BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27117_g1_i1 len=241 path=[1:0-240]

Length=241
                                                                      Score     E

sp|P26573.1|RBS8_NICPL  RecName: Full=Ribulose bisphosphate carbo...    156   6e-46   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|ABY21254.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    154   2e-45   Solanum tuberosum [potatoes]
sp|P26574.1|RBS1_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    154   3e-45   Solanum tuberosum [potatoes]
ref|XP_010032637.1|  PREDICTED: ribulose bisphosphate carboxylase...    154   4e-45   
dbj|BAI53118.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    154   4e-45   Eucalyptus globulus [blue gum]
sp|P07180.1|RBS3A_SOLLC  RecName: Full=Ribulose bisphosphate carb...    154   6e-45   Solanum lycopersicum
ref|XP_004232356.1|  PREDICTED: ribulose bisphosphate carboxylase...    154   6e-45   
sp|P32764.1|RBS3_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    153   7e-45   Solanum tuberosum [potatoes]
ref|XP_004233493.1|  PREDICTED: ribulose bisphosphate carboxylase...    153   9e-45   
gb|AAA34191.1|  ribulose-1,5-bisphosphate carboxylase, small subu...    153   1e-44   Solanum lycopersicum
gb|ABY21253.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    153   1e-44   Solanum tuberosum [potatoes]
sp|P04715.1|RBS2_PETHY  RecName: Full=Ribulose bisphosphate carbo...    152   2e-44   Petunia x hybrida [garden petunia]
sp|P04714.1|RBS1_PETHY  RecName: Full=Ribulose bisphosphate carbo...    152   2e-44   Petunia x hybrida [garden petunia]
ref|WP_026003795.1|  hypothetical protein                               150   2e-44   
ref|XP_009795055.1|  PREDICTED: ribulose bisphosphate carboxylase...    152   2e-44   
ref|XP_009800809.1|  PREDICTED: ribulose bisphosphate carboxylase...    152   3e-44   
gb|AFW90575.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    152   3e-44   
ref|XP_006358055.1|  PREDICTED: ribulose-1,5-bisphosphate carboxy...    152   3e-44   
gb|AAA34192.1|  ribulose-1,5-bisphosphate carboxylase, small subu...    151   3e-44   Solanum lycopersicum
ref|XP_009758143.1|  PREDICTED: ribulose bisphosphate carboxylase...    151   4e-44   
sp|P26575.1|RBSA_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    151   4e-44   Solanum tuberosum [potatoes]
ref|XP_004234568.1|  PREDICTED: ribulose bisphosphate carboxylase...    151   4e-44   
sp|O65349.1|RBS_CAPAN  RecName: Full=Ribulose bisphosphate carbox...    152   4e-44   Capsicum annuum
ref|XP_006363111.1|  PREDICTED: ribulose bisphosphate carboxylase...    151   4e-44   
sp|P26576.1|RBSB_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    151   4e-44   Solanum tuberosum [potatoes]
gb|AHI85721.1|  stress-induced protein 16                               151   4e-44   
gb|AGT97045.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    151   5e-44   
gb|AAR83879.1|  Cristal-Glass1 protein                                  151   5e-44   Capsicum annuum
gb|ABY21255.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    151   6e-44   Solanum tuberosum [potatoes]
pdb|3RUB|S  Chain S, Crystal Structure Of The Unactivated Form Of...    148   1e-43   
gb|AFB70994.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    150   1e-43   
gb|AFK36660.1|  unknown                                                 150   1e-43   
ref|XP_009767108.1|  PREDICTED: ribulose bisphosphate carboxylase...    150   1e-43   
ref|XP_009602965.1|  PREDICTED: ribulose bisphosphate carboxylase...    150   1e-43   
ref|XP_009625434.1|  PREDICTED: ribulose bisphosphate carboxylase...    150   1e-43   
ref|XP_010044264.1|  PREDICTED: ribulose bisphosphate carboxylase...    150   2e-43   
ref|XP_009774104.1|  PREDICTED: ribulose bisphosphate carboxylase...    150   2e-43   
ref|NP_001275244.1|  ribulose bisphosphate carboxylase small chai...    150   2e-43   
gb|AAA34111.1|  ribulose-1,5-bisphosphate carboxylase                   147   2e-43   Nicotiana sylvestris
ref|XP_009595081.1|  PREDICTED: ribulose bisphosphate carboxylase...    149   2e-43   
ref|WP_037767734.1|  hypothetical protein                               147   2e-43   
gb|ABS72189.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    149   2e-43   Corchorus olitorius
ref|XP_004303137.1|  PREDICTED: ribulose bisphosphate carboxylase...    149   3e-43   
emb|CAH59401.1|  Rubisco SSU                                            149   4e-43   Plantago major [cart-track plant]
sp|Q41351.1|RBS_STELP  RecName: Full=Ribulose bisphosphate carbox...    149   5e-43   Stellaria longipes
ref|XP_010265138.1|  PREDICTED: ribulose bisphosphate carboxylase...    148   8e-43   
ref|XP_010263805.1|  PREDICTED: ribulose bisphosphate carboxylase...    148   1e-42   
ref|XP_009357812.1|  PREDICTED: ribulose bisphosphate carboxylase...    147   1e-42   
ref|XP_008381263.1|  PREDICTED: ribulose bisphosphate carboxylase...    147   1e-42   
gb|KCW52065.1|  hypothetical protein EUGRSUZ_J01502                     147   1e-42   
gb|AFK48034.1|  unknown                                                 147   1e-42   
pdb|4RUB|S  Chain S, A Crystal Form Of Ribulose-1,5-Bisphosphate ...    145   1e-42   
ref|XP_010263795.1|  PREDICTED: ribulose bisphosphate carboxylase...    147   2e-42   
prf||0902172A  carboxylase/oxygenase,RBP                                145   2e-42
sp|Q43832.1|RBS2_SPIOL  RecName: Full=Ribulose bisphosphate carbo...    147   3e-42   Spinacia oleracea
gb|AAB81105.1|  ribulose 1,5-bisphosphate carboxylase small subunit     147   3e-42   Spinacia oleracea
emb|CAH59404.1|  Rubisco SSU                                            146   3e-42   Plantago major [cart-track plant]
ref|XP_002521232.1|  Ribulose bisphosphate carboxylase small chai...    146   3e-42   Ricinus communis
dbj|BAE46384.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    146   5e-42   Panax ginseng [Chinese ginseng]
gb|AFK33868.1|  unknown                                                 145   6e-42   
ref|WP_039311749.1|  hypothetical protein                               144   6e-42   
ref|XP_007215051.1|  hypothetical protein PRUPE_ppa012123mg             146   7e-42   
pdb|1IR1|S  Chain S, Crystal Structure Of Spinach Ribulose-1,5-Bi...    144   8e-42   
gb|AAW31667.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    145   9e-42   Ammopiptanthus mongolicus
ref|XP_008244506.1|  PREDICTED: ribulose bisphosphate carboxylase...    145   1e-41   
sp|Q02980.1|RBS_MALSP  RecName: Full=Ribulose bisphosphate carbox...    145   1e-41   Malus sp.
ref|XP_009342656.1|  PREDICTED: ribulose bisphosphate carboxylase...    145   1e-41   
ref|XP_008368660.1|  PREDICTED: ribulose bisphosphate carboxylase...    145   1e-41   
sp|P24007.1|RBS_PYRPY  RecName: Full=Ribulose bisphosphate carbox...    145   1e-41   Pyrus pyrifolia [sha li]
ref|XP_004299075.1|  PREDICTED: ribulose bisphosphate carboxylase...    145   1e-41   
emb|CAD21856.1|  putative ribulose 1,5 biphosphate carboxylase sm...    145   1e-41   Rumex obtusifolius
pdb|1AUS|S  Chain S, Activated Unliganded Spinach Rubisco               143   2e-41   
sp|Q96542.1|RBS_BETPN  RecName: Full=Ribulose bisphosphate carbox...    145   2e-41   Betula pendula [white birch]
gb|AFK42721.1|  unknown                                                 145   2e-41   
gb|ABK95229.1|  unknown                                                 145   2e-41   Populus trichocarpa [western balsam poplar]
ref|XP_002305162.2|  Ribulose bisphosphate carboxylase small chai...    145   2e-41   Populus trichocarpa [western balsam poplar]
sp|Q42823.1|RBS_GLYTA  RecName: Full=Ribulose bisphosphate carbox...    144   3e-41   Glycine tabacina
gb|AAA33716.1|  ribulose 1,5-bisphosphate carboxylase                   142   3e-41   Petunia x hybrida [garden petunia]
ref|XP_002531624.1|  Ribulose bisphosphate carboxylase small chai...    144   4e-41   Ricinus communis
gb|AIR75141.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    143   4e-41   
gb|ABK96567.1|  unknown                                                 144   4e-41   Populus trichocarpa x Populus deltoides
emb|CAD11990.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    143   5e-41   Coffea arabica [arabica coffee]
ref|XP_010693059.1|  PREDICTED: ribulose bisphosphate carboxylase...    143   5e-41   
ref|XP_010693073.1|  PREDICTED: ribulose bisphosphate carboxylase...    143   5e-41   
gb|AEJ33935.1|  chloroplast putative ribulose-1,5-bisphosphate ca...    143   6e-41   
ref|XP_006383456.1|  Ribulose bisphosphate carboxylase small chai...    143   6e-41   
ref|XP_010693054.1|  PREDICTED: ribulose bisphosphate carboxylase...    143   7e-41   
gb|KDP29409.1|  hypothetical protein JCGZ_18330                         142   7e-41   
ref|XP_010036887.1|  PREDICTED: ribulose bisphosphate carboxylase...    143   8e-41   
emb|CBY05833.1|  Ribulose 1,5-bisphosphate carboxylase small subu...    143   8e-41   
gb|AIR75139.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    142   8e-41   
ref|XP_010693099.1|  PREDICTED: ribulose bisphosphate carboxylase...    143   9e-41   
sp|P08705.1|RBS_HELAN  RecName: Full=Ribulose bisphosphate carbox...    143   9e-41   Helianthus annuus
gb|AAK16227.1|AF044395_1  ribulose-1,5-bisphosphate carboxylase s...    141   1e-40   Flaveria ramosissima
gb|ABC17790.1|  plastid ribulose-1,5-bisphosphate carboxylase/oxy...    140   1e-40   Coffea arabica [arabica coffee]
gb|AAA33866.1|  ribulose 1,5-bisphosphate carboxylase small subunit     142   1e-40   Malus domestica x Pyrus communis
gb|AIR75136.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    142   1e-40   
ref|XP_006391132.1|  hypothetical protein EUTSA_v10019199mg             142   1e-40   
gb|AIL82451.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    142   1e-40   
ref|XP_011035062.1|  PREDICTED: ribulose bisphosphate carboxylase...    142   1e-40   
sp|P16032.2|RBS1_MESCR  RecName: Full=Ribulose bisphosphate carbo...    142   1e-40   Mesembryanthemum crystallinum
sp|P07089.1|RBS_FLATR  RecName: Full=Ribulose bisphosphate carbox...    142   1e-40   Flaveria trinervia
gb|AAP31054.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    142   1e-40   Flaveria bidentis
sp|Q08186.1|RBS6_MESCR  RecName: Full=Ribulose bisphosphate carbo...    142   2e-40   Mesembryanthemum crystallinum
gb|AAA33036.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    142   2e-40   Mesembryanthemum crystallinum
gb|AFS41733.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    142   2e-40   
gb|AFS41748.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    142   2e-40   
sp|P19308.1|RBS2_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    142   2e-40   Lemna gibba
dbj|BAI53119.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    142   2e-40   Eucalyptus globulus [blue gum]
gb|AEX60839.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    142   2e-40   
gb|AEX60842.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    142   2e-40   
gb|KHG18747.1|  Ribulose bisphosphate carboxylase small chain, ch...    142   2e-40   
sp|P19311.1|RBS5_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    142   2e-40   Lemna gibba
emb|CAA32701.1|  ribulose bisphosphate carboxylase                      142   2e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CDP20139.1|  unnamed protein product                                141   2e-40   
gb|AIR75140.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    141   3e-40   
gb|AFS41753.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    142   3e-40   
ref|XP_011021244.1|  PREDICTED: ribulose bisphosphate carboxylase...    142   3e-40   
emb|CAA32702.1|  ribulose bisphosphate carboxylase                      142   3e-40   Arabidopsis thaliana [mouse-ear cress]
gb|AAK16231.1|AF044399_1  ribulose-1,5-bisphosphate carboxylase s...    140   3e-40   Flaveria palmeri
ref|XP_010669829.1|  PREDICTED: ribulose bisphosphate carboxylase...    142   3e-40   
ref|XP_004962611.1|  PREDICTED: ribulose bisphosphate carboxylase...    141   3e-40   
ref|NP_198659.1|  ribulose bisphosphate carboxylase small chain 1B      142   3e-40   Arabidopsis thaliana [mouse-ear cress]
gb|AAK16232.1|AF044400_1  ribulose-1,5-bisphosphate carboxylase s...    140   3e-40   Flaveria palmeri
ref|NP_198657.1|  ribulose bisphosphate carboxylase small chain 3B      142   3e-40   Arabidopsis thaliana [mouse-ear cress]
gb|AIR75142.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    141   3e-40   
sp|Q39746.1|RBS4_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    141   3e-40   Flaveria pringlei
ref|NP_198658.1|  ribulose bisphosphate carboxylase small chain 2B      141   3e-40   Arabidopsis thaliana [mouse-ear cress]
sp|P19312.1|RBS6_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    141   3e-40   Lemna gibba
sp|Q08183.1|RBS3_MESCR  RecName: Full=Ribulose bisphosphate carbo...    142   3e-40   Mesembryanthemum crystallinum
sp|Q39744.1|RBS2_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    141   3e-40   Flaveria pringlei
gb|AAA33037.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    141   3e-40   Mesembryanthemum crystallinum
gb|ABS57004.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    140   3e-40   
ref|WP_028130706.1|  hypothetical protein                               139   4e-40   
sp|Q04450.1|RBS2_MESCR  RecName: Full=Ribulose bisphosphate carbo...    141   4e-40   Mesembryanthemum crystallinum
sp|Q39748.1|RBS6_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    141   4e-40   Flaveria pringlei
sp|Q39749.1|RBS7_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    141   4e-40   Flaveria pringlei
sp|Q39745.1|RBS3_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    141   4e-40   Flaveria pringlei
ref|XP_010440948.1|  PREDICTED: ribulose bisphosphate carboxylase...    141   4e-40   
gb|AIF75288.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    140   5e-40   
gb|AIF75285.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    140   5e-40   
sp|Q39747.1|RBS5_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    140   5e-40   Flaveria pringlei
ref|XP_010103758.1|  hypothetical protein L484_014647                   141   5e-40   
ref|XP_010440945.1|  PREDICTED: ribulose bisphosphate carboxylase...    141   5e-40   
gb|ABK96431.1|  unknown                                                 141   5e-40   Populus trichocarpa x Populus deltoides
sp|Q39743.1|RBS1_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    140   5e-40   Flaveria pringlei
sp|Q08185.1|RBS5_MESCR  RecName: Full=Ribulose bisphosphate carbo...    141   5e-40   Mesembryanthemum crystallinum
gb|AIF75289.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    140   5e-40   
sp|Q08184.1|RBS4_MESCR  RecName: Full=Ribulose bisphosphate carbo...    141   5e-40   Mesembryanthemum crystallinum
gb|AIF75295.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    140   5e-40   
ref|XP_006284616.1|  hypothetical protein CARUB_v10005847mg             141   5e-40   
ref|XP_006285696.1|  hypothetical protein CARUB_v10007166mg             140   6e-40   
ref|NP_176880.1|  ribulose bisphosphate carboxylase small chain 1A      140   6e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285820.1|  hypothetical protein CARUB_v10007296mg             140   6e-40   
ref|XP_010435745.1|  PREDICTED: ribulose bisphosphate carboxylase...    140   6e-40   
ref|XP_010435743.1|  PREDICTED: ribulose bisphosphate carboxylase...    140   6e-40   
gb|AAA33035.1|  ribulose-1-5-bisphosphate carboxylase                   140   7e-40   Mesembryanthemum crystallinum
sp|Q42822.1|RBS_GLYTO  RecName: Full=Ribulose bisphosphate carbox...    140   7e-40   Glycine tomentella [wooly glycine]
gb|EYU44637.1|  hypothetical protein MIMGU_mgv1a0165712mg               137   8e-40   
gb|AAK16230.1|AF044398_1  ribulose-1,5-bisphosphate carboxylase s...    139   8e-40   Flaveria palmeri
ref|XP_003618736.1|  Ribulose bisphosphate carboxylase small chain      140   8e-40   
gb|AIF75283.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    140   8e-40   
gb|AFK40375.1|  unknown                                                 140   9e-40   
gb|AAO25119.1|  ribulose-1,5-bisphosphate carboxylase small subunit     140   9e-40   Chrysanthemum x morifolium [florist's chrysanthemum]
sp|P19310.1|RBS4_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    140   9e-40   Lemna gibba
gb|AAP31053.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    140   9e-40   Flaveria bidentis
ref|XP_008446602.1|  PREDICTED: ribulose bisphosphate carboxylase...    140   9e-40   
gb|AFO67218.1|  putative ribulose-1,5-bisphosphate carboxylase/ox...    140   1e-39   
emb|CAA31948.1|  ribulose bisphosphate carboxylase                      140   1e-39   Arabidopsis thaliana [mouse-ear cress]
sp|P19309.1|RBS3_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    140   1e-39   Lemna gibba
gb|AIR75138.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    139   1e-39   
gb|AAK16228.1|AF044396_1  ribulose-1,5-bisphosphate carboxylase s...    139   1e-39   Flaveria ramosissima
ref|XP_010450911.1|  PREDICTED: ribulose bisphosphate carboxylase...    140   1e-39   
ref|XP_002888576.1|  ribulose bisphosphate carboxylase small chai...    140   1e-39   
gb|AFS41732.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    140   1e-39   
gb|AEX60843.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    140   1e-39   
ref|XP_010450912.1|  PREDICTED: ribulose bisphosphate carboxylase...    140   1e-39   
ref|XP_006663954.1|  PREDICTED: ribulose bisphosphate carboxylase...    139   1e-39   
ref|XP_009140170.1|  PREDICTED: ribulose bisphosphate carboxylase...    140   1e-39   
ref|XP_003618735.1|  Ribulose bisphosphate carboxylase small chain      140   1e-39   
ref|XP_010450913.1|  PREDICTED: ribulose bisphosphate carboxylase...    140   1e-39   
sp|P08135.1|RBS_RAPSA  RecName: Full=Ribulose bisphosphate carbox...    140   1e-39   Raphanus sativus
gb|AFS41770.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    139   1e-39   
gb|ACU13285.1|  unknown                                                 140   1e-39   Glycine max [soybeans]
gb|AAG24884.1|AF303941_1  ribulose-1,5-bisphosphate carboxylase s...    139   2e-39   Glycine max [soybeans]
gb|AIF75321.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    139   2e-39   
ref|NP_001241137.1|  ribulose bisphosphate carboxylase small chai...    139   2e-39   
ref|NP_001235266.1|  ribulose-1,5-bisphosphate carboxylase small ...    139   2e-39   
ref|NP_001235314.1|  uncharacterized protein LOC100500504               139   2e-39   
gb|AFS41763.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    139   2e-39   
gb|AFS41744.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    139   2e-39   
gb|AEX60841.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    139   2e-39   
ref|XP_006663961.1|  PREDICTED: ribulose bisphosphate carboxylase...    139   2e-39   
gb|AFS41754.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    139   2e-39   
ref|XP_006664952.1|  PREDICTED: ribulose bisphosphate carboxylase...    139   2e-39   
ref|XP_006663955.1|  PREDICTED: ribulose bisphosphate carboxylase...    139   2e-39   
pdb|3AXK|S  Chain S, Structure Of Rice Rubisco In Complex With Na...    137   2e-39   
gb|AAK49590.1|AF372874_1  F1O19.10/F1O19.10                             137   2e-39   Arabidopsis thaliana [mouse-ear cress]
pdb|4MKV|S  Chain S, Structure Of Pisum Sativum Rubisco With Aba        137   2e-39   
ref|XP_002868776.1|  ribulose bisphosphate carboxylase                  139   2e-39   
ref|XP_002868775.1|  ribulose bisphosphate carboxylase small chai...    139   3e-39   
gb|AFI60243.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    138   3e-39   
gb|KEH21530.1|  ribulose bisphosphate carboxylase small chain           139   3e-39   
gb|KEH21536.1|  ribulose bisphosphate carboxylase small chain           139   3e-39   
ref|XP_003636970.1|  Ribulose bisphosphate carboxylase small chai...    139   3e-39   
gb|KEH21531.1|  ribulose bisphosphate carboxylase small chain           139   3e-39   
gb|AAU14862.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    139   3e-39   Fagus sylvatica
gb|KEH21538.1|  ribulose bisphosphate carboxylase small chain           139   3e-39   
ref|XP_003637843.1|  Ribulose bisphosphate carboxylase small chai...    139   3e-39   
ref|XP_003600302.1|  Ribulose bisphosphate carboxylase small chai...    139   3e-39   
sp|O22077.1|RBS_FAGCR  RecName: Full=Ribulose bisphosphate carbox...    139   3e-39   Fagus crenata
emb|CDY67657.1|  BnaCnng55860D                                          139   3e-39   
gb|ACJ85905.1|  unknown                                                 139   3e-39   Medicago truncatula
gb|AIF75342.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    139   3e-39   
emb|CAA10290.1|  ribulose 1,5-bisphosphate carboxylase small subunit    139   3e-39   Cicer arietinum [garbanzo]
gb|AIF75344.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    139   4e-39   
gb|AIF75322.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    139   4e-39   
ref|XP_006482254.1|  PREDICTED: ribulose bisphosphate carboxylase...    139   4e-39   
gb|AFS41725.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    139   4e-39   
gb|AIF75296.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    138   4e-39   
gb|AIF75291.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    138   4e-39   
emb|CCF55356.1|  ribulose-1,5-bisphosphate carboxylase small subunit    139   4e-39   
ref|XP_004135094.1|  PREDICTED: ribulose bisphosphate carboxylase...    139   4e-39   
gb|AFS41724.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    138   5e-39   
emb|CAA30393.1|  ribulose bisphosphate carboxylase                      138   5e-39   Oryza sativa Japonica Group [Japonica rice]
sp|P00872.2|RBS1_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    138   5e-39   Lemna gibba
sp|Q40250.1|RBS_LACSA  RecName: Full=Ribulose bisphosphate carbox...    138   5e-39   Lactuca sativa [cultivated lettuce]
gb|AAL82195.1|AF396697_1  s/s2                                          136   5e-39   Nicotiana benthamiana
emb|CDY52468.1|  BnaA04g27920D                                          138   5e-39   
gb|AIF75294.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    137   5e-39   
emb|CAA30290.1|  rubisco ssu precursor                                  138   5e-39   Brassica napus [oilseed rape]
dbj|BAK23964.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    138   6e-39   
ref|XP_011089882.1|  PREDICTED: ribulose bisphosphate carboxylase...    138   6e-39   
sp|P18960.1|RBS_SILPR  RecName: Full=Ribulose bisphosphate carbox...    138   6e-39   Silene latifolia subsp. alba [white campion]
ref|XP_002532149.1|  Ribulose bisphosphate carboxylase small chai...    138   6e-39   Ricinus communis
ref|XP_009139778.1|  PREDICTED: ribulose bisphosphate carboxylase...    138   6e-39   
gb|ACQ90229.1|  TuMV resistance protein-like protein                    137   6e-39   
