RPR+
Sbjct  326   NLEGFVRQADNLRQQTLHQLHRILTVRQAARCFLVIGEYYGRLRALSSLWLSRPRE  381



>ref|XP_003627926.1| TGA transcription factor [Medicago truncatula]
 gb|AET02402.1| BZIP family transcription factor [Medicago truncatula]
Length=466

 Score =   286 bits (733),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 152/298 (51%), Positives = 205/298 (69%), Gaps = 16/298 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G   
Sbjct  179   DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGVFISSSGEQT  238

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA  FD EYARW+EE++R   ELR AV+    S+ EL+  VD  
Sbjct  239   H----------SLSGNGAMQFDAEYARWLEEQNRQINELRAAVNS-HASDTELRMIVDGI  287

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++++QLE +TEQ
Sbjct  288   VAHYDEIFRLKGVAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQ  347

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDA---LFYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AE+ALSQGME L  ++++ +S+ A        N+ + M QMA A+ 
Sbjct  348   QLMGITNLQQSSQQAEDALSQGMEALQQSLAETLSTGAPSSSGSSGNVANYMGQMAMAMG  407

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR
Sbjct  408   KLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAIHDYFSRLRALSSLWLARPR  465



>ref|XP_010238296.1| PREDICTED: transcription factor TGA2-like [Brachypodium distachyon]
Length=529

 Score =   288 bits (738),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 147/301 (49%), Positives = 206/301 (68%), Gaps = 13/301 (4%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARG------ARIT  910
             + KTLRRLAQNREAARK R+RKKAY+QQLE+SR++L Q+EQ++  A+A+G        +T
Sbjct  212   DPKTLRRLAQNREAARKSRLRKKAYIQQLESSRIRLAQIEQELHSARAQGVFFPGSGLLT  271

Query  909   EngnvvgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKR  730
             E G            +  ++ E A FDVEY RW EE +R+  ELR A+ +  L E EL+ 
Sbjct  272   EQGVTGKGLG----GIDGLSSEAAMFDVEYGRWQEEHYRVMYELRAALQQ-QLPEGELQM  326

Query  729   YVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE  550
             YV+ C AH+ ++  +   + K DV HL SG+  +P ERCF+W+GGFRPS ++K+++  +E
Sbjct  327   YVENCLAHHDEVVAIKDAVIKGDVFHLTSGVWRSPAERCFLWLGGFRPSEVIKMVLGHVE  386

Query  549   -VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALF-YPSNLPSCMTQMAA  376
              + EQQ + + GL+QS  E EEALSQG++ L+ ++SD + SDAL   P+N+ + M QM  
Sbjct  387   PLAEQQIVAVYGLQQSAAETEEALSQGLDALYQSLSDTVVSDALSCPPANVANYMGQMHV  446

Query  375   AITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRP  196
             A+  L TL  FVRQA+NLR QT+ RL+ +LT  Q+AR  L V+D+FHRLRTLS+LW+ RP
Sbjct  447   AMNKLSTLEGFVRQAENLRQQTLHRLHQVLTTRQMARSLLAVSDYFHRLRTLSSLWVTRP  506

Query  195   R  193
             R
Sbjct  507   R  507



>ref|XP_010904690.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Elaeis 
guineensis]
Length=468

 Score =   286 bits (733),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 153/300 (51%), Positives = 209/300 (70%), Gaps = 16/300 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAYVQQLE SR+KL QLEQ++  A+ +G  I+ +G+ 
Sbjct  180   LDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSGDQ  239

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                          +   GA AFD+EYARW+EE +R   ELR AV+    S+N+L+  VD+
Sbjct  240   SH----------SMGGNGALAFDMEYARWLEEHNRQINELRAAVNS-HASDNDLRTIVDS  288

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L  + AK+DV H++SGM  TP ERCF+W+GGFR S LLK++ +QLE +TE
Sbjct  289   IMAHYDEIFRLKGVAAKADVFHMLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPLTE  348

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDAL---FYPSNLPSCMTQMAAAI  370
             QQ +G+  L+QS+Q+AE+ALSQGME L  ++++ ++S +L       N+ + M QMA A+
Sbjct  349   QQLVGICNLQQSSQQAEDALSQGMEALQQSLAETLASGSLGPAGSSGNVANYMGQMAMAM  408

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L TL +F+RQADNLR QT+Q++  ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  409   GKLGTLESFLRQADNLRQQTLQQMIRILTTRQSARALLAIHDYFSRLRALSSLWLARPRE  468



>ref|XP_009364312.1| PREDICTED: transcription factor TGA2-like [Pyrus x bretschneideri]
Length=541

 Score =   288 bits (738),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 150/296 (51%), Positives = 204/296 (69%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ +  A+A+G  +   G  
Sbjct  235   LDAKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLTQLEQDLQRARAQGLFLGGCG--  292

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                       L  I+   A FD+EYARW+E++HR   ELR  + +  LS+++L+  VD  
Sbjct  293   --------GGLGNISSGAAIFDMEYARWLEDDHRHMSELRTGL-QAHLSDSDLRLVVDGY  343

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              +HY ++  L  M AKSDV HL++GM  TP ERCF+W+GGFRPS L+K++++QL+ +TEQ
Sbjct  344   VSHYDEIFQLKGMAAKSDVFHLITGMWTTPAERCFLWMGGFRPSELIKMLIAQLDPLTEQ  403

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+ EEAL+QG+E LH ++ D I+   +         M QMA A+  L 
Sbjct  404   QFMGIYNLQQSSQQGEEALTQGLEQLHQSLVDTIAGGPVI------DGMQQMAVALGKLT  457

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  458   NLEGFVRQADNLRQQTLHQLRRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  513



>ref|XP_006661375.1| PREDICTED: transcription factor TGA2-like [Oryza brachyantha]
Length=541

 Score =   288 bits (738),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 148/296 (50%), Positives = 210/296 (71%), Gaps = 8/296 (3%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAY+QQLE+SR++L QLEQ++  A+A+G     +  ++
Sbjct  199   DPKTLRRLAQNREAARKSRLRKKAYIQQLESSRIRLAQLEQELHTARAQGVFFPGSSGLL  258

Query  891   g----vghgHPLSLTK--ITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKR  730
                   G G PL      ++ E A FDVEY RW EE +R+  ELR A+ +  L E EL+ 
Sbjct  259   AEPGVAGKGVPLGGIDGALSSEAAMFDVEYGRWQEEHYRLMYELRAALQQ-HLPEGELQM  317

Query  729   YVDACFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE  550
             YV++C AH+ ++  +   + K DV HL+SG+  +P ERCF+W+GGFRPS ++K++++ +E
Sbjct  318   YVESCLAHHDEVAAIKDGVIKGDVFHLISGVWRSPAERCFLWLGGFRPSEVIKMLLAHVE  377

Query  549   -VTEQQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAA  373
              +TEQQ +G+ GL+QS  E EEAL+QG++ L+ ++SD + SDAL  P+N+ + M QMA A
Sbjct  378   PLTEQQIVGVYGLQQSALETEEALTQGLDALYQSLSDTVVSDALSCPANVANYMGQMAVA  437

Query  372   ITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWL  205
             +  L TL  FVRQA+NLR QT+ RL  +LT  Q+AR  L V+D+FHRLRTLS+LW+
Sbjct  438   MNKLSTLEGFVRQAENLRQQTLHRLQQVLTTRQMARSLLAVSDYFHRLRTLSSLWV  493



>ref|XP_004498676.1| PREDICTED: transcription factor TGA6-like isoform X1 [Cicer arietinum]
Length=438

 Score =   285 bits (730),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 207/299 (69%), Gaps = 16/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+K  QLEQ++  A+ +G  I+ +G+  
Sbjct  151   DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKFTQLEQELQRARQQGIFISSSGDQA  210

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA AFDVEYARW+EE++R   ELR AV+    SE EL   +D  
Sbjct  211   H----------SMSGNGAMAFDVEYARWLEEQNRQINELRGAVNS-HASETELHMIMDGI  259

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++++QLE +T+Q
Sbjct  260   LAHYDEIFRLKGIAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTDQ  319

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDAL---FYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+QEAE+ALSQGME L  ++S+ +++  L       N+ + M QMA A+ 
Sbjct  320   QLVGITNLQQSSQEAEDALSQGMEALQQSLSETLTTGPLGSSSSSGNVANYMGQMAMAMG  379

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  380   KLGTLEGFIRQADNLRQQTLQQIHRILTTRQSARALLAIHDYFSRLRALSSLWLARPRE  438



>gb|EPS71573.1| hypothetical protein M569_03185 [Genlisea aurea]
Length=690

 Score =   292 bits (748),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 153/296 (52%), Positives = 206/296 (70%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLETSR++L QLEQ +  A+++G  +   G+ 
Sbjct  383   LDAKTLRRLAQNREAARKSRLRKKAYVQQLETSRIRLTQLEQDLHRARSQGVYLEGGGSA  442

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
              G           I+  G  FD+EYARW+E++HR   ELR A+ +  LS+ +L+  VD  
Sbjct  443   NG----------NISSGGTMFDIEYARWLEDDHRHITELRAAL-QTHLSDGDLRVIVDGY  491

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              +HY ++  L  + AKSDV HL++GM  TP ERCF+W+GGFRPS L+K++M+QL+ +TEQ
Sbjct  492   ISHYDEIFRLKGVAAKSDVFHLITGMWTTPAERCFLWMGGFRPSDLIKMLMAQLDPLTEQ  551

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+ GL+QSTQ+AEEALSQGME L  ++ + IS+       ++   M QMA A+  L 
Sbjct  552   QVVGIYGLQQSTQQAEEALSQGMEQLQQSLIETISN------GSINGSMHQMAIALNQLA  605

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FV+QADNLR QT+ +L  ILTV Q ARCFL + ++  RLR LS+LW  RPR+
Sbjct  606   NLEGFVKQADNLRQQTLHQLRRILTVRQAARCFLAIGEYKGRLRALSSLWASRPRE  661



>ref|XP_002276067.2| PREDICTED: transcription factor TGA6 isoform X1 [Vitis vinifera]
 ref|XP_010651887.1| PREDICTED: transcription factor TGA6 isoform X1 [Vitis vinifera]
 ref|XP_010651888.1| PREDICTED: transcription factor TGA6 isoform X1 [Vitis vinifera]
 emb|CBI28327.3| unnamed protein product [Vitis vinifera]
Length=500

 Score =   287 bits (734),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 150/296 (51%), Positives = 204/296 (69%), Gaps = 12/296 (4%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ +  A+++G  +   G  
Sbjct  188   LDAKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLTQLEQDLQRARSQGLFLGGGGGG  247

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
              G G    +    I+P  A FD+EYARW+E++HR   ELR  +   +L + +L+  VD  
Sbjct  248   GGGGGAGGI----ISPGAAIFDMEYARWLEDDHRHMSELRTGLQAHLL-DGDLRVIVDGY  302

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              +HY ++  L  + AKSDV HL++GM  TP ERCF+W+GGFRPS L+K++++QL+ +TEQ
Sbjct  303   LSHYDEIFRLKGVAAKSDVFHLITGMWTTPAERCFLWMGGFRPSDLIKMLIAQLDPLTEQ  362

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+ GL+ S+Q+AEEALSQG E L  ++ D I+S       ++   M  M  A+  L 
Sbjct  363   QVMGIYGLQHSSQQAEEALSQGQEQLQQSLIDTIAS------GSVADDMAHMVMALGQLT  416

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QTI +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  417   NLEGFVRQADNLRQQTIHQLCRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  472



>ref|XP_006347246.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
isoform X3 [Solanum tuberosum]
Length=488

 Score =   286 bits (733),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/293 (49%), Positives = 204/293 (70%), Gaps = 18/293 (6%)
 Frame = -2

Query  1065  KTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvvgv  886
             KTLRRLAQNREAA+K RIRKKAYVQQLETSR++L QLEQ++  A ++G  +         
Sbjct  185   KTLRRLAQNREAAKKSRIRKKAYVQQLETSRIRLSQLEQELQRASSQGIFLGGGTAAG--  242

Query  885   ghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFAH  706
                     + I+   A FD+EY+RW++++HR   ELR A+ +  LS+ +L+  VD   AH
Sbjct  243   --------SNISSGAAIFDMEYSRWLDDDHRHIAELRTAL-QAHLSDGDLRLIVDGYIAH  293

Query  705   YAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQAL  529
             Y ++ +L  + AKSDV HL++GM  TP ERCF+W+GGFRPS L+K+++ QL+ +TEQQ +
Sbjct  294   YDEIFNLKGVAAKSDVFHLITGMWTTPAERCFLWMGGFRPSELIKMLIGQLDPLTEQQVV  353

Query  528   GMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYTLH  349
             G+  L+QS+Q+AEEALSQG+E L  ++ D +++      ++L   M  MA A+  L  L 
Sbjct  354   GIYSLQQSSQQAEEALSQGLEQLQQSLIDTVAT------ASLHDGMHHMALALGKLSNLE  407

Query  348   TFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              FVRQADNLR QT+ +L+ ILTV Q ARCFL++ +++ RLR LS+LWL RPR+
Sbjct  408   GFVRQADNLRQQTLHQLHRILTVRQAARCFLVIGEYYGRLRALSSLWLSRPRE  460



>ref|XP_010245498.1| PREDICTED: transcription factor TGA2-like isoform X2 [Nelumbo 
nucifera]
Length=468

 Score =   286 bits (731),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 151/300 (50%), Positives = 207/300 (69%), Gaps = 16/300 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+ 
Sbjct  180   LDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQ  239

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                          ++  GA AFD+EYARW+EE +R   ELR AV+    S++EL+  VD 
Sbjct  240   SH----------SVSGNGALAFDIEYARWLEEHNRQINELRNAVNS-HASDSELRVIVDG  288

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY  +  L  + AK+DV H++SGM  TP ERCF+W+GGFR S LLK++++QLE +TE
Sbjct  289   VMAHYDDIFRLKGIAAKADVFHMLSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTE  348

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIIS---SDALFYPSNLPSCMTQMAAAI  370
             QQ +G+  L+QS+Q+AE+ALSQGME L  ++++ ++           N+ + M QMA A+
Sbjct  349   QQLMGICNLQQSSQQAEDALSQGMEALQQSLAETLASGSLGPSGSSGNVANYMGQMAMAM  408

