BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27116_g1_i1 len=505 path=[483:0-504]

Length=505
                                                                      Score     E

ref|XP_009627452.1|  PREDICTED: cytochrome P450 87A3                    290   6e-93   
ref|XP_009782612.1|  PREDICTED: cytochrome P450 87A3                    289   8e-93   
ref|XP_011029202.1|  PREDICTED: cytochrome P450 87A3                    290   8e-93   
ref|XP_006358916.1|  PREDICTED: cytochrome P450 87A3-like               286   1e-91   
ref|XP_002299557.1|  cytochrome P450 family protein                     285   3e-91   Populus trichocarpa [western balsam poplar]
ref|XP_004246127.1|  PREDICTED: cytochrome P450 87A3-like               282   5e-90   
ref|XP_011081025.1|  PREDICTED: cytochrome P450 87A3-like               281   9e-90   
ref|XP_007211052.1|  hypothetical protein PRUPE_ppa018745mg             280   2e-89   
ref|XP_006573760.1|  PREDICTED: cytochrome P450 87A3-like               280   7e-89   
ref|XP_008238815.1|  PREDICTED: cytochrome P450 87A3-like isoform X2    278   2e-88   
ref|XP_008238814.1|  PREDICTED: cytochrome P450 87A3-like isoform X1    278   2e-88   
ref|XP_010112562.1|  Cytochrome P450 87A3                               278   2e-88   
gb|EYU29834.1|  hypothetical protein MIMGU_mgv1a005289mg                278   2e-88   
ref|XP_007040135.1|  Cytochrome P450, family 87, subfamily A, pol...    278   4e-88   
ref|XP_006477592.1|  PREDICTED: cytochrome P450 87A3-like               277   4e-88   
ref|XP_006440550.1|  hypothetical protein CICLE_v10023269mg             277   5e-88   
ref|XP_002283337.1|  PREDICTED: cytochrome P450 87A3                    277   6e-88   Vitis vinifera
emb|CBI34719.3|  unnamed protein product                                277   6e-88   
ref|XP_003538708.1|  PREDICTED: cytochrome P450 87A3-like               275   2e-87   
ref|XP_009342629.1|  PREDICTED: cytochrome P450 87A3                    275   2e-87   
ref|XP_011033792.1|  PREDICTED: cytochrome P450 87A3-like               275   3e-87   
ref|XP_011072203.1|  PREDICTED: cytochrome P450 87A3                    275   3e-87   
ref|XP_004511600.1|  PREDICTED: cytochrome P450 87A3-like isoform X2    271   3e-86   
ref|XP_002303566.1|  cytochrome P450 family protein                     272   3e-86   Populus trichocarpa [western balsam poplar]
ref|XP_010676534.1|  PREDICTED: cytochrome P450 87A3                    272   5e-86   
gb|KEH27443.1|  cytochrome P450 family protein                          271   6e-86   
gb|KFK43534.1|  hypothetical protein AALP_AA1G139200                    270   8e-86   
ref|XP_004511599.1|  PREDICTED: cytochrome P450 87A3-like isoform X1    271   1e-85   
ref|NP_172734.2|  cytochrome P450, family 87, subfamily A, polype...    270   2e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003611140.1|  Cytochrome P450                                    270   2e-85   
gb|AAF88087.1|AC025417_15  T12C24.27                                    270   2e-85   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001184974.1|  cytochrome P450, family 87, subfamily A, pol...    270   3e-85   
ref|XP_010494547.1|  PREDICTED: cytochrome P450 87A3-like               269   6e-85   
ref|XP_010476246.1|  PREDICTED: cytochrome P450 87A3-like               268   9e-85   
ref|XP_006391779.1|  hypothetical protein EUTSA_v10023919mg             269   1e-84   
gb|KDP25498.1|  hypothetical protein JCGZ_20654                         268   1e-84   
ref|XP_010533714.1|  PREDICTED: cytochrome P450 87A3                    268   3e-84   
ref|XP_010458707.1|  PREDICTED: cytochrome P450 87A3-like               267   3e-84   
ref|XP_010053329.1|  PREDICTED: cytochrome P450 87A3                    266   6e-84   
gb|KFK40541.1|  hypothetical protein AALP_AA2G009100                    265   6e-84   
ref|XP_008345352.1|  PREDICTED: cytochrome P450 87A3-like               266   1e-83   
ref|XP_002509718.1|  cytochrome P450, putative                          268   1e-83   Ricinus communis
emb|CDP09801.1|  unnamed protein product                                265   1e-83   
ref|XP_002889964.1|  T12C24.27                                          265   3e-83   
ref|XP_008448965.1|  PREDICTED: cytochrome P450 87A3 isoform X3         262   6e-83   
ref|XP_007158462.1|  hypothetical protein PHAVU_002G154400g             260   2e-82   
ref|XP_010545904.1|  PREDICTED: cytochrome P450 87A3-like               263   3e-82   
ref|XP_009148571.1|  PREDICTED: cytochrome P450 87A3                    262   3e-82   
ref|XP_008448964.1|  PREDICTED: cytochrome P450 87A3 isoform X2         261   3e-82   
ref|XP_008448963.1|  PREDICTED: cytochrome P450 87A3 isoform X1         261   4e-82   
ref|XP_010248255.1|  PREDICTED: cytochrome P450 87A3                    261   5e-82   
ref|XP_010545860.1|  PREDICTED: cytochrome P450 87A3-like               262   1e-81   
ref|XP_006417203.1|  hypothetical protein EUTSA_v10007534mg             260   1e-81   
ref|XP_007158463.1|  hypothetical protein PHAVU_002G154400g             260   2e-81   
ref|XP_006302176.1|  hypothetical protein CARUB_v10020186mg             260   3e-81   
ref|XP_004300758.1|  PREDICTED: cytochrome P450 87A3-like               259   4e-81   
ref|XP_010055602.1|  PREDICTED: cytochrome P450 87A3-like isoform X2    259   4e-81   
ref|XP_006352287.1|  PREDICTED: cytochrome P450 87A3-like               258   1e-80   
ref|XP_006366247.1|  PREDICTED: cytochrome P450 87A3-like               258   2e-80   
emb|CDY66605.1|  BnaA06g38070D                                          257   2e-80   
ref|XP_007210081.1|  hypothetical protein PRUPE_ppa019666mg             257   2e-80   
emb|CDY26591.1|  BnaA09g46860D                                          257   3e-80   
ref|XP_009118059.1|  PREDICTED: cytochrome P450 87A3-like               257   3e-80   
ref|XP_008799522.1|  PREDICTED: cytochrome P450 87A3                    256   5e-80   
ref|XP_004244719.1|  PREDICTED: cytochrome P450 87A3-like               256   7e-80   
ref|XP_004147972.1|  PREDICTED: cytochrome P450 87A3-like               255   9e-80   
emb|CDY60267.1|  BnaC05g49310D                                          255   2e-79   
ref|XP_006857880.1|  hypothetical protein AMTR_s00069p00107680          254   3e-79   
emb|CDY16028.1|  BnaC08g40950D                                          254   3e-79   
ref|XP_009400635.1|  PREDICTED: cytochrome P450 87A3-like               252   5e-79   
ref|XP_010919431.1|  PREDICTED: cytochrome P450 87A3                    253   1e-78   
ref|XP_006300459.1|  hypothetical protein CARUB_v10020228mg             249   3e-77   
ref|XP_009400447.1|  PREDICTED: cytochrome P450 87A3-like               248   6e-77   
ref|XP_010545882.1|  PREDICTED: cytochrome P450 87A3-like               248   8e-77   
ref|XP_010473544.1|  PREDICTED: cytochrome P450 87A3-like               243   9e-75   
ref|XP_003570092.1|  PREDICTED: cytochrome P450 87A3-like               242   2e-74   
ref|XP_004171985.1|  PREDICTED: cytochrome P450 87A3-like               242   2e-74   
ref|XP_010545893.1|  PREDICTED: cytochrome P450 87A3-like               241   3e-74   
ref|XP_004141154.1|  PREDICTED: cytochrome P450 87A3-like               241   3e-74   
gb|EMS46312.1|  Cytochrome P450 87A3                                    241   3e-74   
ref|XP_008355587.1|  PREDICTED: cytochrome P450 87A3-like               238   3e-74   
ref|XP_010055601.1|  PREDICTED: cytochrome P450 87A3-like isoform X1    242   3e-74   
ref|XP_007149239.1|  hypothetical protein PHAVU_005G053400g             240   1e-73   
emb|CAH67038.1|  OSIGBa0139P06.11                                       235   9e-72   Oryza sativa [red rice]
ref|XP_003580352.1|  PREDICTED: cytochrome P450 87A3                    236   1e-71   
ref|XP_004298752.1|  PREDICTED: cytochrome P450 87A3-like               234   1e-71   
ref|XP_008646050.1|  PREDICTED: cytochrome P450 87A3-like               234   2e-71   
emb|CAD41584.3|  OSJNBa0088I22.16                                       234   2e-71   
gb|EMT10534.1|  Cytochrome P450 87A3                                    233   2e-71   
ref|XP_002452760.1|  hypothetical protein SORBIDRAFT_04g032020          234   3e-71   Sorghum bicolor [broomcorn]
gb|EEE61527.1|  hypothetical protein OsJ_15830                          234   5e-71   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053599.1|  Os04g0570000                                       234   5e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008669007.1|  PREDICTED: cytochrome P450 87A3 isoform X1         233   1e-70   
ref|XP_011016152.1|  PREDICTED: cytochrome P450 87A3-like               227   1e-70   
ref|XP_004953429.1|  PREDICTED: cytochrome P450 87A3-like               232   1e-70   
ref|XP_006652661.1|  PREDICTED: cytochrome P450 87A3-like               233   2e-70   
ref|XP_002448362.1|  hypothetical protein SORBIDRAFT_06g025820          231   6e-70   Sorghum bicolor [broomcorn]
ref|XP_006647678.1|  PREDICTED: cytochrome P450 87A3-like               230   6e-70   
ref|XP_008663476.1|  PREDICTED: cytochrome P450 87A3-like               231   9e-70   
ref|XP_004976534.1|  PREDICTED: cytochrome P450 87A3-like               230   1e-69   
dbj|BAJ97484.1|  predicted protein                                      228   5e-69   
gb|EEC73772.1|  hypothetical protein OsI_08447                          228   6e-69   Oryza sativa Indica Group [Indian rice]
ref|XP_011022913.1|  PREDICTED: cytochrome P450 87A3-like isoform X3    227   6e-69   
gb|EAZ31605.1|  hypothetical protein OsJ_15749                          226   2e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011022914.1|  PREDICTED: cytochrome P450 87A3-like               227   2e-68   
ref|XP_011022912.1|  PREDICTED: cytochrome P450 87A3-like isoform X2    227   2e-68   
dbj|BAD29475.1|  putative cytochrome P450                               227   2e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011022911.1|  PREDICTED: cytochrome P450 87A3-like isoform X1    227   6e-68   
ref|XP_004298750.1|  PREDICTED: cytochrome P450 87A3-like               223   3e-67   
gb|EMT30405.1|  Cytochrome P450 87A3                                    224   4e-67   
ref|XP_008669008.1|  PREDICTED: cytochrome P450 87A3 isoform X2         223   5e-67   
ref|XP_002887976.1|  predicted protein                                  215   1e-65   
ref|XP_007051922.1|  Cytochrome P450 87A3                               218   6e-65   
ref|XP_002274332.3|  PREDICTED: cytochrome P450 87A3-like               216   8e-65   Vitis vinifera
ref|XP_007038615.1|  Cytochrome P450, family 87, subfamily A, pol...    216   2e-64   
emb|CBI31826.3|  unnamed protein product                                216   4e-64   
ref|XP_004976535.1|  PREDICTED: cytochrome P450 87A3-like               209   1e-61   
ref|XP_006653691.1|  PREDICTED: cytochrome P450 87A3-like               208   3e-61   
emb|CBI38770.3|  unnamed protein product                                211   3e-61   
emb|CAH67278.1|  OSIGBa0111L12.5                                        207   7e-61   Oryza sativa [red rice]
ref|NP_001053601.1|  Os04g0570600                                       207   7e-61   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04091.3|  OSJNBa0088I22.12                                       207   8e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010661699.1|  PREDICTED: cytochrome P450 87A3-like               210   1e-60   
gb|EMS59428.1|  Cytochrome P450 87A3                                    206   2e-60   
ref|NP_001288455.1|  cytochrome P450 87A3-like                          202   4e-59   
ref|XP_002448363.1|  hypothetical protein SORBIDRAFT_06g025830          202   5e-59   Sorghum bicolor [broomcorn]
ref|XP_002510826.1|  cytochrome P450, putative                          200   3e-58   Ricinus communis
emb|CDP19727.1|  unnamed protein product                                199   3e-58   
ref|XP_009611047.1|  PREDICTED: cytochrome P450 87A3-like               199   4e-58   
dbj|BAJ97704.1|  predicted protein                                      193   4e-58   
ref|XP_008671137.1|  PREDICTED: cytochrome P450 87A3-like               202   1e-57   
emb|CAN64251.1|  hypothetical protein VITISV_001277                     195   3e-57   Vitis vinifera
ref|XP_010227227.1|  PREDICTED: cytochrome P450 87A3-like               197   4e-57   
ref|XP_010275621.1|  PREDICTED: cytochrome P450 87A3-like               196   1e-56   
gb|EMS63415.1|  Cytochrome P450 87A3                                    193   2e-56   
emb|CDP18910.1|  unnamed protein product                                191   2e-56   
ref|XP_010662510.1|  PREDICTED: cytochrome P450 87A3-like               194   3e-56   
ref|XP_009803784.1|  PREDICTED: cytochrome P450 87A3-like               194   7e-56   
gb|EMT25093.1|  Cytochrome P450 87A3                                    192   1e-55   
emb|CDP18915.1|  unnamed protein product                                191   3e-55   
ref|XP_002529163.1|  cytochrome P450, putative                          192   3e-55   Ricinus communis
gb|AFW68203.1|  putative cytochrome P450 superfamily protein            187   4e-55   
gb|EMT05251.1|  Cytochrome P450 87A3                                    193   6e-55   
emb|CDP18909.1|  unnamed protein product                                191   6e-55   
ref|XP_002510669.1|  cytochrome P450, putative                          191   7e-55   Ricinus communis
ref|XP_003581538.1|  PREDICTED: cytochrome P450 87A3-like               190   1e-54   
gb|AAO23096.1|  putative hydroxylase                                    186   8e-54   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050816.1|  Os03g0658800                                       186   5e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009344797.1|  PREDICTED: cytochrome P450 87A3-like               186   5e-53   
ref|XP_002272031.1|  PREDICTED: cytochrome P450 87A3                    186   5e-53   Vitis vinifera
ref|XP_002465524.1|  hypothetical protein SORBIDRAFT_01g040500          186   5e-53   Sorghum bicolor [broomcorn]
ref|XP_009776354.1|  PREDICTED: cytochrome P450 87A3-like isoform X1    186   7e-53   
gb|EMT22412.1|  Cytochrome P450 87A3                                    185   9e-53   
ref|XP_008356324.1|  PREDICTED: cytochrome P450 87A3-like               183   1e-52   
ref|XP_002269701.3|  PREDICTED: cytochrome P450 87A3-like               183   1e-52   Vitis vinifera
emb|CBI40704.3|  unnamed protein product                                186   2e-52   
ref|XP_009344155.1|  PREDICTED: cytochrome P450 87A3-like               184   2e-52   
ref|NP_001140790.1|  uncharacterized protein LOC100272865               184   3e-52   Zea mays [maize]
ref|XP_010092748.1|  Cytochrome P450 87A3                               181   1e-51   
ref|XP_008346328.1|  PREDICTED: cytochrome P450 87A3-like               182   1e-51   
gb|EMS52130.1|  Cytochrome P450 87A3                                    182   2e-51   
gb|KDO40279.1|  hypothetical protein CISIN_1g012100mg                   182   2e-51   
ref|XP_008364406.1|  PREDICTED: cytochrome P450 87A3-like               182   2e-51   
ref|XP_010237177.1|  PREDICTED: cytochrome P450 87A3-like               180   2e-51   
emb|CDP18913.1|  unnamed protein product                                180   5e-51   
gb|EMT08723.1|  Cytochrome P450 87A3                                    179   7e-51   
ref|XP_008644631.1|  PREDICTED: cytochrome P450 87A3-like               180   8e-51   
ref|XP_002514563.1|  cytochrome P450, putative                          179   1e-50   Ricinus communis
ref|XP_004290050.1|  PREDICTED: cytochrome P450 87A3-like               179   2e-50   
gb|AAL73972.1|AF466201_1  putative cytochrome P450-like protein         179   2e-50   Sorghum bicolor [broomcorn]
ref|XP_010111721.1|  Cytochrome P450 87A3                               179   2e-50   
ref|XP_009616055.1|  PREDICTED: cytochrome P450 87A3-like isoform X1    179   3e-50   
ref|XP_006650369.1|  PREDICTED: cytochrome P450 87A3-like               179   3e-50   
ref|XP_002272143.2|  PREDICTED: cytochrome P450 87A3                    178   5e-50   Vitis vinifera
ref|XP_002464218.1|  hypothetical protein SORBIDRAFT_01g014340          177   9e-50   Sorghum bicolor [broomcorn]
ref|XP_002284844.1|  PREDICTED: cytochrome P450 87A3-like               176   2e-49   Vitis vinifera
ref|XP_002299955.2|  hypothetical protein POPTR_0001s27750g             176   2e-49   Populus trichocarpa [western balsam poplar]
ref|XP_006442982.1|  hypothetical protein CICLE_v10019989mg             176   2e-49   
ref|XP_004974765.1|  PREDICTED: cytochrome P450 87A3-like               176   2e-49   
ref|XP_008235946.1|  PREDICTED: cytochrome P450 87A3-like               176   2e-49   
ref|XP_004974764.1|  PREDICTED: cytochrome P450 87A3-like               176   2e-49   
ref|XP_002464219.1|  hypothetical protein SORBIDRAFT_01g014350          176   2e-49   Sorghum bicolor [broomcorn]
ref|XP_007041637.1|  Cytochrome P450, putative                          176   3e-49   
ref|XP_011093255.1|  PREDICTED: cytochrome P450 87A3-like               176   3e-49   
ref|XP_002489065.1|  hypothetical protein SORBIDRAFT_0183s002030        173   3e-49   Sorghum bicolor [broomcorn]
ref|XP_006369643.1|  hypothetical protein POPTR_0001s27720g             176   3e-49   
emb|CBI18863.3|  unnamed protein product                                176   4e-49   
ref|XP_006369644.1|  hypothetical protein POPTR_0001s27730g             176   4e-49   
ref|NP_001176087.1|  Os10g0337100                                       170   5e-49   
ref|XP_003572191.2|  PREDICTED: cytochrome P450 87A3-like isoform X1    175   6e-49   
emb|CBI40703.3|  unnamed protein product                                174   1e-48   
ref|XP_011025046.1|  PREDICTED: cytochrome P450 87A3-like               174   2e-48   
ref|NP_001175197.1|  Os07g0482975                                       170   2e-48   
gb|EAY78080.1|  hypothetical protein OsI_33124                          167   2e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_002313286.1|  hypothetical protein POPTR_0009s06920g             174   2e-48   Populus trichocarpa [western balsam poplar]
ref|XP_011025041.1|  PREDICTED: cytochrome P450 87A3-like               174   2e-48   
ref|XP_007199625.1|  hypothetical protein PRUPE_ppa016466mg             174   2e-48   
ref|XP_011025045.1|  PREDICTED: cytochrome P450 87A3-like               173   3e-48   
ref|XP_002271954.1|  PREDICTED: cytochrome P450 87A3                    173   3e-48   Vitis vinifera
gb|EEC82033.1|  hypothetical protein OsI_26005                          171   4e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_006369642.1|  hypothetical protein POPTR_0001s27700g             172   5e-48   
ref|XP_008235945.1|  PREDICTED: cytochrome P450 87A3-like               172   6e-48   
ref|XP_002299954.1|  hypothetical protein POPTR_0001s27710g             172   6e-48   Populus trichocarpa [western balsam poplar]
ref|XP_011046283.1|  PREDICTED: cytochrome P450 87A3-like               172   8e-48   
ref|XP_006651656.1|  PREDICTED: cytochrome P450 87A3-like               172   1e-47   
ref|XP_003631906.1|  PREDICTED: cytochrome P450 87A3-like               172   1e-47   
gb|EAZ39816.1|  hypothetical protein OsJ_24256                          170   1e-47   Oryza sativa Japonica Group [Japonica rice]
emb|CBI38410.3|  unnamed protein product                                172   2e-47   
dbj|BAC57807.1|  putative cytochrome P450                               170   2e-47   Oryza sativa Japonica Group [Japonica rice]
emb|CDP16077.1|  unnamed protein product                                170   3e-47   
gb|EMT26562.1|  Cytochrome P450 87A3                                    170   7e-47   
gb|KDP43049.1|  hypothetical protein JCGZ_25235                         169   7e-47   
ref|XP_011025042.1|  PREDICTED: cytochrome P450 87A3-like               169   8e-47   
ref|XP_002299957.1|  hypothetical protein POPTR_0001s27770g             169   1e-46   Populus trichocarpa [western balsam poplar]
ref|XP_011101634.1|  PREDICTED: cytochrome P450 87A3-like               169   2e-46   
ref|XP_002265422.2|  PREDICTED: cytochrome P450 87A3-like               169   2e-46   Vitis vinifera
ref|XP_011007350.1|  PREDICTED: cytochrome P450 87A3-like               169   2e-46   
emb|CBI38409.3|  unnamed protein product                                169   2e-46   
ref|XP_002299956.1|  hypothetical protein POPTR_0001s27760g             168   2e-46   Populus trichocarpa [western balsam poplar]
ref|XP_004292300.1|  PREDICTED: cytochrome P450 87A3-like               167   7e-46   
ref|XP_004955876.1|  PREDICTED: cytochrome P450 87A3-like isoform X1    167   7e-46   
gb|EMT08489.1|  Cytochrome P450 87A3                                    167   7e-46   
ref|XP_011025040.1|  PREDICTED: cytochrome P450 87A3-like               166   1e-45   
ref|XP_011007351.1|  PREDICTED: cytochrome P450 87A3-like               166   1e-45   
ref|XP_002313285.2|  hypothetical protein POPTR_0009s06930g             166   1e-45   Populus trichocarpa [western balsam poplar]
gb|EEE68447.1|  hypothetical protein OsJ_26826                          165   4e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006657536.1|  PREDICTED: cytochrome P450 87A3-like               165   5e-45   
ref|XP_002526166.1|  cytochrome P450, putative                          163   5e-45   Ricinus communis
ref|XP_010111726.1|  Cytochrome P450 87A3                               163   6e-45   
ref|XP_007201108.1|  hypothetical protein PRUPE_ppa024382mg             164   1e-44   
gb|EEE61528.1|  hypothetical protein OsJ_15832                          162   1e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006653690.1|  PREDICTED: cytochrome P450 87A3-like               163   2e-44   
emb|CAD41581.3|  OSJNBa0088I22.13                                       162   4e-44   Oryza sativa Japonica Group [Japonica rice]
gb|AGT17443.1|  cytochrome P450                                         162   4e-44   
ref|XP_007016259.1|  Cytochrome P450, putative                          162   5e-44   
ref|XP_002527850.1|  cytochrome P450, putative                          161   5e-44   Ricinus communis
ref|XP_010027150.1|  PREDICTED: cytochrome P450 87A3-like               162   6e-44   
gb|EEC76682.1|  hypothetical protein OsI_14666                          160   6e-44   Oryza sativa Indica Group [Indian rice]
ref|NP_001053600.1|  Os04g0570500                                       161   1e-43   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67277.1|  OSIGBa0111L12.4                                        161   1e-43   Oryza sativa [red rice]
ref|XP_010690665.1|  PREDICTED: cytochrome P450 87A3-like               161   1e-43   