sp|P05346.2|RBS1_BRANA  RecName: Full=Ribulose bisphosphate carbo...    138   6e-39   Brassica napus [oilseed rape]
gb|AFS41772.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    137   6e-39   
ref|XP_006405770.1|  hypothetical protein EUTSA_v10027955mg             138   7e-39   
emb|CAA24969.1|  unnamed protein product                                136   7e-39   Lemna gibba
gb|AIF75340.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    138   7e-39   
gb|ABK15574.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    138   7e-39   Camellia sinensis [black tea]
gb|AIF75323.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    138   7e-39   
gb|AFS41729.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    138   7e-39   
gb|AIF75332.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    138   7e-39   
ref|XP_010511625.1|  PREDICTED: ribulose bisphosphate carboxylase...    138   7e-39   
pir||A05119  ribulose-bisphosphate carboxylase (EC 4.1.1.39) smal...    135   7e-39
gb|AIF75313.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    138   8e-39   
gb|AIF75337.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    137   8e-39   
gb|ABB51649.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    138   8e-39   Brassica napus [oilseed rape]
ref|XP_008797838.1|  PREDICTED: ribulose bisphosphate carboxylase...    138   8e-39   
gb|AIF75317.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    137   8e-39   
dbj|BAJ08160.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase        138   8e-39   
emb|CDY01665.1|  BnaC04g30870D                                          138   8e-39   
gb|ABJ74187.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    135   8e-39   Artemisia annua [sweet Annie]
gb|ABN41481.1|  putative chloroplast ribulose-1,5-bisphosphate ca...    135   9e-39   Cucumis sativus [cucumbers]
gb|AAG40356.1|AF325004_1  At1g67090                                     137   9e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AAG49562.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    135   9e-39   Citrus reticulata [mandarin orange]
ref|XP_010528479.1|  PREDICTED: LOW QUALITY PROTEIN: ribulose bis...    138   9e-39   
ref|XP_009403968.1|  PREDICTED: ribulose bisphosphate carboxylase...    137   9e-39   
gb|AFS41766.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    137   9e-39   
gb|AIF75346.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    137   1e-38   
gb|ACO35888.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    137   1e-38   Ageratina adenophora
sp|P31333.2|RBS_GOSHI  RecName: Full=Ribulose bisphosphate carbox...    137   1e-38   Gossypium hirsutum [American cotton]
ref|NP_001066606.1|  Os12g0291400                                       137   1e-38   Oryza sativa Japonica Group [Japonica rice]
sp|P07689.1|RBS3_PEA  RecName: Full=Ribulose bisphosphate carboxy...    137   1e-38   Pisum sativum [garden pea]
emb|CDX99682.1|  BnaC04g34390D                                          138   1e-38   
sp|P08474.1|RBS_CUCSA  RecName: Full=Ribulose bisphosphate carbox...    138   1e-38   Cucumis sativus [cucumbers]
gb|EAY97115.1|  hypothetical protein OsI_19041                          137   1e-38   Oryza sativa Indica Group [Indian rice]
gb|AFS41727.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    137   1e-38   
gb|AAA84592.1|  ribulose 1,5-bisphosphate carboxylase                   137   1e-38   Oryza sativa [red rice]
ref|XP_006430779.1|  hypothetical protein CICLE_v10012893mg             137   1e-38   
ref|XP_007036525.1|  Ribulose bisphosphate carboxylase (small cha...    137   1e-38   
gb|AIF75349.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    136   1e-38   
sp|P00869.1|RBS2_PEA  RecName: Full=Ribulose bisphosphate carboxy...    137   1e-38   Pisum sativum [garden pea]
gb|AIB04188.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    137   1e-38   
ref|NP_001066604.1|  Os12g0291100                                       137   1e-38   Oryza sativa Japonica Group [Japonica rice]
gb|AIF75367.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    136   1e-38   
gb|AIF75353.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    136   1e-38   
gb|AFS41771.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    137   1e-38   
dbj|BAA00539.1|  small subunit of ribulose-1,5-bisphosphate carbo...    137   1e-38   
gb|AFS41765.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    137   1e-38   
gb|AIF75351.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    136   1e-38   
gb|AIF75359.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    136   1e-38   
gb|ABR26086.1|  ribulose bisphosphate carboxylase small chain c         135   1e-38   
gb|ABL97974.1|  ribulose bisphosphate carboxylase                       136   1e-38   
gb|AIF75355.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    136   2e-38   
ref|NP_001066559.1|  Os12g0274700                                       137   2e-38   
emb|CDX67402.1|  BnaA07g14420D                                          137   2e-38   
ref|XP_009125072.1|  PREDICTED: ribulose bisphosphate carboxylase...    137   2e-38   
gb|AIF75364.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    136   2e-38   
gb|AIF75361.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    136   2e-38   
ref|XP_003576920.1|  PREDICTED: ribulose bisphosphate carboxylase...    137   2e-38   
ref|WP_039311073.1|  hypothetical protein                               135   2e-38   
ref|XP_003577109.1|  PREDICTED: ribulose bisphosphate carboxylase...    137   2e-38   
gb|AIF75324.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    137   2e-38   
gb|ACQ90230.1|  virus-resistance protein                                139   2e-38   
ref|XP_007044343.1|  Ribulose bisphosphate carboxylase small chai...    135   2e-38   
ref|NP_001066607.1|  Os12g0292400                                       137   2e-38   
gb|ABA46900.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    137   2e-38   
gb|ABR25969.1|  ribulose bisphosphate carboxylase small chain c         136   2e-38   
emb|CAA59218.1|  ribulose-bisphosphate carboxylase                      135   2e-38   
sp|P00865.1|RBS1_SOYBN  RecName: Full=Ribulose bisphosphate carbo...    137   2e-38   
pdb|3AXM|S  Chain S, Structure Of Rice Rubisco In Complex With 6pg      135   2e-38   
gb|AAF19793.1|AF162210_1  ribulose-1,5-bisphosphate carboxylase/o...    137   2e-38   
gb|AIF75363.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    135   2e-38   
gb|KEH21539.1|  ribulose bisphosphate carboxylase small chain           137   2e-38   
pdb|1WDD|S  Chain S, Crystal Structure Of Activated Rice Rubisco ...    135   2e-38   
ref|XP_009380302.1|  PREDICTED: ribulose bisphosphate carboxylase...    137   2e-38   
gb|EAY82834.1|  hypothetical protein OsI_38046                          136   3e-38   
gb|AGV08375.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    136   3e-38   
ref|NP_001119331.1|  ribulose bisphosphate carboxylase small chai...    136   3e-38   
ref|XP_006391472.1|  hypothetical protein EUTSA_v10019202mg             136   3e-38   
gb|AAA33685.2|  ribulose 1,5 bisphosphate carboxylase                   135   3e-38   
sp|O65194.1|RBS_MEDSA  RecName: Full=Ribulose bisphosphate carbox...    136   4e-38   
sp|Q42516.1|RBS1_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    136   4e-38   
sp|P12468.1|RBS4_SOYBN  RecName: Full=Ribulose bisphosphate carbo...    136   4e-38   
gb|ABA46901.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    136   4e-38   
gb|AAA82069.1|  ribulose 1,5-bisphosphate carboxylase small subun...    136   4e-38   
gb|ABL97962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    136   4e-38   
ref|XP_006302885.1|  hypothetical protein CARUB_v10021016mg             136   4e-38   
sp|Q9XGX5.1|RBS2_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    136   5e-38   
ref|XP_009356790.1|  PREDICTED: ribulose bisphosphate carboxylase...    136   5e-38   
gb|KDP20120.1|  hypothetical protein JCGZ_05889                         135   5e-38   
gb|ABQ42552.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    135   5e-38   
sp|O24045.1|RBS_MUSAC  RecName: Full=Ribulose bisphosphate carbox...    135   5e-38   
gb|ADB85091.1|  ribulose 1,5-bisphosphate carboxylase small subunit     135   6e-38   
ref|XP_011099669.1|  PREDICTED: ribulose bisphosphate carboxylase...    135   6e-38   
ref|XP_009390221.1|  PREDICTED: ribulose bisphosphate carboxylase...    135   6e-38   
gb|AIF75292.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    135   7e-38   
sp|Q9XGX4.1|RBS3_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    135   7e-38   
gb|AAL15646.1|AF411547_1  ribulose-1,5-bisphosphate carboxylase s...    133   7e-38   
ref|XP_008807113.1|  PREDICTED: ribulose bisphosphate carboxylase...    135   7e-38   
gb|AFS41762.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    135   8e-38   
ref|XP_007033270.1|  Ribulose bisphosphate carboxylase (small cha...    135   9e-38   
ref|XP_009127519.1|  PREDICTED: ribulose bisphosphate carboxylase...    135   9e-38   
ref|XP_010521010.1|  PREDICTED: ribulose bisphosphate carboxylase...    135   9e-38   
ref|XP_009127518.1|  PREDICTED: ribulose bisphosphate carboxylase...    135   9e-38   
ref|XP_011099670.1|  PREDICTED: ribulose bisphosphate carboxylase...    135   1e-37   
gb|AIF75357.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    134   1e-37   
gb|KCW52064.1|  hypothetical protein EUGRSUZ_J01502                     135   1e-37   
gb|ABR45725.1|  RBCS1                                                   134   1e-37   
gb|AHC28978.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    134   2e-37   
gb|AAC14064.1|  ribulose 1,5-bisphosphate carboxylase small subunit     134   2e-37   
dbj|BAA35165.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    134   2e-37   
gb|AIB55758.1|  ribulose bisphosphate carboxylase small chain, pa...    133   2e-37   
emb|CAA53083.1|  ribulose-1,5-bisphosphate carboxylase /oxygenase...    134   2e-37   
ref|XP_008339672.1|  PREDICTED: ribulose bisphosphate carboxylase...    134   2e-37   
emb|CAA42618.1|  ribulose bisphosphate carboxylase                      134   2e-37   
ref|XP_007151650.1|  hypothetical protein PHAVU_004G064800g             134   2e-37   
sp|P29684.1|RBS_HEVBR  RecName: Full=Ribulose bisphosphate carbox...    134   2e-37   
emb|CDY42338.1|  BnaC02g17150D                                          134   2e-37   
gb|AGV54682.1|  ribulose bisphosphate carboxylase                       134   2e-37   
dbj|BAA35158.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    134   2e-37   
dbj|BAA35167.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    134   2e-37   
dbj|BAJ86022.1|  predicted protein                                      134   2e-37   
gb|EYU38174.1|  hypothetical protein MIMGU_mgv1a014707mg                134   2e-37   
dbj|BAJ90404.1|  predicted protein                                      134   2e-37   
dbj|BAA35162.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    134   2e-37   
dbj|BAA35145.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    134   2e-37   
gb|EYU38172.1|  hypothetical protein MIMGU_mgv1a014686mg                134   3e-37   
dbj|BAJ90202.1|  predicted protein                                      134   3e-37   
ref|XP_008352922.1|  PREDICTED: ribulose bisphosphate carboxylase...    134   3e-37   
dbj|BAA35150.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    133   3e-37   
gb|EMS48023.1|  Ribulose bisphosphate carboxylase small chain, ch...    133   3e-37   
dbj|BAB19810.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    134   3e-37   
ref|XP_009127523.1|  PREDICTED: ribulose bisphosphate carboxylase...    134   3e-37   
dbj|BAA35175.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    133   3e-37   
dbj|BAA35169.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    133   3e-37   
emb|CDY12616.1|  BnaA02g12840D                                          134   3e-37   
ref|XP_003573910.1|  PREDICTED: ribulose bisphosphate carboxylase...    134   3e-37   
gb|EMT21846.1|  Ribulose bisphosphate carboxylase small chain PW9...    134   3e-37   
ref|XP_010551266.1|  PREDICTED: ribulose bisphosphate carboxylase...    134   3e-37   
dbj|BAA35179.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    133   3e-37   
ref|XP_007151771.1|  hypothetical protein PHAVU_004G073400g             132   3e-37   
gb|AIF75326.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    134   3e-37   
gb|EMS44969.1|  Ribulose bisphosphate carboxylase small chain PW9...    133   3e-37   
sp|P17673.1|RBS_TRIRP  RecName: Full=Ribulose bisphosphate carbox...    134   3e-37   
dbj|BAK23963.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    133   4e-37   
gb|AIF75311.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    133   4e-37   
gb|ACA42439.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    134   4e-37   
gb|EMT21850.1|  Ribulose bisphosphate carboxylase small chain PW9...    133   4e-37   
ref|XP_003581511.1|  PREDICTED: ribulose bisphosphate carboxylase...    133   4e-37   
emb|CAA42617.1|  ribulose bisphosphate carboxylase                      132   4e-37   
gb|AIF75328.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    133   4e-37   
gb|ABA46899.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    133   4e-37   
dbj|BAA35153.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    133   4e-37   
gb|EMT06085.1|  hypothetical protein F775_43781                         133   4e-37   
sp|P07398.1|RBS3_WHEAT  RecName: Full=Ribulose bisphosphate carbo...    131   4e-37   
dbj|BAB19812.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    133   4e-37   
gb|EMT25898.1|  Ribulose bisphosphate carboxylase small chain PWS...    133   4e-37   
gb|AIF75365.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    132   4e-37   
gb|EMT21848.1|  Ribulose bisphosphate carboxylase small chain PW9...    133   4e-37   
emb|CAA10497.1|  hypothetical protein                                   133   4e-37   
sp|P00871.2|RBS1_WHEAT  RecName: Full=Ribulose bisphosphate carbo...    133   5e-37   
sp|P26667.1|RBS2_WHEAT  RecName: Full=Ribulose bisphosphate carbo...    133   5e-37   
dbj|BAA35161.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    132   5e-37   
dbj|BAA35156.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    132   5e-37   
emb|CAH10356.1|  ribulose 1,5 bisphosphate carboxylase/oxygenase,...    132   6e-37   
gb|EYU45444.1|  hypothetical protein MIMGU_mgv1a014737mg                133   6e-37   
gb|EMS47672.1|  Ribulose bisphosphate carboxylase small chain PWS...    133   6e-37   
ref|XP_010926041.1|  PREDICTED: ribulose bisphosphate carboxylase...    133   7e-37   
gb|EMT21849.1|  Ribulose bisphosphate carboxylase small chain PW9...    131   7e-37   
gb|EMS67205.1|  Ribulose bisphosphate carboxylase small chain, ch...    131   7e-37   
gb|EMS44970.1|  Ribulose bisphosphate carboxylase small chain PWS...    132   7e-37   
dbj|BAJ89884.1|  predicted protein                                      132   7e-37   
dbj|BAB19814.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    132   7e-37   
dbj|BAA35178.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    132   7e-37   
pdb|4HHH|S  Chain S, Structure Of Pisum Sativum Rubisco                 131   7e-37   
dbj|BAK23962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    132   8e-37   
emb|CAG25595.1|  putative rubisco small subunit                         132   8e-37   
dbj|BAA35151.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    132   8e-37   
gb|ABR45726.1|  RBCS1                                                   132   8e-37   
dbj|BAA35176.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    132   8e-37   
dbj|BAJ90550.1|  predicted protein                                      132   9e-37   
gb|AAA33686.1|  ribulose 1,5-bisphosphate carboxylase small subun...    132   9e-37   
gb|AAB70543.1|  ribulose 1,5-bisphosphate carboxylase small subunit     132   1e-36   
gb|EMS44968.1|  Ribulose bisphosphate carboxylase small chain PW9...    131   1e-36   
ref|WP_017428783.1|  hypothetical protein                               130   1e-36   
dbj|BAA35173.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    132   1e-36   
gb|EMT21847.1|  Ribulose bisphosphate carboxylase small chain PW9...    132   1e-36   
ref|XP_004962302.1|  PREDICTED: ribulose bisphosphate carboxylase...    132   1e-36   
emb|CAA10496.1|  hypothetical protein                                   132   1e-36   
dbj|BAJ89663.1|  predicted protein                                      130   1e-36   
emb|CAH10355.1|  ribulose 1,5 bisphosphate carboxylase/oxygenase,...    131   1e-36   
sp|Q40004.1|RBS_HORVU  RecName: Full=Ribulose bisphosphate carbox...    132   2e-36   
gb|AAF06100.1|  ribulose 1,5-bisphosphate carboxylase small chain...    132   2e-36   
gb|EMS44967.1|  Ribulose bisphosphate carboxylase small chain PW9...    130   2e-36   
gb|AAF06098.1|  ribulose 1,5-bisphosphate carboxylase small chain...    132   2e-36   
ref|XP_004962301.1|  PREDICTED: ribulose bisphosphate carboxylase...    131   2e-36   
gb|AAF07942.1|AF192773_1  ribulose-1,5-bisphosphate carboxylase s...    131   2e-36   
gb|AAP31674.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    129   3e-36   
ref|XP_010916368.1|  PREDICTED: ribulose bisphosphate carboxylase...    131   3e-36   
dbj|BAB19813.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    131   3e-36   
gb|AAC67588.1|  ribulose-1,5-bisphosphate carboxylase small subunit     130   3e-36   
dbj|BAA35148.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    130   4e-36   
dbj|BAA35170.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    130   4e-36   
emb|CDY42337.1|  BnaC02g17140D                                          131   4e-36   
dbj|BAA35172.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    130   4e-36   
ref|XP_004962610.1|  PREDICTED: ribulose bisphosphate carboxylase...    130   4e-36   
gb|AAF17590.1|AF202646_1  ribulose-1,5-bisphosphate carboxylase s...    130   5e-36   
dbj|BAA35147.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    130   5e-36   
gb|AAF17589.1|AF202645_1  ribulose-1,5-bisphosphate carboxylase s...    130   5e-36   
gb|AAC83374.1|  ribulose-1,5-bisphosphate carboxylase small subunit     130   5e-36   
gb|AAF07946.1|AF192777_1  ribulose-1,5-bisphosphate carboxylase s...    130   6e-36   
gb|AAF07945.1|AF192776_1  ribulose-1,5-bisphosphate carboxylase s...    130   6e-36   
gb|AAF17591.1|AF202647_1  ribulose-1,5-bisphosphate carboxylase s...    130   6e-36   
gb|AAF07947.1|AF192778_1  ribulose-1,5-bisphosphate carboxylase s...    130   7e-36   
gb|AAC78643.1|  ribulose-1,5-bisphosphate carboxylase small subunit     130   7e-36   
dbj|BAB19811.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    130   7e-36   
dbj|BAA35164.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    130   7e-36   
emb|CDY42341.1|  BnaC02g17180D                                          130   9e-36   
gb|AAF07949.1|AF192780_1  ribulose-1,5-bisphosphate carboxylase s...    129   9e-36   
dbj|BAP82418.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    130   1e-35   
gb|EPS63610.1|  ribulose bisphosphate carboxylase small chain           129   1e-35   
sp|O48550.1|RBS_ZANAE  RecName: Full=Ribulose bisphosphate carbox...    129   1e-35   
gb|ABR25937.1|  ribulose bisphosphate carboxylase small chain c         127   1e-35   
ref|XP_007033269.1|  Ribulose bisphosphate carboxylase (small cha...    129   2e-35   
sp|P13951.1|RBS_SINAL  RecName: Full=Ribulose bisphosphate carbox...    126   2e-35   
gb|AIF75330.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    129   3e-35   
dbj|BAA35166.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    128   3e-35   
gb|AEX60835.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    128   3e-35   
sp|O22572.1|RBS2_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    128   4e-35   
gb|AAC83372.1|  ribulose-1,5-bisphosphate carboxylase small subunit     128   5e-35   
ref|XP_011015710.1|  PREDICTED: ribulose bisphosphate carboxylase...    128   5e-35   
gb|AAF07985.1|AF200303_1  ribulose-1,5-bisphosphate carboxylase s...    127   5e-35   
sp|Q42915.1|RBS_MANES  RecName: Full=Ribulose bisphosphate carbox...    128   6e-35   
sp|O22573.1|RBS3_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    127   7e-35   
sp|O24634.1|RBS1_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    127   8e-35   
gb|AAF07943.1|AF192774_1  ribulose-1,5-bisphosphate carboxylase s...    127   1e-34   
ref|XP_009357814.1|  PREDICTED: ribulose bisphosphate carboxylase...    127   1e-34   
gb|AER24546.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    124   1e-34   
gb|AAF06097.1|  ribulose 1,5-bisphosphate carboxylase small chain...    127   1e-34   
gb|AFO59569.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    126   2e-34   
gb|ADT78691.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    127   2e-34   
gb|AIF75298.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    126   2e-34   
gb|AIF75299.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    125   2e-34   
gb|ABY66908.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    126   2e-34   
gb|AEX60837.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    126   2e-34   
gb|AEX60840.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    125   3e-34   
gb|AGJ76629.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    126   3e-34   
gb|AEB00556.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    126   3e-34   
gb|AAC83373.1|  ribulose-1,5-bisphosphate carboxylase small subunit     125   3e-34   
ref|NP_001031981.1|  ribulose bisphosphate carboxylase small chai...    125   3e-34   
ref|XP_006842277.1|  hypothetical protein AMTR_s00079p00061090          125   5e-34   
dbj|BAJ40065.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    125   5e-34   
ref|XP_002450304.1|  hypothetical protein SORBIDRAFT_05g003480          125   6e-34   
emb|CAA63441.1|  Rubisco                                                123   8e-34   
sp|O22645.1|RBS5_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    125   8e-34   
ref|XP_003555148.2|  PREDICTED: LOW QUALITY PROTEIN: ribulose bis...    125   9e-34   
sp|P00870.1|RBS1_SPIOL  RecName: Full=Ribulose bisphosphate carbo...    123   1e-33   
ref|XP_002276967.1|  PREDICTED: ribulose bisphosphate carboxylase...    124   1e-33   
ref|XP_007225932.1|  hypothetical protein PRUPE_ppa012174mg             124   1e-33   
gb|ABK96590.1|  unknown                                                 124   2e-33   
gb|ACN39871.1|  unknown                                                 123   2e-33   
ref|XP_008243231.1|  PREDICTED: ribulose bisphosphate carboxylase...    124   2e-33   
gb|ABY66910.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    122   2e-33   
prf||0709274A  carboxylase S,RBP                                        122   3e-33
emb|CBI15452.3|  unnamed protein product                                123   3e-33   