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  409   GKLGTLEGFLRQADNLRQQTLQQMHRILTTRQSARALLAINDYFSRLRALSSLWLARPRE  468



>ref|XP_009371923.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Pyrus 
x bretschneideri]
Length=538

 Score =   288 bits (736),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/296 (51%), Positives = 204/296 (69%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ +  A+A+G  +   G  
Sbjct  232   LDAKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLTQLEQDLQRARAQGLFLGGCG--  289

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                       L  I+   A FD+EYARW+E++HR   ELR  + +  LS+++L+  VD  
Sbjct  290   --------GGLGNISSGAAIFDMEYARWLEDDHRHMSELRTGL-QAHLSDSDLRLVVDVY  340

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              +HY ++  L  M AKSDV HL++GM  TP ERCF+W+GGFRPS L+K++++QL+ +TEQ
Sbjct  341   VSHYDEIFQLKGMAAKSDVFHLITGMWTTPAERCFLWMGGFRPSELIKMLIAQLDPLTEQ  400

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+ EEAL+QG+E LH ++ D I+   +         M QMA A+  L 
Sbjct  401   QFMGIYNLQQSSQQGEEALTQGLEQLHQSLVDTIAGGPVI------DGMQQMAVALGKLT  454

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  455   NLEGFVRQADNLRQQTLHQLRRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  510



>ref|XP_006605394.1| PREDICTED: uncharacterized protein LOC100816123 isoform X4 [Glycine 
max]
Length=332

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 152/298 (51%), Positives = 205/298 (69%), Gaps = 16/298 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+  
Sbjct  45    DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIIISNSGDQA  104

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA AFDVEYARW+EE++R   ELR AV+     + EL+  +D  
Sbjct  105   HS----------MSGNGAMAFDVEYARWLEEQNRQVNELRAAVNS-HAGDTELRMIIDGI  153

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L A  AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++++QLE +TEQ
Sbjct  154   MAHYDEIFRLKADAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQ  213

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISD---IISSDALFYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AE+ALSQGME L  ++S+     S  +     N+ + M QMA A+ 
Sbjct  214   QLVGITNLQQSSQQAEDALSQGMEALQQSLSETLSTGSLGSSGSSGNVANYMGQMAMAMG  273

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
              L TL  F++QADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR
Sbjct  274   KLGTLEGFIKQADNLRQQTLQQIHRILTTRQSARALLAIHDYFSRLRALSSLWLARPR  331



>ref|XP_010651889.1| PREDICTED: transcription factor TGA6 isoform X2 [Vitis vinifera]
Length=489

 Score =   286 bits (732),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/296 (51%), Positives = 204/296 (69%), Gaps = 12/296 (4%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ +  A+++G  +   G  
Sbjct  177   LDAKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLTQLEQDLQRARSQGLFLGGGGGG  236

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
              G G    +    I+P  A FD+EYARW+E++HR   ELR  +   +L + +L+  VD  
Sbjct  237   GGGGGAGGI----ISPGAAIFDMEYARWLEDDHRHMSELRTGLQAHLL-DGDLRVIVDGY  291

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              +HY ++  L  + AKSDV HL++GM  TP ERCF+W+GGFRPS L+K++++QL+ +TEQ
Sbjct  292   LSHYDEIFRLKGVAAKSDVFHLITGMWTTPAERCFLWMGGFRPSDLIKMLIAQLDPLTEQ  351

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+ GL+ S+Q+AEEALSQG E L  ++ D I+S       ++   M  M  A+  L 
Sbjct  352   QVMGIYGLQHSSQQAEEALSQGQEQLQQSLIDTIAS------GSVADDMAHMVMALGQLT  405

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QTI +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  406   NLEGFVRQADNLRQQTIHQLCRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  461



>ref|XP_006832856.1| hypothetical protein AMTR_s00095p00059370 [Amborella trichopoda]
 gb|ERM98134.1| hypothetical protein AMTR_s00095p00059370 [Amborella trichopoda]
Length=447

 Score =   285 bits (729),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 153/297 (52%), Positives = 201/297 (68%), Gaps = 15/297 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLETSR+KL QLEQ++  A+ +G  I+      
Sbjct  161   DQKTLRRLAQNREAARKSRLRKKAYVQQLETSRLKLQQLEQELQRARQQGIFISSGDQSH  220

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
              +     L          AFD+EY+RW+EE +R   ELR AV+     +NEL+  VDA  
Sbjct  221   SMNGNGAL----------AFDMEYSRWLEEHNRQINELRAAVNS-HAGDNELRISVDAVM  269

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY  +  L    AK+DV H++SGM  TP ERCF+W+GGFR S LLK+++  LE +TEQQ
Sbjct  270   AHYDDIFRLKGTAAKADVFHMLSGMWKTPAERCFLWLGGFRSSELLKILVPHLEPLTEQQ  329

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALF--YPS-NLPSCMTQMAAAITN  364
              +G+  L+QS+Q+AEEALSQGME L   +++ +++ +L    PS N+ + M QMA A+  
Sbjct  330   LMGICNLQQSSQQAEEALSQGMEALQQALAETLATGSLGPSGPSGNVANYMGQMAVAMGK  389

Query  363   LYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
             L TL  F+RQADNLR QT+Q+L+ ILT  Q AR  L + D+F RLR LS+LWL RPR
Sbjct  390   LGTLENFLRQADNLRQQTLQQLHRILTTRQSARALLAINDYFSRLRALSSLWLARPR  446



>ref|XP_004307087.1| PREDICTED: transcription factor HBP-1b(c1)-like [Fragaria vesca 
subsp. vesca]
Length=334

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/299 (52%), Positives = 206/299 (69%), Gaps = 15/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLETSR+KL QLEQ++  A+ +G  I+ +G   
Sbjct  46    DQKTLRRLAQNREAARKSRLRKKAYVQQLETSRLKLSQLEQELQRARQQGIFISSSGGDA  105

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                          +  GA AFDVEY RW+E+++R   ELR AV+    S+ EL+  VD  
Sbjct  106   AH---------STSGNGAMAFDVEYGRWLEDQNRQINELRSAVNS-HASDAELRIIVDGI  155

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L    AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++++QLE +TEQ
Sbjct  156   LAHYDEIFRLKGTAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQ  215

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPS---NLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AE+ALSQGME L  ++++ +SS +L       N+ + M QMA A+ 
Sbjct  216   QLVGITNLQQSSQQAEDALSQGMEALQQSLAETLSSGSLGSSGSSGNVANYMGQMAMAMG  275

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  276   KLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAINDYFSRLRALSSLWLARPRE  334



>gb|AFK47127.1| unknown [Medicago truncatula]
Length=466

 Score =   285 bits (730),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 151/298 (51%), Positives = 205/298 (69%), Gaps = 16/298 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + +TLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G   
Sbjct  179   DQRTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGVFISSSGEQT  238

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA  FD EYARW+EE++R   ELR AV+    S+ EL+  VD  
Sbjct  239   H----------SLSGNGAMQFDAEYARWLEEQNRQINELRAAVNS-HASDTELRMIVDGI  287

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++++QLE +TEQ
Sbjct  288   VAHYDEIFRLKGVAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQ  347

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDA---LFYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AE+ALSQGME L  ++++ +S+ A        N+ + M QMA A+ 
Sbjct  348   QLMGITNLQQSSQQAEDALSQGMEALQQSLAETLSTGAPSSSGSSGNVANYMGQMAMAMG  407

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR
Sbjct  408   KLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAIHDYFSRLRALSSLWLARPR  465



>gb|AEF30410.1| putative TGA2-like protein 2 [Oryza sativa Japonica Group]
Length=332

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/299 (49%), Positives = 203/299 (68%), Gaps = 14/299 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAY+Q LE+SR+KL Q+EQ++  A+ +G  I+     
Sbjct  44    LDHKTLRRLAQNREAARKSRLRKKAYIQNLESSRLKLTQIEQELQRARQQGIFIS-----  98

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                      S +       AFD+EYARW+EE ++   ELR AV+     +N+L+  VD+ 
Sbjct  99    ----TSSDQSHSASGNRALAFDMEYARWLEEHNKHINELRAAVNA-HAGDNDLESTVDSI  153

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AK+DV H++SGM  TP ERCF+W+GGFR S LLK++  QLE +TEQ
Sbjct  154   MAHYNEIFKLKGVAAKADVFHVLSGMWKTPAERCFMWLGGFRSSELLKLLAGQLEPLTEQ  213

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDAL---FYPSNLPSCMTQMAAAIT  367
             Q  G+  L+QS+Q+AE+ALSQGME L  ++++ ++S +L       N+ + M QMA A+ 
Sbjct  214   QLAGIANLQQSSQQAEDALSQGMEALQQSLAETLASGSLGPAGSSGNVANYMGQMAMAMG  273

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR+QT+Q++  ILT  Q AR  L ++D+F RLR LS+LWL RPR+
Sbjct  274   KLGTLENFLRQADNLRLQTLQQMQRILTTRQSARALLAISDYFSRLRALSSLWLARPRE  332



>ref|XP_006465757.1| PREDICTED: transcription factor TGA6-like isoform X1 [Citrus 
sinensis]
 ref|XP_006465758.1| PREDICTED: transcription factor TGA6-like isoform X2 [Citrus 
sinensis]
 ref|XP_006465759.1| PREDICTED: transcription factor TGA6-like isoform X3 [Citrus 
sinensis]
Length=453

 Score =   285 bits (728),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 207/299 (69%), Gaps = 15/299 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+ 
Sbjct  166   LDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQ  225

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                          ++  GA AFDVEYARW+EE+++   ELR AV+    S+ EL+  VD 
Sbjct  226   AH----------SMSGNGAMAFDVEYARWLEEQNKQINELRSAVNS-HASDTELRMVVDG  274

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L A  AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++++QLE +TE
Sbjct  275   IMAHYDEIFRLKANAAKADVFHLLSGMWKTPAERCFMWLGGFRSSELLKLLVNQLEPLTE  334

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDI--ISSDALFYPSNLPSCMTQMAAAIT  367
             QQ +G+  L+QS+Q+AE+ALSQGME L  ++++     S       N+ + M QMA A+ 
Sbjct  335   QQLVGIGNLQQSSQQAEDALSQGMEALQQSLAETLSSGSLGSSGSGNVANYMGQMAMAMG  394

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LW+ RPR+
Sbjct  395   KLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAIHDYFSRLRALSSLWMARPRE  453



>gb|KHN37699.1| Transcription factor HBP-1b(c1) [Glycine soja]
Length=438

 Score =   284 bits (727),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 152/298 (51%), Positives = 205/298 (69%), Gaps = 16/298 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+  
Sbjct  151   DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQA  210

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA  FD EYARW+EE++R   ELR AV+    S+ EL+  VD  
Sbjct  211   HT----------LSGNGAMQFDAEYARWLEEQNRQINELRAAVNS-HASDTELRMIVDGI  259

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK+++SQLE +TEQ
Sbjct  260   LAHYDEIFRLKGVAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLVSQLEPLTEQ  319

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDA---LFYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AE+ALSQGME L  ++++ +S+ A        N+ S M QMA A+ 
Sbjct  320   QLMGITNLQQSSQQAEDALSQGMEALQQSLAETLSTGAPASSGSSGNVASYMGQMAMAMG  379

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
              L TL  F++QADNLR QT+Q+++ ILT  Q AR  L + D+  RLR LS+LWL RPR
Sbjct  380   KLGTLEGFIQQADNLRQQTLQQMHRILTTRQSARALLAIHDYISRLRALSSLWLARPR  437



>ref|XP_010322436.1| PREDICTED: transcription factor TGA2 isoform X3 [Solanum lycopersicum]
Length=479

 Score =   285 bits (730),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 146/296 (49%), Positives = 204/296 (69%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAA+K RIRKKAYVQQLETSR++L QLEQ++  A ++G  +      
Sbjct  173   LDPKTLRRLAQNREAAKKSRIRKKAYVQQLETSRIRLSQLEQELQRASSQGIFLGGGTAA  232

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                        + I+   A FD+EY+RW++++HR   ELR A+ +  LS+ +L+  VD  
Sbjct  233   G----------SNISSGAAIFDMEYSRWLDDDHRHIAELRTAL-QAHLSDGDLRLIVDGY  281

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AKSDV HL++G   TP ERCF+W+GGFRPS L+K+++ QL+ +TEQ
Sbjct  282   LAHYDEIFSLKGVAAKSDVFHLITGTWTTPAERCFLWMGGFRPSELIKMLIGQLDPLTEQ  341

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEALSQG+E L  ++ D I++      ++L   M  MA A+  L 
Sbjct  342   QVVGIYSLQQSSQQAEEALSQGLEQLQQSLIDTIAT------ASLHDGMHHMALALGKLS  395

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L+ ILTV Q ARCFL++ +++ RLR LS+LWL RPR+
Sbjct  396   NLEGFVRQADNLRQQTLHQLHRILTVRQAARCFLVIGEYYGRLRALSSLWLSRPRE  451



>ref|XP_006465760.1| PREDICTED: transcription factor TGA6-like isoform X4 [Citrus 
sinensis]
 ref|XP_006465761.1| PREDICTED: transcription factor TGA6-like isoform X5 [Citrus 
sinensis]
 ref|XP_006465762.1| PREDICTED: transcription factor TGA6-like isoform X6 [Citrus 
sinensis]
Length=449

 Score =   285 bits (728),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 207/299 (69%), Gaps = 15/299 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+ 
Sbjct  162   LDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQ  221

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                          ++  GA AFDVEYARW+EE+++   ELR AV+    S+ EL+  VD 
Sbjct  222   AH----------SMSGNGAMAFDVEYARWLEEQNKQINELRSAVNS-HASDTELRMVVDG  270

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L A  AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++++QLE +TE
Sbjct  271   IMAHYDEIFRLKANAAKADVFHLLSGMWKTPAERCFMWLGGFRSSELLKLLVNQLEPLTE  330

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDI--ISSDALFYPSNLPSCMTQMAAAIT  367
             QQ +G+  L+QS+Q+AE+ALSQGME L  ++++     S       N+ + M QMA A+ 
Sbjct  331   QQLVGIGNLQQSSQQAEDALSQGMEALQQSLAETLSSGSLGSSGSGNVANYMGQMAMAMG  390