gb|EYU19885.1|  hypothetical protein MIMGU_mgv1a020752mg                160   3e-43   
gb|KCW61505.1|  hypothetical protein EUGRSUZ_H04233                     158   4e-43   
dbj|BAG97817.1|  unnamed protein product                                154   4e-43   Oryza sativa Japonica Group [Japonica rice]
gb|AHF22090.1|  CYP87D16                                                159   6e-43   
ref|XP_008235944.1|  PREDICTED: cytochrome P450 87A3-like               159   8e-43   
ref|XP_004955877.1|  PREDICTED: cytochrome P450 87A3-like isoform X2    158   9e-43   
ref|XP_010111725.1|  Cytochrome P450 87A3                               157   1e-42   
ref|XP_010092091.1|  Cytochrome P450 87A3                               153   1e-42   
ref|XP_010027149.1|  PREDICTED: cytochrome P450 87A3-like               158   1e-42   
gb|KDP29666.1|  hypothetical protein JCGZ_18828                         158   2e-42   
ref|XP_007016260.1|  Cytochrome P450, putative                          158   2e-42   
ref|XP_008235974.1|  PREDICTED: cytochrome P450 87A3-like               157   2e-42   
ref|XP_008235976.1|  PREDICTED: cytochrome P450 87A3-like               157   3e-42   
ref|XP_006384829.1|  hypothetical protein POPTR_0004s21430g             158   3e-42   
gb|KCW66735.1|  hypothetical protein EUGRSUZ_F00492                     156   4e-42   
ref|XP_007149240.1|  hypothetical protein PHAVU_005G053500g             153   6e-42   
ref|XP_008348936.1|  PREDICTED: cytochrome P450 87A3-like               156   6e-42   
ref|XP_010060164.1|  PREDICTED: cytochrome P450 87A3-like               156   7e-42   
ref|XP_008382414.1|  PREDICTED: cytochrome P450 87A3-like               156   8e-42   
ref|XP_002526164.1|  cytochrome P450, putative                          154   4e-41   Ricinus communis
ref|XP_010060163.1|  PREDICTED: cytochrome P450 87A3-like isoform X2    153   5e-41   
gb|KDP43441.1|  hypothetical protein JCGZ_16728                         154   6e-41   
gb|AEM42983.1|  cytochrome P450                                         154   7e-41   
gb|EEC69106.1|  hypothetical protein OsI_38016                          147   9e-41   Oryza sativa Indica Group [Indian rice]
ref|XP_010060162.1|  PREDICTED: cytochrome P450 87A3-like isoform X1    153   2e-40   
ref|XP_010242756.1|  PREDICTED: cytochrome P450 87A3-like               152   2e-40   
gb|EMT20939.1|  Cytochrome P450 87A3                                    152   2e-40   
gb|EEE53052.1|  hypothetical protein OsJ_35786                          148   4e-40   Oryza sativa Japonica Group [Japonica rice]
gb|ABA97487.1|  Cytochrome P450 family protein                          148   4e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010235124.1|  PREDICTED: cytochrome P450 87A3-like isoform X2    150   5e-40   
gb|EMS54142.1|  Cytochrome P450 87A3                                    150   9e-40   
ref|XP_011007291.1|  PREDICTED: cytochrome P450 87A3-like               150   1e-39   
gb|EEE50654.1|  hypothetical protein OsJ_30884                          148   1e-39   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK03801.1|  predicted protein                                      150   2e-39   
gb|EMS49458.1|  Cytochrome P450 87A3                                    148   2e-39   
gb|AAM74303.1|AC083944_21  Putative cytochrome P450                     147   4e-39   Oryza sativa Japonica Group [Japonica rice]
gb|EMS49448.1|  Cytochrome P450 87A3                                    148   2e-38   
ref|XP_007016226.1|  Cytochrome P450, putative isoform 1                147   2e-38   
gb|EYU37761.1|  hypothetical protein MIMGU_mgv1a025836mg                146   3e-38   
ref|XP_002489064.1|  hypothetical protein SORBIDRAFT_0183s002020        145   4e-38   
ref|XP_009588273.1|  PREDICTED: cytochrome P450 87A3-like               145   1e-37   
gb|EEC68024.1|  hypothetical protein OsI_35831                          145   1e-37   
ref|NP_001067707.1|  Os11g0289700                                       145   1e-37   
ref|XP_010068615.1|  PREDICTED: cytochrome P450 87A3-like               144   1e-37   
gb|KCW64199.1|  hypothetical protein EUGRSUZ_G01853                     144   1e-37   
gb|AAV85744.1|  cytochrome P450                                         145   1e-37   
ref|XP_004237161.1|  PREDICTED: cytochrome P450 87A3-like               144   2e-37   
gb|KHG27614.1|  Cytochrome P450                                         143   3e-37   
gb|KHG27613.1|  Cytochrome P450                                         143   3e-37   
ref|XP_002306227.2|  hypothetical protein POPTR_0004s19450g             144   3e-37   
gb|ABB47211.1|  Cytochrome P450 87A3, putative, expressed               137   3e-37   
gb|KCW61504.1|  hypothetical protein EUGRSUZ_H04232                     143   4e-37   
gb|KCW64197.1|  hypothetical protein EUGRSUZ_G01850                     143   4e-37   
ref|XP_009798348.1|  PREDICTED: cytochrome P450 87A3-like               142   9e-37   
ref|XP_007051917.1|  Cytochrome P450 superfamily protein, putative      141   2e-36   
gb|KCW64198.1|  hypothetical protein EUGRSUZ_G01852                     141   2e-36   
ref|XP_010068614.1|  PREDICTED: cytochrome P450 87A3-like               141   2e-36   
ref|XP_010271639.1|  PREDICTED: cytochrome P450 87A3-like               140   2e-36   
gb|EEC66642.1|  hypothetical protein OsI_32903                          139   3e-36   
ref|NP_001289636.1|  uncharacterized protein LOC101213710               139   9e-36   
gb|ADN33686.1|  cytochrome p450                                         137   2e-35   
gb|EMT14969.1|  Cytochrome P450 87A3                                    137   3e-35   
ref|XP_010042651.1|  PREDICTED: cytochrome P450 87A3-like               136   3e-35   
gb|KCW44517.1|  hypothetical protein EUGRSUZ_L01974                     133   4e-35   
ref|XP_006856402.1|  hypothetical protein AMTR_s00047p00210610          137   5e-35   
ref|XP_008459936.1|  PREDICTED: cytochrome P450 87A3-like               137   5e-35   
ref|XP_008437370.1|  PREDICTED: cytochrome P450 87A3-like               137   7e-35   
gb|EMS54525.1|  Cytochrome P450 87A3                                    135   8e-35   
ref|XP_004140660.1|  PREDICTED: cytochrome P450 87A3-like               134   5e-34   
gb|AIT72033.1|  cytochrome P450                                         134   1e-33   
ref|XP_010111724.1|  Cytochrome P450 87A3                               129   1e-33   
gb|AEM42986.1|  cytochrome P450                                         133   2e-33   
gb|AEM42985.1|  cytochrome P450                                         133   2e-33   
gb|AAM00990.1|AC090482_19  Putative cytochrome p450                     127   2e-33   
ref|XP_008379006.1|  PREDICTED: cytochrome P450 87A3-like               132   3e-33   
ref|XP_006434376.1|  hypothetical protein CICLE_v10003322mg             132   4e-33   
ref|XP_010067803.1|  PREDICTED: cytochrome P450 87A3-like               131   1e-32   
gb|KCW66016.1|  hypothetical protein EUGRSUZ_G03307                     131   1e-32   
gb|AAP50989.1|  putative cytochrome P450                                130   1e-32   
emb|CDP07623.1|  unnamed protein product                                128   4e-32   
gb|KDO70317.1|  hypothetical protein CISIN_1g037545mg                   128   5e-32   
ref|XP_006437886.1|  hypothetical protein CICLE_v10031449mg             128   8e-32   
gb|KHG19772.1|  Cytochrome P450                                         127   9e-32   
gb|AAF20011.1|AF216313_1  cytochrome P450                               124   1e-31   
gb|KCW64202.1|  hypothetical protein EUGRSUZ_G01855                     128   1e-31   
ref|XP_006484352.1|  PREDICTED: cytochrome P450 85A1-like               127   1e-31   
ref|XP_010067804.1|  PREDICTED: cytochrome P450 87A3-like               126   5e-31   
emb|CAN73647.1|  hypothetical protein VITISV_036841                     126   6e-31   
gb|KCW66017.1|  hypothetical protein EUGRSUZ_G03309                     126   6e-31   
ref|XP_002273613.1|  PREDICTED: cytochrome P450 85A                     126   6e-31   
ref|XP_011099602.1|  PREDICTED: cytochrome P450 90B1                    125   9e-31   
gb|AIK01727.1|  CYP720PB11                                              125   1e-30   
ref|XP_007156935.1|  hypothetical protein PHAVU_002G029700g             123   4e-30   
gb|AIK01730.1|  CYP720B2                                                123   5e-30   
gb|AJD25212.1|  cytochrome P450 CYP90B26                                123   5e-30   
emb|CDP02030.1|  unnamed protein product                                123   5e-30   
ref|XP_002466841.1|  hypothetical protein SORBIDRAFT_01g015040          123   6e-30   
gb|ABK26932.1|  unknown                                                 123   6e-30   
ref|XP_011099036.1|  PREDICTED: cytochrome P450 85A1                    123   6e-30   
ref|XP_007016227.1|  Cytochrome P450, putative isoform 2                121   8e-30   
sp|Q50EK5.1|C72B2_PINTA  RecName: Full=Cytochrome P450 720B2; Alt...    122   1e-29   
gb|AIK01725.1|  CYP720B2                                                122   1e-29   
ref|XP_007156936.1|  hypothetical protein PHAVU_002G029700g             122   2e-29   
gb|AIK01728.1|  CYP720PB12                                              122   2e-29   
gb|AIK01734.1|  CYP720B12                                               122   2e-29   
gb|ADR78275.1|  CYP720B2                                                121   2e-29   
ref|XP_004982466.1|  PREDICTED: cytochrome P450 85A1-like isoform X2    121   3e-29   
ref|XP_007045811.1|  Brassinosteroid-6-oxidase 2                        121   3e-29   
ref|XP_004982465.1|  PREDICTED: cytochrome P450 85A1-like isoform X1    121   3e-29   
ref|XP_010260629.1|  PREDICTED: cytochrome P450 85A-like                120   4e-29   
gb|AIK01731.1|  CYP720B10v1                                             121   4e-29   
ref|XP_006856023.1|  hypothetical protein AMTR_s00059p00056420          121   4e-29   
dbj|BAF56239.1|  cytochrome P450 enzyme                                 121   4e-29   
ref|XP_008790366.1|  PREDICTED: cytochrome P450 90B1-like               120   4e-29   
ref|XP_008453737.1|  PREDICTED: cytochrome P450 90B1                    120   4e-29   
ref|XP_010254867.1|  PREDICTED: cytochrome P450 90B1-like               121   4e-29   
gb|ABK25038.1|  unknown                                                 120   5e-29   
ref|XP_006365657.1|  PREDICTED: cytochrome P450 85A3-like               120   5e-29   
gb|AIK01733.1|  CYP720B11                                               120   5e-29   
ref|XP_004149155.1|  PREDICTED: cytochrome P450 90B1-like               120   5e-29   
ref|XP_008775849.1|  PREDICTED: cytochrome P450 85A-like                120   6e-29   
gb|ACN40244.1|  unknown                                                 120   6e-29   
ref|XP_008459397.1|  PREDICTED: cytochrome P450 85A-like                120   8e-29   
ref|XP_004141472.1|  PREDICTED: cytochrome P450 85A-like                120   9e-29   
ref|XP_008379447.1|  PREDICTED: cytochrome P450 85A                     120   9e-29   
ref|XP_008783481.1|  PREDICTED: cytochrome P450 90B1-like               120   9e-29   
gb|ABJ90340.1|  steroid 22-alpha-hydroxylase                            120   1e-28   
ref|XP_010253861.1|  PREDICTED: cytochrome P450 90A1-like               120   1e-28   
ref|XP_010032564.1|  PREDICTED: cytochrome P450 85A-like isoform X2     119   1e-28   
gb|EEC75709.1|  hypothetical protein OsI_12535                          119   1e-28   
gb|AJD25206.1|  cytochrome P450 CYP85A1                                 119   1e-28   
gb|ADR78276.1|  CYP720B4                                                119   1e-28   
ref|NP_001050623.1|  Os03g0602300                                       119   1e-28   
ref|XP_010032563.1|  PREDICTED: cytochrome P450 85A-like isoform X1     119   1e-28   
ref|XP_010694086.1|  PREDICTED: cytochrome P450 85A-like                119   2e-28   
ref|XP_008811805.1|  PREDICTED: cytochrome P450 85A1-like               119   2e-28   
ref|XP_003538851.1|  PREDICTED: cytochrome P450 90B1-like               119   2e-28   
gb|KDP41328.1|  hypothetical protein JCGZ_15735                         119   2e-28   
gb|ADR78270.1|  CYP720B12                                               119   2e-28   
gb|ABC68409.1|  cytochrome P450 monooxygenase CYP90A15                  118   2e-28   
ref|XP_006573584.1|  PREDICTED: cytochrome P450 90B1-like isoform X2    118   2e-28   
gb|ADR78277.1|  CYP720B5v1                                              118   3e-28   
gb|ADR78278.1|  CYP720B5v2                                              118   3e-28   
ref|XP_003629467.1|  Cytochrome P450 enzyme                             118   3e-28   
gb|ACM04453.1|  CYP720B4                                                118   3e-28   
dbj|BAO79854.1|  brassinosteroid-6-oxidase                              118   3e-28   
ref|XP_010923635.1|  PREDICTED: cytochrome P450 85A1-like isoform X2    118   3e-28   
gb|AEI98636.1|  hypothetical protein 111O18.23                          118   3e-28   
gb|ACN40968.1|  unknown                                                 118   3e-28   
ref|XP_010032557.1|  PREDICTED: cytochrome P450 85A-like                117   3e-28   
ref|XP_010032561.1|  PREDICTED: cytochrome P450 85A-like isoform X2     118   4e-28   
ref|XP_010041020.1|  PREDICTED: cytochrome P450 85A-like                118   4e-28   
ref|XP_010032560.1|  PREDICTED: cytochrome P450 85A-like isoform X1     118   4e-28   
gb|ABF97985.1|  transposon protein, putative, CACTA, En/Spm sub-c...    121   4e-28   
gb|EYU44229.1|  hypothetical protein MIMGU_mgv1a004825mg                118   4e-28   
dbj|BAO79853.1|  brassinosteroid-6-oxidase                              118   4e-28   
ref|XP_006466783.1|  PREDICTED: cytochrome P450 90B1-like isoform X2    117   4e-28   
gb|KDO79530.1|  hypothetical protein CISIN_1g018520mg                   117   5e-28   
ref|XP_006650284.1|  PREDICTED: cytochrome P450 85A1-like               117   6e-28   
gb|AIU96236.1|  DWARF                                                   115   6e-28   
gb|AIK01732.1|  CYP720B10v2                                             117   6e-28   
ref|XP_007046960.1|  Cytochrome P450 superfamily protein isoform 2      117   6e-28   
gb|KCW51956.1|  hypothetical protein EUGRSUZ_J01402                     117   6e-28   
gb|AIK01726.1|  CYP720B10                                               117   6e-28   
ref|XP_006414544.1|  hypothetical protein EUTSA_v10025084mg             117   6e-28   
gb|KHN34728.1|  Cytochrome P450 90A1                                    116   6e-28   
ref|XP_004512038.1|  PREDICTED: cytochrome P450 90B1-like isoform X1    117   6e-28   
gb|AGJ98221.1|  DWARF4                                                  117   6e-28   
ref|XP_004512039.1|  PREDICTED: cytochrome P450 90B1-like isoform X2    117   6e-28   
ref|XP_007046959.1|  Cytochrome P450 superfamily protein isoform 1      117   6e-28   
ref|XP_010936440.1|  PREDICTED: cytochrome P450 85A1-like               117   6e-28   
gb|AET03943.2|  cytochrome P450 family 90 protein                       117   7e-28   
ref|XP_003611983.1|  Cytochrome P450                                    117   7e-28   
ref|XP_010462465.1|  PREDICTED: cytochrome P450 708A2-like              117   8e-28   
gb|AES94941.2|  cytochrome P450 family protein                          117   8e-28   
ref|XP_003517233.1|  PREDICTED: cytochrome P450 90B1-like isoform X1    117   8e-28   
ref|XP_010649978.1|  PREDICTED: cytochrome P450 85A1-like               116   9e-28   
gb|KDO69003.1|  hypothetical protein CISIN_1g011522mg                   116   9e-28   
ref|XP_006840382.1|  hypothetical protein AMTR_s00045p00135520          116   9e-28   
gb|KHN36124.1|  Cytochrome P450 90B1                                    117   1e-27   
ref|XP_006425688.1|  hypothetical protein CICLE_v10025451mg             117   1e-27   
ref|XP_006425689.1|  hypothetical protein CICLE_v10025451mg             117   1e-27   
ref|XP_009415673.1|  PREDICTED: cytochrome P450 85A-like                117   1e-27   
ref|XP_009373786.1|  PREDICTED: cytochrome P450 85A                     116   1e-27   
gb|AES94940.2|  cytochrome P450 family protein                          117   1e-27   
ref|XP_007163533.1|  hypothetical protein PHAVU_001G242200g             116   1e-27   
ref|XP_003611982.1|  Cytochrome P450                                    117   1e-27   
gb|KDO69002.1|  hypothetical protein CISIN_1g011522mg                   116   1e-27   
ref|NP_001275805.1|  uncharacterized protein LOC102608450               116   1e-27   
emb|CDY24488.1|  BnaC05g34660D                                          116   1e-27   
ref|XP_010480156.1|  PREDICTED: cytochrome P450 708A2-like              117   1e-27   
ref|XP_007141773.1|  hypothetical protein PHAVU_008G224600g             116   2e-27   
ref|XP_003538460.1|  PREDICTED: cytochrome P450 90A1                    116   2e-27   
ref|XP_006435723.1|  hypothetical protein CICLE_v10031576mg             116   2e-27   
gb|KHG20269.1|  Cytochrome P450                                         116   2e-27   
emb|CBI16941.3|  unnamed protein product                                116   2e-27   
ref|NP_001267889.1|  brassinosteroid-6-oxidase                          116   2e-27   
ref|XP_009102065.1|  PREDICTED: cytochrome P450 90B1 isoform X2         116   2e-27   
emb|CAN66537.1|  hypothetical protein VITISV_029635                     116   2e-27   
gb|AAC05093.1|  steroid 22-alpha-hydroxylase                            116   2e-27   
ref|NP_190635.1|  cytochrome P450 90B1                                  116   2e-27   
emb|CDP19976.1|  unnamed protein product                                116   2e-27   
ref|XP_004490986.1|  PREDICTED: cytochrome P450 90A1-like isoform X2    116   2e-27   
ref|XP_009102057.1|  PREDICTED: cytochrome P450 90B1 isoform X1         116   2e-27   
gb|AES99584.2|  cytochrome P450 family monooxygenase                    116   2e-27   
ref|XP_004490985.1|  PREDICTED: cytochrome P450 90A1-like isoform X1    116   2e-27   
ref|XP_003616626.1|  Cytochrome P450                                    116   2e-27   
ref|XP_008241666.1|  PREDICTED: cytochrome P450 90B1 isoform X2         116   2e-27   
ref|XP_008241665.1|  PREDICTED: cytochrome P450 90B1 isoform X1         116   2e-27   
ref|XP_010242200.1|  PREDICTED: cytochrome P450 90D2                    116   2e-27   
ref|XP_010654520.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...    115   2e-27   
ref|XP_010431222.1|  PREDICTED: cytochrome P450 90B1-like               115   2e-27   
gb|KDO69000.1|  hypothetical protein CISIN_1g011522mg                   115   3e-27   
ref|XP_007201951.1|  hypothetical protein PRUPE_ppa004565mg             116   3e-27   
ref|XP_006857640.1|  hypothetical protein AMTR_s00061p00138150          115   3e-27   
ref|XP_006378665.1|  hypothetical protein POPTR_0010s19710g             115   3e-27   
gb|KDO69001.1|  hypothetical protein CISIN_1g011522mg                   115   3e-27   
ref|XP_002877758.1|  cytochrome P450 90B1                               115   3e-27   
emb|CDY49400.1|  BnaA01g35580D                                          115   3e-27   
ref|XP_010263684.1|  PREDICTED: cytochrome P450 90B1-like               115   4e-27   
gb|AHW42466.1|  KAO1                                                    115   4e-27   
ref|XP_002267187.1|  PREDICTED: cytochrome P450 90B1                    115   4e-27   
emb|CBI17531.3|  unnamed protein product                                115   4e-27   
ref|XP_008786029.1|  PREDICTED: cytochrome P450 85A1-like               115   4e-27   
sp|Q50EK6.1|C72B1_PINTA  RecName: Full=Abietadienol/abietadienal ...    115   4e-27   
gb|AET06165.1|  Dwarf2                                                  115   4e-27   
ref|XP_010937936.1|  PREDICTED: cytochrome P450 85A1                    115   4e-27   
ref|XP_004304211.1|  PREDICTED: cytochrome P450 85A-like                115   4e-27   
ref|XP_009419306.1|  PREDICTED: cytochrome P450 90D2-like isoform X2    115   4e-27   
gb|AIK01724.1|  CYP720B1v2                                              115   5e-27   
gb|EMT14731.1|  Cytochrome P450 85A1                                    115   5e-27   
gb|AIK01723.1|  CYP720B1v1                                              115   5e-27   
dbj|BAF56235.1|  cytochrome P450 enzyme                                 115   5e-27   
gb|ADR78279.1|  CYP720B7                                                115   5e-27   
ref|NP_001131939.1|  uncharacterized protein LOC100193331 precursor     115   5e-27   
gb|AAF89209.1|AF279252_1  cytochrome P450                               115   5e-27   
ref|XP_009419305.1|  PREDICTED: cytochrome P450 90D2-like isoform X1    115   5e-27   
gb|ACG46988.1|  cytochrome P450 CYP85A1                                 115   5e-27   
ref|XP_009344816.1|  PREDICTED: cytochrome P450 90A1-like isoform X2    115   5e-27   
ref|XP_009115731.1|  PREDICTED: cytochrome P450 90B1 isoform X2         115   6e-27   
ref|XP_006338341.1|  PREDICTED: cytochrome P450 85A1-like               114   6e-27   
ref|XP_006378663.1|  hypothetical protein POPTR_0010s19710g             114   6e-27   
ref|XP_004509297.1|  PREDICTED: cytochrome P450 90B1-like               115   6e-27   
gb|EPS64226.1|  hypothetical protein M569_10555                         113   6e-27   
ref|XP_007151377.1|  hypothetical protein PHAVU_004G041700g             114   6e-27   
ref|XP_009388906.1|  PREDICTED: cytochrome P450 85A-like                114   6e-27   
ref|XP_010315840.1|  PREDICTED: cytochrome P450 85A1 isoform X1         114   6e-27   
ref|XP_009344808.1|  PREDICTED: cytochrome P450 90A1-like isoform X1    115   6e-27   
ref|XP_006290928.1|  hypothetical protein CARUB_v10017041mg             115   6e-27   
gb|KDP44780.1|  hypothetical protein JCGZ_01280                         114   6e-27   
ref|XP_009115730.1|  PREDICTED: cytochrome P450 90B1 isoform X1         115   6e-27   
emb|CDO99981.1|  unnamed protein product                                115   6e-27   
ref|XP_007009008.1|  Cytochrome P450 superfamily protein isoform 2      114   7e-27   
gb|ABZ89191.1|  putative protein                                        114   7e-27   
ref|XP_002521603.1|  cytochrome P450, putative                          114   7e-27   
gb|ABD62342.1|  6-deoxocastasterone oxidase                             114   7e-27   
ref|XP_010091301.1|  Cytochrome P450                                    114   7e-27   
gb|EMT14727.1|  Cytochrome P450 85A1                                    114   7e-27   
gb|ADR78281.1|  CYP720B10                                               114   7e-27   