>sp|P26573.1|RBS8_NICPL RecName: Full=Ribulose bisphosphate carboxylase small chain 8B, 
chloroplastic; Short=RuBisCO small subunit 8B; Flags: Precursor 
[Nicotiana plumbaginifolia]
 emb|CAA31994.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
 gb|AAA34110.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
Length=180

 Score =   156 bits (394),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE+GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW
Sbjct  96   VPCLEFETERGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIAY
Sbjct  156  VRIIGFDNVRQVQCISFIAY  175



>gb|ABY21254.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   154 bits (390),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+AE++ECKK+YP AW
Sbjct  97   VPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQECKKSYPQAW  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  157  IRIIGFDNVRQVQCISFIAY  176



>sp|P26574.1|RBS1_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49413.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=181

 Score =   154 bits (390),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+AE++ECKK+YP AW
Sbjct  97   VPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQECKKSYPQAW  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  157  IRIIGFDNVRQVQCISFIAY  176



>ref|XP_010032637.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Eucalyptus grandis]
Length=181

 Score =   154 bits (389),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A+
Sbjct  97   VPCLEFETEKGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPTAF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQCI FIA+
Sbjct  157  VRIIGFDNKRQVQCISFIAF  176



>dbj|BAI53118.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
Length=181

 Score =   154 bits (389),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A+
Sbjct  97   VPCLEFETEKGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPTAF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQCI FIA+
Sbjct  157  VRIIGFDNKRQVQCISFIAF  176



>sp|P07180.1|RBS3A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3A/3C, 
chloroplastic; Short=RuBisCO small subunit 3A/3C; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA29402.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 emb|CAA29404.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 gb|AAA34190.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score =   154 bits (388),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AW
Sbjct  96   VPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIAY
Sbjct  156  VRIIGFDNVRQVQCISFIAY  175



>ref|XP_004232356.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic [Solanum lycopersicum]
 sp|P05349.1|RBS3B_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA29403.1| ribulose 1,5-bisphosphate carboxylase/oxyenase [Solanum lycopersicum]
 dbj|BAA01888.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score =   154 bits (388),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AW
Sbjct  96   VPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIAY
Sbjct  156  VRIIGFDNVRQVQCISFIAY  175



>sp|P32764.1|RBS3_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49417.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=181

 Score =   153 bits (387),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AW
Sbjct  97   VPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  157  IRIIGFDNVRQVQCISFIAY  176



>ref|XP_004233493.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Solanum lycopersicum]
 sp|P08706.2|RBS1_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; AltName: Full=LESS 
17; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34188.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
 emb|CAA29400.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=181

 Score =   153 bits (386),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE+GFVYRE +SSPGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AW
Sbjct  97   VPCLEFETERGFVYRENNSSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIAY
Sbjct  157  VRIIGFDNVRQVQCISFIAY  176



>gb|AAA34191.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=181

 Score =   153 bits (386),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE+GFVYRE +SSPGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AW
Sbjct  97   VPCLEFETERGFVYRENNSSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIAY
Sbjct  157  VRIIGFDNVRQVQCISFIAY  176



>gb|ABY21253.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   153 bits (386),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTD TQV+AE++ECKK+YP AW
Sbjct  97   VPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDTTQVLAEVQECKKSYPQAW  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  157  IRIIGFDNVRQVQCISFIAY  176



>sp|P04715.1|RBS2_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU11A, 
chloroplastic; Short=RuBisCO small subunit SSU11A; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS1 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu11A) precursor - garden petunia
 emb|CAA27445.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score =   152 bits (385),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE+H+SP YYDGRYWTMWKLPMFGCTDATQV+ EL+E KKAYP AW
Sbjct  96   VPCLEFETEHGFVYREYHASPRYYDGRYWTMWKLPMFGCTDATQVLGELQEAKKAYPNAW  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  156  IRIIGFDNVRQVQCISFIAY  175



>sp|P04714.1|RBS1_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU8, 
chloroplastic; Short=RuBisCO small subunit SSU8; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS8 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu8) precursor - garden petunia
 emb|CAA27444.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score =   152 bits (384),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE+H+SP YYDGRYWTMWKLPMFGCTDATQV+ EL+E KKAYP AW
Sbjct  96   VPCLEFETEHGFVYREYHASPRYYDGRYWTMWKLPMFGCTDATQVLGELQEAKKAYPNAW  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  156  IRIIGFDNVRQVQCISFIAY  175



>ref|WP_026003795.1| hypothetical protein, partial [Pseudomonas luteola]
Length=120

 Score =   150 bits (379),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AW
Sbjct  39   VPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  98

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIAY
Sbjct  99   VRIIGFDNVRQVQCISFIAY  118



>ref|XP_009795055.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009795056.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009772497.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 sp|P69249.1|RBS_TOBAC RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; AltName: Full=TSSU3-8; 
Flags: Precursor [Nicotiana tabacum]
 sp|P69250.1|RBS1_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA25862.1| unnamed protein product [Nicotiana sylvestris]
 emb|CAA26208.1| small subunit ribulose 1,5-bisphosphate carboxylase [Nicotiana 
tabacum]
 prf||1103193A carboxylase,RBP
Length=180