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LW+ RPR+
Sbjct  391   KLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAIHDYFSRLRALSSLWMARPRE  449



>ref|XP_010313245.1| PREDICTED: transcription factor HBP-1b(c38) [Solanum lycopersicum]
Length=324

 Score =   280 bits (717),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 152/298 (51%), Positives = 205/298 (69%), Gaps = 15/298 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SRMKL QLEQ++  A+ +G  I+ +G+  
Sbjct  38    DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISGSGDQS  97

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA AFDVEYARW+EE++R   ELR AV+     + EL+  VD  
Sbjct  98    Q----------SMSGNGALAFDVEYARWLEEQNRRINELRGAVNS-HAGDAELRIIVDGI  146

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  +  +    AK+DV H++SGM  TP ERCF+W+GGFR S LLK++++QLE +TEQ
Sbjct  147   LAHYDDIFRIKGDAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQ  206

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPS--NLPSCMTQMAAAITN  364
             Q L +  L+QS+Q+AE+ALSQGME L  ++++ ++       S  N+ + M QMA A+  
Sbjct  207   QLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGK  266

Query  363   LYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
             L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L +TD+F RLR LS+LWL RPR+
Sbjct  267   LGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAITDYFSRLRALSSLWLARPRE  324



>ref|XP_011088885.1| PREDICTED: transcription factor TGA2 isoform X2 [Sesamum indicum]
Length=472

 Score =   285 bits (729),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 148/293 (51%), Positives = 204/293 (70%), Gaps = 18/293 (6%)
 Frame = -2

Query  1065  KTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvvgv  886
             KTLRRLAQNREAARK R+RKKAYVQQLE+SR++L QLEQ +  A+++G  +   G     
Sbjct  168   KTLRRLAQNREAARKSRLRKKAYVQQLESSRIRLTQLEQDLQRARSQGLFLGGGGV----  223

Query  885   ghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFAH  706
                   +   I+  GA FD+EYARW+E++HR   ELR A+ +  LS+ +L+  VD   AH
Sbjct  224   ------AGGNISSGGAIFDMEYARWLEDDHRHMSELRTAL-QAHLSDGDLRVIVDGYIAH  276

Query  705   YAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQAL  529
             Y ++  L  + AKSDV HL++GM  TP ERCF+W+GGFRPS L+K++++QL+ +TEQQ +
Sbjct  277   YDEIFRLKGVAAKSDVFHLITGMWTTPAERCFLWMGGFRPSDLIKMLITQLDPLTEQQVM  336

Query  528   GMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYTLH  349
             G+ GL+QS+Q+AEEALSQG+E L  ++ D I++       ++   M  MA A+  L  L 
Sbjct  337   GIYGLQQSSQQAEEALSQGLEQLQQSLIDTIAN------GSINDSMHHMAVALGKLSNLE  390

Query  348   TFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              FVRQADNLR QT+ +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  391   GFVRQADNLRQQTLHQLRRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  443



>ref|XP_007133721.1| hypothetical protein PHAVU_011G203400g [Phaseolus vulgaris]
 gb|AAK84889.1|AF402608_1 TGA-type basic leucine zipper protein TGA2.1 [Phaseolus vulgaris]
 gb|ESW05715.1| hypothetical protein PHAVU_011G203400g [Phaseolus vulgaris]
Length=467

 Score =   285 bits (729),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 151/298 (51%), Positives = 205/298 (69%), Gaps = 16/298 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+  
Sbjct  180   DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQA  239

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA  FD EYARW+EE++R   ELR AV+    S+ EL+  VD  
Sbjct  240   HT----------LSGNGAMQFDAEYARWLEEQNRQINELRAAVNS-HASDTELRMIVDGI  288

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  +  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++ +QLE +TEQ
Sbjct  289   LAHYDEIFRMKGVAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPLTEQ  348

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDA---LFYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AE+ALSQGME L  ++++ +S+ A        N+ + M QMA A+ 
Sbjct  349   QLMGITNLQQSSQQAEDALSQGMEALQQSLAETLSTGAPASSGSSGNVANYMGQMAMAMG  408

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR
Sbjct  409   KLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAIHDYFSRLRALSSLWLARPR  466



>ref|XP_006356348.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006356349.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X2 [Solanum 
tuberosum]
Length=325

 Score =   280 bits (717),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 152/298 (51%), Positives = 205/298 (69%), Gaps = 15/298 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SRMKL QLEQ++  A+ +G  I+ +G+  
Sbjct  39    DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISGSGDQS  98

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA AFDVEYARW+EE++R   ELR AV+     + EL+  VD  
Sbjct  99    Q----------SMSGNGALAFDVEYARWLEEQNRRINELRGAVNS-HAGDAELRIIVDGI  147

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  +  +    AK+DV H++SGM  TP ERCF+W+GGFR S LLK++++QLE +TEQ
Sbjct  148   LAHYDDIFRIKGDAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQ  207

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPS--NLPSCMTQMAAAITN  364
             Q L +  L+QS+Q+AE+ALSQGME L  ++++ ++       S  N+ + M QMA A+  
Sbjct  208   QLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGK  267

Query  363   LYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
             L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L +TD+F RLR LS+LWL RPR+
Sbjct  268   LGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAITDYFSRLRALSSLWLARPRE  325



>ref|XP_004241320.1| PREDICTED: transcription factor TGA2 isoform X1 [Solanum lycopersicum]
Length=501

 Score =   286 bits (732),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 146/296 (49%), Positives = 204/296 (69%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAA+K RIRKKAYVQQLETSR++L QLEQ++  A ++G  +      
Sbjct  195   LDPKTLRRLAQNREAAKKSRIRKKAYVQQLETSRIRLSQLEQELQRASSQGIFLGGGTAA  254

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                        + I+   A FD+EY+RW++++HR   ELR A+ +  LS+ +L+  VD  
Sbjct  255   G----------SNISSGAAIFDMEYSRWLDDDHRHIAELRTAL-QAHLSDGDLRLIVDGY  303

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AKSDV HL++G   TP ERCF+W+GGFRPS L+K+++ QL+ +TEQ
Sbjct  304   LAHYDEIFSLKGVAAKSDVFHLITGTWTTPAERCFLWMGGFRPSELIKMLIGQLDPLTEQ  363

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEALSQG+E L  ++ D I++      ++L   M  MA A+  L 
Sbjct  364   QVVGIYSLQQSSQQAEEALSQGLEQLQQSLIDTIAT------ASLHDGMHHMALALGKLS  417

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L+ ILTV Q ARCFL++ +++ RLR LS+LWL RPR+
Sbjct  418   NLEGFVRQADNLRQQTLHQLHRILTVRQAARCFLVIGEYYGRLRALSSLWLSRPRE  473



>ref|XP_010322435.1| PREDICTED: transcription factor TGA2 isoform X2 [Solanum lycopersicum]
Length=495

 Score =   286 bits (731),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 146/296 (49%), Positives = 204/296 (69%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAA+K RIRKKAYVQQLETSR++L QLEQ++  A ++G  +      
Sbjct  189   LDPKTLRRLAQNREAAKKSRIRKKAYVQQLETSRIRLSQLEQELQRASSQGIFLGGGTAA  248

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                        + I+   A FD+EY+RW++++HR   ELR A+ +  LS+ +L+  VD  
Sbjct  249   G----------SNISSGAAIFDMEYSRWLDDDHRHIAELRTAL-QAHLSDGDLRLIVDGY  297

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AKSDV HL++G   TP ERCF+W+GGFRPS L+K+++ QL+ +TEQ
Sbjct  298   LAHYDEIFSLKGVAAKSDVFHLITGTWTTPAERCFLWMGGFRPSELIKMLIGQLDPLTEQ  357

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEALSQG+E L  ++ D I++      ++L   M  MA A+  L 
Sbjct  358   QVVGIYSLQQSSQQAEEALSQGLEQLQQSLIDTIAT------ASLHDGMHHMALALGKLS  411

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L+ ILTV Q ARCFL++ +++ RLR LS+LWL RPR+
Sbjct  412   NLEGFVRQADNLRQQTLHQLHRILTVRQAARCFLVIGEYYGRLRALSSLWLSRPRE  467



>ref|XP_008787873.1| PREDICTED: transcription factor TGA6-like isoform X2 [Phoenix 
dactylifera]
Length=486

 Score =   285 bits (730),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/297 (48%), Positives = 207/297 (70%), Gaps = 13/297 (4%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AK+LRRLAQNREAARK R+RKKAY+QQLE+SR+KL QLEQ +  A+++G  +      
Sbjct  174   LDAKSLRRLAQNREAARKSRLRKKAYIQQLESSRIKLTQLEQDLQRARSQGLFLGGG---  230

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                      +   I+   A FD+EY RW++E +R   +LR+ + +  LS+ +L+  VD C
Sbjct  231   --------GAGGNISSAAAVFDMEYGRWLDENYRHMTDLREGL-QAHLSDGDLRVIVDEC  281

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  +  + AKSDVLHL++GM  TP ERCF+W+GGFRPS LLK+++ Q++ +TEQ
Sbjct  282   LAHYDEIFRVKGVAAKSDVLHLITGMWTTPAERCFLWMGGFRPSELLKILIPQMDPLTEQ  341

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEALSQG+E LH ++ D ++S +L   +++ + M Q+A A+  L 
Sbjct  342   QLVGICSLQQSSQQAEEALSQGLEQLHQSLGDAVASGSLSEGTDVGNYMGQIAIALGKLA  401

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
              L  FVRQADN+R QT+ +   ILTV Q ARCFL + ++  RLR LS+LW  RPR++
Sbjct  402   DLEGFVRQADNMRQQTLHQTRRILTVRQAARCFLAIGEYNSRLRALSSLWASRPREN  458



>ref|XP_008787881.1| PREDICTED: transcription factor TGA6-like isoform X3 [Phoenix 
dactylifera]
Length=439

 Score =   284 bits (726),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 143/295 (48%), Positives = 205/295 (69%), Gaps = 13/295 (4%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AK+LRRLAQNREAARK R+RKKAY+QQLE+SR+KL QLEQ +  A+++G  +      
Sbjct  123   LDAKSLRRLAQNREAARKSRLRKKAYIQQLESSRIKLTQLEQDLQRARSQGLFLGGG---  179

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                      +   I+   A FD+EY RW++E +R   +LR+ + +  LS+ +L+  VD C
Sbjct  180   --------GAGGNISSAAAVFDMEYGRWLDENYRHMTDLREGL-QAHLSDGDLRVIVDEC  230

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  +  + AKSDVLHL++GM  TP ERCF+W+GGFRPS LLK+++ Q++ +TEQ
Sbjct  231   LAHYDEIFRVKGVAAKSDVLHLITGMWTTPAERCFLWMGGFRPSELLKILIPQMDPLTEQ  290

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEALSQG+E LH ++ D ++S +L   +++ + M Q+A A+  L 
Sbjct  291   QLVGICSLQQSSQQAEEALSQGLEQLHQSLGDAVASGSLSEGTDVGNYMGQIAIALGKLA  350

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
              L  FVRQADN+R QT+ +   ILTV Q ARCFL + ++  RLR LS+LW  RPR
Sbjct  351   DLEGFVRQADNMRQQTLHQTRRILTVRQAARCFLAIGEYNSRLRALSSLWASRPR  405



>ref|XP_010686014.1| PREDICTED: transcription factor TGA2 isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=500

 Score =   285 bits (730),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 149/294 (51%), Positives = 204/294 (69%), Gaps = 16/294 (5%)
 Frame = -2

Query  1065  KTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvvgv  886
             KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ +  A+A+G  +   G     
Sbjct  192   KTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLAQLEQDLQRARAQGYFLGGGGGA---  248

Query  885   ghgHPLSLTKITPEGAA-FDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFA  709
                 P +L+     GAA FD+EYARW+E++HR T ELR A+ +  LS+ +L+  VD    
Sbjct  249   ----PANLSSDGAAGAAIFDMEYARWLEDDHRHTTELRGAL-QAHLSDGDLRIIVDGYIN  303

Query  708   HYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQA  532
             HY ++  L  + AKSD+ HL++GM  TP ERCF+W+GGFRPS L+K++ +QL+ +TEQQ 
Sbjct  304   HYDEIFRLKGVAAKSDIFHLITGMWTTPAERCFLWMGGFRPSELIKMLTAQLDPLTEQQL  363

Query  531   LGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYTL  352
             +G+  L+ S+Q+AEEALSQG+E L  ++ D I++      S +   M QMA A+  L  L
Sbjct  364   MGIYSLQHSSQQAEEALSQGLEQLQQSLVDTIAT------STVTDGMHQMAIALGKLSNL  417

Query  351   HTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               F+RQADNLR QT+ +L  ILT+ Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  418   EGFIRQADNLRQQTLHQLRRILTIRQAARCFLVIGEYYGRLRALSSLWSSRPRE  471



>ref|XP_009419682.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=464

 Score =   284 bits (727),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 152/301 (50%), Positives = 207/301 (69%), Gaps = 19/301 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+ 
Sbjct  177   LDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQKARQQGIFISNSGDQ  236

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                           +  GA  FDVEYARW+EE +R   ELR AV+    SEN+L+  VD 
Sbjct  237   SHA----------TSGNGALTFDVEYARWLEEHNRQISELRAAVNA-HASENDLRVIVDG  285

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L  + AK+DV H++SGM  TP ERCF+W+GGFR S LLK++ +QLE +TE
Sbjct  286   VMAHYDEIFRLKGIAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPLTE  345

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPS----NLPSCMTQMAAA  373
             QQ +G+  L+QS+Q+AE+ALSQGM+ L  ++S+ ++      PS    N+ + M QMA A
Sbjct  346   QQMMGICNLQQSSQQAEDALSQGMDALQQSLSETLAGS--LGPSGTSGNVANYMGQMAMA  403

Query  372   ITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
             +  L TL  F+ QADNLR QT+Q+++ ILT  Q AR  L ++D+F RLR LS+LWL RP+
Sbjct  404   MGKLGTLENFLHQADNLRQQTLQQMHRILTTRQSARALLAISDYFSRLRALSSLWLARPQ  463