>ref|XP_009627452.1| PREDICTED: cytochrome P450 87A3 [Nicotiana tomentosiformis]
Length=476

 Score =   290 bits (741),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRESFVAFIQGLISFP+DIPGTAYH CLQGRKKAMK+LK  +EERRA PRK Q+DFFD+V
Sbjct  196  LRESFVAFIQGLISFPIDIPGTAYHKCLQGRKKAMKMLKTLLEERRAQPRKEQSDFFDYV  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL+RKDTILTE IALDLMFVLLFASFETTSLA+TLA KFL DHPL L++LTEEHEAII
Sbjct  256  LEELQRKDTILTEAIALDLMFVLLFASFETTSLAITLATKFLHDHPLALKELTEEHEAII  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            + RENP SGLTW+EYKSM FTFQ I+ETVRLANIVP IFRK+LRD+N
Sbjct  316  RRRENPASGLTWKEYKSMKFTFQVINETVRLANIVPAIFRKALRDVN  362



>ref|XP_009782612.1| PREDICTED: cytochrome P450 87A3 [Nicotiana sylvestris]
Length=476

 Score =   289 bits (740),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRESFVAFIQGLISFP+DIPGTAYH CLQGRKKAMK+LK  +EERRA PRK Q+DFFD+V
Sbjct  196  LRESFVAFIQGLISFPIDIPGTAYHKCLQGRKKAMKMLKTLLEERRAKPRKEQSDFFDYV  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL+RKDTILTE IALDLMFVLLFASFETTSLA+TLA KFL DHPL L++LTEEHEAII
Sbjct  256  LEELQRKDTILTEAIALDLMFVLLFASFETTSLAITLATKFLHDHPLALKELTEEHEAII  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            + RENP SGLTW+EYKSM FTFQ I+ETVRLANIVP IFRK+LRD+N
Sbjct  316  RRRENPASGLTWKEYKSMKFTFQVINETVRLANIVPAIFRKALRDVN  362



>ref|XP_011029202.1| PREDICTED: cytochrome P450 87A3 [Populus euphratica]
Length=477

 Score =   290 bits (741),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFIQGLISFPLDIPGTAYH CLQGRKKAM++LK  ++ERRANPRK++TDFFD+V
Sbjct  194  LRENFVAFIQGLISFPLDIPGTAYHECLQGRKKAMRMLKNLLQERRANPRKHETDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL++  TILTE IALDLMFVLLFASFETTSLALTLA+KF+SDHPLVL+KLTEEH+ I+
Sbjct  254  LEELQKNKTILTEEIALDLMFVLLFASFETTSLALTLAVKFISDHPLVLQKLTEEHDGIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNREN NSGLTW+EYKSM FTFQ I+ETVRLANIVPGIFRK+LRDI
Sbjct  314  KNRENANSGLTWKEYKSMKFTFQVINETVRLANIVPGIFRKTLRDI  359



>ref|XP_006358916.1| PREDICTED: cytochrome P450 87A3-like [Solanum tuberosum]
Length=482

 Score =   286 bits (733),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRESFVAFIQGLISFP+DIPGTAYH CLQGRKKAMK+LK  +EERRA PRK  TDFFD+V
Sbjct  202  LRESFVAFIQGLISFPIDIPGTAYHKCLQGRKKAMKMLKTMLEERRAKPRKEGTDFFDYV  261

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL++ DTILTE IALDLMFVLLFASFETTSLA+TLA KFL DHPL L++LTEEHEAII
Sbjct  262  LEELQKNDTILTEAIALDLMFVLLFASFETTSLAITLATKFLHDHPLALKELTEEHEAII  321

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            ++RENP SGLTW+EYKSM FTFQ I+ETVRLANIVP IFRK+LRDIN
Sbjct  322  RSRENPASGLTWKEYKSMKFTFQVINETVRLANIVPAIFRKTLRDIN  368



>ref|XP_002299557.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE84362.1| cytochrome P450 family protein [Populus trichocarpa]
Length=477

 Score =   285 bits (730),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFIQGLISFPLDIPGTAYH CLQGRKKAM++LK  ++ER+ANPRK++TDFFD+V
Sbjct  194  LRENFVAFIQGLISFPLDIPGTAYHECLQGRKKAMRMLKNLLQERQANPRKHETDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL++  TILTE IALDLMFVLLFASFETTSL LTLA+KF+SDHPLVL++LTEEHE I+
Sbjct  254  LEELQKNKTILTEEIALDLMFVLLFASFETTSLGLTLAVKFISDHPLVLKELTEEHEGIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNREN NSGLTW+EYKSM FTFQ I+ETVRLANIVPGIFRK+LRDI
Sbjct  314  KNRENANSGLTWKEYKSMKFTFQVINETVRLANIVPGIFRKTLRDI  359



>ref|XP_004246127.1| PREDICTED: cytochrome P450 87A3-like [Solanum lycopersicum]
Length=476

 Score =   282 bits (722),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRESFVAFIQGLISFP+DIPGTAYH CLQGRKKAMK+LK  +EERRA PRK  TDFFD+V
Sbjct  196  LRESFVAFIQGLISFPIDIPGTAYHKCLQGRKKAMKMLKTMLEERRAKPRKEGTDFFDYV  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL++ D ILTE IALDLMFVLLFASFETTSLA+TLA KFL DHPL L++LTEEHEAII
Sbjct  256  LEELQKNDIILTEAIALDLMFVLLFASFETTSLAITLATKFLHDHPLALKELTEEHEAII  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            ++RENP SGLTW+EYKSM FTFQ I+ETVRLANIVP IFRK+L DIN
Sbjct  316  RSRENPASGLTWKEYKSMKFTFQVINETVRLANIVPAIFRKTLTDIN  362



>ref|XP_011081025.1| PREDICTED: cytochrome P450 87A3-like [Sesamum indicum]
Length=473

 Score =   281 bits (720),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFIQGLISFP+DIPGTAYH CLQGRKKAMK+LK  ++ERR  PRK +TDFFD+V
Sbjct  196  LRENFVAFIQGLISFPVDIPGTAYHKCLQGRKKAMKMLKNMLQERRERPRKVRTDFFDYV  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL+R+DT+LTE IALDLMFVLLFASFETTSLALTLA KFL +HPLVL++LTEEHEAII
Sbjct  256  LEELQREDTLLTEAIALDLMFVLLFASFETTSLALTLATKFLVEHPLVLKELTEEHEAII  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            K RENP+SGLTW EYKSM FTFQFI+ETVRLANIVPGIFRK++R+
Sbjct  316  KRRENPDSGLTWSEYKSMRFTFQFINETVRLANIVPGIFRKAMRE  360



>ref|XP_007211052.1| hypothetical protein PRUPE_ppa018745mg [Prunus persica]
 gb|EMJ12251.1| hypothetical protein PRUPE_ppa018745mg [Prunus persica]
Length=462

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFIQGLISFPLDIPGTAYH CLQGRK AM++LK  ++ERRA  RK   DFFD+V
Sbjct  194  LRENFVAFIQGLISFPLDIPGTAYHKCLQGRKNAMRMLKNMLQERRAESRKQPVDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEELK++ TILTEGIALDLMFVLLFASFETTSLA+TLA+KFLSDHPLVL++LTEEHE II
Sbjct  254  LEELKKEGTILTEGIALDLMFVLLFASFETTSLAITLAMKFLSDHPLVLKQLTEEHEMII  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K RE  +SGLTW+EYKSMTFTFQFI+ETVRLANIVPGIFRK++R+IN
Sbjct  314  KQREIADSGLTWKEYKSMTFTFQFINETVRLANIVPGIFRKAVREIN  360



>ref|XP_006573760.1| PREDICTED: cytochrome P450 87A3-like [Glycine max]
 gb|KHN25726.1| Cytochrome P450 87A3 [Glycine soja]
Length=482

 Score =   280 bits (715),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFIQGLISFPLDIPGTAYH CLQGRK+AMK+LK  ++ERR   RK QTDFFD+V
Sbjct  194  LRENFVAFIQGLISFPLDIPGTAYHKCLQGRKRAMKMLKNMLQERRRMQRKEQTDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EELK++ TILTE IALDLMFVLLFASFETTSLALT AIK LSD+P+VL++L EEHEAI+
Sbjct  254  VEELKKEGTILTEAIALDLMFVLLFASFETTSLALTYAIKLLSDNPVVLKRLQEEHEAIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K RE+PNSG+TW+EYKSMTFTFQFI+ETVRLANIVPGIFRK+LR+IN
Sbjct  314  KQREDPNSGVTWKEYKSMTFTFQFINETVRLANIVPGIFRKALREIN  360



>ref|XP_008238815.1| PREDICTED: cytochrome P450 87A3-like isoform X2 [Prunus mume]
Length=483

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFIQGLISFPLDIPGTAYH CLQGRK AM++LK  ++ERRA  RK   DFFD+V
Sbjct  194  LRENFVAFIQGLISFPLDIPGTAYHKCLQGRKNAMRMLKNMLQERRAESRKQPVDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEELK++ TILTEGIALDLMFVLLFASFETTSLA+TLA+KFLSDHPLVL++LT+EHE II
Sbjct  254  LEELKKEGTILTEGIALDLMFVLLFASFETTSLAITLAMKFLSDHPLVLKQLTKEHEMII  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K RE  +SGLTW+EYKSMTFTFQFI+ETVRLANIVPGIFRK++R+IN
Sbjct  314  KQREIADSGLTWKEYKSMTFTFQFINETVRLANIVPGIFRKAVREIN  360



>ref|XP_008238814.1| PREDICTED: cytochrome P450 87A3-like isoform X1 [Prunus mume]
Length=489

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFIQGLISFPLDIPGTAYH CLQGRK AM++LK  ++ERRA  RK   DFFD+V
Sbjct  200  LRENFVAFIQGLISFPLDIPGTAYHKCLQGRKNAMRMLKNMLQERRAESRKQPVDFFDYV  259

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEELK++ TILTEGIALDLMFVLLFASFETTSLA+TLA+KFLSDHPLVL++LT+EHE II
Sbjct  260  LEELKKEGTILTEGIALDLMFVLLFASFETTSLAITLAMKFLSDHPLVLKQLTKEHEMII  319

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K RE  +SGLTW+EYKSMTFTFQFI+ETVRLANIVPGIFRK++R+IN
Sbjct  320  KQREIADSGLTWKEYKSMTFTFQFINETVRLANIVPGIFRKAVREIN  366



>ref|XP_010112562.1| Cytochrome P450 87A3 [Morus notabilis]
 gb|EXC34109.1| Cytochrome P450 87A3 [Morus notabilis]
Length=479

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFIQGLISFPL+IPGTAY+ CL+GRK+AM++LK+ ++ERR NP+K Q+DFFD+V
Sbjct  194  LRENFVAFIQGLISFPLNIPGTAYNKCLEGRKRAMRMLKKLLQERRENPKKQQSDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL+++ TILTE IALDLMFVLLFASFETTSLALTLA+KFL+DHPLVL+KLTEEHE I+
Sbjct  254  LEELQKEGTILTEAIALDLMFVLLFASFETTSLALTLAVKFLTDHPLVLKKLTEEHEMIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNREN +SG+TW+EYKSMTFT Q I+ETVRLANIVPGIFRK+LRDI
Sbjct  314  KNRENADSGITWKEYKSMTFTIQVINETVRLANIVPGIFRKALRDI  359



>gb|EYU29834.1| hypothetical protein MIMGU_mgv1a005289mg [Erythranthe guttata]
Length=490

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRESFVAFIQGLISFPL+IPG+AY+ CLQGRKKAMK+LK  ++ERR  PRK QTDFFD+V
Sbjct  196  LRESFVAFIQGLISFPLNIPGSAYNKCLQGRKKAMKMLKNMLQERRERPRKIQTDFFDYV  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL+R+DT+LTE IALDLMFVLLFASFETTSLA+TLA KFL ++PLVL++LTEEHEAII
Sbjct  256  LEELQREDTVLTEAIALDLMFVLLFASFETTSLAITLATKFLVEYPLVLKELTEEHEAII  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K RENP+SGLTW EYKSM FTFQFI+ETVRLANIVP IFRK+LR+I
Sbjct  316  KRRENPDSGLTWNEYKSMKFTFQFINETVRLANIVPAIFRKALREI  361



>ref|XP_007040135.1| Cytochrome P450, family 87, subfamily A, polypeptide 2 [Theobroma 
cacao]
 gb|EOY24636.1| Cytochrome P450, family 87, subfamily A, polypeptide 2 [Theobroma 
cacao]
Length=481

 Score =   278 bits (710),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFIQGLISFPLDIPGTAYH CLQGR+ AMK+LK  + ERRA P KN++DFFD+V
Sbjct  194  LRENFVAFIQGLISFPLDIPGTAYHKCLQGRRNAMKMLKNLLNERRAMPGKNRSDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL+++ TIL+E IALDLMFVLLFASFETTSLALTLA+KFLSD P VL+KLTEEHE I+
Sbjct  254  LEELQKEGTILSEAIALDLMFVLLFASFETTSLALTLAVKFLSDDPSVLKKLTEEHETIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NRE+P+SGLTW+EYKSMT+TFQFI+ETVRLANIVPGIFRK+LR+I
Sbjct  314  RNREDPDSGLTWKEYKSMTYTFQFINETVRLANIVPGIFRKALREI  359



>ref|XP_006477592.1| PREDICTED: cytochrome P450 87A3-like [Citrus sinensis]
 gb|KDO63547.1| hypothetical protein CISIN_1g040767mg [Citrus sinensis]
Length=476