 Score =   152 bits (384),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW
Sbjct  96   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  156  IRIIGFDNVRQVQCISFIAY  175



>ref|XP_009800809.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   152 bits (383),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW
Sbjct  97   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  157  IRIIGFDNVRQVQCISFIAY  176



>gb|AFW90575.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Solanum tuberosum]
Length=181

 Score =   152 bits (383),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE++ECK AYP AW
Sbjct  97   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQECKNAYPQAW  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  157  IRIIGFDNVRQVQCISFIAY  176



>ref|XP_006358055.1| PREDICTED: ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Solanum tuberosum]
Length=181

 Score =   152 bits (383),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE++ECK AYP AW
Sbjct  97   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQECKNAYPQAW  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  157  IRIIGFDNVRQVQCISFIAY  176



>gb|AAA34192.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=180

 Score =   151 bits (382),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AW
Sbjct  96   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIAY
Sbjct  156  VRIIGFDNVRQVQCISFIAY  175



>ref|XP_009758143.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana sylvestris]
 sp|P22433.1|RBS2_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain S41, 
chloroplastic; Short=RuBisCO small subunit S41; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA37516.1| NySS41 [Nicotiana sylvestris]
Length=181

 Score =   151 bits (382),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW
Sbjct  97   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  157  IRIIGFDNVRQVQCISFIAY  176



>sp|P26575.1|RBSA_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49414.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   151 bits (382),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW
Sbjct  96   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  156  IRIIGFDNVRQVQCISFIAY  175



>ref|XP_004234568.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic [Solanum lycopersicum]
 sp|P07179.2|RBS2A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; AltName: Full=LESS 
5; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34189.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
(EC 4.1.1.39) [Solanum lycopersicum]
 emb|CAA29401.2| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=180

 Score =   151 bits (382),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AW
Sbjct  96   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIAY
Sbjct  156  VRIIGFDNVRQVQCISFIAY  175



>sp|O65349.1|RBS_CAPAN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Capsicum annuum]
 gb|AAC17126.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Capsicum annuum]
Length=187

 Score =   152 bits (383),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+ E++E KKAYP AW
Sbjct  96   VPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAW  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  156  IRIIGFDNVRQVQCISFIAY  175



>ref|XP_006363111.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 ref|XP_006363112.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 sp|P26577.1|RBSC_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic; Short=RuBisCO small subunit 2C; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49416.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   151 bits (382),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW
Sbjct  96   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  156  IRIIGFDNVRQVQCISFIAY  175



>sp|P26576.1|RBSB_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49415.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   151 bits (382),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW
Sbjct  96   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  156  IRIIGFDNVRQVQCISFIAY  175



>gb|AHI85721.1| stress-induced protein 16 [Capsicum annuum]
Length=180

 Score =   151 bits (382),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+ E++E KKAYP AW
Sbjct  96   VPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAW  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  156  IRIIGFDNVRQVQCISFIAY  175



>gb|AGT97045.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Capsicum annuum]
Length=180

 Score =   151 bits (381),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+ E++E KKAYP AW
Sbjct  96   VPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAW  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  156  IRIIGFDNVRQVQCISFIAY  175



>gb|AAR83879.1| Cristal-Glass1 protein [Capsicum annuum]
Length=180

 Score =   151 bits (381),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+ E++E KKAYP AW
Sbjct  96   VPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAW  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  156  IRIIGFDNVRQVQCISFIAY  175



>gb|ABY21255.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   151 bits (381),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE G VYRE H SPGYYDGRYW MWKLPMFGCTDATQV+AE++ECKK+YP AW
Sbjct  97   VPCLEFETEHGIVYREKHKSPGYYDGRYWNMWKLPMFGCTDATQVLAEVQECKKSYPQAW  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  157  IRIIGFDNVRQVQCISFIAY  176



>pdb|3RUB|S Chain S, Crystal Structure Of The Unactivated Form Of Ribulose-1,5-Bisphosphate 
Carboxylase(Slash)oxygenase From Tobacco 
Refined At 2.0-Angstroms Resolution
 pdb|1RLC|S Chain S, Crystal Structure Of The Unactivated Ribulose 1, 5-Bisphosphate 
Carboxylase(Slash)oxygenase Complexed With A Transition 
State Analog, 2-Carboxy-D-Arabinitol 1,5-Bisphosphate
 pdb|1RLD|S Chain S, Solid-State Phase Transition In The Crystal Structure 
Of Ribulose 1,5- Biphosphate Carboxylase(Slash)oxygenase
 pdb|1RLD|T Chain T, Solid-State Phase Transition In The Crystal Structure 
Of Ribulose 1,5- Biphosphate Carboxylase(Slash)oxygenase
 pdb|1EJ7|S Chain S, Crystal Structure Of Unactivated Tobacco Rubisco With 
Bound Phosphate Ions
Length=123

 Score =   148 bits (374),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW
Sbjct  39   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  98

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  99   IRIIGFDNVRQVQCISFIAY  118



>gb|AFB70994.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Nicotiana attenuata]
Length=180

 Score =   150 bits (379),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA QV+AE+EE KKAYP AW
Sbjct  96   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDAAQVLAEVEEAKKAYPQAW  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  156  IRIIGFDNVRQVQCISFIAY  175



>gb|AFK36660.1| unknown [Lotus japonicus]
 gb|AFK45650.1| unknown [Lotus japonicus]
Length=177

 Score =   150 bits (378),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFG TDA+QV+ ELEE KKAYP A+
Sbjct  93   VPCLEFETEKGFVYRENHKSPGYYDGRYWTMWKLPMFGTTDASQVLKELEEAKKAYPNAF  152

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN+RQVQCI FIA+
Sbjct  153  IRIIGFDNKRQVQCISFIAH  172



>ref|XP_009767108.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   150 bits (378),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW
Sbjct  97   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  157  IRIIGFDNVRQVQCISFIAY  176



>ref|XP_009602965.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana tomentosiformis]
Length=179

 Score =   150 bits (378),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW
Sbjct  95   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  155  IRIIGFDNVRQVQCISFIAY  174



>ref|XP_009625434.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana tomentosiformis]
Length=181

 Score =   150 bits (378),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW
Sbjct  97   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  157  IRIIGFDNVRQVQCISFIAY  176



>ref|XP_010044264.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic-like [Eucalyptus grandis]
 dbj|BAI53120.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
 gb|KCW86324.1| hypothetical protein EUGRSUZ_B03013 [Eucalyptus grandis]
Length=179

 Score =   150 bits (378),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE HSSPGYYDGRYWTMWKLPMFGCTD+ QV+ ELEE KKAYP A+
Sbjct  95   VPCLEFELEHGFVYREHHSSPGYYDGRYWTMWKLPMFGCTDSAQVLKELEEAKKAYPTAF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN+RQVQCI FIAY
Sbjct  155  IRIIGFDNKRQVQCISFIAY  174



>ref|XP_009774104.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   150 bits (378),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW
Sbjct  97   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  157  IRIIGFDNVRQVQCISFIAY  176



>ref|NP_001275244.1| ribulose bisphosphate carboxylase small chain C, chloroplastic 
[Solanum tuberosum]
 sp|P10647.1|RBS0_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain C, 
chloroplastic; Short=RuBisCO small subunit C; Flags: Precursor 
[Solanum tuberosum]
 gb|AAA33838.1| ribulose bisphosphate carboxylase (EC 4.1.1.39) [Solanum tuberosum]
Length=181

 Score =   150 bits (378),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE +SSPGYYDGRYWTMWKLPMFGCTD TQV+AE++E K AYP AW
Sbjct  97   VPCLEFETEHGFVYREHNSSPGYYDGRYWTMWKLPMFGCTDGTQVLAEVQEAKNAYPQAW  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  157  IRIIGFDNVRQVQCISFIAY  176



>gb|AAA34111.1| ribulose-1,5-bisphosphate carboxylase, partial [Nicotiana sylvestris]
 prf||0905192A carboxylase,RBP
Length=86

 Score =   147 bits (370),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW
Sbjct  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  61

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  62   IRIIGFDNVRQVQCISFIAY  81



>ref|XP_009595081.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 ref|XP_009609566.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 gb|AAP03874.1| putative ribulose bisphosphate carboxylase small subunit protein 
precursor [Nicotiana tabacum]
Length=180

 Score =   149 bits (377),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE+GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+ E KKAYP AW
Sbjct  96   VPCLEFETERGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVGEAKKAYPEAW  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  156  IRIIGFDNVRQVQCISFIAY  175



>ref|WP_037767734.1| hypothetical protein [Streptomyces olindensis]
 gb|KDN74154.1| hypothetical protein DF19_37695 [Streptomyces olindensis]
Length=123

 Score =   147 bits (372),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+ E++E KKAYP AW
Sbjct  39   VPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAW  98

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  99   IRIIGFDNVRQVQCISFIAY  118



>gb|ABS72189.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
1A [Corchorus olitorius]
Length=183

 Score =   149 bits (377),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP A+
Sbjct  96   IPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPDAF  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDNRRQVQCI FIAY
Sbjct  156  IRIIGFDNRRQVQCISFIAY  175



>ref|XP_004303137.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=182

 Score =   149 bits (376),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE EKGFVYRE H SPGYYDGRYWTMWKLPMFGCTDA+QV+ ELEE KKAYP A+
Sbjct  98   VPCLEFELEKGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDASQVLKELEEAKKAYPNAF  157

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  158  IRIIGFDNVRQVQCISFIAY  177



>emb|CAH59401.1| Rubisco SSU [Plantago major]
Length=177

 Score =   149 bits (375),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+AELEECKK YP AW
Sbjct  93   IPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDASQVIAELEECKKEYPNAW  152

Query  182  VRILGFDNRRQVQCIMFIA  238
            VRI+GFDN RQVQCI FIA
Sbjct  153  VRIIGFDNVRQVQCISFIA  171



>sp|Q41351.1|RBS_STELP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Stellaria longipes]
 gb|AAA69018.1| ribulose 1,5-bisphosphate carboxylase small subunit [Stellaria 
longipes]
Length=180

 Score =   149 bits (375),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE  SSPGYYDGRYWTMWKLPMFGCTDATQV AE++E KKAYP A 
Sbjct  96   VPCLEFETEHGFVYREHTSSPGYYDGRYWTMWKLPMFGCTDATQVAAEVQEAKKAYPDAH  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  156  IRIIGFDNVRQVQCISFIAY  175



>ref|XP_010265138.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score =   148 bits (373),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+AELEE KKAYP A+
Sbjct  98   IPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDSSQVLAELEEAKKAYPNAF  157

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN+RQVQCI FIAY
Sbjct  158  IRIIGFDNKRQVQCISFIAY  177



>ref|XP_010263805.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score =   148 bits (373),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+AELEE KKAYP A+
Sbjct  98   IPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDSSQVLAELEEAKKAYPNAF  157

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN+RQVQCI FIAY
Sbjct  158  IRIIGFDNKRQVQCISFIAY  177



>ref|XP_009357812.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=183

 Score =   147 bits (372),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP A+
Sbjct  99   VPCLEFELETGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPNAF  158

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  159  IRIIGFDNVRQVQCISFIAY  178



>ref|XP_008381263.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Malus domestica]
Length=183

 Score =   147 bits (372),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP A+
Sbjct  99   VPCLEFELEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPNAF  158

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  159  IRIIGFDNVRQVQCISFIAY  178



>gb|KCW52065.1| hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis]
Length=180

 Score =   147 bits (372),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A+
Sbjct  97   VPCLEFETE-GFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPTAF  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQCI FIA+
Sbjct  156  VRIIGFDNKRQVQCISFIAF  175



>gb|AFK48034.1| unknown [Lotus japonicus]
Length=181

 Score =   147 bits (372),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGC+DATQV+ EL+E  KAYP A+
Sbjct  97   VPCLEFETEKGFVYRENHKSPGYYDGRYWTMWKLPMFGCSDATQVLKELDEAVKAYPNAF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIA+
Sbjct  157  VRIIGFDNVRQVQCISFIAH  176



>pdb|4RUB|S Chain S, A Crystal Form Of Ribulose-1,5-Bisphosphate Carboxylase(Slash) 
Oxygenase From Nicotiana Tabacum In The Activated 
State
 pdb|4RUB|T Chain T, A Crystal Form Of Ribulose-1,5-Bisphosphate Carboxylase(Slash) 
Oxygenase From Nicotiana Tabacum In The Activated 
State
 pdb|4RUB|U Chain U, A Crystal Form Of Ribulose-1,5-Bisphosphate Carboxylase(Slash) 
Oxygenase From Nicotiana Tabacum In The Activated 
State
 pdb|4RUB|V Chain V, A Crystal Form Of Ribulose-1,5-Bisphosphate Carboxylase(Slash) 
Oxygenase From Nicotiana Tabacum In The Activated 
State
Length=123

 Score =   145 bits (367),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+ E KKAYP AW
Sbjct  39   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVGEAKKAYPQAW  98

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  99   IRIIGFDNVRQVQCISFIAY  118



>ref|XP_010263795.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=184

 Score =   147 bits (372),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+AELEE KKAYP A+
Sbjct  100  IPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDSSQVLAELEEAKKAYPNAF  159

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN+RQVQCI FIAY
Sbjct  160  IRIIGFDNKRQVQCISFIAY  179



>prf||0902172A carboxylase/oxygenase,RBP
Length=123

 Score =   145 bits (365),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+ E KKAYP AW
Sbjct  39   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVGEAKKAYPEAW  98

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  99   IRIIGFDNVRQVQCISFIAY  118



>sp|Q43832.1|RBS2_SPIOL RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Spinacia oleracea]
 emb|CAA66201.1| ribulose-bisphosphate carboxylase [Spinacia oleracea]
Length=180

 Score =   147 bits (370),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFET+ GFVYRE H+SPGYYDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A+
Sbjct  96   VPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAF  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFD+ RQVQC+ FIAY
Sbjct  156  IRIIGFDSNRQVQCVSFIAY  175



>gb|AAB81105.1| ribulose 1,5-bisphosphate carboxylase small subunit [Spinacia 
oleracea]
Length=180

 Score =   147 bits (370),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFET+ GFVYRE H+SPGYYDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A+
Sbjct  96   VPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAF  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFD+ RQVQC+ FIAY
Sbjct  156  IRIIGFDSNRQVQCVSFIAY  175



>emb|CAH59404.1| Rubisco SSU [Plantago major]
Length=174

 Score =   146 bits (369),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTDA+QV+AELEECKK YP AW
Sbjct  90   IPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDASQVIAELEECKKEYPNAW  149

Query  182  VRILGFDNRRQVQCIMFIA  238
            VRI+GFDN RQVQCI FIA
Sbjct  150  VRIIGFDNVRQVQCISFIA  168



>ref|XP_002521232.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
 gb|EEF41184.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
Length=181

 Score =   146 bits (369),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGC+D+TQV+ EL+E KKAYP ++
Sbjct  95   IPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCSDSTQVLKELDEAKKAYPNSF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDNRRQVQCI FIAY
Sbjct  155  IRIIGFDNRRQVQCISFIAY  174



>dbj|BAE46384.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Panax ginseng]
Length=183

 Score =   146 bits (368),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ E+EECKK YP A+
Sbjct  97   VPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSSQVLKEVEECKKEYPNAY  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIA+
Sbjct  157  IRIIGFDNVRQVQCISFIAF  176



>gb|AFK33868.1| unknown [Lotus japonicus]
Length=177

 Score =   145 bits (367),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETEKGFVYRE   SPGYYDGRYWTMWKLPMFG TDA+QV+ ELEE KKAYP A+
Sbjct  93   VPCLEFETEKGFVYRENLKSPGYYDGRYWTMWKLPMFGTTDASQVLKELEEAKKAYPNAF  152

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN+RQVQCI FIA+
Sbjct  153  IRIIGFDNKRQVQCISFIAH  172



>ref|WP_039311749.1| hypothetical protein [Paenibacillus sp. IHB B 3415]
 gb|KHL91125.1| hypothetical protein QW71_36450 [Paenibacillus sp. IHB B 3415]
Length=123

 Score =   144 bits (363),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFETE GFVYRE H+SPGYYDGRYWTMWKLPMFGCTD++QV+ EL+EC K YP A+
Sbjct  39   IPCLEFETEHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDSSQVLKELDECTKEYPKAF  98

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQCI FIA+
Sbjct  99   VRIIGFDNKRQVQCISFIAH  118



>ref|XP_007215051.1| hypothetical protein PRUPE_ppa012123mg [Prunus persica]
 gb|EMJ16250.1| hypothetical protein PRUPE_ppa012123mg [Prunus persica]
Length=183

 Score =   146 bits (368),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE EKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKA P ++
Sbjct  99   VPCLEFELEKGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKANPNSF  158

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  159  IRIIGFDNVRQVQCISFIAY  178