Query  192   Q  190
             +
Sbjct  464   E  464



>ref|XP_010686013.1| PREDICTED: transcription factor TGA2 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=510

 Score =   286 bits (731),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 151/297 (51%), Positives = 207/297 (70%), Gaps = 20/297 (7%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ +  A+A+G  +   G  
Sbjct  203   LDAKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLAQLEQDLQRARAQGYFLGGGGGA  262

Query  894   vgvghgHPLSLTKITPEGAA-FDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                    P +L+     GAA FD+EYARW+E++HR T ELR A+ +  LS+ +L+  VD 
Sbjct  263   -------PANLSS----GAAIFDMEYARWLEDDHRHTTELRGAL-QAHLSDGDLRIIVDG  310

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
                HY ++  L  + AKSD+ HL++GM  TP ERCF+W+GGFRPS L+K++ +QL+ +TE
Sbjct  311   YINHYDEIFRLKGVAAKSDIFHLITGMWTTPAERCFLWMGGFRPSELIKMLTAQLDPLTE  370

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNL  361
             QQ +G+  L+ S+Q+AEEALSQG+E L  ++ D I++      S +   M QMA A+  L
Sbjct  371   QQLMGIYSLQHSSQQAEEALSQGLEQLQQSLVDTIAT------STVTDGMHQMAIALGKL  424

Query  360   YTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L  F+RQADNLR QT+ +L  ILT+ Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  425   SNLEGFIRQADNLRQQTLHQLRRILTIRQAARCFLVIGEYYGRLRALSSLWSSRPRE  481



>ref|XP_008383945.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Malus 
domestica]
Length=526

 Score =   286 bits (732),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 147/293 (50%), Positives = 200/293 (68%), Gaps = 18/293 (6%)
 Frame = -2

Query  1065  KTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvvgv  886
             KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ +  A+A+G  +   G     
Sbjct  223   KTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLTQLEQDLQRARAQGLFLGSCGG----  278

Query  885   ghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFAH  706
                    L  I+   A FD+EY RW+E++HR   ELR  + +  LS+++L+  VD   +H
Sbjct  279   ------GLGNISSGAAIFDMEYVRWLEDDHRQMSELRTGL-QAHLSDSDLRLVVDGYVSH  331

Query  705   YAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQAL  529
             Y ++  L  M AKSDV HL++GM  TP ERCF+W+GGFRPS L+K++++QL+ +TEQQ +
Sbjct  332   YDEIFQLKGMAAKSDVFHLITGMWTTPAERCFLWMGGFRPSELIKMLIAQLDPLTEQQFM  391

Query  528   GMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYTLH  349
             G+  L+QS+Q+AEEAL+QG+E LH ++ D I+   +         M QMA A+  L  L 
Sbjct  392   GIYNLQQSSQQAEEALTQGLEQLHQSLIDTIAGGPVI------DGMQQMAVALGKLTNLE  445

Query  348   TFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              FVRQADN R QT+ +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  446   GFVRQADNFRQQTLHQLRRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  498



>gb|ADW40546.1| bZIP transcription factor [Saccharum hybrid cultivar Q117]
Length=331

 Score =   280 bits (716),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 149/300 (50%), Positives = 209/300 (70%), Gaps = 16/300 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAY+Q LE+SR+KL QLEQ++  A+ +G  I+ +G+ 
Sbjct  43    LDQKTLRRLAQNREAARKSRLRKKAYIQNLESSRLKLTQLEQELQRARQQGIFISTSGDQ  102

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                           +  GA AFD+EYARW+EE ++   ELR AV+     +N+L+  VD+
Sbjct  103   AQ----------STSGNGALAFDMEYARWLEEHNKHVNELRAAVNA-HAGDNDLRGIVDS  151

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L  + AK+DV H++SGM  TP ERCF+W+GGFR S LLK++   LE +T+
Sbjct  152   IMAHYDEIFRLKGVAAKADVFHVLSGMWKTPAERCFMWLGGFRSSELLKLLAXHLEPLTD  211

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDAL--FYPS-NLPSCMTQMAAAI  370
             QQ +G+  L+QS+Q+AE+ALSQGME L  ++++ ++S +L    PS N+ + M QMA A+
Sbjct  212   QQLIGISNLQQSSQQAEDALSQGMEALQQSLAETLASGSLGPAGPSGNVANYMGQMAMAM  271

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L TL  F+RQADNLR+QT+Q++  ILT  Q AR  L ++D+F RLR LS+LWL RPR+
Sbjct  272   GKLGTLENFLRQADNLRLQTLQQMQRILTTRQSARALLAISDYFSRLRALSSLWLARPRE  331



>ref|XP_011007183.1| PREDICTED: transcription factor TGA2 isoform X1 [Populus euphratica]
 ref|XP_011007192.1| PREDICTED: transcription factor TGA2 isoform X1 [Populus euphratica]
Length=499

 Score =   285 bits (730),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 152/296 (51%), Positives = 198/296 (67%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLETSR+KL QLEQ +  A+ +G      G  
Sbjct  193   LDAKTLRRLAQNREAARKSRLRKKAYVQQLETSRIKLSQLEQDLQRARQQGLFFGGCGGA  252

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
              G     P          A FD+EYARW+E++HR   ELR  +    LS+ EL+  VD  
Sbjct  253   GGNISSGP----------AIFDMEYARWLEDDHRHMSELRTGLHS-HLSDGELRVIVDGY  301

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              +HY ++  L    AKSDV HL++GM  TP ERCF+W+GGFRPS L+K+++SQL+ +TEQ
Sbjct  302   MSHYDEIFRLKVEAAKSDVFHLITGMWSTPAERCFLWMGGFRPSELIKMLISQLDPLTEQ  361

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEALSQG+E L  ++ D I+   +         M QM  A+  L 
Sbjct  362   QIMGIYSLQQSSQQAEEALSQGLEQLQQSLVDTIAGGPVI------GGMQQMVVALGKLA  415

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L  ILTV QVARCFL++ +++ RLR LS+LW  RPR+
Sbjct  416   NLEGFVRQADNLRQQTLHQLRRILTVRQVARCFLVIGEYYRRLRALSSLWASRPRE  471



>ref|XP_009419683.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=457

 Score =   284 bits (727),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 152/301 (50%), Positives = 207/301 (69%), Gaps = 19/301 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+ 
Sbjct  170   LDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQKARQQGIFISNSGDQ  229

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                           +  GA  FDVEYARW+EE +R   ELR AV+    SEN+L+  VD 
Sbjct  230   SHA----------TSGNGALTFDVEYARWLEEHNRQISELRAAVN-AHASENDLRVIVDG  278

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L  + AK+DV H++SGM  TP ERCF+W+GGFR S LLK++ +QLE +TE
Sbjct  279   VMAHYDEIFRLKGIAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPLTE  338

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPS----NLPSCMTQMAAA  373
             QQ +G+  L+QS+Q+AE+ALSQGM+ L  ++S+ ++      PS    N+ + M QMA A
Sbjct  339   QQMMGICNLQQSSQQAEDALSQGMDALQQSLSETLAGS--LGPSGTSGNVANYMGQMAMA  396

Query  372   ITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
             +  L TL  F+ QADNLR QT+Q+++ ILT  Q AR  L ++D+F RLR LS+LWL RP+
Sbjct  397   MGKLGTLENFLHQADNLRQQTLQQMHRILTTRQSARALLAISDYFSRLRALSSLWLARPQ  456

Query  192   Q  190
             +
Sbjct  457   E  457



>ref|XP_004970302.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Setaria 
italica]
 ref|XP_004970303.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X2 [Setaria 
italica]
Length=473

 Score =   285 bits (728),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 150/300 (50%), Positives = 207/300 (69%), Gaps = 16/300 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAY+Q LE+SR+KL QLEQ++  A+ +G  I+     
Sbjct  185   LDQKTLRRLAQNREAARKSRLRKKAYIQNLESSRLKLTQLEQELQRARQQGIFIS-----  239

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                    P S    +  GA AFD+EYARW+EE ++   ELR AV+     +N+L+  VD+
Sbjct  240   --TSGDQPQS---TSGNGALAFDMEYARWLEEHNKHVNELRAAVNA-HAGDNDLRGIVDS  293

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L  + AK+DV H++SGM  TP ERCF+W+GGFR S LLK++  QLE +T+
Sbjct  294   IMAHYDEIFRLKGVAAKADVFHVLSGMWKTPAERCFMWLGGFRSSELLKLLAGQLEPLTD  353

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALF---YPSNLPSCMTQMAAAI  370
             QQ +G+  L+QS+Q+AE+ALSQGME L  ++++ ++S +L       N+ S M QMA A+
Sbjct  354   QQLVGISNLQQSSQQAEDALSQGMEALQQSLAETLASGSLGPAGSSGNVASYMGQMAMAM  413

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L TL  F+RQADNLR+QT+Q++  ILT  Q AR  L ++D+F RLR LS+LWL RPR+
Sbjct  414   GKLGTLENFLRQADNLRLQTLQQMQRILTTRQSARALLAISDYFSRLRALSSLWLARPRE  473



>ref|NP_001237963.1| bZIP transcription factor bZIP99 [Glycine max]
 gb|ABI34658.1| bZIP transcription factor bZIP99 [Glycine max]
Length=467

 Score =   284 bits (727),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 152/298 (51%), Positives = 205/298 (69%), Gaps = 16/298 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+  
Sbjct  180   DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQA  239

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA  FD EYARW+EE++R   ELR AV+    S+ EL+  VD  
Sbjct  240   HT----------LSGNGAMQFDAEYARWLEEQNRQINELRAAVNS-HASDTELRMIVDGI  288

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK+++SQLE +TEQ
Sbjct  289   LAHYDEIFRLKGVAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLVSQLEPLTEQ  348

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDA---LFYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AE+ALSQGME L  ++++ +S+ A        N+ S M QMA A+ 
Sbjct  349   QLMGITNLQQSSQQAEDALSQGMEALQQSLAETLSTGAPASSGSSGNVASYMGQMAMAMG  408

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
              L TL  F++QADNLR QT+Q+++ ILT  Q AR  L + D+  RLR LS+LWL RPR
Sbjct  409   KLGTLEGFIQQADNLRQQTLQQMHRILTTRQSARALLAIHDYISRLRALSSLWLARPR  466



>ref|XP_007028142.1| Transcription factor HBP-1b(c1) isoform 8 [Theobroma cacao]
 gb|EOY08644.1| Transcription factor HBP-1b(c1) isoform 8 [Theobroma cacao]
Length=306

 Score =   279 bits (713),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 151/299 (51%), Positives = 205/299 (69%), Gaps = 16/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             N +TLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+  
Sbjct  19    NQRTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQS  78

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA AFDVEYARW+EE +R   ELR AV+     + EL+  VD  
Sbjct  79    H----------SMSGNGALAFDVEYARWLEEHNRQINELRAAVNS-HAGDTELRTIVDNV  127

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AH+  +  L  + AK+DV H++SGM  TP ERCF+WIGGFR S LLK++ +QLE +TEQ
Sbjct  128   TAHFDDIFRLKGIAAKADVFHVLSGMWKTPAERCFLWIGGFRSSELLKLLANQLEPLTEQ  187

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPS---NLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AE+ALSQGME L  ++++ +++ +        N+ + M QMA A+ 
Sbjct  188   QFMGIHNLQQSSQQAEDALSQGMEALQQSLAETLTNGSPGPSGSSGNVANYMGQMAMAMG  247

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  FVRQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  248   KLGTLEGFVRQADNLRQQTLQQMHRILTTRQSARALLAINDYFSRLRALSSLWLARPRE  306



>gb|EYU45341.1| hypothetical protein MIMGU_mgv1a009902mg [Erythranthe guttata]
Length=328

 Score =   280 bits (715),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 152/298 (51%), Positives = 203/298 (68%), Gaps = 15/298 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SRMKL QLEQ++  A+ +G  I+ +G+  
Sbjct  42    DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISSSGDQS  101

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                             GA AFDVEYARW+EE +R   ELR AV+     + EL+  VD  
Sbjct  102   QSA----------GGNGALAFDVEYARWLEEHNRRINELRGAVNS-HAGDGELRIIVDGI  150

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  +  + A  AK+DV H++SGM  TP ERCF+W+GGFR S LLK++++QLE +TEQ
Sbjct  151   IAHYEDIFRIKADAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQ  210

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPS--NLPSCMTQMAAAITN  364
             Q L +  L+QS+Q+AE+ALSQGME L  ++++ ++       S  N+ + M QMA A+  
Sbjct  211   QLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGK  270

Query  363   LYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
             L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L ++D+F RLR LS+LWL RPR+
Sbjct  271   LGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAISDYFSRLRALSSLWLARPRE  328



>ref|XP_008231625.1| PREDICTED: transcription factor TGA2-like [Prunus mume]
Length=333

 Score =   280 bits (716),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 151/299 (51%), Positives = 204/299 (68%), Gaps = 16/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+  
Sbjct  46    DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDAA  105

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA AFDVEY RW EE++R   ELR AV+    S+ EL+  VD  
Sbjct  106   HS----------MSGNGAMAFDVEYGRWQEEQNRQINELRSAVNS-HASDAELRTIVDGI  154

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L    AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++++QLE +TEQ
Sbjct  155   LAHYDEIFRLKGTAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQ  214

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDI---ISSDALFYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AE+ALSQGM+ L  ++++     S  +     N+ + M QMA A+ 
Sbjct  215   QLVGITNLQQSSQQAEDALSQGMDALQQSLAETLSSGSLGSSGSSGNVANYMGQMAMAMG  274

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  275   KLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAINDYFSRLRALSSLWLARPRE  333



>ref|XP_010557921.1| PREDICTED: transcription factor TGA6 [Tarenaya hassleriana]
 ref|XP_010557923.1| PREDICTED: transcription factor TGA6 [Tarenaya hassleriana]
 ref|XP_010557924.1| PREDICTED: transcription factor TGA6 [Tarenaya hassleriana]
Length=331

 Score =   280 bits (715),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 149/300 (50%), Positives = 207/300 (69%), Gaps = 16/300 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAYVQQLE SR+KL QLEQ++  A+ +G  I+ +G+ 
Sbjct  43    LDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSGDQ  102