 Score =   277 bits (709),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAF++GLISFPLDIPGTAYH CLQGR++AMK LK  ++ERRANPRK Q+DF+D+V
Sbjct  194  LRENFVAFMEGLISFPLDIPGTAYHKCLQGRERAMKKLKNLLQERRANPRKEQSDFYDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            L+EL+++ TILTE IALDLMFVLLFASFETTS+A+TLAIKFLS++PLVL++LTEEHEAI+
Sbjct  254  LKELQKEGTILTEAIALDLMFVLLFASFETTSVAITLAIKFLSENPLVLKQLTEEHEAIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNREN +SGLTW+EYKSMT+TFQFI+ET RLANIVPGIFRK+LRDI
Sbjct  314  KNRENVHSGLTWREYKSMTYTFQFINETARLANIVPGIFRKALRDI  359



>ref|XP_006440550.1| hypothetical protein CICLE_v10023269mg [Citrus clementina]
 gb|ESR53790.1| hypothetical protein CICLE_v10023269mg [Citrus clementina]
Length=476

 Score =   277 bits (709),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAF++GLISFPLDIPGTAYH CLQGR++AMK LK  ++ERRANPRK Q+DF+D+V
Sbjct  194  LRENFVAFMEGLISFPLDIPGTAYHKCLQGRERAMKKLKNLLQERRANPRKEQSDFYDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            L+EL+++ TILTE IALDLMFVLLFASFETTS+A+TLAIKFLS++PLVL++LTEEHEAI+
Sbjct  254  LKELQKEGTILTEAIALDLMFVLLFASFETTSVAITLAIKFLSENPLVLKQLTEEHEAIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNREN +SGLTW+EYKSMT+TFQFI+ET RLANIVPGIFRK+LRDI
Sbjct  314  KNRENVHSGLTWREYKSMTYTFQFINETARLANIVPGIFRKALRDI  359



>ref|XP_002283337.1| PREDICTED: cytochrome P450 87A3 [Vitis vinifera]
Length=472

 Score =   277 bits (708),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFIQGLISFPLDIPGTAYH CLQGRKKAM +LK  ++ERRA PRK Q+DFFD+V
Sbjct  196  LRENFVAFIQGLISFPLDIPGTAYHKCLQGRKKAMSMLKNMLKERRAMPRKKQSDFFDYV  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EELK++ TILTE IALDLMFVLLFASFETTSLA+TLA KFLSDHPLVL+KLTEEHEAI+
Sbjct  256  IEELKKEGTILTEAIALDLMFVLLFASFETTSLAITLATKFLSDHPLVLKKLTEEHEAIL  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            + RE  +S LTW+EYKSMTFTFQFI+ETVRLANIVPGIFRK+LR+I 
Sbjct  316  EKREIVDSELTWKEYKSMTFTFQFINETVRLANIVPGIFRKALREIQ  362



>emb|CBI34719.3| unnamed protein product [Vitis vinifera]
Length=488

 Score =   277 bits (709),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFIQGLISFPLDIPGTAYH CLQGRKKAM +LK  ++ERRA PRK Q+DFFD+V
Sbjct  212  LRENFVAFIQGLISFPLDIPGTAYHKCLQGRKKAMSMLKNMLKERRAMPRKKQSDFFDYV  271

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EELK++ TILTE IALDLMFVLLFASFETTSLA+TLA KFLSDHPLVL+KLTEEHEAI+
Sbjct  272  IEELKKEGTILTEAIALDLMFVLLFASFETTSLAITLATKFLSDHPLVLKKLTEEHEAIL  331

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            + RE  +S LTW+EYKSMTFTFQFI+ETVRLANIVPGIFRK+LR+I 
Sbjct  332  EKREIVDSELTWKEYKSMTFTFQFINETVRLANIVPGIFRKALREIQ  378



>ref|XP_003538708.1| PREDICTED: cytochrome P450 87A3-like [Glycine max]
 gb|KHN35000.1| Cytochrome P450 87A3 [Glycine soja]
Length=477

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFIQGLISFPLDI GTAYH CLQGRK+AMK+LK  ++ERR   RK QTDFFD++
Sbjct  194  LRDNFVAFIQGLISFPLDIQGTAYHKCLQGRKRAMKMLKNMLQERRRMQRKQQTDFFDYI  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EELK++ TILTE IALDLMFVLLFASFETTSLALT AIK LSD+PLVL++L EEHEAI+
Sbjct  254  VEELKKEGTILTEAIALDLMFVLLFASFETTSLALTYAIKLLSDNPLVLKRLQEEHEAIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K RE+PNSG+TW+EYKSMTFTFQFI+ETVRLANIVPGIFRK+LR+IN
Sbjct  314  KQREDPNSGITWKEYKSMTFTFQFINETVRLANIVPGIFRKALREIN  360



>ref|XP_009342629.1| PREDICTED: cytochrome P450 87A3 [Pyrus x bretschneideri]
Length=473

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFIQGLISFP+DIPGTAYH CL GRK AM++LK  ++ERRA  RK   DFFD+V
Sbjct  194  LRENFVAFIQGLISFPMDIPGTAYHKCLVGRKSAMRMLKNMLQERRAESRKQPIDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEELK++ TILTEGIALDLMFVLLFASFETTSLA+TLA+KFL+DHPLVL++LTEEHE I+
Sbjct  254  LEELKKEGTILTEGIALDLMFVLLFASFETTSLAITLAMKFLTDHPLVLKQLTEEHEMIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K REN +SGLTW+EYKSM FTFQFI ETVRLANIVPGIFRK++R+IN
Sbjct  314  KQRENSDSGLTWKEYKSMKFTFQFISETVRLANIVPGIFRKAVREIN  360



>ref|XP_011033792.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=481

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI GLISFPLDIPGTAYH CLQGRKKAMK+LK + +ERRANPRK ++DFFD+V
Sbjct  194  LRDNFVAFIHGLISFPLDIPGTAYHECLQGRKKAMKMLKNQQQERRANPRKYRSDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL+    ILTE IALDLMFVLLFASFETTSLALTLA+KFLSD+PLVL+KLTEEHE I+
Sbjct  254  LEELQEDRGILTEEIALDLMFVLLFASFETTSLALTLAVKFLSDNPLVLKKLTEEHEGIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NR N NSGLTW EYKSM FTFQ I+ETVRLANIVPGIFRK+LRDI
Sbjct  314  RNRVNSNSGLTWNEYKSMKFTFQVINETVRLANIVPGIFRKALRDI  359



>ref|XP_011072203.1| PREDICTED: cytochrome P450 87A3 [Sesamum indicum]
Length=490

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRESFVAFIQGLISFPL+IPGTAY  CLQGRKKAMK+LK  +++RR  PRK  TDFFD+V
Sbjct  196  LRESFVAFIQGLISFPLNIPGTAYSKCLQGRKKAMKMLKTMLQQRRERPRKIGTDFFDYV  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL+R+DT+L E IALDLMFVLLFASFETTSLAL LAIKFL DHPL +++LTEEHEAII
Sbjct  256  LEELQREDTLLKEAIALDLMFVLLFASFETTSLALILAIKFLVDHPLAIKELTEEHEAII  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            + RENP+S LTW+EYKSM FTFQFIHETVRLANIVPGIFRK+LRD
Sbjct  316  RRRENPDSRLTWEEYKSMKFTFQFIHETVRLANIVPGIFRKALRD  360



>ref|XP_004511600.1| PREDICTED: cytochrome P450 87A3-like isoform X2 [Cicer arietinum]
Length=442

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFIQGLISFPLD+PGTAYH CLQGRK+AMK+LK  ++ERR  PRK Q DFFD+V
Sbjct  195  LRENFVAFIQGLISFPLDVPGTAYHKCLQGRKRAMKMLKNMLQERREMPRKQQKDFFDYV  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+++ T+LTE IALDLMFVLLFASFETTSLALT AIK LSD+P VL +L EE+EAI+
Sbjct  255  IEELRKEGTLLTEAIALDLMFVLLFASFETTSLALTYAIKLLSDNPSVLNQLQEENEAIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K R+NPNSG+TWQEYKSMTFTFQ I ET RLANIVPGIFRK+LR++N
Sbjct  315  KRRKNPNSGVTWQEYKSMTFTFQLITETARLANIVPGIFRKALREVN  361



>ref|XP_002303566.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE78545.1| cytochrome P450 family protein [Populus trichocarpa]
Length=481

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI GLISFPLDIPGTAYH CL+GRKKAM++LK +++ERRANPRK ++DFFD+V
Sbjct  194  LRDNFVAFIHGLISFPLDIPGTAYHECLRGRKKAMRMLKNQLQERRANPRKYRSDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL+    ILTE IALDLMFVLLFASFETTSLALTLA+KFLSD+PLVL+KLTEEHE I+
Sbjct  254  LEELQEDRGILTEEIALDLMFVLLFASFETTSLALTLAVKFLSDNPLVLKKLTEEHEGIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NR + NSGLTW EYKSM FTFQ I+ETVRLANIVPGIFRK+LRDI
Sbjct  314  RNRVDSNSGLTWNEYKSMKFTFQVINETVRLANIVPGIFRKALRDI  359



>ref|XP_010676534.1| PREDICTED: cytochrome P450 87A3 [Beta vulgaris subsp. vulgaris]
Length=481

 Score =   272 bits (695),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFI+GLISFPL+IPGTA+H CLQGRKKAMK+LK+ +++RR  P+K  TDFFD+V
Sbjct  196  LRENFVAFIKGLISFPLNIPGTAFHKCLQGRKKAMKMLKDMLQKRRMMPKKQSTDFFDYV  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL ++ T LTEGIALDLMFVLLFASFETTSLALT+AIK+LS++PLVL+KLTEEHEAI+
Sbjct  256  LEELAKEGTPLTEGIALDLMFVLLFASFETTSLALTVAIKYLSEYPLVLQKLTEEHEAIL  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K RE+PNS LTW+EYKSMT+TFQ I+ETVR+ANIVPGIFRK+LRD++
Sbjct  316  KRREDPNSHLTWKEYKSMTYTFQVINETVRVANIVPGIFRKALRDVS  362



>gb|KEH27443.1| cytochrome P450 family protein [Medicago truncatula]
Length=442

 Score =   271 bits (692),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFIQGLISFPL+IPGTAY+ CLQGRKKAMK+LK  ++ERR  PRK Q DFFD+V
Sbjct  195  LRENFVAFIQGLISFPLNIPGTAYNKCLQGRKKAMKMLKNMLQERREMPRKQQMDFFDYV  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+++ T+LTE IALDLMFVLLFASFETTS ALT AIK LSD+PLV ++L EEHEAI+
Sbjct  255  IEELRKEGTLLTEAIALDLMFVLLFASFETTSQALTYAIKLLSDNPLVFKQLQEEHEAIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            + RENPNSG+TWQEYKSMTFTFQ I ET RLANIVPGIFRK+LR+IN
Sbjct  315  ERRENPNSGVTWQEYKSMTFTFQLITETARLANIVPGIFRKALREIN  361



>gb|KFK43534.1| hypothetical protein AALP_AA1G139200 [Arabis alpina]
Length=441

 Score =   270 bits (691),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +FVAFIQGLISFP +IPGTAYH CL+GR+KAMK+L++ ++ERR NPRKN +DFFD+V
Sbjct  160  LRSNFVAFIQGLISFPFNIPGTAYHKCLKGREKAMKMLRDMLQERRKNPRKNPSDFFDYV  219

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE++++ TILTE IALDLMFVLLFASFETTSLALTLAIKFLSD P VL++LTEEHE I+
Sbjct  220  IEEIQKEGTILTEEIALDLMFVLLFASFETTSLALTLAIKFLSDDPEVLKRLTEEHETIL  279

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NRE+ NSGLTW+EYKSMT+TFQFI+ET RLANIVP IFRK+LRDI
Sbjct  280  RNREDANSGLTWEEYKSMTYTFQFINETARLANIVPAIFRKALRDI  325



>ref|XP_004511599.1| PREDICTED: cytochrome P450 87A3-like isoform X1 [Cicer arietinum]
Length=486

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFIQGLISFPLD+PGTAYH CLQGRK+AMK+LK  ++ERR  PRK Q DFFD+V
Sbjct  195  LRENFVAFIQGLISFPLDVPGTAYHKCLQGRKRAMKMLKNMLQERREMPRKQQKDFFDYV  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+++ T+LTE IALDLMFVLLFASFETTSLALT AIK LSD+P VL +L EE+EAI+
Sbjct  255  IEELRKEGTLLTEAIALDLMFVLLFASFETTSLALTYAIKLLSDNPSVLNQLQEENEAIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K R+NPNSG+TWQEYKSMTFTFQ I ET RLANIVPGIFRK+LR++N
Sbjct  315  KRRKNPNSGVTWQEYKSMTFTFQLITETARLANIVPGIFRKALREVN  361



>ref|NP_172734.2| cytochrome P450, family 87, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
 gb|AAR24666.1| At1g12740 [Arabidopsis thaliana]
 dbj|BAD44087.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28919.1| cytochrome P450, family 87, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
Length=472

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +FVAFIQGLISFP DIPGTAYH CLQGR KAMK+L+  ++ERR NPRKN +DFFD+V
Sbjct  195  LRANFVAFIQGLISFPFDIPGTAYHKCLQGRAKAMKMLRNMLQERRENPRKNPSDFFDYV  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE++++ TILTE IALDLMFVLLFASFETTSLALTLAIKFLSD P VL++LTEEHE I+
Sbjct  255  IEEIQKEGTILTEEIALDLMFVLLFASFETTSLALTLAIKFLSDDPEVLKRLTEEHETIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NRE+ +SGLTW+EYKSMT+TFQFI+ET RLANIVP IFRK+LRDI
Sbjct  315  RNREDADSGLTWEEYKSMTYTFQFINETARLANIVPAIFRKALRDI  360



>ref|XP_003611140.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94098.1| cytochrome P450 family protein [Medicago truncatula]
Length=483

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFIQGLISFPL+IPGTAY+ CLQGRKKAMK+LK  ++ERR  PRK Q DFFD+V
Sbjct  195  LRENFVAFIQGLISFPLNIPGTAYNKCLQGRKKAMKMLKNMLQERREMPRKQQMDFFDYV  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+++ T+LTE IALDLMFVLLFASFETTS ALT AIK LSD+PLV ++L EEHEAI+
Sbjct  255  IEELRKEGTLLTEAIALDLMFVLLFASFETTSQALTYAIKLLSDNPLVFKQLQEEHEAIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            + RENPNSG+TWQEYKSMTFTFQ I ET RLANIVPGIFRK+LR+IN
Sbjct  315  ERRENPNSGVTWQEYKSMTFTFQLITETARLANIVPGIFRKALREIN  361



>gb|AAF88087.1|AC025417_15 T12C24.27 [Arabidopsis thaliana]
Length=478

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +FVAFIQGLISFP DIPGTAYH CLQGR KAMK+L+  ++ERR NPRKN +DFFD+V
Sbjct  195  LRANFVAFIQGLISFPFDIPGTAYHKCLQGRAKAMKMLRNMLQERRENPRKNPSDFFDYV  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE++++ TILTE IALDLMFVLLFASFETTSLALTLAIKFLSD P VL++LTEEHE I+
Sbjct  255  IEEIQKEGTILTEEIALDLMFVLLFASFETTSLALTLAIKFLSDDPEVLKRLTEEHETIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NRE+ +SGLTW+EYKSMT+TFQFI+ET RLANIVP IFRK+LRDI
Sbjct  315  RNREDADSGLTWEEYKSMTYTFQFINETARLANIVPAIFRKALRDI  360



>ref|NP_001184974.1| cytochrome P450, family 87, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
 gb|AEE28920.1| cytochrome P450, family 87, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
Length=478

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +FVAFIQGLISFP DIPGTAYH CLQGR KAMK+L+  ++ERR NPRKN +DFFD+V
Sbjct  201  LRANFVAFIQGLISFPFDIPGTAYHKCLQGRAKAMKMLRNMLQERRENPRKNPSDFFDYV  260

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE++++ TILTE IALDLMFVLLFASFETTSLALTLAIKFLSD P VL++LTEEHE I+
Sbjct  261  IEEIQKEGTILTEEIALDLMFVLLFASFETTSLALTLAIKFLSDDPEVLKRLTEEHETIL  320

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NRE+ +SGLTW+EYKSMT+TFQFI+ET RLANIVP IFRK+LRDI
Sbjct  321  RNREDADSGLTWEEYKSMTYTFQFINETARLANIVPAIFRKALRDI  366



>ref|XP_010494547.1| PREDICTED: cytochrome P450 87A3-like [Camelina sativa]
Length=472

 Score =   269 bits (687),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +FVAFIQGLISFP DIPGTAYH CLQGR+KAMK+LK  ++ERR NPRK  +DFFD+V
Sbjct  195  LRANFVAFIQGLISFPFDIPGTAYHKCLQGREKAMKMLKSMLQERRKNPRKVPSDFFDYV  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE++++ TILTE IALDLMFVLLFASFETTSLALTLAIKFL+D P VL++LTEEHE I+
Sbjct  255  IEEIQKEGTILTEDIALDLMFVLLFASFETTSLALTLAIKFLTDDPAVLKRLTEEHETIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NRE+ +SGLTW+EYKSMT+TFQFI+ET RLANIVP IFRK+LRDI
Sbjct  315  RNREDADSGLTWEEYKSMTYTFQFINETARLANIVPAIFRKTLRDI  360



>ref|XP_010476246.1| PREDICTED: cytochrome P450 87A3-like [Camelina sativa]
Length=472

 Score =   268 bits (686),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +FVAFIQGLISFP DIPGTAYH CLQGR+KAMK+LK  ++ERR NPRK  +DFFD+V
Sbjct  195  LRANFVAFIQGLISFPFDIPGTAYHKCLQGREKAMKMLKSMLQERRKNPRKVPSDFFDYV  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE++++ TILTE IALDLMFVLLFASFETTSLALTLAIKFL+D P VL++LTEEHE I+
Sbjct  255  IEEIQKEGTILTEDIALDLMFVLLFASFETTSLALTLAIKFLTDDPAVLKRLTEEHETIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NRE+ +SGLTW+EYKSMT+TFQFI+ET RLANIVP IFRK+LRDI
Sbjct  315  RNREDADSGLTWEEYKSMTYTFQFINETARLANIVPAIFRKTLRDI  360



>ref|XP_006391779.1| hypothetical protein EUTSA_v10023919mg [Eutrema salsugineum]
 gb|ESQ29065.1| hypothetical protein EUTSA_v10023919mg [Eutrema salsugineum]
Length=480

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFI+GLISFPLDIPGTAYH CL+GR++AMK+L+  ++ERR  PR+N +DFFD+V
Sbjct  196  LRENFVAFIRGLISFPLDIPGTAYHKCLKGRERAMKMLRNMLQERRDKPRENPSDFFDYV  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EELK++ TILTE IALDLMFVLLFASFETTSLALTLAIKFLS  P VL++LTEEHEAI+
Sbjct  256  IEELKKEGTILTEEIALDLMFVLLFASFETTSLALTLAIKFLSQDPSVLKRLTEEHEAIL  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NRE+ +SGLTW+EYKSMT+TFQFI+ETVRLANIVP IFRK+LRDI
Sbjct  316  RNREDAHSGLTWKEYKSMTYTFQFINETVRLANIVPAIFRKALRDI  361



>gb|KDP25498.1| hypothetical protein JCGZ_20654 [Jatropha curcas]
Length=476

 Score =   268 bits (686),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAF+QGLISFPL++PGTAYH CLQGRK+AMK+LK  + ERRA PRK+Q+DFFDFV
Sbjct  194  LRENFVAFMQGLISFPLEVPGTAYHKCLQGRKRAMKMLKNLLHERRAKPRKHQSDFFDFV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL+++ +ILTE IALDLMFVLLFASFETTSLA+T+ IKFLSD PL L++LTEEHEAI+
Sbjct  254  LEELQKEGSILTEAIALDLMFVLLFASFETTSLAITMVIKFLSDSPLALKQLTEEHEAIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            +NREN NS +TW+EYKSMTFTFQ I+ETVRLANIVP IFRK L DI 
Sbjct  314  RNRENANSSITWKEYKSMTFTFQVINETVRLANIVPVIFRKVLTDIQ  360



>ref|XP_010533714.1| PREDICTED: cytochrome P450 87A3 [Tarenaya hassleriana]
Length=477

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFI+GLISFP DIPGTAYH CL+GR++AM++LK  ++ERR NPRKN +DFFD+V
Sbjct  195  LRENFVAFIKGLISFPFDIPGTAYHKCLKGRERAMRMLKNMLQERRGNPRKNPSDFFDYV  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+++ TILTE IALDLMFVLLFASFETTSLALTL+IKFL+D+P VL++LTEEHEAI+
Sbjct  255  IEELQKEGTILTEEIALDLMFVLLFASFETTSLALTLSIKFLTDYPSVLKRLTEEHEAIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            + RE+P+S LTW+EY+SMT+TFQFI+ET RLANIVP IFRK+LRDI
Sbjct  315  REREDPDSELTWKEYRSMTYTFQFINETARLANIVPAIFRKALRDI  360