>pdb|1IR1|S Chain S, Crystal Structure Of Spinach Ribulose-1,5-Bisphosphate 
CarboxylaseOXYGENASE (RUBISCO) COMPLEXED WITH CO2, MG2+ AND 
2- Carboxyarabinitol-1,5-Bisphosphate
 pdb|1IR1|T Chain T, Crystal Structure Of Spinach Ribulose-1,5-Bisphosphate 
CarboxylaseOXYGENASE (RUBISCO) COMPLEXED WITH CO2, MG2+ AND 
2- Carboxyarabinitol-1,5-Bisphosphate
 pdb|1IR1|U Chain U, Crystal Structure Of Spinach Ribulose-1,5-Bisphosphate 
CarboxylaseOXYGENASE (RUBISCO) COMPLEXED WITH CO2, MG2+ AND 
2- Carboxyarabinitol-1,5-Bisphosphate
 pdb|1IR1|V Chain V, Crystal Structure Of Spinach Ribulose-1,5-Bisphosphate 
CarboxylaseOXYGENASE (RUBISCO) COMPLEXED WITH CO2, MG2+ AND 
2- Carboxyarabinitol-1,5-Bisphosphate
Length=123

 Score =   144 bits (362),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFET+ GFVYRE H+SPGYYDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A+
Sbjct  39   VPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAF  98

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFD+ RQVQC+ FIAY
Sbjct  99   IRIIGFDSNRQVQCVSFIAY  118



>gb|AAW31667.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Ammopiptanthus mongolicus]
Length=174

 Score =   145 bits (366),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGC+DA+QV+ ELEECKK YP A+
Sbjct  88   VPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCSDASQVMKELEECKKEYPTAF  147

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQCI FIAY
Sbjct  148  VRIIGFDNKRQVQCISFIAY  167



>ref|XP_008244506.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X1 [Prunus mume]
Length=182

 Score =   145 bits (366),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE EKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKA P ++
Sbjct  98   VPCLEFELEKGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKANPNSF  157

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  158  IRIIGFDNVRQVQCISFIAY  177



>sp|Q02980.1|RBS_MALSP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Malus sp.]
 emb|CAA46475.1| ribulose bisphosphate carboxylase [Malus sp.]
Length=183

 Score =   145 bits (366),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP ++
Sbjct  99   VPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSF  158

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  159  IRIIGFDNVRQVQCISFIAY  178



>ref|XP_009342656.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Pyrus x bretschneideri]
Length=183

 Score =   145 bits (366),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP ++
Sbjct  99   VPCLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSF  158

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  159  IRIIGFDNVRQVQCISFIAY  178



>ref|XP_008368660.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X1 [Malus domestica]
Length=179

 Score =   145 bits (366),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP ++
Sbjct  95   VPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  155  IRIIGFDNVRQVQCISFIAY  174



>sp|P24007.1|RBS_PYRPY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Pyrus pyrifolia]
 dbj|BAA00450.1| RuBisCO small subunit [Pyrus pyrifolia var. culta]
Length=183

 Score =   145 bits (366),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP ++
Sbjct  99   VPCLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSF  158

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  159  IRIIGFDNVRQVQCISFIAY  178



>ref|XP_004299075.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=180

 Score =   145 bits (365),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE  +SPGYYDGRYWTMWKLPMFGCTDA+QV+AELEE KK YP A+
Sbjct  96   VPCLEFELEHGFVYREHGNSPGYYDGRYWTMWKLPMFGCTDASQVIAELEEAKKTYPEAF  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQC+ FIAY
Sbjct  156  IRIIGFDNIRQVQCVSFIAY  175



>emb|CAD21856.1| putative ribulose 1,5 biphosphate carboxylase small subunit percursor 
[Rumex obtusifolius]
Length=181

 Score =   145 bits (365),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEF+   G VYRE H SPGYYDGRYWTMWKLPMFGCTDATQVVAELEE KKAYP A+
Sbjct  93   VPCLEFDVGPGAVYREHHHSPGYYDGRYWTMWKLPMFGCTDATQVVAELEEAKKAYPHAF  152

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQC+ FIAY
Sbjct  153  VRIIGFDNVRQVQCVSFIAY  172



>pdb|1AUS|S Chain S, Activated Unliganded Spinach Rubisco
 pdb|8RUC|I Chain I, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
Bisphosphate
 pdb|8RUC|J Chain J, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
Bisphosphate
 pdb|8RUC|K Chain K, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
Bisphosphate
 pdb|8RUC|L Chain L, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
Bisphosphate
 pdb|1RBO|S Chain S, Spinach Rubisco In Complex With The Inhibitor 2-carboxyarabinitol-1,5- 
Diphosphate
 pdb|1RBO|C Chain C, Spinach Rubisco In Complex With The Inhibitor 2-carboxyarabinitol-1,5- 
Diphosphate
 pdb|1RBO|F Chain F, Spinach Rubisco In Complex With The Inhibitor 2-carboxyarabinitol-1,5- 
Diphosphate
 pdb|1RBO|I Chain I, Spinach Rubisco In Complex With The Inhibitor 2-carboxyarabinitol-1,5- 
Diphosphate
 pdb|1RCO|S Chain S, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1RCO|C Chain C, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1RCO|F Chain F, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1RCO|I Chain I, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1RCO|M Chain M, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1RCO|P Chain P, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1AA1|S Chain S, Activated Spinach Rubisco In Complex With The Product 
3- Phosphoglycerate
 pdb|1AA1|C Chain C, Activated Spinach Rubisco In Complex With The Product 
3- Phosphoglycerate
 pdb|1AA1|F Chain F, Activated Spinach Rubisco In Complex With The Product 
3- Phosphoglycerate
 pdb|1AA1|I Chain I, Activated Spinach Rubisco In Complex With The Product 
3- Phosphoglycerate
 pdb|1RCX|S Chain S, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|C Chain C, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|F Chain F, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|I Chain I, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|M Chain M, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|P Chain P, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|T Chain T, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|W Chain W, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RXO|S Chain S, Activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5- Bisphosphate And Calcium
 pdb|1RXO|C Chain C, Activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5- Bisphosphate And Calcium
 pdb|1RXO|F Chain F, Activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5- Bisphosphate And Calcium
 pdb|1RXO|I Chain I, Activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5- Bisphosphate And Calcium
 pdb|1RCO|T Chain T, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1RCO|W Chain W, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1UPM|C Chain C, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|F Chain F, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|I Chain I, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|M Chain M, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|P Chain P, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|S Chain S, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|T Chain T, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|W Chain W, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPP|I Chain I, Spinach Rubisco In Complex With 2-Carboxyarabinitol 
2 Bisphosphate And Calcium.
 pdb|1UPP|J Chain J, Spinach Rubisco In Complex With 2-Carboxyarabinitol 
2 Bisphosphate And Calcium.
 pdb|1UPP|K Chain K, Spinach Rubisco In Complex With 2-Carboxyarabinitol 
2 Bisphosphate And Calcium.
 pdb|1UPP|L Chain L, Spinach Rubisco In Complex With 2-Carboxyarabinitol 
2 Bisphosphate And Calcium.
 pdb|1AUS|T Chain T, Activated Unliganded Spinach Rubisco
 pdb|1AUS|U Chain U, Activated Unliganded Spinach Rubisco
 pdb|1AUS|V Chain V, Activated Unliganded Spinach Rubisco
Length=123

 Score =   143 bits (360),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFET+ GFVYRE H+SPGYYDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A+
Sbjct  39   VPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAF  98

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFD+ R+VQCI FIAY
Sbjct  99   IRIIGFDSNREVQCISFIAY  118



>sp|Q96542.1|RBS_BETPN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Betula pendula]
 emb|CAA69102.1| ribulose-bisphosphate carboxylase [Betula pendula]
Length=182

 Score =   145 bits (365),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGC D++QV+ ELEECKKAYP A+
Sbjct  98   IPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCNDSSQVLKELEECKKAYPSAF  157

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN+RQVQ I FIAY
Sbjct  158  IRIIGFDNKRQVQIISFIAY  177



>gb|AFK42721.1| unknown [Lotus japonicus]
Length=182

 Score =   145 bits (365),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGC+DA QV+ EL+E  +AYP A+
Sbjct  98   VPCLEFETEKGFVYRENHKSPGYYDGRYWTMWKLPMFGCSDAAQVLKELDEAVRAYPNAF  157

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIA+
Sbjct  158  VRIIGFDNVRQVQCISFIAH  177



>gb|ABK95229.1| unknown [Populus trichocarpa]
 gb|ABK95250.1| unknown [Populus trichocarpa]
Length=182

 Score =   145 bits (365),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE EKG+VYRE HSSPGYYDGRYWTMWKLPMFGCT+A+QV+ ELEE KKAYP A+
Sbjct  98   VPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMFGCTEASQVLLELEEAKKAYPNAF  157

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCI FIA
Sbjct  158  IRIIGFDNTRQVQCISFIA  176



>ref|XP_002305162.2| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
 gb|ABK95372.1| unknown [Populus trichocarpa]
 gb|ABK95841.1| unknown [Populus trichocarpa]
 gb|EEE85673.2| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
Length=182

 Score =   145 bits (365),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE EKG+VYRE HSSPGYYDGRYWTMWKLPMFGCT+A+QV+ ELEE KKAYP A+
Sbjct  98   VPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMFGCTEASQVLLELEEAKKAYPNAF  157

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCI FIA
Sbjct  158  IRIIGFDNTRQVQCISFIA  176



>sp|Q42823.1|RBS_GLYTA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Glycine tabacina]
 gb|AAA82071.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Glycine tabacina]
Length=178

 Score =   144 bits (363),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP A+
Sbjct  94   IPCLEFELEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNVRQVQCISFIAY  173



>gb|AAA33716.1| ribulose 1,5-bisphosphate carboxylase, partial [Petunia x hybrida]
Length=106

 Score =   142 bits (357),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE +  F+YRE+H+SPGYYDGRYWTMWKLPMFGCTDATQV+ EL+E KKAYP AW
Sbjct  28   VPCLEFELKHKFIYREYHASPGYYDGRYWTMWKLPMFGCTDATQVLGELQEAKKAYPNAW  87

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GF+N RQVQCI FIA
Sbjct  88   IRIIGFENVRQVQCISFIA  106



>ref|XP_002531624.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF30752.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
Length=180

 Score =   144 bits (362),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE H SPGYYDGR WTMWKLPMFGCTD++QV+ ELEE KKAYP ++
Sbjct  96   VPCLEFELEHGFVYRENHRSPGYYDGRCWTMWKLPMFGCTDSSQVLKELEEAKKAYPNSF  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN+RQVQCI FIAY
Sbjct  156  IRIIGFDNKRQVQCISFIAY  175



>gb|AIR75141.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum nuttallianum]
Length=165

 Score =   143 bits (361),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFETE GFVYRE  ++PGYYDGRYWTMWKLPMFGCTD  QVV EL+ECKKAYP A+
Sbjct  88   IPCLEFETEHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPAQVVNELDECKKAYPNAF  147

Query  182  VRILGFDNRRQVQCIMFI  235
            +RI+GFDN+RQVQCI FI
Sbjct  148  IRIIGFDNKRQVQCISFI  165



>gb|ABK96567.1| unknown [Populus trichocarpa x Populus deltoides]
Length=181

 Score =   144 bits (362),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPMFGCT+A+QV+ ELEE KKAYP ++
Sbjct  97   VPCLEFELEKGWVYREHHQSPGYYDGRYWTMWKLPMFGCTEASQVLIELEEAKKAYPNSF  156

Query  182  VRILGFDNRRQVQCIMFIA  238
            VRI+GFDN RQVQCI FIA
Sbjct  157  VRIIGFDNTRQVQCISFIA  175



>emb|CAD11990.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Coffea arabica]
 emb|CAD11991.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Coffea arabica]
Length=181

 Score =   143 bits (361),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE EKGFVYRE+H SPGYYDGRYWTMWKLPM+GCTDATQV+ E+ EC K YP  W
Sbjct  97   VPCLEFELEKGFVYREYHRSPGYYDGRYWTMWKLPMYGCTDATQVLNEVGECLKEYPNCW  156

Query  182  VRILGFDNRRQVQCIMFIA  238
            VRI+GFDN RQVQCI FIA
Sbjct  157  VRIIGFDNVRQVQCISFIA  175



>ref|XP_010693059.1| PREDICTED: ribulose bisphosphate carboxylase small chain [Beta 
vulgaris subsp. vulgaris]
Length=180

 Score =   143 bits (361),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD  QVV E+EE KKAYP A+
Sbjct  96   IPCLEFEVKDGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAF  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQCI FIAY
Sbjct  156  VRIIGFDNKRQVQCISFIAY  175



>ref|XP_010693073.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=180

 Score =   143 bits (361),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD  QVV E+EE KKAYP A+
Sbjct  96   IPCLEFEVKDGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAF  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQCI FIAY
Sbjct  156  VRIIGFDNKRQVQCISFIAY  175



>gb|AEJ33935.1| chloroplast putative ribulose-1,5-bisphosphate carboxylase/oxygenase 
small subunit [Wolffia australiana]
Length=177

 Score =   143 bits (360),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EF  E GFVYRE+H+SPGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +
Sbjct  96   IPCIEFSKE-GFVYREYHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPDYF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQC+ FIAY
Sbjct  155  VRIIGFDNKRQVQCVSFIAY  174



>ref|XP_006383456.1| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
 gb|ABK95904.1| unknown [Populus trichocarpa]
 gb|ABK96181.1| unknown [Populus trichocarpa]
 gb|ERP61253.1| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
Length=181

 Score =   143 bits (361),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPMFGCT+A+QV+ ELEE KKAYP ++
Sbjct  97   VPCLEFELEKGWVYREHHQSPGYYDGRYWTMWKLPMFGCTEASQVLIELEEAKKAYPNSF  156

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCI FIA
Sbjct  157  IRIIGFDNTRQVQCISFIA  175



>ref|XP_010693054.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=179

 Score =   143 bits (360),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE + GFVYRE ++SPGYYDGRYWTMWKLPMFGCTD  QVV E+EE KKAYP A+
Sbjct  95   IPCLEFEVKDGFVYREHNNSPGYYDGRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQCI FIAY
Sbjct  155  VRIIGFDNKRQVQCISFIAY  174



>gb|KDP29409.1| hypothetical protein JCGZ_18330 [Jatropha curcas]
Length=153

 Score =   142 bits (358),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ ELEE K AYP ++
Sbjct  75   VPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSAQVLKELEEAKTAYPNSF  134

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN+RQVQCI FIA
Sbjct  135  IRIIGFDNKRQVQCISFIA  153



>ref|XP_010036887.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW48548.1| hypothetical protein EUGRSUZ_K02223 [Eucalyptus grandis]
Length=181

 Score =   143 bits (360),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE EKGFVYR+ H SPGYYDGRYWTMWKLPMFGCTD  QV+ EL+E  K YP A+
Sbjct  97   VPCLEFELEKGFVYRDNHKSPGYYDGRYWTMWKLPMFGCTDPLQVLKELDEAIKTYPNAF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQCI FIAY
Sbjct  157  VRIIGFDNKRQVQCISFIAY  176



>emb|CBY05833.1| Ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Coffea canephora]
 emb|CBY89197.1| ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Coffea canephora]
Length=181

 Score =   143 bits (360),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE EKG VYRE+H SPGYYDGRYWTMWKLPMFGCTDATQV+ E+ EC K YP  W
Sbjct  97   IPCLEFELEKGHVYREYHRSPGYYDGRYWTMWKLPMFGCTDATQVLKEVRECLKEYPNCW  156

Query  182  VRILGFDNRRQVQCIMFIA  238
            VRI+GFDN RQVQCI FIA
Sbjct  157  VRIIGFDNVRQVQCISFIA  175



>gb|AIR75139.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia turkestanica]
Length=165

 Score =   142 bits (359),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFET+ GFVYRE H+SPGYYDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A+
Sbjct  88   VPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAF  147

Query  182  VRILGFDNRRQVQCIMFI  235
            +RI+GFD+ RQVQC+ FI
Sbjct  148  IRIIGFDSNRQVQCVSFI  165



>ref|XP_010693099.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=181

 Score =   143 bits (360),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD  QVV E+EE KKAYP A+
Sbjct  97   IPCLEFEIKDGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQCI FIAY
Sbjct  157  VRIIGFDNKRQVQCISFIAY  176



>sp|P08705.1|RBS_HELAN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Helianthus annuus]
 emb|CAA68490.1| ribulose bisphosphate carboxylase [Helianthus annuus]
 emb|CAA28737.1| RuBisCO (SSU) [Helianthus annuus]
Length=178

 Score =   143 bits (360),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL ECKK YP AW
Sbjct  94   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELAECKKEYPQAW  153

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCIMFIA
Sbjct  154  IRIIGFDNVRQVQCIMFIA  172



>gb|AAK16227.1|AF044395_1 ribulose-1,5-bisphosphate carboxylase small subunit R1 [Flaveria 
ramosissima]
Length=131