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                           +  GA AFDVEY+RW EE++R   ELR A++    S+ EL+  VD 
Sbjct  103   AHS----------TSGNGAMAFDVEYSRWQEEKNRQMNELRSALN-AHASDAELRIIVDG  151

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  + +  +K+DV HL+SG+  TP ERCF+W+GGFR S LLK++ +QLE +TE
Sbjct  152   VMAHYEELFRIKSNASKNDVFHLLSGLWKTPAERCFLWLGGFRSSELLKLVANQLEPLTE  211

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPS---NLPSCMTQMAAAI  370
             QQ++G+I L+QS+Q+AE+ALSQGME L  ++++ +S+  L       N+ + M QMA A+
Sbjct  212   QQSIGIINLQQSSQQAEDALSQGMEALQQSLAETLSNGTLGSSGSSGNVANYMGQMAMAM  271

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L TL  F+RQADNLR+QT+Q++  ILT  Q AR    + ++F RLR LS+LWL RPR+
Sbjct  272   GKLGTLEGFIRQADNLRLQTLQQMLRILTTRQSARALQAIHEYFSRLRALSSLWLARPRE  331



>ref|XP_004142384.1| PREDICTED: transcription factor HBP-1b(c1)-like [Cucumis sativus]
Length=331

 Score =   280 bits (715),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 206/299 (69%), Gaps = 16/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+  
Sbjct  44    DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQA  103

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         +   GA AFDVEYARW+EE+++   ELR AV+    S+ EL+  VD  
Sbjct  104   HS----------MAGNGAMAFDVEYARWLEEQNKQINELRAAVNS-HASDTELRMIVDGI  152

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++++QLE +TEQ
Sbjct  153   LAHYDEVFRLKGVAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQ  212

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISD---IISSDALFYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+ E+ALSQGME L  ++++     S  +     N+ + M QMA A+ 
Sbjct  213   QLMGISNLQQSSQQTEDALSQGMEALQQSLAETLSSGSLGSSNTSGNVANYMGQMATAMG  272

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+++ ILT+ Q AR  L + D+F RLR LS+LWL RP++
Sbjct  273   KLGTLEGFIRQADNLRQQTLQQMHRILTIRQSARALLAIHDYFSRLRALSSLWLARPKE  331



>ref|XP_003546706.1| PREDICTED: transcription factor HBP-1b(c1) isoform X1 [Glycine 
max]
 ref|XP_006598095.1| PREDICTED: transcription factor HBP-1b(c1) isoform X3 [Glycine 
max]
 gb|KHN35294.1| TGACG-sequence-specific DNA-binding protein TGA-2.1 [Glycine 
soja]
Length=468

 Score =   284 bits (727),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 151/298 (51%), Positives = 205/298 (69%), Gaps = 16/298 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+  G  I+ +G+  
Sbjct  181   DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQHGIFISSSGDQA  240

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA  FD EYARW+EE++R   EL+ AV+    S+ EL+  VD  
Sbjct  241   HT----------LSGNGAMQFDAEYARWLEEQNRQINELKAAVNS-HASDTELRMIVDGI  289

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK+++SQLE +TEQ
Sbjct  290   LAHYDEIFRLKGVAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLVSQLEPLTEQ  349

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDA---LFYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AE+ALSQGME L  ++++ +S+ A        N+ + M QMA A+ 
Sbjct  350   QLMGITNLQQSSQQAEDALSQGMEALQQSLAETLSTGAPASSGSSGNVANYMGQMAMAMG  409

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
              L TL  F++QADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR
Sbjct  410   KLGTLEGFIQQADNLRQQTLQQMHRILTTRQSARALLAIHDYFSRLRALSSLWLARPR  467



>ref|XP_008391112.1| PREDICTED: transcription factor TGA2-like isoform X3 [Malus domestica]
Length=513

 Score =   285 bits (730),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 147/296 (50%), Positives = 203/296 (69%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKK+YVQQLE+SR+KL QLEQ++  A+A+G  +   G  
Sbjct  207   LDAKTLRRLAQNREAARKSRLRKKSYVQQLESSRIKLTQLEQELHRARAQGLFLGGAG--  264

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                       L  I+   A FD+EY RW+E++HR   E R  + +  LS+++L+  VD  
Sbjct  265   --------GGLGNISSGAAIFDMEYGRWLEDDHRHMSEFRTGL-QAHLSDSDLRLSVDGY  315

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              +HY ++  L  + AKSDV HL++GM  TP ERCF+W+GGFRPS L+K+++ QL+ +TEQ
Sbjct  316   ISHYDELFQLKGVAAKSDVFHLITGMWTTPAERCFLWMGGFRPSELIKMLIGQLDPLTEQ  375

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEAL+QG+E LH ++ D I+   +         M QMA A+  L 
Sbjct  376   QFMGIYNLQQSSQQAEEALTQGLEQLHQSLVDTIAGGPVI------DGMQQMAVALGKLT  429

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  430   NLEGFVRQADNLRQQTLHQLRRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  485



>ref|XP_008350323.1| PREDICTED: transcription factor HBP-1b(c38)-like [Malus domestica]
 ref|XP_008350324.1| PREDICTED: transcription factor HBP-1b(c38)-like [Malus domestica]
Length=452

 Score =   283 bits (725),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 203/299 (68%), Gaps = 16/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+  
Sbjct  165   DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQS  224

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA AFDVEYARW+EE +R   ELR AV+     + EL+  +D  
Sbjct  225   HS----------MSGNGALAFDVEYARWLEEHNRQINELRAAVNS-HAGDTELRTVIDNV  273

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  +  L    AK+DV H++SGM  TP ERCF+WIGGFR S LLK+++SQLE +TEQ
Sbjct  274   IAHYNDIFRLKGTAAKADVFHILSGMWKTPAERCFMWIGGFRSSELLKLLVSQLEPLTEQ  333

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDII---SSDALFYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AE+ALSQGME L  ++S+ +   S        N+ + M QMA A+ 
Sbjct  334   QLVGIYNLQQSSQQAEDALSQGMEALQQSLSETLASGSPAPSGSSGNVANYMGQMAMAMG  393

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  394   KLGTLDGFLRQADNLRQQTLQQMHRILTTRQSARALLAINDYFSRLRALSSLWLARPRE  452



>gb|KDO57728.1| hypothetical protein CISIN_1g038233mg, partial [Citrus sinensis]
Length=332

 Score =   280 bits (715),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 143/247 (58%), Positives = 185/247 (75%), Gaps = 5/247 (2%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G        ++
Sbjct  90    DPKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLTQLEQELQRARTQGMFFG---GIL  146

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
             G   G P+ ++ I+ E A FD+EYARW+E  HR+ CELR AV E  L ENEL+ YVD C 
Sbjct  147   GGEQGLPVGISNISSEAAVFDMEYARWLEVHHRLMCELRAAVQE-HLPENELRLYVDNCL  205

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY ++ +L  M+AK+DV HLVSG+  +P ERCF+W+GGFRPS L+KVI+SQ+E +TEQQ
Sbjct  206   AHYDEIMNLKGMVAKTDVFHLVSGLWKSPAERCFLWLGGFRPSELIKVILSQIEPLTEQQ  265

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              LG+ GL+QSTQEAE+ALSQG+E L+ +I D I+SD+L  P N+ + M QMA A+  L T
Sbjct  266   ILGICGLQQSTQEAEDALSQGLEALNQSILDTIASDSLSCPPNMANYMGQMAVAMNKLST  325

Query  354   LHTFVRQ  334
             L  FVRQ
Sbjct  326   LEGFVRQ  332



>ref|XP_008787868.1| PREDICTED: transcription factor TGA6-like isoform X1 [Phoenix 
dactylifera]
Length=490

 Score =   285 bits (728),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 143/295 (48%), Positives = 205/295 (69%), Gaps = 13/295 (4%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AK+LRRLAQNREAARK R+RKKAY+QQLE+SR+KL QLEQ +  A+++G  +      
Sbjct  174   LDAKSLRRLAQNREAARKSRLRKKAYIQQLESSRIKLTQLEQDLQRARSQGLFLGGG---  230

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                      +   I+   A FD+EY RW++E +R   +LR+ + +  LS+ +L+  VD C
Sbjct  231   --------GAGGNISSAAAVFDMEYGRWLDENYRHMTDLREGL-QAHLSDGDLRVIVDEC  281

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  +  + AKSDVLHL++GM  TP ERCF+W+GGFRPS LLK+++ Q++ +TEQ
Sbjct  282   LAHYDEIFRVKGVAAKSDVLHLITGMWTTPAERCFLWMGGFRPSELLKILIPQMDPLTEQ  341

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEALSQG+E LH ++ D ++S +L   +++ + M Q+A A+  L 
Sbjct  342   QLVGICSLQQSSQQAEEALSQGLEQLHQSLGDAVASGSLSEGTDVGNYMGQIAIALGKLA  401

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
              L  FVRQADN+R QT+ +   ILTV Q ARCFL + ++  RLR LS+LW  RPR
Sbjct  402   DLEGFVRQADNMRQQTLHQTRRILTVRQAARCFLAIGEYNSRLRALSSLWASRPR  456



>ref|XP_011007200.1| PREDICTED: transcription factor TGA2 isoform X2 [Populus euphratica]
Length=498

 Score =   285 bits (728),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 152/296 (51%), Positives = 198/296 (67%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLETSR+KL QLEQ +  A+ +G      G  
Sbjct  192   LDAKTLRRLAQNREAARKSRLRKKAYVQQLETSRIKLSQLEQDLQRARQQGLFFGGCGGA  251

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
              G     P          A FD+EYARW+E++HR   ELR  +    LS+ EL+  VD  
Sbjct  252   GGNISSGP----------AIFDMEYARWLEDDHRHMSELRTGLHS-HLSDGELRVIVDGY  300

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              +HY ++  L    AKSDV HL++GM  TP ERCF+W+GGFRPS L+K+++SQL+ +TEQ
Sbjct  301   MSHYDEIFRLKVEAAKSDVFHLITGMWSTPAERCFLWMGGFRPSELIKMLISQLDPLTEQ  360

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEALSQG+E L  ++ D I+   +         M QM  A+  L 
Sbjct  361   QIMGIYSLQQSSQQAEEALSQGLEQLQQSLVDTIAGGPVI------GGMQQMVVALGKLA  414

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L  ILTV QVARCFL++ +++ RLR LS+LW  RPR+
Sbjct  415   NLEGFVRQADNLRQQTLHQLRRILTVRQVARCFLVIGEYYRRLRALSSLWASRPRE  470



>ref|XP_004303596.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Fragaria vesca subsp. vesca]
Length=451

 Score =   283 bits (724),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 204/299 (68%), Gaps = 16/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+  
Sbjct  164   DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQA  223

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA AFDVEYARW+EE ++   ELR AV+     + EL+  +D  
Sbjct  224   H----------SMSGNGALAFDVEYARWLEEHNKQINELRAAVNS-HAGDTELRTVIDNV  272

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  +  +    AK+DV H++SGM  TP ERCF+WIGGFR S LLK+++ QLE +TEQ
Sbjct  273   IAHYDDIFRIKGTAAKADVFHILSGMWKTPAERCFMWIGGFRSSELLKLLVRQLEPLTEQ  332

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDA---LFYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AE+ALSQGME L  ++S+ ++S +        N+ + M QMA A+ 
Sbjct  333   QVMGIYNLQQSSQQAEDALSQGMEALQQSLSETLASGSPGPSGTSGNVANYMGQMAMAMG  392

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  393   KLGTLEGFLRQADNLRQQTLQQMHRILTTRQSARALLAINDYFSRLRALSSLWLARPRE  451



>ref|XP_006594375.1| PREDICTED: transcription factor HBP-1b(c1) isoform X1 [Glycine 
max]
 ref|XP_006594376.1| PREDICTED: transcription factor HBP-1b(c1) isoform X2 [Glycine 
max]
Length=469

 Score =   284 bits (726),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 152/298 (51%), Positives = 205/298 (69%), Gaps = 16/298 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+  
Sbjct  182   DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQA  241

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA  FD EYARW+EE++R   ELR AV+    S+ EL+  VD  
Sbjct  242   HT----------LSGNGAMQFDAEYARWLEEQNRQINELRAAVNS-HASDTELRMIVDGI  290

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK+++SQLE +TEQ
Sbjct  291   LAHYDEIFRLKGVAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLVSQLEPLTEQ  350

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDA---LFYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AE+ALSQGME L  ++++ +S+ A        N+ S M QMA A+ 
Sbjct  351   QLMGITNLQQSSQQAEDALSQGMEALQQSLAETLSTGAPASSGSSGNVASYMGQMAMAMG  410

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
              L TL  F++QADNLR QT+Q+++ ILT  Q AR  L + D+  RLR LS+LWL RPR
Sbjct  411   KLGTLEGFIQQADNLRQQTLQQMHRILTTRQSARALLAIHDYISRLRALSSLWLARPR  468



>ref|XP_010659087.1| PREDICTED: transcription factor TGA2 isoform X1 [Vitis vinifera]
 ref|XP_010659088.1| PREDICTED: transcription factor TGA2 isoform X1 [Vitis vinifera]
 ref|XP_010659089.1| PREDICTED: transcription factor TGA2 isoform X1 [Vitis vinifera]
 ref|XP_010659090.1| PREDICTED: transcription factor TGA2 isoform X1 [Vitis vinifera]
 ref|XP_010659091.1| PREDICTED: transcription factor TGA2 isoform X1 [Vitis vinifera]
 ref|XP_010659092.1| PREDICTED: transcription factor TGA2 isoform X1 [Vitis vinifera]
 ref|XP_010659093.1| PREDICTED: transcription factor TGA2 isoform X1 [Vitis vinifera]
Length=473

 Score =   284 bits (726),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 155/299 (52%), Positives = 206/299 (69%), Gaps = 16/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SRMKL QLEQ++  A+ +G  I+ +G+  
Sbjct  186   DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISSSGDQA  245

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA AFDVEYARW+EE++R   ELR AV+    S+ EL+  VD  
Sbjct  246   H----------SMSGNGAMAFDVEYARWLEEQNRQINELRSAVNS-HASDAELRVIVDNI  294

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  +  L  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++++QLE +TEQ
Sbjct  295   MAHYDDIFRLKGVAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQ  354