>ref|XP_010458707.1| PREDICTED: cytochrome P450 87A3-like [Camelina sativa]
Length=472

 Score =   267 bits (683),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +FVAFIQGLISFP DIPGTAYH CLQGR+KAMK+LK  ++ERR NPRK  +DFFD+V
Sbjct  195  LRANFVAFIQGLISFPFDIPGTAYHKCLQGREKAMKMLKSMLQERRKNPRKIPSDFFDYV  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE++++ TILTE IALDLMFVLLFASFETTSLALTLAIKFL+D P VL++LTEEHE I+
Sbjct  255  IEEIQKEGTILTEDIALDLMFVLLFASFETTSLALTLAIKFLTDDPAVLKRLTEEHETIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NR++ +SGLTW+EYKSMT+TFQFI+ET RLANIVP IFRK+LRDI
Sbjct  315  RNRKDADSGLTWEEYKSMTYTFQFINETARLANIVPAIFRKTLRDI  360



>ref|XP_010053329.1| PREDICTED: cytochrome P450 87A3 [Eucalyptus grandis]
 gb|KCW77602.1| hypothetical protein EUGRSUZ_D01916 [Eucalyptus grandis]
Length=477

 Score =   266 bits (681),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRESFV+FI+GLISFPLDIPGTAYHNCLQGRK+AM++LK  ++ERR  PRK Q DFFD+V
Sbjct  194  LRESFVSFIRGLISFPLDIPGTAYHNCLQGRKRAMRMLKNLLQERRMMPRKQQNDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL+++ TILTE IALDLMFVLLFASFETTSLALTLA+KFL ++P  L++LTEEHEAII
Sbjct  254  LEELQKEGTILTEAIALDLMFVLLFASFETTSLALTLAMKFLLENPTALKRLTEEHEAII  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            + RE+ +S LTW+EYKSMTFTFQ I+ETVRLANIVPGIFRK+LR I 
Sbjct  314  RKREDADSALTWKEYKSMTFTFQVINETVRLANIVPGIFRKALRQIQ  360



>gb|KFK40541.1| hypothetical protein AALP_AA2G009100 [Arabis alpina]
Length=435

 Score =   265 bits (678),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFI+GLISFP DIPGTAYH CL+GR++AMK+LK  +++RR  PR N +DFFD+V
Sbjct  160  LRENFVAFIRGLISFPFDIPGTAYHKCLKGRERAMKMLKNMLQKRREKPRDNPSDFFDYV  219

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EELK++ TILTE IALDLMFVLLFASFETTSLALTLAIKFLS++P VL++LT EHEAI+
Sbjct  220  IEELKKEGTILTEEIALDLMFVLLFASFETTSLALTLAIKFLSENPSVLKRLTVEHEAIL  279

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NRE+ NSGLTW+EYKSMT+TFQFI+ET RLANIVP IFRK+LRDI
Sbjct  280  RNREDANSGLTWKEYKSMTYTFQFINETARLANIVPAIFRKALRDI  325



>ref|XP_008345352.1| PREDICTED: cytochrome P450 87A3-like [Malus domestica]
Length=492

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 150/170 (88%), Gaps = 3/170 (2%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFIQGLISFP+DIPGT+YH CL GRK AM++LK  ++ERRA  RK   DFFD+V
Sbjct  194  LRENFVAFIQGLISFPMDIPGTSYHKCLVGRKSAMRMLKNMLQERRAESRKQPIDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEELK++ TILTEGIALDLMFVLLFASFETTSLA+TLA+KFL+DHPLVL++LTEEHE I+
Sbjct  254  LEELKKEGTILTEGIALDLMFVLLFASFETTSLAITLAMKFLTDHPLVLKQLTEEHEMIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKS---LRDIN  3
            K REN +SGLTW+EYKSM FTFQ I ETVRLANIVPGIFRK+   +R+IN
Sbjct  314  KQRENSDSGLTWKEYKSMKFTFQVISETVRLANIVPGIFRKAVVPMREIN  363



>ref|XP_002509718.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF51105.1| cytochrome P450, putative [Ricinus communis]
Length=544

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAF+QGLISFPL+IPGTAYH CLQGRK+AMK+LK  + ERR NPR++Q DFFD+V
Sbjct  194  LRDNFVAFMQGLISFPLEIPGTAYHKCLQGRKRAMKILKNLLNERRRNPRQHQRDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LE+L+++ ++LTE I LDLMFVLLFASFETTSLA+T+A+KFLSDHPL L++LTEEHEAI+
Sbjct  254  LEDLQKEGSVLTEEIVLDLMFVLLFASFETTSLAITMAVKFLSDHPLALKQLTEEHEAIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NREN +SG+TW+EYKSMTFTFQ I+ETVRLANIVP IFRK LRDI
Sbjct  314  ENRENADSGITWKEYKSMTFTFQVINETVRLANIVPVIFRKVLRDI  359



>emb|CDP09801.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 150/181 (83%), Gaps = 14/181 (8%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGR--------------KKAMKLLKEKIEERR  366
            LRE+FVAFIQGLISFP+DIPGTAYH CLQ                KKAMK+LK  +EERR
Sbjct  160  LRENFVAFIQGLISFPVDIPGTAYHKCLQNEFCKFKLSLINLNELKKAMKMLKSMLEERR  219

Query  365  ANPRKNQTDFFDFVLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHP  186
            A PR++Q+DFFD+VL+EL RKDTILTE IALDLMFVLLFASFETTSLALTLA+K L++HP
Sbjct  220  AKPREHQSDFFDYVLQELGRKDTILTEAIALDLMFVLLFASFETTSLALTLAVKLLAEHP  279

Query  185  LVLEKLTEEHEAIIKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
              L++LTEEHEAI++ RE P+S LTW EYKSMTFTFQ I+ETVRLANIVPGIFRK+L+D 
Sbjct  280  AALKELTEEHEAIVRKRETPDSALTWSEYKSMTFTFQIINETVRLANIVPGIFRKALQDC  339

Query  5    N  3
            N
Sbjct  340  N  340



>ref|XP_002889964.1| T12C24.27 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66223.1| T12C24.27 [Arabidopsis lyrata subsp. lyrata]
Length=478

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +FVAFIQGLISFP DIPGTAYH CLQGR+KAMK+L+  ++ERR  PRKN +DFFD+V
Sbjct  195  LRANFVAFIQGLISFPFDIPGTAYHKCLQGREKAMKMLRNMLQERRKKPRKNPSDFFDYV  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE++++ TILTE IALDLMFVLLFASFETTSLA+TLAIKFLSD P VL++LTEEHE I+
Sbjct  255  IEEIQKEGTILTEEIALDLMFVLLFASFETTSLAITLAIKFLSDDPAVLKRLTEEHETIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NRE+ +SGLTW+EYKSMT+TFQFI+ET RLANIVP IFRK+L DI
Sbjct  315  RNREDADSGLTWEEYKSMTYTFQFINETARLANIVPAIFRKALIDI  360



>ref|XP_008448965.1| PREDICTED: cytochrome P450 87A3 isoform X3 [Cucumis melo]
Length=409

 Score =   262 bits (669),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFIQGLISFPL++PGTAY+ CLQGRKKAM++LK  ++ERRANPRK + DFFDFV
Sbjct  134  LRDNFVAFIQGLISFPLNVPGTAYNKCLQGRKKAMRMLKNMLQERRANPRKQRIDFFDFV  193

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL++  T+LTE IALDLMFVLLFASFETTSLA+T AIKFL ++P VLE+LT EHE I+
Sbjct  194  LEELEKDGTLLTEEIALDLMFVLLFASFETTSLAITAAIKFLLNNPHVLEELTAEHEGIL  253

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K RE  +SGLTW EYKSMTFTFQFI+ETVRLANIVPGIFRK+L+DI
Sbjct  254  KRREISDSGLTWGEYKSMTFTFQFINETVRLANIVPGIFRKALKDI  299



>ref|XP_007158462.1| hypothetical protein PHAVU_002G154400g [Phaseolus vulgaris]
 gb|ESW30456.1| hypothetical protein PHAVU_002G154400g [Phaseolus vulgaris]
Length=405

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFIQGLISFPLD+PGTAYH CLQGRKKAMK+LK+ ++ERR   RK Q DFFD+V
Sbjct  194  LRDNFVAFIQGLISFPLDVPGTAYHKCLQGRKKAMKMLKKMLQERRGMKRKEQKDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EELK++ T+LTE IALDLMFVLLFASFETTSLALT AIK LSD+PLVL++L EEHEAI+
Sbjct  254  IEELKKEGTVLTEAIALDLMFVLLFASFETTSLALTYAIKVLSDNPLVLKQLQEEHEAIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K RE+PNSG+TW+EYKSMT+TFQFI+ETVRLANIVPGIFRK+LR+IN
Sbjct  314  KRREDPNSGITWKEYKSMTYTFQFINETVRLANIVPGIFRKALREIN  360



>ref|XP_010545904.1| PREDICTED: cytochrome P450 87A3-like [Tarenaya hassleriana]
Length=503

 Score =   263 bits (672),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+F AFI+GLIS PLDIPGTAYH CL+GR++AM++LK  ++ERR NPRKN +DF+D+V
Sbjct  225  LRENFDAFIRGLISLPLDIPGTAYHKCLKGRERAMQMLKNMLKERRENPRKNPSDFYDYV  284

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+++ TILTE IALDLMFVL+FASFETTSLALTLAIKFLSD+P VL++LTEEHEAI+
Sbjct  285  IEELQKEGTILTEAIALDLMFVLIFASFETTSLALTLAIKFLSDYPSVLKRLTEEHEAIL  344

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            +NRE+P+SGLTW+EY+SMT+TFQFI+ET RLANI P +FRK+L+D +
Sbjct  345  RNREDPDSGLTWEEYRSMTYTFQFINETARLANIAPVLFRKALKDYH  391



>ref|XP_009148571.1| PREDICTED: cytochrome P450 87A3 [Brassica rapa]
Length=476

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +FVAFIQGLISFP DIPGTAYH CL+GR+ AM++L+  ++ERR  PRKN +DFFD+V
Sbjct  195  LRANFVAFIQGLISFPFDIPGTAYHKCLKGRENAMRMLRNMLQERRKKPRKNPSDFFDYV  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE++++ TILTE IALDLMFVLLFASFETTSLALTLAIKFLSD P VL +LTEEHE I+
Sbjct  255  IEEIQKEGTILTEEIALDLMFVLLFASFETTSLALTLAIKFLSDDPKVLRRLTEEHETIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NRE+ NSGLTW+EYKSMT+TFQFI+ET RLANIVP IFRK+L DI
Sbjct  315  RNREDANSGLTWEEYKSMTYTFQFINETARLANIVPAIFRKALIDI  360



>ref|XP_008448964.1| PREDICTED: cytochrome P450 87A3 isoform X2 [Cucumis melo]
Length=449

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFIQGLISFPL++PGTAY+ CLQGRKKAM++LK  ++ERRANPRK + DFFDFV
Sbjct  174  LRDNFVAFIQGLISFPLNVPGTAYNKCLQGRKKAMRMLKNMLQERRANPRKQRIDFFDFV  233

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL++  T+LTE IALDLMFVLLFASFETTSLA+T AIKFL ++P VLE+LT EHE I+
Sbjct  234  LEELEKDGTLLTEEIALDLMFVLLFASFETTSLAITAAIKFLLNNPHVLEELTAEHEGIL  293

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K RE  +SGLTW EYKSMTFTFQFI+ETVRLANIVPGIFRK+L+DI
Sbjct  294  KRREISDSGLTWGEYKSMTFTFQFINETVRLANIVPGIFRKALKDI  339



>ref|XP_008448963.1| PREDICTED: cytochrome P450 87A3 isoform X1 [Cucumis melo]
Length=469

 Score =   261 bits (668),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFIQGLISFPL++PGTAY+ CLQGRKKAM++LK  ++ERRANPRK + DFFDFV
Sbjct  194  LRDNFVAFIQGLISFPLNVPGTAYNKCLQGRKKAMRMLKNMLQERRANPRKQRIDFFDFV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL++  T+LTE IALDLMFVLLFASFETTSLA+T AIKFL ++P VLE+LT EHE I+
Sbjct  254  LEELEKDGTLLTEEIALDLMFVLLFASFETTSLAITAAIKFLLNNPHVLEELTAEHEGIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K RE  +SGLTW EYKSMTFTFQFI+ETVRLANIVPGIFRK+L+DI
Sbjct  314  KRREISDSGLTWGEYKSMTFTFQFINETVRLANIVPGIFRKALKDI  359



>ref|XP_010248255.1| PREDICTED: cytochrome P450 87A3 [Nelumbo nucifera]
Length=472

 Score =   261 bits (668),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+FVAFI+GLISFPLDIPGT YH CLQGRKKAMKLLK+ + ERRA P K   DFFD V
Sbjct  196  LRENFVAFIKGLISFPLDIPGTQYHKCLQGRKKAMKLLKDMLXERRAMPZKRHGDFFDLV  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+++ T+LTE IALDLMF LLFASFETTSLALTL +KFLSDHP VL++LTEEHEAI+
Sbjct  256  VEELEKQGTVLTESIALDLMFXLLFASFETTSLALTLGMKFLSDHPSVLKRLTEEHEAIL  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            + +EN +SGLTW++YKSMTFTFQ I E VRLANIVPGIFRK+L DI+
Sbjct  316  RRKENGDSGLTWKDYKSMTFTFQVIXEIVRLANIVPGIFRKALHDIH  362



>ref|XP_010545860.1| PREDICTED: cytochrome P450 87A3-like [Tarenaya hassleriana]
Length=540

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQ-GRKKAMKLLKEKIEERRANPRKNQTDFFDF  327
            LRE+FVAFI+GLISFP DIPGTAYHNCL+   ++AMK+LK  ++ERR NPR++ +DFFD+
Sbjct  257  LRENFVAFIRGLISFPFDIPGTAYHNCLKLAGERAMKILKNMLQERRENPRESPSDFFDY  316

Query  326  VLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAI  147
            V+EEL+++ TILTE IALDLMFVLLFASFETTSLALTLAIKFLSD+P VL++LTEEHEAI
Sbjct  317  VIEELQKEGTILTEAIALDLMFVLLFASFETTSLALTLAIKFLSDYPSVLKRLTEEHEAI  376

Query  146  IKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            ++NR++ +SGLTW+EY+SMT+TFQFI+ET RLANIVP IFRK+LRDI 
Sbjct  377  LRNRDHADSGLTWKEYRSMTYTFQFINETARLANIVPAIFRKALRDIQ  424



>ref|XP_006417203.1| hypothetical protein EUTSA_v10007534mg [Eutrema salsugineum]
 gb|ESQ35556.1| hypothetical protein EUTSA_v10007534mg [Eutrema salsugineum]
Length=474

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +FVAFIQGLISFP DIPGTAYH CL+GR+ AMK+L+  ++ERR  PRKN +DFFD+V
Sbjct  195  LRANFVAFIQGLISFPFDIPGTAYHKCLKGRENAMKMLRNMLQERRKKPRKNPSDFFDYV  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE++++ TILTE IALDLMFVLLFASFETTSLALTLAIKFLSD P VL++LTEEHE I+
Sbjct  255  IEEIQKEGTILTEEIALDLMFVLLFASFETTSLALTLAIKFLSDDPAVLKRLTEEHETIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K RE+ +SGLTW+EYKSMT+TFQFI+ET RLANIVP IFRK+L DI
Sbjct  315  KKREDADSGLTWEEYKSMTYTFQFINETARLANIVPAIFRKALIDI  360



>ref|XP_007158463.1| hypothetical protein PHAVU_002G154400g [Phaseolus vulgaris]
 gb|ESW30457.1| hypothetical protein PHAVU_002G154400g [Phaseolus vulgaris]
Length=482

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFIQGLISFPLD+PGTAYH CLQGRKKAMK+LK+ ++ERR   RK Q DFFD+V
Sbjct  194  LRDNFVAFIQGLISFPLDVPGTAYHKCLQGRKKAMKMLKKMLQERRGMKRKEQKDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EELK++ T+LTE IALDLMFVLLFASFETTSLALT AIK LSD+PLVL++L EEHEAI+
Sbjct  254  IEELKKEGTVLTEAIALDLMFVLLFASFETTSLALTYAIKVLSDNPLVLKQLQEEHEAIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K RE+PNSG+TW+EYKSMT+TFQFI+ETVRLANIVPGIFRK+LR+IN
Sbjct  314  KRREDPNSGITWKEYKSMTYTFQFINETVRLANIVPGIFRKALREIN  360



>ref|XP_006302176.1| hypothetical protein CARUB_v10020186mg [Capsella rubella]
 gb|EOA35074.1| hypothetical protein CARUB_v10020186mg [Capsella rubella]
Length=493

 Score =   260 bits (665),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR+ F +F+ GLISFP++IPGTAYH CL+GR++AMK+L++ ++ERR NPR+N +DFFD+V
Sbjct  216  LRDCFASFVDGLISFPINIPGTAYHKCLEGRERAMKMLRDMLQERRENPRENPSDFFDYV  275

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EELK++ ++LTE IALDLMFVL+FASFETTS +LTLAIKFLSD+PL+LE+LTEEHEAI+
Sbjct  276  IEELKKEGSLLTEEIALDLMFVLIFASFETTSYSLTLAIKFLSDNPLILERLTEEHEAIL  335

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            +NRE+ NSGLTW+EYKSMT+TFQFI+ET RLAN+ PGIFRK+L D
Sbjct  336  RNREDANSGLTWKEYKSMTYTFQFINETARLANLAPGIFRKALID  380



>ref|XP_004300758.1| PREDICTED: cytochrome P450 87A3-like [Fragaria vesca subsp. vesca]
Length=484

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +F AFIQGLISFP+DIPGTAY+ C+QGRK AM++L   ++ERR NPRK   DFFD V
Sbjct  195  LRNNFSAFIQGLISFPVDIPGTAYYKCVQGRKNAMRMLVNLLQERRENPRKQPIDFFDHV  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEE K++ TILTE I LDLMFVLLFASFETTSLALTLAIKFLSDHP VL+KLTEEHE I+
Sbjct  255  LEEFKKEGTILTEPIFLDLMFVLLFASFETTSLALTLAIKFLSDHPAVLKKLTEEHEMIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K REN +SGLTW+EYKSMTFTFQ I+ETVRLANIVPG+FRK+ R+I
Sbjct  315  KQRENADSGLTWKEYKSMTFTFQIINETVRLANIVPGVFRKAKREI  360



>ref|XP_010055602.1| PREDICTED: cytochrome P450 87A3-like isoform X2 [Eucalyptus grandis]
 gb|KCW72095.1| hypothetical protein EUGRSUZ_E00537 [Eucalyptus grandis]
Length=477

 Score =   259 bits (662),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +F AFI+GLISFPL++PGTAYH CLQGR+KAM++LK  ++ER+A P+K+++DFFD+V
Sbjct  194  LRANFDAFIKGLISFPLNMPGTAYHKCLQGREKAMRMLKNLMQERQATPKKHRSDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL+++ T+LTE IALDLMFVLLFASFETTSLALTLAIKFLSDHP VL++LTEEHEAI+
Sbjct  254  LEELQKEGTLLTEAIALDLMFVLLFASFETTSLALTLAIKFLSDHPRVLKQLTEEHEAIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            + R++   GL+W+EYK MT+TFQFI+ETVRLANIVPGIFR++LRDI 
Sbjct  314  RKRDDATPGLSWKEYKLMTYTFQFINETVRLANIVPGIFRRALRDIQ  360



>ref|XP_006352287.1| PREDICTED: cytochrome P450 87A3-like [Solanum tuberosum]
Length=471

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = -3

Query  497  ESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFVLE  318
            E+FVAFI+GL+SFP+  PGTAY+ CLQGRKK +K+LK  +EER++ PRK Q+DFFD+VLE
Sbjct  196  ENFVAFIKGLVSFPIYFPGTAYYKCLQGRKKILKMLKRMLEERKSQPRKEQSDFFDYVLE  255

Query  317  ELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKN  138
            EL+ KDTILTEGIALDLMFVLLF SFETTS A+TLAIKFL +HPL L++L EEHEAII+ 
Sbjct  256  ELQSKDTILTEGIALDLMFVLLFVSFETTSWAITLAIKFLHEHPLALKELKEEHEAIIRR  315