 Score =   141 bits (355),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ EL ECKK YP AW
Sbjct  47   VPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVMKELGECKKEYPQAW  106

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCI FIA
Sbjct  107  IRIIGFDNVRQVQCISFIA  125



>gb|ABC17790.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17791.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17792.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17793.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17794.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17795.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17796.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17797.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17798.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17799.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17800.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17801.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
Length=117

 Score =   140 bits (354),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE EKGFVYRE+H SPGYYDGRYWTMWKLPM+GCTDATQV+ E+ EC K YP  W
Sbjct  34   VPCLEFELEKGFVYREYHRSPGYYDGRYWTMWKLPMYGCTDATQVLNEVGECLKEYPNCW  93

Query  182  VRILGFDNRRQVQCIMFIA  238
            VRI+GFDN RQVQCI FIA
Sbjct  94   VRIIGFDNVRQVQCISFIA  112



>gb|AAA33866.1| ribulose 1,5-bisphosphate carboxylase small subunit [Malus domestica 
x Pyrus communis]
Length=179

 Score =   142 bits (359),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP ++
Sbjct  95   VPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  155  IRIIGFDNVRQVQCISFIAY  174



>gb|AIR75136.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
 gb|AIR75137.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
Length=165

 Score =   142 bits (358),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFET+ GFVYRE H+SPGYYDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A+
Sbjct  88   VPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAF  147

Query  182  VRILGFDNRRQVQCIMFI  235
            +RI+GFD+ RQVQC+ FI
Sbjct  148  IRIIGFDSNRQVQCVSFI  165



>ref|XP_006391132.1| hypothetical protein EUTSA_v10019199mg [Eutrema salsugineum]
 gb|ESQ28418.1| hypothetical protein EUTSA_v10019199mg [Eutrema salsugineum]
Length=182

 Score =   142 bits (359),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE + SPGYYDGRYWTMWKLP+FGCTD++QV+ E+EECKK YP A+
Sbjct  98   IPCVEFELEHGFVYREHNKSPGYYDGRYWTMWKLPLFGCTDSSQVLKEVEECKKEYPNAF  157

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  158  IRIIGFDNSRQVQCISFIAY  177



>gb|AIL82451.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
Length=165

 Score =   142 bits (358),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFET+ GFVYRE H+SPGYYDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A+
Sbjct  88   VPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAF  147

Query  182  VRILGFDNRRQVQCIMFI  235
            +RI+GFD+ RQVQC+ FI
Sbjct  148  IRIIGFDSNRQVQCVSFI  165



>ref|XP_011035062.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Populus euphratica]
Length=181

 Score =   142 bits (359),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPMFGCT+A+QV+ EL+E KKAYP A+
Sbjct  97   VPCLEFELEKGWVYRENHRSPGYYDGRYWTMWKLPMFGCTEASQVLVELQEAKKAYPNAF  156

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCI FIA
Sbjct  157  IRIIGFDNVRQVQCISFIA  175



>sp|P16032.2|RBS1_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03693.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 prf||1802403A RuBisCO:SUBUNIT=small
Length=182

 Score =   142 bits (359),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE   GFVYRE  ++PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A+
Sbjct  96   VPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAF  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  156  IRIIGFDNVRQVQCISFIAY  175



>sp|P07089.1|RBS_FLATR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Flaveria trinervia]
 emb|CAA28711.1| unnamed protein product [Flaveria trinervia]
Length=173

 Score =   142 bits (358),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE  SSPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW
Sbjct  89   VPCLEFELEHGFVYRENASSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  148

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQC+ FIA
Sbjct  149  IRIIGFDNVRQVQCVSFIA  167



>gb|AAP31054.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Flaveria bidentis]
Length=173

 Score =   142 bits (358),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE  SSPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW
Sbjct  89   VPCLEFELEHGFVYRENASSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  148

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQC+ FIA
Sbjct  149  IRIIGFDNVRQVQCVSFIA  167



>sp|Q08186.1|RBS6_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 6, 
chloroplastic; Short=RuBisCO small subunit 6; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03698.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=186

 Score =   142 bits (359),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE   GFVYRE  ++PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A+
Sbjct  100  VPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAF  159

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQC+ FIAY
Sbjct  160  IRIIGFDNVRQVQCVSFIAY  179



>gb|AAA33036.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score =   142 bits (358),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE   GFVYRE  ++PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A+
Sbjct  94   VPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNVRQVQCISFIAY  173



>gb|AFS41733.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
Length=179

 Score =   142 bits (358),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E+GFV+R++ S P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A+
Sbjct  95   VPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPNAF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  155  IRIIGFDNVRQVQCISFIAY  174



>gb|AFS41748.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=179

 Score =   142 bits (357),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E+GFV+R++ S P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A+
Sbjct  95   VPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPNAF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  155  IRIIGFDNVRQVQCISFIAY  174



>sp|P19308.1|RBS2_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU26, 
chloroplastic; Short=RuBisCO small subunit SSU26; Flags: 
Precursor [Lemna gibba]
 emb|CAA35101.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   142 bits (357),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPC+EF  E GFVYRE H+SPGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +
Sbjct  96   VPCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQCI FIAY
Sbjct  155  VRIIGFDNKRQVQCISFIAY  174



>dbj|BAI53119.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
Length=181

 Score =   142 bits (357),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE EKGFVYR+ H SPGYYDGRYWTMWKLPMFGCTD  QV  EL+E  K YP A+
Sbjct  97   VPCLEFELEKGFVYRDNHKSPGYYDGRYWTMWKLPMFGCTDPLQVFKELDEAIKTYPNAF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQCI FIAY
Sbjct  157  VRIIGFDNKRQVQCISFIAY  176



>gb|AEX60839.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41738.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41746.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41758.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score =   142 bits (357),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E+GFV+R++ S P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A+
Sbjct  95   VPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEELEECKKAYPNAF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  155  IRIIGFDNVRQVQCISFIAY  174



>gb|AEX60842.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41722.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41723.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41730.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41731.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41737.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41745.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41752.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41759.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
 gb|KHG00063.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
 gb|KHG20485.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=179

 Score =   142 bits (357),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E+GFV+R++ S P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A+
Sbjct  95   VPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEELEECKKAYPNAF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  155  IRIIGFDNVRQVQCISFIAY  174



>gb|KHG18747.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=182

 Score =   142 bits (357),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E+GFV+R++ S P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A+
Sbjct  98   VPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEELEECKKAYPNAF  157

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  158  IRIIGFDNVRQVQCISFIAY  177



>sp|P19311.1|RBS5_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU5A, 
chloroplastic; Short=RuBisCO small subunit SSU5A; Flags: 
Precursor [Lemna gibba]
 emb|CAA35099.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   142 bits (357),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPC+EF  E GFVYRE H+SPGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +
Sbjct  96   VPCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQCI FIAY
Sbjct  155  VRIIGFDNKRQVQCISFIAY  174



>emb|CAA32701.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=181

 Score =   142 bits (357),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA+
Sbjct  94   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNTRQVQCISFIAY  173



>emb|CDP20139.1| unnamed protein product [Coffea canephora]
Length=158

 Score =   141 bits (355),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE EKG VYRE+H SPGYYDGRYWTMWKLPMFGCTDATQV+ E+ EC K YP  W
Sbjct  74   IPCLEFELEKGHVYREYHRSPGYYDGRYWTMWKLPMFGCTDATQVLKEVRECLKEYPNCW  133

Query  182  VRILGFDNRRQVQCIMFIA  238
            VRI+GFDN RQVQCI FIA
Sbjct  134  VRIIGFDNVRQVQCISFIA  152



>gb|AIR75140.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum nuttallianum]
Length=165

 Score =   141 bits (355),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFETE GFVYRE  ++PGYYDGRYWTMWKLPMFGC D  QVV EL+ECKKAYP A+
Sbjct  88   IPCLEFETEHGFVYREHGNTPGYYDGRYWTMWKLPMFGCIDPAQVVNELDECKKAYPNAF  147

Query  182  VRILGFDNRRQVQCIMFI  235
            +RI+GFDN+RQVQCI FI
Sbjct  148  IRIIGFDNKRQVQCISFI  165



>gb|AFS41753.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=179

 Score =   142 bits (357),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E+GFV+R++ S P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A+
Sbjct  95   VPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEELEECKKAYPNAF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  155  IRIIGFDNVRQVQCISFIAY  174



>ref|XP_011021244.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Populus euphratica]
Length=181

 Score =   142 bits (357),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPMFGCT A+QV+ ELEE KKAYP ++
Sbjct  97   VPCLEFELEKGWVYREHHRSPGYYDGRYWTMWKLPMFGCTQASQVLIELEEAKKAYPNSF  156

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCI FIA
Sbjct  157  IRIIGFDNVRQVQCISFIA  175



>emb|CAA32702.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=181

 Score =   142 bits (357),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA+
Sbjct  94   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNTRQVQCISFIAY  173



>gb|AAK16231.1|AF044399_1 ribulose-1,5-bisphosphate carboxylase small subunit P1B [Flaveria 
palmeri]
 gb|AAK16233.1|AF044401_1 ribulose-1,5-bisphosphate carboxylase small subunit P2B [Flaveria 
palmeri]
Length=131

 Score =   140 bits (353),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE  SSPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW
Sbjct  47   VPCLEFELEHGFVYRENASSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  106

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQC+ FIA
Sbjct  107  IRIIGFDNVRQVQCVSFIA  125



>ref|XP_010669829.1| PREDICTED: ribulose bisphosphate carboxylase small chain 6, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=183

 Score =   142 bits (357),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE + GFVYRE ++SPGYYDGRYWTMWKLPMFGCTD  QVV ELEE KKAYP A+
Sbjct  99   IPCLEFEVKDGFVYREHNNSPGYYDGRYWTMWKLPMFGCTDPAQVVNELEEVKKAYPQAF  158

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFD  RQVQCI FIAY
Sbjct  159  VRIIGFDKNRQVQCISFIAY  178



>ref|XP_004962611.1| PREDICTED: ribulose bisphosphate carboxylase small chain A, chloroplastic-like 
[Setaria italica]
Length=173

 Score =   141 bits (356),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEF ++ GFVYRE + SPGYYDGRYWTMWKLPMFGCT+ATQV AELEECKKAYP A+
Sbjct  83   IPCLEF-SKVGFVYRENNRSPGYYDGRYWTMWKLPMFGCTEATQVYAELEECKKAYPDAY  141

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RILGFDN RQVQCIMFIAY
Sbjct  142  IRILGFDNVRQVQCIMFIAY  161



>ref|NP_198659.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
 sp|P10796.1|RBS1B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 1B, 
chloroplastic; Short=RuBisCO small subunit 1B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK95269.1|AF410283_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 emb|CAA32700.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
 dbj|BAB09355.1| ribulose bisphosphate carboxylase small chain 1b precursor (RuBisCO 
small subunit 1b) [Arabidopsis thaliana]
 gb|AAN28753.1| At5g38430/F1O19.10 [Arabidopsis thaliana]
 gb|AED94315.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
Length=181

 Score =   142 bits (357),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA+
Sbjct  94   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNTRQVQCISFIAY  173



>gb|AAK16232.1|AF044400_1 ribulose-1,5-bisphosphate carboxylase small subunit P2A [Flaveria 
palmeri]
Length=131

 Score =   140 bits (353),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE  SSPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW
Sbjct  47   VPCLEFELEHGFVYRENASSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  106

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQC+ FIA
Sbjct  107  IRIIGFDNVRQVQCVSFIA  125



>ref|NP_198657.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
 sp|P10798.2|RBS3B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK25834.1|AF360124_1 putative ribulose bisphosphate carboxylase small chain 3b precursor 
[Arabidopsis thaliana]
 gb|AAK95300.1|AF410314_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 gb|AAL58912.1|AF462822_1 At5g38410/F1O19.10 [Arabidopsis thaliana]
 dbj|BAB09353.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAK93702.1| putative RuBisCO small 3b subunit precursor [Arabidopsis thaliana]
 gb|AAK96743.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAL47390.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAM19980.1| At5g38410/F1O19.10 [Arabidopsis thaliana]
 gb|AAN31863.1| putative ribulose bisphosphate carboxylase small chain 3b precursor 
(RuBisCO small subunit 3b) [Arabidopsis thaliana]
 gb|AED94311.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
Length=181

 Score =   142 bits (357),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA+
Sbjct  94   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNTRQVQCISFIAY  173



>gb|AIR75142.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Chenopodium album]
Length=164

 Score =   141 bits (355),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD TQVV ELEE KKAYP A+
Sbjct  87   VPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDPTQVVNELEEAKKAYPNAF  146

Query  182  VRILGFDNRRQVQCIMFI  235
            +RI+GFD+ RQVQCI FI
Sbjct  147  IRIIGFDSFRQVQCISFI  164



>sp|Q39746.1|RBS4_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67848.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=178

 Score =   141 bits (356),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW
Sbjct  94   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  153

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCI FIA
Sbjct  154  IRIIGFDNVRQVQCISFIA  172



>ref|NP_198658.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
 sp|P10797.2|RBS2B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB09354.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL24421.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32515.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32536.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32621.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAM13287.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAN72105.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO00914.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO29974.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AED94314.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
Length=181

 Score =   141 bits (356),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA+
Sbjct  94   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNTRQVQCISFIAY  173



>sp|P19312.1|RBS6_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU5B, 
chloroplastic; Short=RuBisCO small subunit SSU5B; Flags: 
Precursor [Lemna gibba]
 emb|CAA35100.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   141 bits (356),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPC+EF  E GFVYRE H+SPGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +
Sbjct  96   VPCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQCI FIAY
Sbjct  155  VRIIGFDNKRQVQCISFIAY  174



>sp|Q08183.1|RBS3_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03695.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   142 bits (357),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE   GFVYRE  ++PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A+
Sbjct  97   VPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  157  IRIIGFDNVRQVQCISFIAY  176



>sp|Q39744.1|RBS2_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67846.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=178

 Score =   141 bits (356),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW
Sbjct  94   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  153

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCI FIA
Sbjct  154  IRIIGFDNVRQVQCISFIA  172



>gb|AAA33037.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   141 bits (356),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE   GFVYRE  ++PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A+
Sbjct  97   VPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  157  IRIIGFDNVRQVQCISFIAY  176



>gb|ABS57004.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[synthetic construct]
Length=129

 Score =   140 bits (352),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL ECKK YP AW
Sbjct  39   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELAECKKEYPQAW  98

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCIMFIA
Sbjct  99   IRIIGFDNVRQVQCIMFIA  117



>ref|WP_028130706.1| hypothetical protein [Serratia marcescens]
Length=123

 Score =   139 bits (351),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPMFGCT+A+QV+ ELEE KKAYP ++
Sbjct  39   VPCLEFELEKGWVYREHHRSPGYYDGRYWTMWKLPMFGCTEASQVLIELEEAKKAYPNSF  98

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCI FIA
Sbjct  99   IRIIGFDNVRQVQCISFIA  117



>sp|Q04450.1|RBS2_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03694.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score =   141 bits (355),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE   GFVYRE  ++PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A+
Sbjct  94   VPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
             RI+GFDN RQVQCI FIAY
Sbjct  154  TRIIGFDNVRQVQCISFIAY  173



>sp|Q39748.1|RBS6_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 6, 
chloroplastic; Short=RuBisCO small subunit 6; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67850.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   141 bits (355),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW
Sbjct  89   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSVQVMKELQECKKEYPQAW  148

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCI FIA
Sbjct  149  IRIIGFDNVRQVQCISFIA  167



>sp|Q39749.1|RBS7_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 7, 
chloroplastic; Short=RuBisCO small subunit 7; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67851.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   141 bits (355),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW
Sbjct  89   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  148

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCI FIA
Sbjct  149  IRIIGFDNVRQVQCISFIA  167



>sp|Q39745.1|RBS3_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67847.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   141 bits (355),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW
Sbjct  89   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  148

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCI FIA
Sbjct  149  IRIIGFDNVRQVQCISFIA  167



>ref|XP_010440948.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   141 bits (355),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNNRQVQCISFIAY  173



>gb|AIF75288.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   140 bits (354),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA+
Sbjct  82   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAF  141

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  142  IRIIGFDNTRQVQCISFIAY  161



>gb|AIF75285.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75286.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
 gb|AIF75287.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
Length=163

 Score =   140 bits (354),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA+
Sbjct  82   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAF  141

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  142  IRIIGFDNTRQVQCISFIAY  161



>sp|Q39747.1|RBS5_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 5, 
chloroplastic; Short=RuBisCO small subunit 5; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67849.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   140 bits (354),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW
Sbjct  89   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  148

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCI FIA
Sbjct  149  IRIIGFDNVRQVQCISFIA  167



>ref|XP_010103758.1| hypothetical protein L484_014647 [Morus notabilis]
 gb|EXB97036.1| hypothetical protein L484_014647 [Morus notabilis]
Length=182