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDI---ISSDALFYPSNLPSCMTQMAAAIT  367
             Q LG+  L+QS+Q+AE+ALSQGME L  ++++     S  +     N+ + M QMA A+ 
Sbjct  355   QLLGIGNLQQSSQQAEDALSQGMEALQQSLAETLSSGSLGSSGSSGNVANYMGQMAMAMG  414

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  415   KLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAIHDYFSRLRALSSLWLARPRE  473



>ref|XP_007028137.1| Transcription factor HBP-1b(c1) isoform 3 [Theobroma cacao]
 ref|XP_007028138.1| Transcription factor HBP-1b(c1) isoform 3 [Theobroma cacao]
 ref|XP_007028141.1| Transcription factor HBP-1b(c1) isoform 3 [Theobroma cacao]
 gb|EOY08639.1| Transcription factor HBP-1b(c1) isoform 3 [Theobroma cacao]
 gb|EOY08640.1| Transcription factor HBP-1b(c1) isoform 3 [Theobroma cacao]
 gb|EOY08643.1| Transcription factor HBP-1b(c1) isoform 3 [Theobroma cacao]
Length=331

 Score =   279 bits (714),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 151/299 (51%), Positives = 205/299 (69%), Gaps = 16/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+  
Sbjct  44    DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQS  103

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA AFDVEYARW+EE +R   ELR AV+     + EL+  VD  
Sbjct  104   HS----------MSGNGALAFDVEYARWLEEHNRQINELRAAVNS-HAGDTELRTIVDNV  152

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AH+  +  L  + AK+DV H++SGM  TP ERCF+WIGGFR S LLK++ +QLE +TEQ
Sbjct  153   TAHFDDIFRLKGIAAKADVFHVLSGMWKTPAERCFLWIGGFRSSELLKLLANQLEPLTEQ  212

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPS---NLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AE+ALSQGME L  ++++ +++ +        N+ + M QMA A+ 
Sbjct  213   QFMGIHNLQQSSQQAEDALSQGMEALQQSLAETLTNGSPGPSGSSGNVANYMGQMAMAMG  272

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  FVRQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  273   KLGTLEGFVRQADNLRQQTLQQMHRILTTRQSARALLAINDYFSRLRALSSLWLARPRE  331



>ref|XP_002263159.2| PREDICTED: transcription factor TGA2 isoform X2 [Vitis vinifera]
 emb|CBI35106.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   284 bits (726),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 155/299 (52%), Positives = 206/299 (69%), Gaps = 16/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SRMKL QLEQ++  A+ +G  I+ +G+  
Sbjct  182   DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISSSGDQA  241

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA AFDVEYARW+EE++R   ELR AV+    S+ EL+  VD  
Sbjct  242   H----------SMSGNGAMAFDVEYARWLEEQNRQINELRSAVNS-HASDAELRVIVDNI  290

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  +  L  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++++QLE +TEQ
Sbjct  291   MAHYDDIFRLKGVAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQ  350

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDI---ISSDALFYPSNLPSCMTQMAAAIT  367
             Q LG+  L+QS+Q+AE+ALSQGME L  ++++     S  +     N+ + M QMA A+ 
Sbjct  351   QLLGIGNLQQSSQQAEDALSQGMEALQQSLAETLSSGSLGSSGSSGNVANYMGQMAMAMG  410

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  411   KLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAIHDYFSRLRALSSLWLARPRE  469



>ref|XP_009627416.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nicotiana tomentosiformis]
 ref|XP_009627417.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nicotiana tomentosiformis]
Length=327

 Score =   279 bits (713),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/297 (50%), Positives = 202/297 (68%), Gaps = 13/297 (4%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SRMKL QLEQ++  A+ +G  I+ +G+  
Sbjct  41    DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISSSGDQ-  99

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
                     S +K      AFDVEYARW+EE +R   ELR AV      + EL+  VD   
Sbjct  100   --------SQSKTGNGALAFDVEYARWLEEHNRRITELRGAVSS-HAGDGELRIIVDGIL  150

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY  +  +    AK+DV H++SGM  TP ERCF+W+GGFR S LLK++++QLE +TEQQ
Sbjct  151   AHYDDIFRIKGDAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQ  210

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPS--NLPSCMTQMAAAITNL  361
              L +  L++S+Q+AE+ALSQGME L  ++++ ++       S  N+ + M QMA A+  L
Sbjct  211   LLAINNLQESSQQAEDALSQGMEALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKL  270

Query  360   YTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              TL  F+RQADNLR QT+Q+++ +LT  Q AR  L ++D+F RLR LS+LWL RPR+
Sbjct  271   GTLEGFIRQADNLRQQTLQQMHRVLTTRQSARALLAISDYFSRLRALSSLWLARPRE  327



>ref|XP_009803516.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009803517.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Nicotiana 
sylvestris]
Length=327

 Score =   279 bits (713),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/297 (50%), Positives = 202/297 (68%), Gaps = 13/297 (4%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SRMKL QLEQ++  A+ +G  I+ +G+  
Sbjct  41    DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISSSGDQ-  99

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
                     S +K      AFDVEYARW+EE +R   ELR AV      + EL+  VD   
Sbjct  100   --------SQSKTGNGALAFDVEYARWLEEHNRRITELRGAVSS-HAGDGELRIIVDGIL  150

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY  +  +    AK+DV H++SGM  TP ERCF+W+GGFR S LLK++++QLE +TEQQ
Sbjct  151   AHYDDIFRIKGDAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQ  210

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPS--NLPSCMTQMAAAITNL  361
              L +  L++S+Q+AE+ALSQGME L  ++++ ++       S  N+ + M QMA A+  L
Sbjct  211   LLAINNLQESSQQAEDALSQGMEALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKL  270

Query  360   YTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              TL  F+RQADNLR QT+Q+++ +LT  Q AR  L ++D+F RLR LS+LWL RPR+
Sbjct  271   GTLEGFIRQADNLRQQTLQQMHRVLTTRQSARALLAISDYFSRLRALSSLWLARPRE  327



>gb|AAT28675.1| bZIP transcription factor [Oryza sativa Japonica Group]
Length=473

 Score =   284 bits (726),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 148/300 (49%), Positives = 206/300 (69%), Gaps = 16/300 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAY+Q LE+SR+KL Q+EQ++  A+ +G  I+ + + 
Sbjct  185   LDHKTLRRLAQNREAARKSRLRKKAYIQNLESSRLKLTQIEQELQRARQQGIFISTSSDQ  244

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                           +  GA AFD+EYARW+EE ++   ELR AV+     +N+LK  VD+
Sbjct  245   SHSA----------SGNGALAFDMEYARWLEEHNKHINELRAAVNA-HAGDNDLKSTVDS  293

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L  + AK+DV H++SGM  TP ERCF+W+GGFR S LLK++  QLE +TE
Sbjct  294   IMAHYNEIFKLKGVAAKADVFHVLSGMWKTPAERCFMWLGGFRSSELLKLLAGQLEPLTE  353

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDAL---FYPSNLPSCMTQMAAAI  370
             QQ  G+  L+QS+Q+AE+ALSQGME L  ++++ ++S +L       N+ + M QMA A+
Sbjct  354   QQLAGIANLQQSSQQAEDALSQGMEALQQSLAETLASGSLGPAGSSGNVANYMGQMAMAM  413

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L TL  F+RQADNLR+QT+Q++  ILT  Q AR  L ++D+F RLR LS+LWL RPR+
Sbjct  414   GKLGTLENFLRQADNLRLQTLQQMQRILTTRQSARALLAISDYFSRLRALSSLWLARPRE  473



>gb|EPS67211.1| hypothetical protein M569_07557, partial [Genlisea aurea]
Length=324

 Score =   279 bits (713),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/300 (50%), Positives = 201/300 (67%), Gaps = 19/300 (6%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SRMKL QLEQ++  A+ +G   + +G+  
Sbjct  38    DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRMKLTQLEQELQRARQQGIFTSSSGDQA  97

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         +   GA AFDVEY RW+E+ +R   ELR AV+     + EL+  VD  
Sbjct  98    QA----------VGGNGALAFDVEYGRWLEDHNRRINELRGAVNS-QAGDGELRMIVDGI  146

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
               HY ++  +    AKSDV H++SGM  TP ERCF+W+GGFR S L+K++MSQLE +T+Q
Sbjct  147   LTHYEEIFRIKGEAAKSDVFHVLSGMWKTPAERCFLWLGGFRSSELIKLLMSQLEPLTDQ  206

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPS----NLPSCMTQMAAAI  370
             Q L +  L+QS+QEAE+ALSQGME L  +++D ++      PS    N+ + M QMA A+
Sbjct  207   QVLAINNLQQSSQEAEDALSQGMEALQQSLADTLAGS--LGPSGSSVNVANYMGQMAMAM  264

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L TL  F+RQAD+LR  T+Q+L+ +LT  Q AR  L ++D+F RLR LS+LWL RPR+
Sbjct  265   GKLGTLEGFIRQADHLRRGTLQQLHRVLTTRQSARALLAMSDYFSRLRALSSLWLARPRE  324



>gb|KGN52332.1| hypothetical protein Csa_5G624430 [Cucumis sativus]
Length=348

 Score =   280 bits (715),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 206/299 (69%), Gaps = 16/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+  
Sbjct  61    DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQA  120

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         +   GA AFDVEYARW+EE+++   ELR AV+    S+ EL+  VD  
Sbjct  121   HS----------MAGNGAMAFDVEYARWLEEQNKQINELRAAVNS-HASDTELRMIVDGI  169

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++++QLE +TEQ
Sbjct  170   LAHYDEVFRLKGVAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQ  229

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISD---IISSDALFYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+ E+ALSQGME L  ++++     S  +     N+ + M QMA A+ 
Sbjct  230   QLMGISNLQQSSQQTEDALSQGMEALQQSLAETLSSGSLGSSNTSGNVANYMGQMATAMG  289

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+++ ILT+ Q AR  L + D+F RLR LS+LWL RP++
Sbjct  290   KLGTLEGFIRQADNLRQQTLQQMHRILTIRQSARALLAIHDYFSRLRALSSLWLARPKE  348



>ref|XP_008804825.1| PREDICTED: transcription factor TGA2 [Phoenix dactylifera]
Length=325

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 206/308 (67%), Gaps = 17/308 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLE+SR++L QLEQ++  A+++G  +      
Sbjct  13    LDAKTLRRLAQNREAARKSRLRKKAYVQQLESSRIRLQQLEQELQRARSQGLFLGGGSAS  72

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                          ++   A FD+EYARW+++  +   ELR  + +  L +  L   VD C
Sbjct  73    -----------GDLSSGAAMFDMEYARWLDDNSKHMSELRGGL-QAHLPDGNLAVIVDEC  120

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AKSDV HL++GM  TP ERCF+W+GGF+PS LLK++M QL+ +TEQ
Sbjct  121   IAHYDELFRLKGVAAKSDVFHLLTGMWATPAERCFLWMGGFKPSELLKILMPQLDPLTEQ  180

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEALSQG+E LH +++D ++  +L   +++ + M  MA A+  L 
Sbjct  181   QLMGICNLQQSSQQAEEALSQGLEQLHQSLADTVAGGSLSDGADITNYMGHMAIALGKLA  240

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD*SW  178
              L  F++QADNLR QTI ++  ILT+ Q ARCFL + +++ RLR LS+ W  RP++    
Sbjct  241   NLEGFIQQADNLRQQTIHQMRRILTIRQAARCFLAIGEYYSRLRALSSFWSSRPQE----  296

Query  177   NVPPTKST  154
             N+ P +S 
Sbjct  297   NLIPNESV  304



>gb|EEC71673.1| hypothetical protein OsI_04142 [Oryza sativa Indica Group]
Length=473

 Score =   283 bits (725),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 148/300 (49%), Positives = 206/300 (69%), Gaps = 16/300 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAY+Q LE+SR+KL Q+EQ++  A+ +G  I+ + + 
Sbjct  185   LDHKTLRRLAQNREAARKSRLRKKAYIQNLESSRLKLTQIEQELQRARQQGIFISTSSDQ  244

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                           +  GA AFD+EYARW+EE ++   ELR AV+     +N+LK  VD+
Sbjct  245   SHSA----------SGNGALAFDMEYARWLEEHNKHINELRAAVNA-HAGDNDLKSTVDS  293

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L  + AK+DV H++SGM  TP ERCF+W+GGFR S LLK++  QLE +TE
Sbjct  294   IMAHYNEIFKLKGVAAKADVFHVLSGMWKTPAERCFMWLGGFRSSELLKLLAGQLEPLTE  353

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDAL---FYPSNLPSCMTQMAAAI  370
             QQ  G+  L+QS+Q+AE+ALSQGME L  ++++ ++S +L       N+ + M QMA A+
Sbjct  354   QQLAGIANLQQSSQQAEDALSQGMEALQQSLAETLASGSLGPAGSSGNVANYMGQMAMAM  413

Query  369   TNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
               L TL  F+RQADNLR+QT+Q++  ILT  Q AR  L ++D+F RLR LS+LWL RPR+
Sbjct  414   GKLGTLENFLRQADNLRLQTLQQMQRILTTRQSARALLAISDYFSRLRALSSLWLARPRE  473



>ref|XP_009338082.1| PREDICTED: transcription factor HBP-1b(c38)-like [Pyrus x bretschneideri]
Length=452

 Score =   283 bits (723),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 202/299 (68%), Gaps = 16/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+  
Sbjct  165   DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQS  224

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         +   GA AFDVEYARW+EE +R   ELR AV+     + EL+  +D  
Sbjct  225   HS----------MNGNGALAFDVEYARWLEEHNRQINELRAAVNS-HAGDTELRTVIDNV  273

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  +  L    AK+DV H++SGM  TP ERCF+WIGGFR S LLK+++SQLE +TEQ
Sbjct  274   IAHYDDIFRLKGTAAKADVFHILSGMWKTPAERCFMWIGGFRSSELLKLLVSQLEPLTEQ  333

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDII---SSDALFYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AE+ALSQGME L  ++S+ +   S        N+ + M QMA A+ 
Sbjct  334   QLVGIYNLQQSSQQAEDALSQGMEALQQSLSETLASGSPAPSGSSGNVANYMGQMAMAMG  393