Query  137  RENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            REN + GLTWQEYKSM FTFQFI+ETVRLANI P +FRK+L++IN
Sbjct  316  RENASYGLTWQEYKSMKFTFQFINETVRLANIAPALFRKTLKEIN  360



>ref|XP_006366247.1| PREDICTED: cytochrome P450 87A3-like [Solanum tuberosum]
Length=471

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            + E+FVAFI+GLISFPL  PGTAY+ CLQGRKK +K+LK  +EER++ PRK Q+DFFD+V
Sbjct  194  VSENFVAFIKGLISFPLYFPGTAYYKCLQGRKKILKMLKRMLEERKSQPRKEQSDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL+ KDTILTE IALDLMFVLLFASFETTSLA+TLAIKFL +HP VL++LTEEHEAI 
Sbjct  254  LEELQSKDTILTETIALDLMFVLLFASFETTSLAITLAIKFLHEHPKVLKELTEEHEAIN  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            + REN + GLTW+EYKSM FTFQFI+ETVRLANI P IFRK+L+DIN
Sbjct  314  RRRENASYGLTWKEYKSMKFTFQFINETVRLANIAPVIFRKALKDIN  360



>emb|CDY66605.1| BnaA06g38070D [Brassica napus]
Length=474

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +FVAFIQGLISFP DIPGTAYH CL+GR+ AM++L+  ++ERR  PRKN +DFFD+V
Sbjct  195  LRANFVAFIQGLISFPFDIPGTAYHKCLKGRENAMRMLRNMLQERRKKPRKNPSDFFDYV  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE++++ TILTE IALDLMFVLLFASFETTSLALTLAIKFLSD P VL +LTEEHE I+
Sbjct  255  IEEIQKEGTILTEEIALDLMFVLLFASFETTSLALTLAIKFLSDDPKVLRRLTEEHETIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTF-QFIHETVRLANIVPGIFRKSLRDI  6
            +NRE+ NSGLTW+EYKSMT+TF QFI+ET RLANIVP IFRK+L DI
Sbjct  315  RNREDANSGLTWEEYKSMTYTFQQFINETARLANIVPAIFRKALIDI  361



>ref|XP_007210081.1| hypothetical protein PRUPE_ppa019666mg [Prunus persica]
 gb|EMJ11280.1| hypothetical protein PRUPE_ppa019666mg [Prunus persica]
Length=480

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFIQGLISFPLDIPGTAYH CLQGR +A+ +LK+ + ERR   +    DFFD+V
Sbjct  194  LRDNFVAFIQGLISFPLDIPGTAYHKCLQGRNRAIGMLKDMLRERRGKSQDQPNDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+++ TILTE I+LDLMFVLLFASFETTS+A+TLAIKFLSDHPLVL++LTEEHE I+
Sbjct  254  IEELEKEGTILTEEISLDLMFVLLFASFETTSIAMTLAIKFLSDHPLVLKQLTEEHEMIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K R+N +SGLTW+EYKSMTFTFQFI+ETVRL NI P IFRK+L++IN
Sbjct  314  KQRKNADSGLTWKEYKSMTFTFQFINETVRLGNIAPCIFRKALKEIN  360



>emb|CDY26591.1| BnaA09g46860D [Brassica napus]
Length=460

 Score =   257 bits (656),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +FVAFI+GLISFP +IPGTAYH CL+GR+ AMK+L+  ++ERR  PRKN +DFFD+V
Sbjct  183  LRANFVAFIRGLISFPFNIPGTAYHKCLKGRENAMKMLRNMLQERRKKPRKNPSDFFDYV  242

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE++++ TILTE IALDLMFVLLFASFETTSLALTLAIKFLSD P VL++LTEEHE I+
Sbjct  243  IEEIQKEGTILTEEIALDLMFVLLFASFETTSLALTLAIKFLSDDPEVLKRLTEEHETIL  302

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NRE+  SGLTW+EYKSMT+TFQFI+ET RLANIVP IFRK+L DI
Sbjct  303  RNREDAESGLTWEEYKSMTYTFQFINETARLANIVPAIFRKALIDI  348



>ref|XP_009118059.1| PREDICTED: cytochrome P450 87A3-like [Brassica rapa]
Length=472

 Score =   257 bits (656),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +FVAFI+GLISFP +IPGTAYH CL+GR+ AMK+L+  ++ERR  PRKN +DFFD+V
Sbjct  195  LRANFVAFIRGLISFPFNIPGTAYHKCLKGRENAMKMLRNMLQERRKKPRKNPSDFFDYV  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE++++ TILTE IALDLMFVLLFASFETTSLALTLAIKFLSD P VL++LTEEHE I+
Sbjct  255  IEEIQKEGTILTEEIALDLMFVLLFASFETTSLALTLAIKFLSDDPEVLKRLTEEHETIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NRE+  SGLTW+EYKSMT+TFQFI+ET RLANIVP IFRK+L DI
Sbjct  315  RNREDAESGLTWEEYKSMTYTFQFINETARLANIVPAIFRKALIDI  360



>ref|XP_008799522.1| PREDICTED: cytochrome P450 87A3 [Phoenix dactylifera]
Length=467

 Score =   256 bits (654),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI+GLISFP++IPGTAYH C+QGRK AMK+LK  ++ER+ +PR+   DFFD V
Sbjct  192  LRKNFVAFIRGLISFPVNIPGTAYHQCMQGRKNAMKVLKTMLKERQNSPRRQCVDFFDSV  251

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EELK++  ++TE IALDLMFVLLFASFETTSLALT A+K L+DHP VLE+LTEEHEAI+
Sbjct  252  IEELKKERPVITETIALDLMFVLLFASFETTSLALTAAMKLLTDHPRVLEELTEEHEAIL  311

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNRENP+SG+TW EYKSM+FTFQ I+ET RLANIVPGIFRK++ DI
Sbjct  312  KNRENPDSGITWNEYKSMSFTFQVINETARLANIVPGIFRKTMEDI  357



>ref|XP_004244719.1| PREDICTED: cytochrome P450 87A3-like [Solanum lycopersicum]
Length=471

 Score =   256 bits (654),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = -3

Query  497  ESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFVLE  318
            E+FVAF++GLISFP+  PGTAY+ CLQGRKK MK+LK  +EER++ PRK Q+DFFD+VLE
Sbjct  196  ENFVAFVKGLISFPIYFPGTAYYKCLQGRKKTMKMLKRMLEERKSQPRKEQSDFFDYVLE  255

Query  317  ELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKN  138
            EL+ KDTILTE IALDLMFVLLF SFETTS A+TLAIKFL  HP  L++L EEHEAII+ 
Sbjct  256  ELQSKDTILTEAIALDLMFVLLFVSFETTSWAITLAIKFLHQHPQALKELKEEHEAIIRR  315

Query  137  RENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            REN + GLTWQEYKSM FTFQFI+ETVRLANI P IFRK+L++IN
Sbjct  316  RENASYGLTWQEYKSMKFTFQFINETVRLANIAPAIFRKTLKEIN  360



>ref|XP_004147972.1| PREDICTED: cytochrome P450 87A3-like [Cucumis sativus]
 ref|XP_004166827.1| PREDICTED: cytochrome P450 87A3-like [Cucumis sativus]
 gb|KGN55957.1| hypothetical protein Csa_3G038790 [Cucumis sativus]
Length=469

 Score =   255 bits (652),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFIQGLISFPL++PGTAY+ CLQGRKKAM++LK  ++ERR NPRK + DFFDFV
Sbjct  194  LRDNFVAFIQGLISFPLNVPGTAYNKCLQGRKKAMRMLKNMLQERRTNPRKQRIDFFDFV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEEL++  T+LTE IALDLMFVLLFASFETTSLA+T AIKFL ++P VLE+LT EHE I+
Sbjct  254  LEELEKDGTLLTEEIALDLMFVLLFASFETTSLAITAAIKFLLNNPHVLEELTAEHEGIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K RE  +S LTW EYKSMTFTFQFI+ETVRLANIVPGIFRK+L+DI
Sbjct  314  KRREISDSRLTWGEYKSMTFTFQFINETVRLANIVPGIFRKALKDI  359



>emb|CDY60267.1| BnaC05g49310D [Brassica napus]
Length=473

 Score =   255 bits (651),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +FVAFIQGLISFP DIPGTAYH CL+GR+ AM++L+  ++ERR  PRKN  DFFD+V
Sbjct  195  LRANFVAFIQGLISFPFDIPGTAYHKCLKGRENAMRMLRNMLQERRRKPRKNPIDFFDYV  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE++++ TILTE IALDLMFVLLFASFETTSLALTLAIKFLSD P VL++LTEEHE I+
Sbjct  255  IEEIQKEGTILTEEIALDLMFVLLFASFETTSLALTLAIKFLSDDPEVLKRLTEEHETIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTF-QFIHETVRLANIVPGIFRKSLRDI  6
            +NRE+ +SGLTW+EYKSMT+TF QFI+ET RLANIVP IFRK+L DI
Sbjct  315  RNREDADSGLTWEEYKSMTYTFQQFINETARLANIVPAIFRKALIDI  361



>ref|XP_006857880.1| hypothetical protein AMTR_s00069p00107680 [Amborella trichopoda]
 gb|ERN19347.1| hypothetical protein AMTR_s00069p00107680 [Amborella trichopoda]
Length=473

 Score =   254 bits (649),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L+++FVAF+ GLISFPL+IPGT+YH CLQGR+KAMK+LK+ +EERR  P K   DFFD+V
Sbjct  197  LQKNFVAFVDGLISFPLNIPGTSYHKCLQGRQKAMKMLKKMLEERRREPEKAHGDFFDYV  256

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            L ELK++ ++LTE IALDLMFVLLFASFETTSLALTLA+KFLSDHP VLE+LT+EHEAI 
Sbjct  257  LGELKKERSVLTEEIALDLMFVLLFASFETTSLALTLAVKFLSDHPKVLEELTKEHEAIR  316

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NREN  SGLTW+EYKSM FT Q I+ETVRLANIVPGIFRK+L++I
Sbjct  317  RNRENQCSGLTWKEYKSMIFTSQVINETVRLANIVPGIFRKALKEI  362



>emb|CDY16028.1| BnaC08g40950D [Brassica napus]
Length=473

 Score =   254 bits (649),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +FVAFI+GLISFP +IPGTAYH CL+GR+ AMK+L+  ++ERR  PRKN +DFFD+V
Sbjct  195  LRANFVAFIRGLISFPFNIPGTAYHKCLKGRENAMKMLRNMLQERRKKPRKNPSDFFDYV  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE++++ TILTE IALDLMFVLLFASFETTSLALTLAIKFLSD P VL++LTEEHE I+
Sbjct  255  IEEIQKEGTILTEEIALDLMFVLLFASFETTSLALTLAIKFLSDDPEVLKRLTEEHETIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTF-QFIHETVRLANIVPGIFRKSLRDIN  3
            +NRE+  SGLTW+EYKSMT+TF QFI+ET RLANIVP IFRK+L DIN
Sbjct  315  RNREDAESGLTWEEYKSMTYTFQQFINETARLANIVPAIFRKALIDIN  362



>ref|XP_009400635.1| PREDICTED: cytochrome P450 87A3-like [Musa acuminata subsp. malaccensis]
Length=411

 Score =   252 bits (643),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI+GLIS+P+D+PGTAY+ C+QGRK  MK+LK  ++ERR +PRK   DFFD +
Sbjct  134  LRKNFVAFIRGLISYPVDLPGTAYYQCMQGRKNVMKVLKNMLKERRNSPRKQHGDFFDSL  193

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL ++ +++TE IALDLMFVLLFASFETTSLALTLAIK L+DHP VLEKLTEEH+ II
Sbjct  194  IEELNKERSLITETIALDLMFVLLFASFETTSLALTLAIKLLTDHPNVLEKLTEEHDTII  253

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            KNRE+P SG+TW EY+SMTFTFQ I ET RLANIVPGIFRK+L+DI 
Sbjct  254  KNREDPLSGVTWMEYRSMTFTFQVITETARLANIVPGIFRKALKDIQ  300



>ref|XP_010919431.1| PREDICTED: cytochrome P450 87A3 [Elaeis guineensis]
Length=477

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI+GLISFPL+IPGTAYH C+QGRK AMKLLK  ++ER+ +PR+   DFFD V
Sbjct  198  LRKNFVAFIRGLISFPLNIPGTAYHQCMQGRKNAMKLLKTMLKERQNSPRRQCMDFFDSV  257

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EELK++  ++TE IALDLMFVLLFASFETTSLALT+A+K L+D+P VLE+L EEHEAI+
Sbjct  258  IEELKKERPVITETIALDLMFVLLFASFETTSLALTVAMKLLTDNPRVLEELKEEHEAIL  317

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K+RENP+SG+TW EYKSM+FTFQ I+ETVRLANIVPGIFRK++ DI
Sbjct  318  KHRENPDSGITWNEYKSMSFTFQVINETVRLANIVPGIFRKAVEDI  363



>ref|XP_006300459.1| hypothetical protein CARUB_v10020228mg [Capsella rubella]
 gb|EOA33357.1| hypothetical protein CARUB_v10020228mg [Capsella rubella]
Length=473

 Score =   249 bits (636),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR+ F AF  GLISFP++IPGTAYH CL+GR++AMK+L++ ++ERR NPR+N +DFFD+V
Sbjct  196  LRDCFAAFNDGLISFPINIPGTAYHKCLEGRERAMKMLRDMLQERRENPRENPSDFFDYV  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EELK++DT+LTE IALDLMFVL+F SFETTS +LTLAIKFLSD P +L+ LTEEHEAI+
Sbjct  256  IEELKKEDTLLTEEIALDLMFVLIFTSFETTSYSLTLAIKFLSDDPSILKSLTEEHEAIL  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            +NRE+ NSGLTW+EYKSMT+T QFI+ET RLAN+  GIFRK+L D
Sbjct  316  RNREDANSGLTWKEYKSMTYTLQFINETARLANLAIGIFRKALVD  360



>ref|XP_009400447.1| PREDICTED: cytochrome P450 87A3-like [Musa acuminata subsp. malaccensis]
Length=476

 Score =   248 bits (634),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAF++GLIS+P+D+PGTAYH C+QGRK  +K+LK  ++ERR +P K   DFFD V
Sbjct  199  LRKNFVAFLRGLISYPVDLPGTAYHRCMQGRKNVLKVLKNMLKERRNSPWKQHGDFFDCV  258

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL ++ +++TE IALDLMF LLFASFETTSLALTLAIKFL+DHP VLEKLTEEH+ I+
Sbjct  259  IEELNKERSLITETIALDLMFALLFASFETTSLALTLAIKFLTDHPNVLEKLTEEHDTIL  318

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNRE+P +G+TW EY+SMTFTFQ I+ET RLANI PGIFRK+L+DI
Sbjct  319  KNREDPMTGVTWMEYRSMTFTFQVINETARLANIAPGIFRKALKDI  364



>ref|XP_010545882.1| PREDICTED: cytochrome P450 87A3-like [Tarenaya hassleriana]
Length=472

 Score =   248 bits (633),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+F AFI+GLIS PLDIPGTAYH CL+GR  AMK+LK  ++ERR NPR N +DFFD+V
Sbjct  195  LRENFDAFIRGLISLPLDIPGTAYHKCLKGRDMAMKMLKNMLKERRENPRNNPSDFFDYV  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+++ T +TE IA+ L+F+LLFASFETTSLALTLA+KFLSDHP VL++LTEEHEAI+
Sbjct  255  MEELQKEGTAMTEEIAIALIFLLLFASFETTSLALTLAVKFLSDHPSVLKRLTEEHEAIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            +NRE  +SGLTW+EY+SMT+TFQFI+ET RL NI+P +FRK L+D
Sbjct  315  RNREASHSGLTWEEYRSMTYTFQFINETTRLGNILPAVFRKVLKD  359



>ref|XP_010473544.1| PREDICTED: cytochrome P450 87A3-like [Camelina sativa]
Length=473

 Score =   243 bits (619),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L+E F AFI GLISFP++IPGTAYH CL+GR++AMK+L++ ++ER   PR+N +DFFD+V
Sbjct  196  LKECFAAFIDGLISFPINIPGTAYHKCLKGRERAMKMLRDMLQERYEKPRENPSDFFDYV  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL ++ T LTE IALDLMFVL+FASFETTS +LTLAIKFLSD P +L++LTEEHEAI+
Sbjct  256  IEELNKEGTPLTEEIALDLMFVLVFASFETTSFSLTLAIKFLSDDPSILKRLTEEHEAIL  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            +NRE+ +SGLTW+EYKSMT+TFQ I+ET RLAN+ P IFRK+L D
Sbjct  316  RNREDADSGLTWKEYKSMTYTFQCINETARLANLAPAIFRKALVD  360



>ref|XP_003570092.1| PREDICTED: cytochrome P450 87A3-like [Brachypodium distachyon]
Length=478

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI+GLISFP++IPGTAYH C++GR++AMK+LK  + ER A+P + + DF D +
Sbjct  201  LRKNFVAFIRGLISFPVNIPGTAYHECMKGRREAMKVLKRMMRERMADPSRQREDFLDVM  260

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+R+  +LTE +ALDLMFVLLFASFETT+LALTL IK L+++P VLE LTEEHEAI+
Sbjct  261  IEELRREKPVLTEAVALDLMFVLLFASFETTALALTLGIKLLTENPRVLEALTEEHEAIV  320

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            ++RE+P++GLTW EYKSMTFT+Q   E VRLANIVPGIFRK+L+DI
Sbjct  321  RDREDPDAGLTWAEYKSMTFTYQVTLEIVRLANIVPGIFRKALQDI  366



>ref|XP_004171985.1| PREDICTED: cytochrome P450 87A3-like [Cucumis sativus]
Length=471

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            +RE+FVAFIQGLISFP+DIPGT+YH CLQGRK+ M++L+  ++ER+ NPR+ Q D+FDFV
Sbjct  194  MRENFVAFIQGLISFPIDIPGTSYHKCLQGRKRVMRMLENMLKERQQNPREQQVDYFDFV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++ELK+  T LT+ +ALDL+F+LLFAS ETTS+ALTLAIKFL+DHP VL +LT EHE I+
Sbjct  254  IQELKKDGTPLTQQVALDLIFLLLFASHETTSIALTLAIKFLTDHPHVLNQLTAEHEGIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K R+N +  ++W EYKSMTFTF+F++ET+RLANI PGIFR++LRD+
Sbjct  314  KKRKNKSDKISWNEYKSMTFTFKFMNETLRLANIAPGIFRRALRDV  359



>ref|XP_010545893.1| PREDICTED: cytochrome P450 87A3-like [Tarenaya hassleriana]
Length=474

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            +RE F AFI+GLIS PL+IPGTAYHNCL+GR++AMK+LK  + ERR   RKN +DFFD+V
Sbjct  196  IREYFDAFIRGLISLPLNIPGTAYHNCLKGRERAMKMLKNMLNERRKTQRKNPSDFFDYV  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            L EL+++ +ILTE IALDL+F +LFASFETTSLALTLAIKFLSD+P  L++LTEEHE I+
Sbjct  256  LRELQKEGSILTEEIALDLIFSMLFASFETTSLALTLAIKFLSDYPSALKRLTEEHEGIL  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            +NRE  +SGLTW+EY+SMT+TFQFI+ET RLANI P +FRK+L D
Sbjct  316  RNREVSDSGLTWEEYRSMTYTFQFINETARLANIAPVLFRKALED  360



>ref|XP_004141154.1| PREDICTED: cytochrome P450 87A3-like [Cucumis sativus]
 gb|KGN59780.1| hypothetical protein Csa_3G845470 [Cucumis sativus]
Length=471

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            +RE+FVAFIQGLISFP+DIPGT+YH CLQGRK+ M++L+  ++ER+ NPR+ Q D+FDFV
Sbjct  194  MRENFVAFIQGLISFPIDIPGTSYHKCLQGRKRVMRMLENILKERQQNPREQQVDYFDFV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++ELK+  T LT+ +ALDL+F+LLFAS ETTS+ALTLAIKFL+DHP VL +LT EHE I+
Sbjct  254  IQELKKDGTPLTQQVALDLIFLLLFASHETTSIALTLAIKFLTDHPHVLNQLTAEHEGIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K R+N +  ++W EYKSMTFTF+F++ET+RLANI PGIFR++LRD+
Sbjct  314  KKRKNKSDKISWNEYKSMTFTFKFMNETLRLANIAPGIFRRALRDV  359