 Score =   141 bits (355),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE  K  +YRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP A 
Sbjct  98   IPCLEFEVGKAHIYRENNRSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQETKKAYPDAH  157

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIAY
Sbjct  158  VRIIGFDNNRQVQCISFIAY  177



>ref|XP_010440945.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
 ref|XP_010440946.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
 ref|XP_010440947.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   141 bits (355),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNNRQVQCISFIAY  173



>gb|ABK96431.1| unknown [Populus trichocarpa x Populus deltoides]
Length=182

 Score =   141 bits (355),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE EKG+V+RE HSSPGYYDGRYWTMWKLPMFGCT+A+QV+ EL E KKAYP A+
Sbjct  98   VPCLEFELEKGWVHREHHSSPGYYDGRYWTMWKLPMFGCTEASQVLVELGEAKKAYPNAF  157

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCI FIA
Sbjct  158  IRIIGFDNTRQVQCISFIA  176



>sp|Q39743.1|RBS1_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67845.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   140 bits (354),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW
Sbjct  89   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  148

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCI FIA
Sbjct  149  IRIIGFDNVRQVQCISFIA  167



>sp|Q08185.1|RBS5_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 5, 
chloroplastic; Short=RuBisCO small subunit 5; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03697.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial [Mesembryanthemum crystallinum]
Length=182

 Score =   141 bits (355),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE   GFVYRE  ++PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A+
Sbjct  96   VPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAF  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQC+ FIAY
Sbjct  156  IRIIGFDNVRQVQCVSFIAY  175



>gb|AIF75289.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75290.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   140 bits (353),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA+
Sbjct  82   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAF  141

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  142  IRIIGFDNTRQVQCISFIAY  161



>sp|Q08184.1|RBS4_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA33038.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 gb|AAA03696.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   141 bits (355),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE   GFVYRE  ++PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A+
Sbjct  97   VPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQC+ FIAY
Sbjct  157  IRIIGFDNVRQVQCVSFIAY  176



>gb|AIF75295.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   140 bits (353),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA+
Sbjct  82   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAF  141

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  142  IRIIGFDNTRQVQCISFIAY  161



>ref|XP_006284616.1| hypothetical protein CARUB_v10005847mg [Capsella rubella]
 gb|EOA17514.1| hypothetical protein CARUB_v10005847mg [Capsella rubella]
Length=181

 Score =   141 bits (355),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNTRQVQCISFIAY  173



>ref|XP_006285696.1| hypothetical protein CARUB_v10007166mg [Capsella rubella]
 gb|EOA18594.1| hypothetical protein CARUB_v10007166mg [Capsella rubella]
Length=181

 Score =   140 bits (354),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNTRQVQCISFIAY  173



>ref|NP_176880.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
 sp|P10795.2|RBS1A_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic; Short=RuBisCO small subunit 1A; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG40363.1|AF325011_1 000C10C11 [Arabidopsis thaliana]
 gb|AAK95277.1|AF410291_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 gb|AAD10655.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAK96772.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL06849.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAL24219.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAL24422.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL32690.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL32789.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL38277.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM13379.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM13387.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM19882.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAN15681.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAN72087.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 dbj|BAE98610.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98685.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98695.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98874.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 gb|AEE34594.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
Length=180

 Score =   140 bits (354),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  +SPGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNTRQVQCISFIAY  173



>ref|XP_006285820.1| hypothetical protein CARUB_v10007296mg [Capsella rubella]
 gb|EOA18718.1| hypothetical protein CARUB_v10007296mg [Capsella rubella]
Length=181

 Score =   140 bits (354),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNTRQVQCISFIAY  173



>ref|XP_010435745.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   140 bits (354),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNTRQVQCISFIAY  173



>ref|XP_010435743.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like isoform X1 [Camelina sativa]
 ref|XP_010435744.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like isoform X2 [Camelina sativa]
Length=181

 Score =   140 bits (354),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNTRQVQCISFIAY  173



>gb|AAA33035.1| ribulose-1-5-bisphosphate carboxylase [Mesembryanthemum crystallinum]
Length=182

 Score =   140 bits (354),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE   GFVYRE  ++PGYYDGRYWTMWKLPMFGCTD +QVVAEL E KKAYP A+
Sbjct  96   VPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELREAKKAYPEAF  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  156  IRIIGFDNVRQVQCISFIAY  175



>sp|Q42822.1|RBS_GLYTO RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Glycine tomentella]
 gb|AAA82070.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Glycine tomentella]
Length=178

 Score =   140 bits (354),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E GFVYRE H SPGYYDGRYWTMWKLP+FGCTDA+QV+ EL+E K AYP  +
Sbjct  94   IPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPVFGCTDASQVLKELQEAKTAYPNGF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNVRQVQCISFIAY  173



>gb|EYU44637.1| hypothetical protein MIMGU_mgv1a0165712mg, partial [Erythranthe 
guttata]
Length=87

 Score =   137 bits (346),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE++SSPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+E KK YP A+
Sbjct  3    IPCIEFELEHGFVYREYNSSPGYYDGRYWTMWKLPMFGCTDSAQVLRELDEAKKTYPSAF  62

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQ I FIAY
Sbjct  63   IRIIGFDNVRQVQSISFIAY  82



>gb|AAK16230.1|AF044398_1 ribulose-1,5-bisphosphate carboxylase small subunit P1A, partial 
[Flaveria palmeri]
Length=131

 Score =   139 bits (349),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE  SSPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW
Sbjct  47   VPCLEFELEHGFVYRENASSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  106

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQC+ FI+
Sbjct  107  IRIIGFDNVRQVQCVSFIS  125



>ref|XP_003618736.1| Ribulose bisphosphate carboxylase small chain [Medicago truncatula]
 gb|ACJ84141.1| unknown [Medicago truncatula]
 gb|AES74954.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=180

 Score =   140 bits (353),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE EKGFVYRE HSSPGYYDGRYWTMWKLP+FG TD++QV+ EL E K AYP ++
Sbjct  96   VPCLEFELEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDSSQVLKELAEAKAAYPESF  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIA+
Sbjct  156  IRIIGFDNVRQVQCISFIAH  175



>gb|AIF75283.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75284.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   140 bits (352),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  +SPGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A+
Sbjct  82   IPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  141

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  142  IRIIGFDNTRQVQCISFIAY  161



>gb|AFK40375.1| unknown [Medicago truncatula]
Length=180

 Score =   140 bits (353),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE EKGFVYRE HSSPGYYDGRYWTMWKLP+FG TD++QV+ EL E K AYP ++
Sbjct  96   VPCLEFELEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDSSQVLKELAEAKAAYPESF  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIA+
Sbjct  156  IRIIGFDNVRQVQCISFIAH  175



>gb|AAO25119.1| ribulose-1,5-bisphosphate carboxylase small subunit [Chrysanthemum 
x morifolium]
Length=179

 Score =   140 bits (353),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GF YRE + SPGYYDGRYWTMWKLPMFGC DA+QV+ EL ECKK YP +W
Sbjct  95   VPCLEFELEHGFPYRENNRSPGYYDGRYWTMWKLPMFGCNDASQVLKELNECKKEYPQSW  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIA+
Sbjct  155  VRIIGFDNVRQVQCISFIAH  174



>sp|P19310.1|RBS4_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU40B, 
chloroplastic; Short=RuBisCO small subunit SSU40B; Flags: 
Precursor [Lemna gibba]
 emb|CAA35103.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   140 bits (353),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPC+EF  E GFVYRE H+SPGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +
Sbjct  96   VPCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQCI FIAY
Sbjct  155  VRIIGFDNKRQVQCISFIAY  174



>gb|AAP31053.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Flaveria bidentis]
Length=173

 Score =   140 bits (352),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW
Sbjct  89   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  148

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQC+ FIA
Sbjct  149  IRIIGFDNVRQVQCVSFIA  167



>ref|XP_008446602.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Cucumis melo]
Length=185

 Score =   140 bits (353),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EF+   GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QVV E+EE KK YP A+
Sbjct  97   IPCIEFDIHSGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVVNEIEEAKKEYPDAY  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +R++GFDN RQVQCI FIAY
Sbjct  157  IRVIGFDNVRQVQCISFIAY  176



>gb|AFO67218.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Aralia elata]
Length=183

 Score =   140 bits (353),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E G+VYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ E+EECKK YP A+
Sbjct  97   VPCLEFELEHGWVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLNEVEECKKEYPNAF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIA+
Sbjct  157  IRIIGFDNVRQVQCISFIAF  176



>emb|CAA31948.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=182

 Score =   140 bits (353),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  +SPGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A+
Sbjct  96   IPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  155

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI F+AY
Sbjct  156  IRIIGFDNTRQVQCISFVAY  175



>sp|P19309.1|RBS3_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU40A, 
chloroplastic; Short=RuBisCO small subunit SSU40A; Flags: 
Precursor [Lemna gibba]
 emb|CAA35102.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   140 bits (353),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPC+EF  E GFVYRE H+SPGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +
Sbjct  96   VPCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQCI FIAY
Sbjct  155  VRIIGFDNKRQVQCISFIAY  174



>gb|AIR75138.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia tetrandra]
Length=165

 Score =   139 bits (351),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFET+ GFVYRE H+SPGYYDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A+
Sbjct  88   VPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAF  147

Query  182  VRILGFDNRRQVQCIMFI  235
            +RI+G D+ RQVQC+ FI
Sbjct  148  IRIIGSDSNRQVQCVSFI  165



>gb|AAK16228.1|AF044396_1 ribulose-1,5-bisphosphate carboxylase small subunit R2 [Flaveria 
ramosissima]
Length=131

 Score =   139 bits (349),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW
Sbjct  47   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  106

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCI FIA
Sbjct  107  IRIIGFDNVRQVQCISFIA  125



>ref|XP_010450911.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNNRQVQCISFIAY  173



>ref|XP_002888576.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64835.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
Length=180

 Score =   140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  +SPGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPEAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNSRQVQCISFIAY  173



>gb|AFS41732.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41740.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41761.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score =   140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E+GFV+R++ S P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A+
Sbjct  95   VPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  155  IRIIGFDNVRQVQCISFIAY  174



>gb|AEX60843.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41739.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41747.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41760.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score =   140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E+GFV+R++ S P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A+
Sbjct  95   VPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  155  IRIIGFDNVRQVQCISFIAY  174



>ref|XP_010450912.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic [Camelina sativa]
Length=181

 Score =   140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNNRQVQCISFIAY  173



>ref|XP_006663954.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Oryza brachyantha]
Length=170

 Score =   139 bits (351),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEF ++ GFVYRE H SPGYYDGRYWTMWKLPMFGC+DATQV+ ELEE KKAYP A+
Sbjct  86   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCSDATQVLKELEEAKKAYPDAF  144

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIAY
Sbjct  145  VRIIGFDNVRQVQCISFIAY  164



>ref|XP_009140170.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Brassica rapa]
Length=181

 Score =   140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD++QV+ E++ECK  YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSSQVLKEVQECKTEYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI+FIAY
Sbjct  154  IRIIGFDNNRQVQCIIFIAY  173



>ref|XP_003618735.1| Ribulose bisphosphate carboxylase small chain [Medicago truncatula]
 gb|AES74953.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=177

 Score =   140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE EKGFVYRE HSSPGYYDGRYWTMWKLP+FG TD++QV+ EL E K AYP ++
Sbjct  93   VPCLEFELEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDSSQVLKELAEAKAAYPESF  152

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIA+
Sbjct  153  IRIIGFDNVRQVQCISFIAH  172



>ref|XP_010450913.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNNRQVQCISFIAY  173



>sp|P08135.1|RBS_RAPSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Raphanus sativus]
 emb|CAA29801.1| carboxylase [Raphanus sativus]
 prf||1405335A ribulose bisphosphate carboxylase S
Length=181

 Score =   140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A 
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAL  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNNRQVQCISFIAY  173



>gb|AFS41770.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium gossypioides]
Length=168

 Score =   139 bits (351),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E+GFV+R++ S PGYYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A+
Sbjct  90   IPCLEFELEEGFVHRKYSSLPGYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAF  149

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCI FIA
Sbjct  150  IRIIGFDNVRQVQCISFIA  168



>gb|ACU13285.1| unknown [Glycine max]
Length=178

 Score =   140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP  +
Sbjct  94   IPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNVRQVQCISFIAY  173



>gb|AAG24884.1|AF303941_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS3 [Glycine 
max]
Length=178

 Score =   139 bits (351),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP  +
Sbjct  94   IPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNVRQVQCISFIAY  173



>gb|AIF75321.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
Length=177

 Score =   139 bits (351),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD++QV+ E++ECK  YP A+
Sbjct  90   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSSQVLKEVQECKTEYPNAF  149

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI+FIAY
Sbjct  150  IRIIGFDNNRQVQCIIFIAY  169



>ref|NP_001241137.1| ribulose bisphosphate carboxylase small chain 1, chloroplastic-like 
[Glycine max]
 gb|AAG24882.1|AF303939_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS1 [Glycine 
max]
 gb|AAA81328.1| ribulose-1,5-bisphosphate carboxylase small subunit [Glycine 
max]
 gb|KHN07517.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
 gb|KHN07519.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
Length=178

 Score =   139 bits (351),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP  +
Sbjct  94   IPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNVRQVQCISFIAY  173



>ref|NP_001235266.1| ribulose-1,5-bisphosphate carboxylase small subunit rbcS2 [Glycine 
max]
 gb|AAG24883.1|AF303940_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS2 [Glycine 
max]
Length=178

 Score =   139 bits (351),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP  +
Sbjct  94   IPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNVRQVQCISFIAY  173



>ref|NP_001235314.1| uncharacterized protein LOC100500504 [Glycine max]
 gb|ACU15604.1| unknown [Glycine max]
 gb|KHN47663.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
Length=178

 Score =   139 bits (351),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP  +
Sbjct  94   IPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNVRQVQCISFIAY  173



>gb|AFS41763.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium herbaceum]
 gb|AFS41764.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium herbaceum]
Length=165

 Score =   139 bits (350),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E+GFV+R++ S P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A+
Sbjct  87   VPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEELEECKKAYPNAF  146

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCI FIA
Sbjct  147  IRIIGFDNVRQVQCISFIA  165



>gb|AFS41744.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=182

 Score =   139 bits (351),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E+GFV+R++ S P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A+
Sbjct  98   IPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAF  157

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  158  IRIIGFDNVRQVQCISFIAY  177



>gb|AEX60841.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41728.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41735.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41743.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41750.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41757.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=182

 Score =   139 bits (351),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E+GFV+R++ S P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A+
Sbjct  98   IPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAF  157

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  158  IRIIGFDNVRQVQCISFIAY  177



>ref|XP_006663961.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Oryza brachyantha]
Length=182

 Score =   139 bits (351),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEF ++ GFVYRE H SPGYYDGRYWTMWKLPMFGC+DATQV+ ELEE KKAYP A+
Sbjct  86   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCSDATQVLKELEEAKKAYPDAF  144

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIAY
Sbjct  145  VRIIGFDNVRQVQCISFIAY  164



>gb|AFS41754.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=179

 Score =   139 bits (351),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFV+R++ S P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A+
Sbjct  95   VPCLEFELEDGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  155  IRIIGFDNVRQVQCISFIAY  174



>ref|XP_006664952.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Oryza brachyantha]
Length=170

 Score =   139 bits (350),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEF ++ GFVYRE H SPGYYDGRYWTMWKLPMFGC+DATQV+ ELEE KKAYP A+
Sbjct  86   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCSDATQVLKELEEAKKAYPDAF  144

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIAY
Sbjct  145  VRIIGFDNVRQVQCISFIAY  164



>ref|XP_006663955.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Oryza brachyantha]
Length=170

 Score =   139 bits (350),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEF ++ GFVYRE H SPGYYDGRYWTMWKLPMFGC+DATQV+ ELEE KKAYP A+
Sbjct  86   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCSDATQVLKELEEAKKAYPDAF  144

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIAY
Sbjct  145  VRIIGFDNVRQVQCISFIAY  164



>pdb|3AXK|S Chain S, Structure Of Rice Rubisco In Complex With Nadp(h)
 pdb|3AXK|T Chain T, Structure Of Rice Rubisco In Complex With Nadp(h)
Length=129

 Score =   137 bits (346),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEF ++ GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+ ELEE KKAYP A+
Sbjct  40   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAF  98

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIAY
Sbjct  99   VRIIGFDNVRQVQCISFIAY  118



>gb|AAK49590.1|AF372874_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
Length=125

 Score =   137 bits (346),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  +SPGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A+
Sbjct  39   IPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  98

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  99   IRIIGFDNTRQVQCISFIAY  118



>pdb|4MKV|S Chain S, Structure Of Pisum Sativum Rubisco With Aba
 pdb|4MKV|T Chain T, Structure Of Pisum Sativum Rubisco With Aba
 pdb|4MKV|U Chain U, Structure Of Pisum Sativum Rubisco With Aba
 pdb|4MKV|V Chain V, Structure Of Pisum Sativum Rubisco With Aba
Length=123