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  394   KLGTLDGFLRQADNLRQQTLQQMHRILTTRQSARALLAINDYFSRLRALSSLWLARPRE  452



>ref|XP_006855016.1| hypothetical protein AMTR_s00031p00017860 [Amborella trichopoda]
 gb|ERN16483.1| hypothetical protein AMTR_s00031p00017860 [Amborella trichopoda]
Length=473

 Score =   283 bits (724),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/299 (49%), Positives = 203/299 (68%), Gaps = 16/299 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAA+K R+RKKAYVQQLE+S++KL QLEQ +  A+A+G  I   G  
Sbjct  187   LDAKTLRRLAQNREAAKKSRLRKKAYVQQLESSKIKLTQLEQDLQRARAQGLFIAGAGGG  246

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                        + ++   A FD+E+ARWIEE  R   ELR  ++   L + +L+  +D C
Sbjct  247   -----------SNVSSGAAIFDMEHARWIEENQRHMAELRAGLN-AHLPDTDLRLILDGC  294

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
               HY ++  L  + AK+DV H+ SG+  TP ERCF+W+GGF+PS LLK+++ QLE +TEQ
Sbjct  295   LGHYDEIFRLKGIAAKADVFHVFSGLWLTPAERCFLWMGGFKPSELLKILVPQLEPLTEQ  354

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISD-IISSDALFYPSN--LPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AEEALSQG+E LH +++D ++   +L  P N  + + M  MA A+ 
Sbjct  355   QFIGICNLQQSSQQAEEALSQGLEALHQSLADTVVGGGSLGDPPNHHVTNYMAHMAIALA  414

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  L +FVRQADNLR QT+ +L  ILTV Q  RCFL + +++ RLR LS+LW  RPR+
Sbjct  415   RLANLESFVRQADNLRQQTLHQLRRILTVRQAVRCFLAIGEYYSRLRALSSLWASRPRE  473



>ref|XP_008446973.1| PREDICTED: transcription factor TGA2-like isoform X1 [Cucumis 
melo]
 ref|XP_008446975.1| PREDICTED: transcription factor TGA2-like isoform X1 [Cucumis 
melo]
 ref|XP_008446976.1| PREDICTED: transcription factor TGA2-like isoform X1 [Cucumis 
melo]
Length=331

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 205/299 (69%), Gaps = 16/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+  
Sbjct  44    DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQA  103

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         +   GA AFDVEYARW+EE+++   ELR AV+    S+ EL+  VD  
Sbjct  104   HS----------MAGNGAMAFDVEYARWLEEQNKQINELRAAVNS-HASDTELRMIVDGI  152

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++++QLE +TEQ
Sbjct  153   LAHYDEVFRLKGVAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQ  212

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISD---IISSDALFYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+ E+ALSQGME L  ++++     S  +     N+ + M QMA A+ 
Sbjct  213   QLMGISNLQQSSQQTEDALSQGMEALQQSLAETLSSGSLGSSNTSGNVANYMGQMATAMG  272

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RP++
Sbjct  273   KLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAIHDYFSRLRALSSLWLARPKE  331



>ref|XP_008228573.1| PREDICTED: transcription factor TGA2 isoform X2 [Prunus mume]
Length=515

 Score =   284 bits (727),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/293 (51%), Positives = 201/293 (69%), Gaps = 18/293 (6%)
 Frame = -2

Query  1065  KTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvvgv  886
             KTLRRLAQNREAARK R+RKKAYVQQLETSR+KL QLEQ +  A+A+G  +   G     
Sbjct  212   KTLRRLAQNREAARKSRLRKKAYVQQLETSRIKLTQLEQDLQRARAQGLFLGGCG-----  266

Query  885   ghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFAH  706
                    L  I+   A FD+EYARW+E++HR   ELR  + +  LS+++L+  VD   +H
Sbjct  267   -----GGLGNISSGAAIFDMEYARWLEDDHRHMSELRTGL-QAHLSDSDLRVIVDGYISH  320

Query  705   YAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQAL  529
             Y ++  L  + AKSDV HL++GM  TP ERCF+W+GGFRPS L+K++ +QL+ +TEQQ +
Sbjct  321   YDEIFQLKGVAAKSDVFHLITGMWTTPAERCFLWMGGFRPSELIKMLTAQLDPLTEQQFM  380

Query  528   GMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYTLH  349
             G+  L+QS+Q+AEEAL+QG+E LH ++ D I+   +         M QMA A+  L  L 
Sbjct  381   GIYSLQQSSQQAEEALTQGLEQLHQSLVDTIAGGPVI------DGMQQMAVALGKLTNLE  434

Query  348   TFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              FVRQADNLR QT+ +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  435   GFVRQADNLRQQTLHQLRRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  487



>ref|XP_010095986.1| Transcription factor HBP-1b(c1) [Morus notabilis]
 gb|EXB62679.1| Transcription factor HBP-1b(c1) [Morus notabilis]
Length=386

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 206/299 (69%), Gaps = 16/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+  G+  
Sbjct  99    DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSAGDQA  158

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA AFDVEYARW+EE++R   ELR AV+    S+ EL+  +D  
Sbjct  159   H----------SMSGNGAMAFDVEYARWLEEQNRQINELRSAVNS-HASDTELRIIIDGI  207

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++++QLE +TEQ
Sbjct  208   LAHYDEIFRLKGIAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQ  267

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDI---ISSDALFYPSNLPSCMTQMAAAIT  367
             Q LG+  L+QS+Q+AE+ALSQGME L  ++++     S  +     N+ + M QMA A+ 
Sbjct  268   QLLGITNLQQSSQQAEDALSQGMEALQQSLAETLSNGSLGSSGSSGNVANYMGQMAMAMG  327

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  328   KLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAIHDYFSRLRALSSLWLARPRE  386



>ref|XP_006424250.1| hypothetical protein CICLE_v100284281mg, partial [Citrus clementina]
 gb|ESR37490.1| hypothetical protein CICLE_v100284281mg, partial [Citrus clementina]
Length=432

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/296 (50%), Positives = 203/296 (69%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLETSR+KL QLEQ++  A+++G  +      
Sbjct  126   LDAKTLRRLAQNREAARKSRLRKKAYVQQLETSRIKLNQLEQELQRARSQGLFLG-----  180

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                  G  ++   I+   A FD+EYARW+E++ R   ELR  +++   S+ +L+  VDA 
Sbjct  181   -----GCGVAAGNISSGAAIFDMEYARWLEDDQRHISELRSGLNQ-HYSDGDLRIIVDAY  234

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              +HY ++  L  + AKSDV HL++GM  T  ERCF+W+GGFRPS L+K+++SQL+ +TEQ
Sbjct  235   ISHYDEIFRLKGVAAKSDVFHLITGMWTTSAERCFLWMGGFRPSELIKMLISQLDPLTEQ  294

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QSTQ+AEEALSQG+E L  ++ + I+         +   M QM  A+  L 
Sbjct  295   QVMGIYSLQQSTQQAEEALSQGLEQLQQSLIETIAGGP------VDDGMQQMVVALGKLE  348

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  349   NLEGFVRQADNLRQQTLHQLRRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  404



>ref|XP_006288172.1| hypothetical protein CARUB_v10001409mg [Capsella rubella]
 ref|XP_006288173.1| hypothetical protein CARUB_v10001409mg [Capsella rubella]
 gb|EOA21070.1| hypothetical protein CARUB_v10001409mg [Capsella rubella]
 gb|EOA21071.1| hypothetical protein CARUB_v10001409mg [Capsella rubella]
Length=330

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/299 (49%), Positives = 204/299 (68%), Gaps = 15/299 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             ++ KTLRRLAQNREAARK R+RKKAYVQQLE SR+KL QLEQ++  A+ +G  I+  G+ 
Sbjct  43    MDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSTGDQ  102

Query  894   vgvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                              GA AFD E++RW+EE+++   ELR A++     + EL+  VD 
Sbjct  103   AHS----------TGGNGALAFDAEHSRWLEEKNKQMNELRSALNA-HAGDAELRTIVDG  151

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  + +  AK+DV HL+SGM  TP ERCF+W+GGFR S LLK++ +QLE +TE
Sbjct  152   VMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTE  211

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPS--NLPSCMTQMAAAIT  367
             +Q  G+  L+Q++Q+AE+ALSQGME+L  +++D +S+  L   S  N+ S M QMA A+ 
Sbjct  212   RQLGGINNLQQTSQQAEDALSQGMESLQQSLADTLSNGTLGSSSSGNVASYMGQMAMAMG  271

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL  F+RQADNLR+QT+Q++  +LT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  272   KLGTLEGFIRQADNLRLQTLQQMIRVLTTRQSARALLAIHDYFSRLRALSSLWLARPRE  330



>ref|XP_011075851.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Sesamum 
indicum]
 ref|XP_011075852.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Sesamum 
indicum]
 ref|XP_011075853.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Sesamum 
indicum]
 ref|XP_011075854.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Sesamum 
indicum]
 ref|XP_011075855.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Sesamum 
indicum]
 ref|XP_011075856.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Sesamum 
indicum]
 ref|XP_011075857.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Sesamum 
indicum]
Length=328

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/298 (51%), Positives = 203/298 (68%), Gaps = 15/298 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SRMKL QLEQ++  A+ +G  I+ +G+  
Sbjct  42    DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISSSGDQS  101

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         I   GA AFDVEYARW+EE +R   ELR AV+     + EL+  V+  
Sbjct  102   Q----------SIGGNGALAFDVEYARWLEEHNRRINELRGAVNS-HAGDGELRIIVEGI  150

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY  +  +    AK+DV H++SGM  TP ERCF+W+GGFR S LLK++++QLE +TEQ
Sbjct  151   VAHYDDIFRIKGDAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQ  210

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPS--NLPSCMTQMAAAITN  364
             Q L +  L+QS+Q+AE+ALSQGME L  ++++ ++       S  N+ + M QMA A+  
Sbjct  211   QLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAGSLGPSSSSGNVANYMGQMAMAMGK  270

Query  363   LYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
             L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L ++D+F RLR LS+LWL RPR+
Sbjct  271   LGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAISDYFSRLRALSSLWLARPRE  328



>ref|XP_010055972.1| PREDICTED: transcription factor HBP-1b(c38)-like [Eucalyptus 
grandis]
 ref|XP_010055976.1| PREDICTED: transcription factor HBP-1b(c38)-like [Eucalyptus 
grandis]
 ref|XP_010055985.1| PREDICTED: transcription factor HBP-1b(c38)-like [Eucalyptus 
grandis]
 ref|XP_010055993.1| PREDICTED: transcription factor HBP-1b(c38)-like [Eucalyptus 
grandis]
 gb|KCW90037.1| hypothetical protein EUGRSUZ_A02240 [Eucalyptus grandis]
Length=468

 Score =   283 bits (723),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 150/297 (51%), Positives = 207/297 (70%), Gaps = 16/297 (5%)
 Frame = -2

Query  1065  KTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvvgv  886
             KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G     
Sbjct  183   KTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISGSGEQSH-  241

Query  885   ghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACFA  709
                       ++  GA AFDVEYARW+EE +++  ELR AV+     + EL+  VD   A
Sbjct  242   ---------SMSGNGALAFDVEYARWLEEHNKVVNELRNAVN-AHAGDTELRTIVDNVAA  291

Query  708   HYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQA  532
             H+ ++  L    AK+DV H++SGM  TP ERCF+WIGGFR S +LK++++QLE +TEQQ 
Sbjct  292   HFDEIFKLKGTAAKADVFHILSGMWKTPAERCFMWIGGFRSSEVLKLLVNQLEPLTEQQL  351

Query  531   LGMIGLRQSTQEAEEALSQGMETLHHTISDII--SSDALFYPS-NLPSCMTQMAAAITNL  361
             +G+  L+QS+Q+AE+ALSQG+E L  ++++ +  S+ A   PS N+ + M QMA A+  L
Sbjct  352   VGIGNLQQSSQQAEDALSQGLEALQQSLAETLANSTTATAGPSGNVANYMGQMAMAMGKL  411

Query  360   YTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              TL  F+RQADNLR QT+Q+++ +LT  Q AR  L + D+F RLR LS+LWL RPR+
Sbjct  412   GTLEGFLRQADNLRQQTLQQMHRVLTTRQSARALLAINDYFSRLRALSSLWLARPRE  468



>ref|XP_001779430.1| predicted protein [Physcomitrella patens]
 gb|EDQ55820.1| predicted protein [Physcomitrella patens]
Length=329

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/296 (49%), Positives = 200/296 (68%), Gaps = 14/296 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             ++K LRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  +       
Sbjct  44    DSKALRRLAQNREAARKSRLRKKAYVQQLESSRIKLNQLEQELQRARQQGLYLG------  97

Query  891   gvghgHPLSLTKITPEGAA--FDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDA  718
                     S  +I   G A  FD+EYARW+EE+ R   ELR A+ +   ++ EL+  VD 
Sbjct  98    ----SGSYSGDQIAHSGGAVAFDLEYARWMEEQQRQMSELRAAL-QAHAADTELRGLVDG  152

Query  717   CFAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTE  541
               AHY ++  L A+ AK+DV H+VSGM  TP ERCFIW+GGFRPS LLK+++ Q+E +TE
Sbjct  153   GMAHYEEIFRLKAVAAKADVFHVVSGMWKTPAERCFIWMGGFRPSELLKILLPQIEPLTE  212

Query  540   QQALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNL  361
             QQ + +  L+Q++  AEE LS  ME+L  T++D +S+ +    SN+ + MTQMA A++ L
Sbjct  213   QQTMSICTLQQTSHAAEENLSSAMESLQQTLADTLSAGSFGSSSNVANYMTQMAVAMSEL  272

Query  360   YTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
               L TFV +AD+LR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LW  RPR
Sbjct  273   AALETFVLEADSLRKQTLQQMHRILTTRQAARGLLAMGDYFARLRALSSLWSARPR  328



>ref|XP_011000921.1| PREDICTED: transcription factor TGA2-like isoform X2 [Populus 
euphratica]
Length=497

 Score =   284 bits (726),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/296 (50%), Positives = 201/296 (68%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAA+K R+RKKAYVQQLETSR+KL QLEQ +  A+ +G  +   G  
Sbjct  191   LDAKTLRRLAQNREAAKKSRLRKKAYVQQLETSRIKLTQLEQDLQRARQQGLFLGGCG--  248