>gb|EMS46312.1| Cytochrome P450 87A3 [Triticum urartu]
Length=447

 Score =   241 bits (614),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+F AFI+GLISFPL+IPGTAYH C++GRKKAMK+LK  ++ER A+P +   DFFD V
Sbjct  170  LRENFTAFIRGLISFPLNIPGTAYHECMEGRKKAMKVLKGMMQERMADPERKCEDFFDHV  229

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL+R+  +LTE IALDLMFVLLFASFETT+LALTL +K L+++P V++ LTEEHEAI+
Sbjct  230  IQELRREKPLLTETIALDLMFVLLFASFETTALALTLGVKLLTENPRVVDALTEEHEAIV  289

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NRE+P++ +TW EYKSMTFT Q I E VRLANIVPGIFRK+L+D+
Sbjct  290  RNREDPDAAVTWAEYKSMTFTAQVIMEIVRLANIVPGIFRKALQDV  335



>ref|XP_008355587.1| PREDICTED: cytochrome P450 87A3-like [Malus domestica]
Length=364

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+F  FI+GLISFPL IPGTAYH CLQGRK+AM++L+  ++ERR   R+   DFFD++
Sbjct  194  LRENFDEFIRGLISFPLGIPGTAYHKCLQGRKRAMRVLQNLLQERRGKSRQQPIDFFDYL  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE  ++ T++T+ I+LDL+F+LLFASFETTS A+TLA+K LSDHP  LE+LTEEHE I+
Sbjct  254  IEESDKEGTLMTDEISLDLIFLLLFASFETTSTAITLAVKLLSDHPRALEQLTEEHEMIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K REN +SGLTW+EYKSMTFT Q I+ET+RLANIVPGIFRK+  DIN
Sbjct  314  KQRENSDSGLTWKEYKSMTFTLQSINETIRLANIVPGIFRKAATDIN  360



>ref|XP_010055601.1| PREDICTED: cytochrome P450 87A3-like isoform X1 [Eucalyptus grandis]
Length=509

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 152/199 (76%), Gaps = 32/199 (16%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +F AFI+GLISFPL++PGTAYH CLQGR+KAM++LK  ++ER+A P+K+++DFFD+V
Sbjct  194  LRANFDAFIKGLISFPLNMPGTAYHKCLQGREKAMRMLKNLMQERQATPKKHRSDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLT-------  165
            LEEL+++ T+LTE IALDLMFVLLFASFETTSLALTLAIKFLSDHP VL++LT       
Sbjct  254  LEELQKEGTLLTEAIALDLMFVLLFASFETTSLALTLAIKFLSDHPRVLKQLTVCKILPF  313

Query  164  -------------------------EEHEAIIKNRENPNSGLTWQEYKSMTFTFQFIHET  60
                                     EEHEAI++ R++   GL+W+EYK MT+TFQFI+ET
Sbjct  314  WFHCIILPIGLKCWQTFPESLCLWQEEHEAILRKRDDATPGLSWKEYKLMTYTFQFINET  373

Query  59   VRLANIVPGIFRKSLRDIN  3
            VRLANIVPGIFR++LRDI 
Sbjct  374  VRLANIVPGIFRRALRDIQ  392



>ref|XP_007149239.1| hypothetical protein PHAVU_005G053400g [Phaseolus vulgaris]
 gb|ESW21233.1| hypothetical protein PHAVU_005G053400g [Phaseolus vulgaris]
Length=477

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L ++F +F++GLIS PL+IPGTAYH CLQGRK+AMK LK  ++ERR  PRK  +DFFD+V
Sbjct  194  LMDNFNSFMEGLISLPLNIPGTAYHKCLQGRKRAMKTLKSMLKERREKPRKEVSDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL ++ T L E +ALDLMF LLFASFETTSLALT AIK LS HP VL+KL EEHE I+
Sbjct  254  VEELSKEGTPLNEEMALDLMFTLLFASFETTSLALTYAIKELSHHPSVLKKLQEEHEGIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K RE+PNS LTW EYKSMTFTFQ I+ET+RLANIVPGIFRK+L++I
Sbjct  314  KGREDPNSELTWHEYKSMTFTFQVINETIRLANIVPGIFRKTLQEI  359



>emb|CAH67038.1| OSIGBa0139P06.11 [Oryza sativa Indica Group]
 emb|CAH67275.1| OSIGBa0111L12.2 [Oryza sativa Indica Group]
 gb|EAY95213.1| hypothetical protein OsI_17032 [Oryza sativa Indica Group]
Length=480

 Score =   235 bits (600),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F AFI+GLISFPL+IPGTAYH C++GRK AMK+L+  ++ER A P +   DFFD V
Sbjct  203  LRKNFGAFIRGLISFPLNIPGTAYHECMEGRKNAMKVLRGMMKERMAEPERPCEDFFDHV  262

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL+R+  +LTE IALDLMFVLLFASFETT+LALT+ +K L+++P V++ L EEHEAII
Sbjct  263  IQELRREKPLLTETIALDLMFVLLFASFETTALALTIGVKLLTENPKVVDALREEHEAII  322

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NR++PNSG+TW EYKSMTFT Q I E VRLANIVPGIFRK+L+D+
Sbjct  323  RNRKDPNSGVTWAEYKSMTFTSQVIMEIVRLANIVPGIFRKALQDV  368



>ref|XP_003580352.1| PREDICTED: cytochrome P450 87A3 [Brachypodium distachyon]
Length=511

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E+F AFI+GLISFPL+IPGTAYH C++GRKKAMK+L+  ++ER A+P +   DFFD V
Sbjct  234  LMENFTAFIRGLISFPLNIPGTAYHECMEGRKKAMKVLRGMMKERMADPERKCEDFFDHV  293

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL+R+  +LTE IALDLMFVLLFASFETT+LALTL +K L+++P V++ LTEEHEAI+
Sbjct  294  IQELRREKPLLTETIALDLMFVLLFASFETTALALTLGVKLLTENPKVVDALTEEHEAIV  353

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NRE+P++ +TW EYKSMTFT Q I E VRLANIVPGIFR++L DI
Sbjct  354  RNREDPDAAVTWAEYKSMTFTSQVIMEIVRLANIVPGIFRRALEDI  399



>ref|XP_004298752.1| PREDICTED: cytochrome P450 87A3-like [Fragaria vesca subsp. vesca]
Length=480

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            ++ +F AF+ GLISFPLD+PGTA+H  L+GRK+ +  LK  ++ERRA   K   DFFD+V
Sbjct  194  IKGNFDAFMSGLISFPLDVPGTAFHESLRGRKRVLSTLKSMLQERRAKLMKRPIDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL +  T+LTEG++LDLMF+LLFASFETTS+A+TLA+KFLSDHPLVL++LTEEHE I+
Sbjct  254  IEELDKDGTLLTEGMSLDLMFLLLFASFETTSVAMTLALKFLSDHPLVLKQLTEEHEMIL  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            + R + +SGLTW+EYKSMTFTFQFI+ETVRLANIVPGIFRK++  I+
Sbjct  314  EQRVDADSGLTWEEYKSMTFTFQFINETVRLANIVPGIFRKTMSQIS  360



>ref|XP_008646050.1| PREDICTED: cytochrome P450 87A3-like [Zea mays]
 gb|AFW72785.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=475

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI+GLISFP+DIPGTAYH C+QGRKKAMK+L+  + ER  +P +   DFFD +
Sbjct  198  LRKNFVAFIRGLISFPVDIPGTAYHECMQGRKKAMKVLRTMMRERMPHPGRQNEDFFDVL  257

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+R+  ++TE IALDLMFVLLFASFETT+LALTL IK L+ +P VL  LTEEHEAI+
Sbjct  258  IEELRREKPVMTEAIALDLMFVLLFASFETTALALTLGIKLLAQNPRVLRALTEEHEAIV  317

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
             +R++ ++GLTW EYKSMTFT Q   E VRLANIVPGIFRK+L+DI
Sbjct  318  SSRKDRDAGLTWAEYKSMTFTSQVTLEIVRLANIVPGIFRKALQDI  363



>emb|CAD41584.3| OSJNBa0088I22.16 [Oryza sativa Japonica Group]
Length=480

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F AFI GLISFPL+IPGTAYH C++GRK AMK+L+  ++ER A P +   DFFD V
Sbjct  203  LRKNFGAFICGLISFPLNIPGTAYHECMEGRKNAMKVLRGMMKERMAEPERPCEDFFDHV  262

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL+R+  +LTE IALDLMFVLLFASFETT+LALT+ +K L+++P V++ L EEHEAII
Sbjct  263  IQELRREKPLLTETIALDLMFVLLFASFETTALALTIGVKLLTENPKVVDALREEHEAII  322

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NR++PNSG+TW EYKSMTFT Q I E VRLANIVPGIFRK+L+D+
Sbjct  323  RNRKDPNSGVTWAEYKSMTFTSQVIMEIVRLANIVPGIFRKALQDV  368



>gb|EMT10534.1| Cytochrome P450 87A3 [Aegilops tauschii]
Length=444

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 143/175 (82%), Gaps = 9/175 (5%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE+F AFI+GLISFPL+IPGTAYH C++GRKKAMK+LK  ++ER A+P +   DFFD V
Sbjct  158  LRENFTAFIRGLISFPLNIPGTAYHECMEGRKKAMKVLKGMMQERMADPERKCEDFFDHV  217

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLT-------  165
            ++EL+R+  +LTE IALDLMFVLLFASFETT+LALTL +K L+++P V++ LT       
Sbjct  218  IQELRREKPLLTETIALDLMFVLLFASFETTALALTLGVKLLTENPRVVDALTTLTERAR  277

Query  164  --EEHEAIIKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
              EEHEAI++NRE+P++ +TW EYKSMTFT Q I E VRLANIVPGIFRK+L+D+
Sbjct  278  EQEEHEAIVRNREDPDAAITWAEYKSMTFTAQVIMEIVRLANIVPGIFRKALQDV  332



>ref|XP_002452760.1| hypothetical protein SORBIDRAFT_04g032020 [Sorghum bicolor]
 gb|EES05736.1| hypothetical protein SORBIDRAFT_04g032020 [Sorghum bicolor]
Length=482

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 142/168 (85%), Gaps = 2/168 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRAN-PRKNQT-DFFD  330
            LR++FVAFI+GLISFP+DIPGTAYH C+QGRKKAMK+L+  + ER A+ P + Q+ DFFD
Sbjct  203  LRKNFVAFIRGLISFPVDIPGTAYHECMQGRKKAMKVLRTMMRERMADRPGRQQSEDFFD  262

Query  329  FVLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEA  150
             ++EEL+R+  ++TE IALDLMFVLLFASFETT+LALTL +K L+++P VL  LTEEHEA
Sbjct  263  VLIEELRREKPVMTEAIALDLMFVLLFASFETTALALTLGVKLLAENPRVLRALTEEHEA  322

Query  149  IIKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            I+ NR++ ++GLTW EYKSMTFT Q   E VRLANIVPGIFRK+L+DI
Sbjct  323  IVSNRKDRDAGLTWAEYKSMTFTSQVTLEIVRLANIVPGIFRKALQDI  370



>gb|EEE61527.1| hypothetical protein OsJ_15830 [Oryza sativa Japonica Group]
Length=531

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F AFI GLISFPL+IPGTAYH C++GRK AMK+L+  ++ER A P +   DFFD V
Sbjct  203  LRKNFGAFICGLISFPLNIPGTAYHECMEGRKNAMKVLRGMMKERMAEPERPCEDFFDHV  262

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL+R+  +LTE IALDLMFVLLFASFETT+LALT+ +K L+++P V++ L EEHEAII
Sbjct  263  IQELRREKPLLTETIALDLMFVLLFASFETTALALTIGVKLLTENPKVVDALREEHEAII  322

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NR++PNSG+TW EYKSMTFT Q I E VRLANIVPGIFRK+L+D+
Sbjct  323  RNRKDPNSGVTWAEYKSMTFTSQVIMEIVRLANIVPGIFRKALQDV  368



>ref|NP_001053599.1| Os04g0570000 [Oryza sativa Japonica Group]
 sp|Q7XU38.3|C87A3_ORYSJ RecName: Full=Cytochrome P450 87A3 [Oryza sativa Japonica Group]
 emb|CAD30852.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 dbj|BAF15513.1| Os04g0570000 [Oryza sativa Japonica Group]
Length=514

 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F AFI GLISFPL+IPGTAYH C++GRK AMK+L+  ++ER A P +   DFFD V
Sbjct  237  LRKNFGAFICGLISFPLNIPGTAYHECMEGRKNAMKVLRGMMKERMAEPERPCEDFFDHV  296

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL+R+  +LTE IALDLMFVLLFASFETT+LALT+ +K L+++P V++ L EEHEAII
Sbjct  297  IQELRREKPLLTETIALDLMFVLLFASFETTALALTIGVKLLTENPKVVDALREEHEAII  356

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NR++PNSG+TW EYKSMTFT Q I E VRLANIVPGIFRK+L+D+
Sbjct  357  RNRKDPNSGVTWAEYKSMTFTSQVIMEIVRLANIVPGIFRKALQDV  402



>ref|XP_008669007.1| PREDICTED: cytochrome P450 87A3 isoform X1 [Zea mays]
 gb|AFW59283.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=506

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI+GLISFP++IPGTAYH C++GRK AMK+LK  ++ER A+P +   DFFD V
Sbjct  229  LRKNFVAFIRGLISFPVNIPGTAYHECMEGRKNAMKVLKRMMKERMADPERRCEDFFDHV  288

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL+R+  +LTE IALDLMFVLLFASFETT+LALTL +K L+D+P V++ L EEH+AI 
Sbjct  289  IQELRREKPLLTETIALDLMFVLLFASFETTALALTLGVKLLTDNPKVVDALREEHDAIA  348

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNR++P++ +TW EY+SMTFT Q I E VRLANIVPGIFRK+L+D+
Sbjct  349  KNRKDPDAPVTWAEYRSMTFTNQVIMEMVRLANIVPGIFRKALQDV  394



>ref|XP_011016152.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=313

 Score =   227 bits (579),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQ-TDFFDF  327
            LR+++  F  GLISFPL+IPGTAY  CLQGRKKA++++K  +EER A PRK Q  DF D 
Sbjct  22   LRQAYADFQHGLISFPLNIPGTAYWKCLQGRKKAVEIIKSILEERCATPRKRQEKDFLDL  81

Query  326  VLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAI  147
            V+EE+K+  +++TE +ALDL+FVL+FA+FETTS+ LTLA+K + +HP VLE+L +EHEAI
Sbjct  82   VIEEIKKNGSLMTEAMALDLLFVLVFAAFETTSITLTLAVKNVCEHPKVLEELIKEHEAI  141

Query  146  IKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            ++NR+N  SG+TWQEYKSM FT   IHETVRLANIVPGIFRK L+D++
Sbjct  142  LRNRKNIESGITWQEYKSMNFTHAVIHETVRLANIVPGIFRKVLKDVD  189



>ref|XP_004953429.1| PREDICTED: cytochrome P450 87A3-like [Setaria italica]
Length=478

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI+GLISFP+DIPGTAYH C+QGRK AMK+LK+ + ER A+  +   DFFD +
Sbjct  201  LRKNFVAFIRGLISFPVDIPGTAYHECMQGRKNAMKVLKKMMRERIADKGRQSEDFFDVL  260

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+R+  ++TE IALDLMFVLLFASFETT+LALTL +K L+++P VL+ LTEEHEAI+
Sbjct  261  IEELRREKPVMTEAIALDLMFVLLFASFETTALALTLGVKLLAENPRVLQALTEEHEAIV  320

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
             NR++ ++ LTW +YKSMTFT Q I E VRLANIVPGIFRK+L+DI
Sbjct  321  SNRKDRDAELTWADYKSMTFTSQVILEIVRLANIVPGIFRKALQDI  366



>ref|XP_006652661.1| PREDICTED: cytochrome P450 87A3-like [Oryza brachyantha]
Length=513

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F +FI+GLISFP++IPGTAYH C++GRK AM++L+  ++ER A+P +   DFFD V
Sbjct  236  LRKNFASFIRGLISFPVNIPGTAYHECMEGRKNAMRVLRSMMKERMADPERPCEDFFDHV  295

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL+R+  +LTE IALDLMFVLLFASFETT+LALT+ +K L+++P V++ L EEHEAII
Sbjct  296  IQELRREKPLLTETIALDLMFVLLFASFETTALALTIGVKLLTENPKVVDALREEHEAII  355

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NR++P+SG+TW EYKSMTFT Q I E VRLANIVPGIFRK+L+D+
Sbjct  356  RNRKDPDSGVTWAEYKSMTFTSQVIMEIVRLANIVPGIFRKALQDV  401



>ref|XP_002448362.1| hypothetical protein SORBIDRAFT_06g025820 [Sorghum bicolor]
 gb|EES12690.1| hypothetical protein SORBIDRAFT_06g025820 [Sorghum bicolor]
Length=517

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI+GLISFP++IPGTAYH C++GRKKAMK+L+  ++ER A+P +   DFFD V
Sbjct  240  LRKNFVAFIRGLISFPVNIPGTAYHECMEGRKKAMKVLRGMMKERMADPERRCDDFFDHV  299

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL+R+  +LTE IALDLMFVLLFASFETT+LALTL +K L+++P V++ L EEH+AI 
Sbjct  300  IQELRREKPLLTETIALDLMFVLLFASFETTALALTLGVKLLTENPKVVDALREEHDAIA  359

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNR++P++ +TW EY+SMTFT Q I E VRLANIVPGIFRK+L+D+
Sbjct  360  KNRKDPDAPVTWAEYRSMTFTNQVIMEMVRLANIVPGIFRKALQDV  405



>ref|XP_006647678.1| PREDICTED: cytochrome P450 87A3-like [Oryza brachyantha]
Length=465

 Score =   230 bits (586),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI+GLISFP+ IPGTAYH C++GR+ AMK+LK+ + ER A P +   DFFD +
Sbjct  188  LRKNFVAFIRGLISFPVGIPGTAYHECMKGRRNAMKVLKKMMRERMAEPARQCEDFFDVL  247

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+R+  +LTE IALDLMFVLLFASFETTSLALTL ++ L+++P+VL+ LTEEHEAI+
Sbjct  248  IEELRREKPVLTEAIALDLMFVLLFASFETTSLALTLGVRLLAENPMVLDALTEEHEAIV  307

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            + R+  ++ LTW EYKSMTFT Q   E VRLANIVPGIFRK+L+DI
Sbjct  308  RARKECDAALTWAEYKSMTFTSQVTLEIVRLANIVPGIFRKALQDI  353



>ref|XP_008663476.1| PREDICTED: cytochrome P450 87A3-like [Zea mays]
 gb|AFW59150.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=508

 Score =   231 bits (588),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI+GLISFP++IPGTAYH C++GRK AMK+LK  ++ER A+P +   DFFD V
Sbjct  231  LRKNFVAFIRGLISFPVNIPGTAYHECMEGRKNAMKVLKGMMKERMADPERRCEDFFDHV  290

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL+R+  +LTE IALDLMFVLLFASFETT+LALTL +K L+D P V++ L EEH+AI 
Sbjct  291  IQELRREKPLLTETIALDLMFVLLFASFETTALALTLGVKLLTDSPKVVDALREEHDAIA  350

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNR +P++ +TW EY+SMTFT Q I E VRLANIVPGIFRK+L+D+
Sbjct  351  KNRNDPDAPVTWAEYRSMTFTNQVIMEMVRLANIVPGIFRKALQDV  396



>ref|XP_004976534.1| PREDICTED: cytochrome P450 87A3-like [Setaria italica]
Length=511

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI+GLISFPL+IPGTAYH C++GRK AMK+LK  ++ER A+P +   DFFD V
Sbjct  234  LRKNFVAFIRGLISFPLNIPGTAYHECMEGRKNAMKVLKSMMKERMADPERRCEDFFDHV  293

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL+R+  +LTE IALDLMFVLLFASFETT+LALTL +K L+++P V++ L EEH+AI 
Sbjct  294  IQELRREKPLLTETIALDLMFVLLFASFETTALALTLGVKLLTENPKVVDALREEHDAIA  353

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NR++P++ +TW EY+SMTFT Q I E VRLANIVPGIFRK+L+D+
Sbjct  354  RNRKDPDAPVTWAEYRSMTFTNQVIMEMVRLANIVPGIFRKALQDV  399



>dbj|BAJ97484.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93628.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=473