 Score =   137 bits (345),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE +KGFVYRE + SPGYYDGRYWTMWKLPMFG TDA+QV+ EL+E KKAYP A+
Sbjct  39   VPCLEFELKKGFVYREHNKSPGYYDGRYWTMWKLPMFGTTDASQVLKELDEVKKAYPRAF  98

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIA+
Sbjct  99   VRIIGFDNVRQVQCISFIAH  118



>ref|XP_002868776.1| ribulose bisphosphate carboxylase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45035.1| ribulose bisphosphate carboxylase [Arabidopsis lyrata subsp. 
lyrata]
Length=181

 Score =   139 bits (350),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNNRQVQCISFIAY  173



>ref|XP_002868775.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45034.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
lyrata subsp. lyrata]
Length=181

 Score =   139 bits (350),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNNRQVQCISFIAY  173



>gb|AFI60243.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Panicum virgatum]
Length=148

 Score =   138 bits (347),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEF ++ GFV+RE  +SPGYYDGRYWTMWKLPMFGCTDATQV AELEECKKAYP  +
Sbjct  70   VPCLEF-SKLGFVFRENATSPGYYDGRYWTMWKLPMFGCTDATQVYAELEECKKAYPDNY  128

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RILGFDN RQVQC+ FIAY
Sbjct  129  IRILGFDNARQVQCVSFIAY  148



>gb|KEH21530.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   139 bits (350),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            V CLEFETEKGFVYRE HSSPGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+
Sbjct  97   VACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIA+
Sbjct  157  VRIIGFDNVRQVQCISFIAH  176



>gb|KEH21536.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   139 bits (350),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            V CLEFETEKGFVYRE HSSPGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+
Sbjct  97   VACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIA+
Sbjct  157  VRIIGFDNVRQVQCISFIAH  176



>ref|XP_003636970.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   139 bits (350),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            V CLEFETEKGFVYRE HSSPGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+
Sbjct  97   VACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIA+
Sbjct  157  VRIIGFDNVRQVQCISFIAH  176



>gb|KEH21531.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   139 bits (350),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            V CLEFETEKGFVYRE HSSPGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+
Sbjct  97   VACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIA+
Sbjct  157  VRIIGFDNVRQVQCISFIAH  176



>gb|AAU14862.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Fagus sylvatica]
Length=181

 Score =   139 bits (350),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E  FVYRE + SPGYYDGRYW MWKLPMFGCTDATQV+AEL+E  K YP + 
Sbjct  98   IPCLEFELEHPFVYRENNRSPGYYDGRYWVMWKLPMFGCTDATQVLAELQEASKTYPTSH  157

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN+RQVQCI FIAY
Sbjct  158  IRIIGFDNKRQVQCISFIAY  177



>gb|KEH21538.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   139 bits (350),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            V CLEFETEKGFVYRE HSSPGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+
Sbjct  97   VACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIA+
Sbjct  157  VRIIGFDNVRQVQCISFIAH  176



>ref|XP_003637843.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   139 bits (350),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            V CLEFETEKGFVYRE HSSPGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+
Sbjct  97   VACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIA+
Sbjct  157  VRIIGFDNVRQVQCISFIAH  176



>ref|XP_003600302.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   139 bits (350),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            V CLEFETEKGFVYRE HSSPGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+
Sbjct  97   VACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIA+
Sbjct  157  VRIIGFDNVRQVQCISFIAH  176



>sp|O22077.1|RBS_FAGCR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Fagus crenata]
 dbj|BAA23214.1| small subunit of ribulose-1,5-bisphosphate carboxylase/oxygenase 
[Fagus crenata]
Length=182

 Score =   139 bits (350),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E  FVYRE + SPGYYDGRYW MWKLPMFGCTDATQV+AEL+E  K YP + 
Sbjct  98   IPCLEFELEHPFVYRENNRSPGYYDGRYWVMWKLPMFGCTDATQVLAELQEASKTYPTSH  157

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN+RQVQCI FIAY
Sbjct  158  IRIIGFDNKRQVQCISFIAY  177



>emb|CDY67657.1| BnaCnng55860D [Brassica napus]
Length=181

 Score =   139 bits (349),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNNRQVQCISFIAY  173



>gb|ACJ85905.1| unknown [Medicago truncatula]
 gb|AFK33847.1| unknown [Medicago truncatula]
 gb|KEH21532.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   139 bits (349),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            V CLEFETEKGFVYRE HSSPGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+
Sbjct  97   VACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIA+
Sbjct  157  VRIIGFDNVRQVQCISFIAH  176



>gb|AIF75342.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75343.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   139 bits (349),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A+
Sbjct  90   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  149

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  150  IRIIGFDNNRQVQCISFIAY  169



>emb|CAA10290.1| ribulose 1,5-bisphosphate carboxylase small subunit [Cicer arietinum]
Length=181

 Score =   139 bits (349),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE EKGFVYRE ++SPGYYDGRYWTMWKLP+FGCT+A QV+ EL+E  KAYP A+
Sbjct  97   VPCLEFELEKGFVYREHNNSPGYYDGRYWTMWKLPLFGCTEAVQVLKELQEVVKAYPNAF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIA+
Sbjct  157  VRIIGFDNVRQVQCISFIAH  176



>gb|AIF75344.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75345.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   139 bits (349),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A+
Sbjct  90   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  149

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  150  IRIIGFDNNRQVQCISFIAY  169



>gb|AIF75322.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   139 bits (349),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD++QV+ E++ECK  YP A+
Sbjct  90   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSSQVLKEVQECKTEYPNAF  149

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  150  IRIIGFDNNRQVQCISFIAY  169



>ref|XP_006482254.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=182

 Score =   139 bits (349),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE EKG+VYRE HSSPGYYDGRYWTMWKLPM+GCTDATQV+ E+ E +K YP ++
Sbjct  98   IPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSF  157

Query  182  VRILGFDNRRQVQCIMFIA  238
            VRI+GFDN+RQVQCI F+A
Sbjct  158  VRIIGFDNKRQVQCISFLA  176



>gb|AFS41725.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium raimondii]
Length=179

 Score =   139 bits (349),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A+
Sbjct  95   VPCLEFELEEGFVHRKYSNLPTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAF  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  155  IRIIGFDNVRQVQCISFIAY  174



>gb|AIF75296.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
 gb|AIF75297.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   138 bits (347),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A+
Sbjct  82   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPEAF  141

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  142  IRIIGFDNNRQVQCISFIAY  161



>gb|AIF75291.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
 gb|AIF75293.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
Length=163

 Score =   138 bits (347),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A+
Sbjct  82   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  141

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  142  IRIIGFDNNRQVQCISFIAY  161



>emb|CCF55356.1| ribulose-1,5-bisphosphate carboxylase small subunit [Cucumis 
sativus]
Length=185

 Score =   139 bits (349),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPC+EF+   GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ E+EE KK YP A+
Sbjct  98   VPCVEFDIGSGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVIQEIEEAKKEYPDAF  157

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +R++GFDN RQVQCI FIAY
Sbjct  158  IRVIGFDNVRQVQCISFIAY  177



>ref|XP_004135094.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004164158.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 gb|KGN52085.1| hypothetical protein Csa_5G609710 [Cucumis sativus]
Length=185

 Score =   139 bits (349),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPC+EF+   GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ E+EE KK YP A+
Sbjct  98   VPCVEFDIGSGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVIQEIEEAKKEYPDAF  157

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +R++GFDN RQVQCI FIAY
Sbjct  158  IRVIGFDNVRQVQCISFIAY  177



>gb|AFS41724.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium raimondii]
Length=182

 Score =   138 bits (348),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A+
Sbjct  98   IPCLEFELEEGFVHRKYSNLPTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAF  157

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  158  IRIIGFDNVRQVQCISFIAY  177



>emb|CAA30393.1| ribulose bisphosphate carboxylase [Oryza sativa]
Length=172

 Score =   138 bits (347),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEF ++ GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQVV ELEE KKAYP A+
Sbjct  84   VPCLEF-SKVGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVVKELEEAKKAYPDAF  142

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQ I FIAY
Sbjct  143  VRIIGFDNVRQVQLISFIAY  162



>sp|P00872.2|RBS1_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU1, 
chloroplastic; Short=RuBisCO small subunit SSU1; Flags: 
Precursor [Lemna gibba]
 emb|CAA35104.1| unnamed protein product [Lemna gibba]
Length=173

 Score =   138 bits (347),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPC+EF  E GFVYRE ++SPGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +
Sbjct  92   VPCIEFSKE-GFVYRENNASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYF  150

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQCI FIAY
Sbjct  151  VRIIGFDNKRQVQCISFIAY  170



>sp|Q40250.1|RBS_LACSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Lactuca sativa]
 dbj|BAA03103.1| riburose-1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Lactuca sativa]
Length=181

 Score =   138 bits (348),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+ ECKK YP A+
Sbjct  96   IPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVMKEVGECKKEYPNAF  155

Query  182  VRILGFDNRRQVQCIMFI  235
            +R++GFDN RQVQCI FI
Sbjct  156  IRVIGFDNIRQVQCISFI  173



>gb|AAL82195.1|AF396697_1 s/s2 [Nicotiana benthamiana]
Length=113

 Score =   136 bits (342),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  14   EFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  193
            EF  ++GFVYRE HSSPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AWVRI+
Sbjct  2    EFVPKRGFVYREHHSSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWVRII  61

Query  194  GFDNRRQVQCIMFIA  238
            GFDN RQVQCI FIA
Sbjct  62   GFDNVRQVQCISFIA  76



>emb|CDY52468.1| BnaA04g27920D [Brassica napus]
Length=181

 Score =   138 bits (348),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECK  YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNNRQVQCISFIAY  173



>gb|AIF75294.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   137 bits (346),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A+
Sbjct  82   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  141

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  142  IRIIGFDNNRQVQCISFIAY  161



>emb|CAA30290.1| rubisco ssu precursor [Brassica napus]
Length=181

 Score =   138 bits (348),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECK  YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNNRQVQCISFIAY  173



>dbj|BAK23964.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[synthetic construct]
Length=170

 Score =   138 bits (347),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEF ++ GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+ ELEE KKAYP A+
Sbjct  86   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAF  144

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQ I FIAY
Sbjct  145  VRIIGFDNVRQVQLISFIAY  164



>ref|XP_011089882.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Sesamum indicum]
Length=181

 Score =   138 bits (348),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTDA QV+ EL+E  KA+P  +
Sbjct  97   IPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDAVQVLLELDEAIKAHPNGF  156

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQC  FIAY
Sbjct  157  IRIIGFDNARQVQCTSFIAY  176



>sp|P18960.1|RBS_SILPR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Silene latifolia subsp. alba]
 gb|AAB39037.1| ribulose bisphosphate carboxylase precursor [Silene latifolia 
subsp. alba]
Length=177

 Score =   138 bits (347),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE     VYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV AE+ ECK AYP A 
Sbjct  95   VPCLEFEVGPAHVYRENNKSPGYYDGRYWTMWKLPMFGCTDASQVAAEVVECKNAYPDAH  154

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQCI FIAY
Sbjct  155  VRIIGFDNKRQVQCISFIAY  174



>ref|XP_002532149.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF30223.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
Length=185

 Score =   138 bits (348),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGC+DA QV+ EL+E  KAYP ++
Sbjct  98   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCSDAVQVLKELDEAIKAYPNSF  157

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN RQVQCI FIAY
Sbjct  158  VRIIGFDNVRQVQCISFIAY  177



>ref|XP_009139778.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic isoform X1 [Brassica rapa]
 sp|P27985.1|RBS2_BRANA RecName: Full=Ribulose bisphosphate carboxylase small chain F1, 
chloroplastic; Short=RuBisCO small subunit F1; Flags: Precursor 
[Brassica napus]
 emb|CAA39402.1| ribulose bisphosphate carboxylase /oxygenase small subunit [Brassica 
napus]
 emb|CDY71122.1| BnaAnng36210D [Brassica napus]
Length=181

 Score =   138 bits (347),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECK  YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNNRQVQCISFIAY  173



>gb|ACQ90229.1| TuMV resistance protein-like protein [Brassica rapa subsp. chinensis]
Length=162

 Score =   137 bits (346),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECK  YP A+
Sbjct  75   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAF  134

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  135  IRIIGFDNNRQVQCISFIAY  154



>sp|P05346.2|RBS1_BRANA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Brassica napus]
 emb|CAA43410.1| ribulose bisphosphate carboxylase [Brassica napus]
 gb|AHL28802.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Brassica rapa subsp. chinensis]
 emb|CDY01671.1| BnaC04g30810D [Brassica napus]
 emb|CDX74532.1| BnaA04g08570D [Brassica napus]
Length=181

 Score =   138 bits (347),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECK  YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNNRQVQCISFIAY  173



>gb|AFS41772.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypioides kirkii]
 gb|AFS41773.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypioides kirkii]
Length=168

 Score =   137 bits (346),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E GFV+R++ S P YYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKKAYP A+
Sbjct  90   IPCLEFELEDGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKELDECKKAYPNAF  149

Query  182  VRILGFDNRRQVQCIMFIA  238
            +RI+GFDN RQVQCI FIA
Sbjct  150  IRIIGFDNVRQVQCISFIA  168



>ref|XP_006405770.1| hypothetical protein EUTSA_v10027955mg [Eutrema salsugineum]
 gb|ESQ47223.1| hypothetical protein EUTSA_v10027955mg [Eutrema salsugineum]
Length=181

 Score =   138 bits (347),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFV+RE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A+
Sbjct  94   IPCVEFELENGFVHREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPQAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNTRQVQCISFIAY  173



>emb|CAA24969.1| unnamed protein product [Lemna gibba]
Length=120

 Score =   136 bits (342),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPC+EF  E GFVYRE ++SPGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +
Sbjct  39   VPCIEFSKE-GFVYRENNASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYF  97

Query  182  VRILGFDNRRQVQCIMFIAY  241
            VRI+GFDN+RQVQCI FIAY
Sbjct  98   VRIIGFDNKRQVQCISFIAY  117



>gb|AIF75340.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75341.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   138 bits (347),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECK  YP A+
Sbjct  90   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAF  149

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  150  IRIIGFDNNRQVQCISFIAY  169



>gb|ABK15574.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Camellia sinensis]
Length=176

 Score =   138 bits (347),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEF  + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+ E+EECKK YP ++
Sbjct  92   IPCLEFSVQGGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDSSQVLKEVEECKKEYPQSF  151

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN+RQVQCI FI Y
Sbjct  152  IRIIGFDNKRQVQCISFICY  171



>gb|AIF75323.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   138 bits (347),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECK  YP A+
Sbjct  90   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAF  149

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  150  IRIIGFDNNRQVQCISFIAY  169



>gb|AFS41729.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41736.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41751.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=182

 Score =   138 bits (347),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PCLEFE E+GFV+R++ S P YYDGRYWTMWKLPMFGCTD+ QV+ ELE CKK YP A+
Sbjct  98   IPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKELENCKKEYPNAF  157

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  158  IRIIGFDNVRQVQCISFIAY  177



>gb|AIF75332.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75333.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   138 bits (347),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECK  YP A+
Sbjct  90   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAF  149

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  150  IRIIGFDNNRQVQCISFIAY  169



>ref|XP_010511625.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic [Camelina sativa]
 ref|XP_010415258.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic [Camelina sativa]
 ref|XP_010470602.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic isoform X1 [Camelina sativa]
Length=181

 Score =   138 bits (347),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFV+RE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A+
Sbjct  94   IPCVEFELENGFVHREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPEAF  153

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  154  IRIIGFDNTRQVQCISFIAY  173



>pir||A05119 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain - 
petunia (clone pSSU 117) (fragment)
Length=106

 Score =   135 bits (341),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            VPCLEFE +  F+YRE+H+SPGYYDGRYWTMWKLPMFGCTDATQV+ EL+E KKAYP A 
Sbjct  28   VPCLEFELKHKFIYREYHASPGYYDGRYWTMWKLPMFGCTDATQVLGELQEAKKAYPNAG  87

Query  182  VRILGFDNRRQVQCIMFIA  238
              I+GFDN RQVQCI FIA
Sbjct  88   SGIIGFDNVRQVQCISFIA  106



>gb|AIF75313.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
 gb|AIF75314.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
 gb|AIF75315.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
 gb|AIF75316.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
 gb|AIF75339.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   138 bits (347),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECK  YP A+
Sbjct  90   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAF  149

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  150  IRIIGFDNNRQVQCISFIAY  169



>gb|AIF75337.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75338.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   137 bits (346),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    VPCLEFETEKGFVYREWHSSPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  181
            +PC+EFE E GFVYRE  S+PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECK  YP A+
Sbjct  90   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAF  149

Query  182  VRILGFDNRRQVQCIMFIAY  241
            +RI+GFDN RQVQCI FIAY
Sbjct  150  IRIIGFDNNRQVQCISFIAY  169



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 528788483009