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                      +   I+   A FD+EYARW+E++HR   ELR  + +  LS+ +L+  VD  
Sbjct  249   --------GAGGNISSGAAIFDMEYARWLEDDHRHMSELRTGL-QAHLSDGDLRVIVDGY  299

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              +HY ++  L  + AKSDV HL++GM  TP ERCF+W+GGFRPS L+K+++SQL+ +TEQ
Sbjct  300   ISHYDEIFRLKVVAAKSDVFHLITGMWSTPAERCFLWMGGFRPSELIKMLISQLDPLTEQ  359

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEALSQG+E L  ++ D I+   +         M QM  A+  L 
Sbjct  360   QVMGIYSLQQSSQQAEEALSQGLEQLQQSLVDTIAGGPVI------GGMQQMVVALGKLA  413

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  414   NLEGFVRQADNLRQQTLHQLRRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  469



>ref|XP_008391110.1| PREDICTED: transcription factor TGA2-like isoform X1 [Malus domestica]
Length=541

 Score =   285 bits (729),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/296 (50%), Positives = 203/296 (69%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKK+YVQQLE+SR+KL QLEQ++  A+A+G  +   G  
Sbjct  235   LDAKTLRRLAQNREAARKSRLRKKSYVQQLESSRIKLTQLEQELHRARAQGLFLGGAG--  292

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                       L  I+   A FD+EY RW+E++HR   E R  + +  LS+++L+  VD  
Sbjct  293   --------GGLGNISSGAAIFDMEYGRWLEDDHRHMSEFRTGL-QAHLSDSDLRLSVDGY  343

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              +HY ++  L  + AKSDV HL++GM  TP ERCF+W+GGFRPS L+K+++ QL+ +TEQ
Sbjct  344   ISHYDELFQLKGVAAKSDVFHLITGMWTTPAERCFLWMGGFRPSELIKMLIGQLDPLTEQ  403

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEAL+QG+E LH ++ D I+   +         M QMA A+  L 
Sbjct  404   QFMGIYNLQQSSQQAEEALTQGLEQLHQSLVDTIAGGPVI------DGMQQMAVALGKLT  457

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  458   NLEGFVRQADNLRQQTLHQLRRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  513



>gb|AFO63289.1| bZIP10 [Tamarix hispida]
Length=454

 Score =   282 bits (722),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/301 (50%), Positives = 203/301 (67%), Gaps = 16/301 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAYVQQLE SR+KL QLEQ++  A+ +G  IT +G+ 
Sbjct  164   LDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFITSSGDQ  223

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                      S +       AFD EYARW+EEE+R+  ELR AV+    S+ EL+  V+  
Sbjct  224   ---------SHSTGGTGAMAFDAEYARWLEEENRLVNELRAAVNS-HASDTELRTVVENA  273

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
               H+  +  +  + AK+DV H++SGM  TP ERCF+WIGGFR S LLK++++QLE +TEQ
Sbjct  274   ITHFDDIFRMKGVAAKTDVFHILSGMWKTPAERCFMWIGGFRSSELLKLLVNQLEPLTEQ  333

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSD-----ALFYPSNLPSCMTQMAAA  373
             Q + +  L+ S+Q+AE+ALSQGME L  ++++ ++S      A     N+ + M QMA A
Sbjct  334   QVMNIYNLQHSSQQAEDALSQGMEALQQSLAETLASGTPAAGASGSSGNVANYMGQMAVA  393

Query  372   ITNLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPR  193
             +  L TL  F+RQADNLR QT+Q+++ ILT  Q AR  L + D+F RLR LS+LWL RPR
Sbjct  394   MGKLGTLEGFLRQADNLRQQTLQQMHRILTTRQSARALLAINDYFSRLRALSSLWLARPR  453

Query  192   Q  190
             +
Sbjct  454   E  454



>gb|AGI17587.1| transcription factor TGA2 [Gladiolus hybrid cultivar]
Length=431

 Score =   281 bits (720),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/299 (50%), Positives = 207/299 (69%), Gaps = 16/299 (5%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+ +G  I+ +G+  
Sbjct  144   DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISNSGDQS  203

Query  891   gvghgHPLSLTKITPEGA-AFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         ++  GA AFD EY RW+E+ +R   ELR AV+    S+N+ +  VD  
Sbjct  204   H----------SMSGNGALAFDAEYGRWLEDHNRQINELRAAVN-AHASDNDPRAIVDGV  252

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHYA +  L +  AK+DV H++SGM  TP ERCF+W+GGFR S LLK++ +QLE +TEQ
Sbjct  253   MAHYADIFKLKSTAAKADVFHMLSGMWKTPAERCFMWLGGFRSSELLKLLATQLEPLTEQ  312

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISS---DALFYPSNLPSCMTQMAAAIT  367
             Q +G+  L+QS+Q+AE+ALSQGME L  ++S+ +SS    +     N+ + M QMA A+ 
Sbjct  313   QLVGICNLQQSSQQAEDALSQGMEALQQSLSETLSSASPASGGTSGNVANYMGQMAMAMG  372

Query  366   NLYTLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L TL +F+ QADNLR+QT+Q+++ ILT  Q AR  L + D+F+RLR LS+LWL RP++
Sbjct  373   KLGTLESFLCQADNLRLQTLQQMHRILTTRQAARALLAINDYFYRLRALSSLWLARPKE  431



>ref|XP_011000920.1| PREDICTED: transcription factor TGA2-like isoform X1 [Populus 
euphratica]
Length=498

 Score =   283 bits (725),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 148/296 (50%), Positives = 201/296 (68%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAA+K R+RKKAYVQQLETSR+KL QLEQ +  A+ +G  +   G  
Sbjct  192   LDAKTLRRLAQNREAAKKSRLRKKAYVQQLETSRIKLTQLEQDLQRARQQGLFLGGCG--  249

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                      +   I+   A FD+EYARW+E++HR   ELR  + +  LS+ +L+  VD  
Sbjct  250   --------GAGGNISSGAAIFDMEYARWLEDDHRHMSELRTGL-QAHLSDGDLRVIVDGY  300

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              +HY ++  L  + AKSDV HL++GM  TP ERCF+W+GGFRPS L+K+++SQL+ +TEQ
Sbjct  301   ISHYDEIFRLKVVAAKSDVFHLITGMWSTPAERCFLWMGGFRPSELIKMLISQLDPLTEQ  360

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEALSQG+E L  ++ D I+   +         M QM  A+  L 
Sbjct  361   QVMGIYSLQQSSQQAEEALSQGLEQLQQSLVDTIAGGPVI------GGMQQMVVALGKLA  414

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  FVRQADNLR QT+ +L  ILTV Q ARCFL++ +++ RLR LS+LW  RPR+
Sbjct  415   NLEGFVRQADNLRQQTLHQLRRILTVRQAARCFLVIGEYYGRLRALSSLWASRPRE  470



>gb|EYU20805.1| hypothetical protein MIMGU_mgv1a006646mg [Erythranthe guttata]
Length=436

 Score =   281 bits (720),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 147/296 (50%), Positives = 198/296 (67%), Gaps = 15/296 (5%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+ KTLRRLAQNREAARK R+RKKAYVQQLE+SRMKL QLEQ++   +  GA ++ NG  
Sbjct  154   LDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRMKLTQLEQELKPPRQHGAFVSNNG--  211

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                         +     +AFDVEYARW+EE+ R   ELR AV     S+ EL   VD+ 
Sbjct  212   -----------DQSNAGASAFDVEYARWMEEQSRRINELRTAVTS-HASDTELHSIVDSV  259

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
               H+  +  L    AK+DV H++SGM  TP ERCF+W+GGFRPS LLK++++QLE +TEQ
Sbjct  260   KTHFNDIFRLKGNAAKADVFHILSGMWKTPAERCFLWLGGFRPSELLKLLVNQLEPLTEQ  319

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q  G   L+QS+ +AE+ALSQGME L  ++++ ++S       N+ + M QMA A+  L 
Sbjct  320   QMTGFYNLQQSSHQAEDALSQGMEALQQSLAETLASGTEGSSGNVANYMGQMAMAMGKLG  379

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
             TL  F+RQADNLR QT+Q+++  LT  Q AR  +++ D+F RLR LS+LWL RP++
Sbjct  380   TLEGFLRQADNLRQQTLQQMHRTLTTRQSARALVLINDYFSRLRALSSLWLARPQE  435



>ref|XP_006417705.1| hypothetical protein EUTSA_v10007490mg [Eutrema salsugineum]
 gb|ESQ36058.1| hypothetical protein EUTSA_v10007490mg [Eutrema salsugineum]
Length=487

 Score =   283 bits (724),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 145/296 (49%), Positives = 203/296 (69%), Gaps = 18/296 (6%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLE+SR+KL QLEQ++  A+++G  +   G  
Sbjct  181   LDAKTLRRLAQNREAARKSRLRKKAYVQQLESSRIKLSQLEQELQRARSQGLFMGGCGPP  240

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                          IT   A FD+EY RW+E+++R   E+R  + +  LS+N+L+  VD  
Sbjct  241   G----------PNITSGAAIFDMEYGRWLEDDNRHMSEIRTGL-QAHLSDNDLRLIVDGY  289

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLEV-TEQ  538
               H+ ++  L A+ AK+DV HL+ G   +P ERCFIWI GFRPS L+K+++SQ+++ TEQ
Sbjct  290   ITHFDEILRLKAVAAKADVFHLIIGTWMSPAERCFIWIAGFRPSDLIKILVSQMDLLTEQ  349

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+ GL+ S+Q+AEEALSQG+E L H++ D +++  +         M QMA A+  L 
Sbjct  350   QLMGIYGLQHSSQQAEEALSQGLEQLQHSLIDTLAASPVI------DGMQQMAVALGKLS  403

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
              L  F+RQADNLR QT+ +L  ILTV Q ARCFL++ +++ RLR LS+LWL RPR+
Sbjct  404   NLEGFIRQADNLRQQTVHQLRRILTVRQAARCFLVIGEYYGRLRALSSLWLSRPRE  459



>ref|XP_009779356.1| PREDICTED: transcription factor TGA2 [Nicotiana sylvestris]
Length=500

 Score =   283 bits (724),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 143/295 (48%), Positives = 203/295 (69%), Gaps = 18/295 (6%)
 Frame = -2

Query  1071  NAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnvv  892
             + KTLRRLAQNREAA+K R+RKKAYVQQLETSR++L QLEQ++  A+++G  +       
Sbjct  195   DPKTLRRLAQNREAAKKSRLRKKAYVQQLETSRIRLSQLEQELQRARSQGIFLGGGTAAG  254

Query  891   gvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDACF  712
                         I+   A FD+EY+RW++++HR   ELR A+ +  LS+ +L+  VD   
Sbjct  255   ----------ANISSGAALFDMEYSRWLDDDHRHMSELRTAL-QAHLSDGDLRLIVDGYI  303

Query  711   AHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQQ  535
             AHY ++  L  + AKSDV HL++GM  TP ERCF+W+GGFRPS L+K+++ QL+ +TEQQ
Sbjct  304   AHYDEIFSLKGVAAKSDVFHLITGMWTTPAERCFLWMGGFRPSELIKMLIGQLDPLTEQQ  363

Query  534   ALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLYT  355
              +G+  L+QS+Q+AE+ALSQG+E L  ++ D ++S       ++   M  MA A+  L  
Sbjct  364   LMGIYSLQQSSQQAEDALSQGLEQLQQSLVDTVAS------GSINDGMHHMALALGKLSN  417

Query  354   LHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQ  190
             L  FVRQADNLR QT+ +L+ ILTV Q ARCFL++ +++ RLR LS+LWL RPR+
Sbjct  418   LEGFVRQADNLRQQTLHQLHRILTVRQAARCFLVIGEYYGRLRALSSLWLSRPRE  472



>ref|XP_010907586.1| PREDICTED: transcription factor TGA2-like [Elaeis guineensis]
Length=493

 Score =   283 bits (723),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 141/297 (47%), Positives = 204/297 (69%), Gaps = 13/297 (4%)
 Frame = -2

Query  1074  LNAKTLRRLAQNREAARKCRIRKKAYVQQLETSRMKLIQLEQQVALAQARGARITEngnv  895
             L+AKTLRRLAQNREAARK R+RKKAYVQQLE+SR++L QLEQ++  A+++G  +      
Sbjct  181   LDAKTLRRLAQNREAARKSRLRKKAYVQQLESSRIRLQQLEQELQRARSQGLFLGGGSAS  240

Query  894   vgvghgHPLSLTKITPEGAAFDVEYARWIEEEHRITCELRKAVDELMLSENELKRYVDAC  715
                          I+   A FD+EY RW+++  +   ELR  + +  L ++ L   VD C
Sbjct  241   G-----------DISSGAAMFDMEYNRWLDDTSKHMSELRGGL-QAHLPDSNLAITVDEC  288

Query  714   FAHYAQMTHLNAMLAKSDVLHLVSGMCWTPVERCFIWIGGFRPSLLLKVIMSQLE-VTEQ  538
              AHY ++  L  + AKSDV HL++GM  TP ERCF+W+GGF+PS LLK++M QL+ +TEQ
Sbjct  289   IAHYDELFRLKGVAAKSDVFHLLTGMWTTPAERCFLWMGGFKPSELLKILMPQLDPLTEQ  348

Query  537   QALGMIGLRQSTQEAEEALSQGMETLHHTISDIISSDALFYPSNLPSCMTQMAAAITNLY  358
             Q +G+  L+QS+Q+AEEALSQG+E LH +++D ++S +L   +++ + M  MA A+  L 
Sbjct  349   QLMGICNLQQSSQQAEEALSQGLEQLHQSLADTVASGSLSDGTDITNYMGHMAIALGKLA  408

Query  357   TLHTFVRQADNLRIQTIQRLYHILTVGQVARCFLIVTDFFHRLRTLSALWLGRPRQD  187
              L  F++QADNLR QTI ++  ILT+ Q ARCFL + +++ RLR LS+LW  RP+++
Sbjct  409   NLEGFIQQADNLRQQTIHQMRRILTIRQAARCFLAIGEYYSRLRALSSLWASRPQEN  465



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5109523114556