 Score =   228 bits (581),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI+GLISFP++IPGTAYH C++GR+ AMK+LK  + ER A+  + + DF D +
Sbjct  196  LRKNFVAFIRGLISFPVNIPGTAYHECMKGRRNAMKVLKRMMRERMADQGRQRQDFLDVM  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+R+  +LTE +ALDLMFVLLFASFETT+LALTL I+ ++++P VL+ LTEEHEAI+
Sbjct  256  IEELRREKPVLTETVALDLMFVLLFASFETTALALTLGIRLITENPRVLDALTEEHEAIV  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            ++R++P++GLTW EYKSMTFT Q   E  R+ANIVPGIFRK+L+DI
Sbjct  316  RDRKDPDAGLTWAEYKSMTFTSQVTLEIARIANIVPGIFRKALQDI  361



>gb|EEC73772.1| hypothetical protein OsI_08447 [Oryza sativa Indica Group]
Length=480

 Score =   228 bits (581),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI+GLISFP+DIPGTAYH C++GR+ AMK+LK+ + ER   P +   DFFD +
Sbjct  201  LRKNFVAFIRGLISFPVDIPGTAYHECMKGRRNAMKVLKKMMRERMEEPGRQCEDFFDVL  260

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL R+  +LTEGIALDLMFVLLFASFETTSLALTL ++ L+++P VL+ LTEEHEAI+
Sbjct  261  IEELGREKPVLTEGIALDLMFVLLFASFETTSLALTLGVRLLAENPTVLDALTEEHEAIV  320

Query  143  KNRENP--NSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            + R+     +GLTW EYKSMTFT Q   E VRLANIVPGIFRK+L+DI
Sbjct  321  RGRKEGCDAAGLTWAEYKSMTFTSQVTLEMVRLANIVPGIFRKALQDI  368



>ref|XP_011022913.1| PREDICTED: cytochrome P450 87A3-like isoform X3 [Populus euphratica]
Length=445

 Score =   227 bits (578),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQ-TDFFDF  327
            LR+++  F +GLISFPL+IPGTAY  CLQGRKKA++++K  +EER A PRK Q  DF D 
Sbjct  203  LRKAYADFQRGLISFPLNIPGTAYWKCLQGRKKAVEIIKSILEERCATPRKRQEKDFLDL  262

Query  326  VLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAI  147
            V+EE+K+  +++TE +ALDL+FVL+FA+FETTS+ LTLA+K + +HP VLE+L +EHEAI
Sbjct  263  VIEEIKKNGSLMTEAMALDLLFVLVFAAFETTSITLTLAVKNVCEHPKVLEELIKEHEAI  322

Query  146  IKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            ++NR+N  SG+TWQEYKSM FT   IHETVRLANIVPGIFRK L+D++
Sbjct  323  LRNRKNIESGITWQEYKSMNFTHAVIHETVRLANIVPGIFRKVLKDVD  370



>gb|EAZ31605.1| hypothetical protein OsJ_15749 [Oryza sativa Japonica Group]
Length=480

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI+GLISFP+DIPGTAYH C++GR+ AMK+LK+ + ER   P +   DFFD +
Sbjct  201  LRKNFVAFIRGLISFPVDIPGTAYHECMKGRRNAMKVLKKMMRERMEEPGRQCEDFFDVL  260

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL R+  +LTEGIALDLMFVLLFASFETTSLALTL ++ L+++P VL+ LTEEHEAI+
Sbjct  261  IEELGREKPVLTEGIALDLMFVLLFASFETTSLALTLGVRLLAENPTVLDALTEEHEAIV  320

Query  143  KNRENP--NSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            + R+     +GLTW +YKSMTFT Q   E VRLANIVPGIFRK+L+DI
Sbjct  321  RGRKEGCDAAGLTWADYKSMTFTSQVTLEMVRLANIVPGIFRKALQDI  368



>ref|XP_011022914.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=494

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQ-TDFFDF  327
            LR+++  F +GLISFPL+IPGTAY  CLQGRKKA++++K  +EER A PRK Q  DF D 
Sbjct  203  LRKAYADFQRGLISFPLNIPGTAYWKCLQGRKKAVEIIKSILEERCATPRKRQEKDFLDL  262

Query  326  VLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAI  147
            V+EE+K+  +++TE +ALDL+FVL+FA+FETTS+ALTLA+K + +HP VLE+L +EHEAI
Sbjct  263  VIEEIKKNGSLMTEAMALDLLFVLVFAAFETTSIALTLAVKNVCEHPKVLEELIKEHEAI  322

Query  146  IKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            ++NR+   SG+TWQEYKSMTFT   IHETVRLANIVPGIFRK L+D++
Sbjct  323  LRNRKIIESGITWQEYKSMTFTHAVIHETVRLANIVPGIFRKVLKDVD  370



>ref|XP_011022912.1| PREDICTED: cytochrome P450 87A3-like isoform X2 [Populus euphratica]
Length=494

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQ-TDFFDF  327
            LR+++  F +GLISFPL+IPGTAY  CLQGRKKA++++K  +EER A PRK Q  DF D 
Sbjct  203  LRKAYADFQRGLISFPLNIPGTAYWKCLQGRKKAVEIIKSILEERCATPRKRQEKDFLDL  262

Query  326  VLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAI  147
            V+EE+K+  +++TE +ALDL+FVL+FA+FETTS+ LTLA+K + +HP VLE+L +EHEAI
Sbjct  263  VIEEIKKNGSLMTEAMALDLLFVLVFAAFETTSITLTLAVKNVCEHPKVLEELIKEHEAI  322

Query  146  IKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            ++NR+N  SG+TWQEYKSM FT   IHETVRLANIVPGIFRK L+D++
Sbjct  323  LRNRKNIESGITWQEYKSMNFTHAVIHETVRLANIVPGIFRKVLKDVD  370



>dbj|BAD29475.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 dbj|BAD29524.1| putative cytochrome P450 [Oryza sativa Japonica Group]
Length=506

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI+GLISFP+DIPGTAYH C++GR+ AMK+LK+ + ER   P +   DFFD +
Sbjct  201  LRKNFVAFIRGLISFPVDIPGTAYHECMKGRRNAMKVLKKMMRERMEEPGRQCEDFFDVL  260

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL R+  +LTEGIALDLMFVLLFASFETTSLALTL ++ L+++P VL+ LTEEHEAI+
Sbjct  261  IEELGREKPVLTEGIALDLMFVLLFASFETTSLALTLGVRLLAENPTVLDALTEEHEAIV  320

Query  143  KNRENP--NSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            + R+     +GLTW +YKSMTFT Q   E VRLANIVPGIFRK+L+DI
Sbjct  321  RGRKEGCDAAGLTWADYKSMTFTSQVTLEMVRLANIVPGIFRKALQDI  368



>ref|XP_011022911.1| PREDICTED: cytochrome P450 87A3-like isoform X1 [Populus euphratica]
Length=557

 Score =   227 bits (579),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQ-TDFFDF  327
            LR+++  F +GLISFPL+IPGTAY  CLQGRKKA++++K  +EER A PRK Q  DF D 
Sbjct  203  LRKAYADFQRGLISFPLNIPGTAYWKCLQGRKKAVEIIKSILEERCATPRKRQEKDFLDL  262

Query  326  VLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAI  147
            V+EE+K+  +++TE +ALDL+FVL+FA+FETTS+ LTLA+K + +HP VLE+L +EHEAI
Sbjct  263  VIEEIKKNGSLMTEAMALDLLFVLVFAAFETTSITLTLAVKNVCEHPKVLEELIKEHEAI  322

Query  146  IKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            ++NR+N  SG+TWQEYKSM FT   IHETVRLANIVPGIFRK L+D++
Sbjct  323  LRNRKNIESGITWQEYKSMNFTHAVIHETVRLANIVPGIFRKVLKDVD  370



>ref|XP_004298750.1| PREDICTED: cytochrome P450 87A3-like [Fragaria vesca subsp. vesca]
Length=480

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 134/167 (80%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +F AF  GLI+ PL+IPGTA+H CLQGR + +  LK+ ++ERRA  RK   DFFD+V
Sbjct  194  LRANFSAFADGLIAIPLNIPGTAFHKCLQGRDRVLSRLKDMLQERRATSRKQPIDFFDYV  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            L+EL ++ T+LTE I  DLMF+LL+ SFETTS A+TL +KF+S+HP VL++LTEEHE II
Sbjct  254  LQELDKEGTVLTEEICFDLMFLLLYTSFETTSTAMTLLLKFVSEHPPVLKQLTEEHEKII  313

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K REN NSGLTW+EYKSM FT Q I+ETVRLA+ VPGIFRK+++++ 
Sbjct  314  KRRENANSGLTWEEYKSMKFTLQVINETVRLASQVPGIFRKAIKEVQ  360



>gb|EMT30405.1| Cytochrome P450 87A3 [Aegilops tauschii]
Length=521

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI+GLISFP++IPGTAYH C++GR+ AM +LK  + ER A+  +   DF D +
Sbjct  196  LRKNFVAFIRGLISFPVNIPGTAYHECMKGRRNAMTVLKRMMRERMADEGRQPEDFLDVM  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+R+  +LTE +ALDLMFVLLFASFETT+L+LTL I+ ++++P VLE LTEEHEAI+
Sbjct  256  IEELRREKPVLTETVALDLMFVLLFASFETTALSLTLGIRLITENPKVLEALTEEHEAIV  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            ++R++P++GLTW EYKSMTFT Q   E  R+ANIVPGIFRK+L+DI
Sbjct  316  RDRKDPDAGLTWAEYKSMTFTSQVTLEIARIANIVPGIFRKALQDI  361



>ref|XP_008669008.1| PREDICTED: cytochrome P450 87A3 isoform X2 [Zea mays]
Length=500

 Score =   223 bits (569),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 137/166 (83%), Gaps = 6/166 (4%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI+GLISFP++IPGTAYH C++GRK AMK+LK  ++ER A+P +   DFFD V
Sbjct  229  LRKNFVAFIRGLISFPVNIPGTAYHECMEGRKNAMKVLKRMMKERMADPERRCEDFFDHV  288

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL+R+  +LTE IALDLMFVLLFASFETT+LALTL +K L+D+P       EEH+AI 
Sbjct  289  IQELRREKPLLTETIALDLMFVLLFASFETTALALTLGVKLLTDNP------KEEHDAIA  342

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNR++P++ +TW EY+SMTFT Q I E VRLANIVPGIFRK+L+D+
Sbjct  343  KNRKDPDAPVTWAEYRSMTFTNQVIMEMVRLANIVPGIFRKALQDV  388



>ref|XP_002887976.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64235.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=328

 Score =   215 bits (548),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE FVAFI GLISFP+DIPGTAYH CL+GR+ AMK+L+  ++ER   PR+N +DFFD+V
Sbjct  102  LREYFVAFIHGLISFPIDIPGTAYHKCLKGRESAMKMLRNMLQERCEKPRENPSDFFDYV  161

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EELK++ TILTE IALDLMF LLFASFETTSL+LTLAIKFLSD+P VL++LTEEHE I+
Sbjct  162  IEELKKEGTILTEAIALDLMFALLFASFETTSLSLTLAIKFLSDNPSVLKRLTEEHEEIL  221

Query  143  KNRENPNSGLTWQEYKSMT  87
             NRE+ +SGLTW+EYKSMT
Sbjct  222  GNREDADSGLTWKEYKSMT  240



>ref|XP_007051922.1| Cytochrome P450 87A3 [Theobroma cacao]
 gb|EOX96079.1| Cytochrome P450 87A3 [Theobroma cacao]
Length=496

 Score =   218 bits (555),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            +R+SF AF+ GLIS PL+IPGTAYH CLQGRKK  K++K+  E+R+A+ + +  DF +++
Sbjct  198  VRDSFQAFLDGLISLPLNIPGTAYHACLQGRKKVYKVIKDIFEKRKAS-KGHHNDFLEYL  256

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            L E++R+DT LTE IA DL+FVLLFAS ETTS A TLA+KF++DH  VLE+LT+EHEAII
Sbjct  257  LNEVEREDTFLTEQIAKDLVFVLLFASHETTSAATTLAVKFIADHHQVLEELTKEHEAII  316

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K+R N NS LTWQEYKSMTFT   I+ETVRLANI PG+FRK ++D+
Sbjct  317  KSRGNENSELTWQEYKSMTFTHMVINETVRLANIAPGMFRKVVKDV  362



>ref|XP_002274332.3| PREDICTED: cytochrome P450 87A3-like [Vitis vinifera]
Length=447

 Score =   216 bits (550),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE++ AF+ GLISFPL IPGT+Y  CLQGRK+AMK ++  ++ERRA+P +   D+ DFV
Sbjct  161  LRENYAAFLDGLISFPLKIPGTSYWKCLQGRKRAMKTIRNMLDERRASPEREDKDYIDFV  220

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEE+++  TILTE I LDL+F L FA++ETTS AL LAI++L  HP  L ++T+EHE+I+
Sbjct  221  LEEMQKDQTILTEEIVLDLLFALPFATYETTSSALVLAIQYLGSHPSALAEITKEHESIL  280

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            ++RE  +SG+TW EYKSM FT   I+ETVRL NIVPGIFRK  +DI
Sbjct  281  RSRERVDSGITWNEYKSMNFTMMVINETVRLGNIVPGIFRKVAKDI  326



>ref|XP_007038615.1| Cytochrome P450, family 87, subfamily A, polypeptide 2, putative 
[Theobroma cacao]
 gb|EOY23116.1| Cytochrome P450, family 87, subfamily A, polypeptide 2, putative 
[Theobroma cacao]
Length=480

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR  + AF+ GLISFPL+IPGTAY  CLQGR KAMK++K  +EERRA+P++ Q DF D V
Sbjct  196  LRACYSAFLDGLISFPLNIPGTAYWKCLQGRNKAMKVIKSMLEERRASPKRQQKDFLDIV  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE+K+ +TIL+E  ALDL+F L FA+FE+ S A+ LA+++L ++PL L +LT+EHEAI+
Sbjct  256  VEEMKKAETILSEQTALDLLFALPFAAFESASSAVVLALQYLRNNPLALAELTQEHEAIL  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
              RE  +SG+TW+EYKSMTFT   I+ET+RL NIVP IFRK ++D+
Sbjct  316  TERETKDSGITWKEYKSMTFTHMVINETIRLGNIVPAIFRKVVKDV  361



>emb|CBI31826.3| unnamed protein product [Vitis vinifera]
Length=493

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE++ AF+ GLISFPL IPGT+Y  CLQGRK+AMK ++  ++ERRA+P +   D+ DFV
Sbjct  199  LRENYAAFLDGLISFPLKIPGTSYWKCLQGRKRAMKTIRNMLDERRASPEREDKDYIDFV  258

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEE+++  TILTE I LDL+F L FA++ETTS AL LAI++L  HP  L ++T+EHE+I+
Sbjct  259  LEEMQKDQTILTEEIVLDLLFALPFATYETTSSALVLAIQYLGSHPSALAEITKEHESIL  318

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            ++RE  +SG+TW EYKSM FT   I+ETVRL NIVPGIFRK  +DI
Sbjct  319  RSRERVDSGITWNEYKSMNFTMMVINETVRLGNIVPGIFRKVAKDI  364



>ref|XP_004976535.1| PREDICTED: cytochrome P450 87A3-like [Setaria italica]
Length=494

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 139/181 (77%), Gaps = 14/181 (8%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRAN------------  360
            LR+SF  F++GLISFPL +PGTAY++C++GR+ AM++L+E +EERR +            
Sbjct  203  LRKSFFDFVRGLISFPLYLPGTAYYSCMKGRQSAMEVLQEVLEERRRSVQYPGGAGGDDR  262

Query  359  PRKNQTDFFDFVLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLV  180
             R+   DF D+V++E+ R++ ++T+ +ALDLMFVLLFASF TTSLALTLA+K L+DHP V
Sbjct  263  ARRRHGDFLDYVVQEITREEPLVTDKMALDLMFVLLFASFHTTSLALTLAVKLLADHPHV  322

Query  179  LEKLTEEHEAIIKNRE--NPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            LE+LT EHE I+ +R+    + G+TW EYKSMTFT Q I+ETVRLANI PGIFRK+L+DI
Sbjct  323  LEELTVEHETILNDRKPGRESDGITWMEYKSMTFTSQVINETVRLANIAPGIFRKALKDI  382

Query  5    N  3
             
Sbjct  383  Q  383



>ref|XP_006653691.1| PREDICTED: cytochrome P450 87A3-like [Oryza brachyantha]
Length=485

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 136/176 (77%), Gaps = 9/176 (5%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERR-------ANPRKNQ  345
            LR SF  F++GLISFPL +PGTAY++C+QGR++AM +L++ +EER+           K+ 
Sbjct  199  LRRSFFDFVRGLISFPLYLPGTAYYSCMQGRRRAMVVLEQVLEERKRSTELQHGGQAKHH  258

Query  344  TDFFDFVLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLT  165
             DF D+V++E+ ++  ++TE +ALDLMFVLLFASF TTSLALTLA+K L+D+PLVLE+LT
Sbjct  259  GDFLDYVIQEITKEKPVMTEKMALDLMFVLLFASFHTTSLALTLAVKLLADYPLVLEELT  318

Query  164  EEHEAIIKNRENPN--SGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            EEH+ I+  RE  +   G+TW+EYKSM FT Q I+ETVRLANI P IFRK+L+DI 
Sbjct  319  EEHDTILMGREGGSEPDGITWKEYKSMAFTSQVINETVRLANIAPVIFRKALKDIQ  374



>emb|CBI38770.3| unnamed protein product [Vitis vinifera]
Length=613

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRES+ AF+ GLISFPL+IPGTA+H CL+GR+ A+K++   I ER+++ +K   DF DF+
Sbjct  337  LRESYKAFLDGLISFPLNIPGTAFHACLKGRENAIKVINNVINERKSS-QKLCHDFLDFL  395

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEE K KDTIL E I +DL+F+LLFAS+ETTS A+TL +KFLSDHP V+ +LT+EHE I+
Sbjct  396  LEEAKSKDTILNEAIIVDLVFLLLFASYETTSEAITLVMKFLSDHPSVVVELTKEHEEIL  455

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNR+N   G+TW EYKSMTFT   I+ET+RL NIVPGIFR   +DI
Sbjct  456  KNRKNEELGITWTEYKSMTFTHMVINETLRLGNIVPGIFRGVTKDI  501



>emb|CAH67278.1| OSIGBa0111L12.5 [Oryza sativa Indica Group]
 gb|EEC77825.1| hypothetical protein OsI_17035 [Oryza sativa Indica Group]
Length=484

 Score =   207 bits (526),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 136/175 (78%), Gaps = 9/175 (5%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEER-------RANPRKNQ  345
            LR+SF  F++GLISFPL +PGTAY++C+QGR++AM +L++ +EER       R    +  
Sbjct  198  LRKSFFDFVRGLISFPLYLPGTAYYSCMQGRRRAMVVLEQVLEERKQSTGLQRGGEAQQH  257

Query  344  TDFFDFVLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLT  165
             DF D+V++E+ ++  ++TE +ALDLMFVLLFASF TTSLALTLA+K L+DHPLVLE+LT
Sbjct  258  GDFLDYVIQEITKEKPVMTEKMALDLMFVLLFASFHTTSLALTLAVKLLADHPLVLEELT  317

Query  164  EEHEAIIKNRENPN--SGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
             EHE I+K+RE  +    +TW+EYKSM FT Q I+ETVRLANI P IFRK+L+DI
Sbjct  318  VEHETILKDREAGSELDRITWKEYKSMAFTSQVINETVRLANIAPVIFRKALKDI  372



>ref|NP_001053601.1| Os04g0570600 [Oryza sativa Japonica Group]
 dbj|BAF15515.1| Os04g0570600 [Oryza sativa Japonica Group]
 gb|EEE61529.1| hypothetical protein OsJ_15833 [Oryza sativa Japonica Group]
Length=486

 Score =   207 bits (526),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 136/175 (78%), Gaps = 9/175 (5%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEER-------RANPRKNQ  345
            LR+SF  F++GLISFPL +PGTAY++C+QGR++AM +L++ +EER       R    +  
Sbjct  200  LRKSFFDFVRGLISFPLYLPGTAYYSCMQGRRRAMVVLEQVLEERKQSTGLQRGGEAQQH  259

Query  344  TDFFDFVLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLT  165
             DF D+V++E+ ++  ++TE +ALDLMFVLLFASF TTSLALTLA+K L+DHPLVLE+LT
Sbjct  260  GDFLDYVIQEITKEKPVMTEKMALDLMFVLLFASFHTTSLALTLAVKLLADHPLVLEELT  319

Query  164  EEHEAIIKNRENPN--SGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
             EHE I+K+RE  +    +TW+EYKSM FT Q I+ETVRLANI P IFRK+L+DI
Sbjct  320  VEHETILKDREAGSELDRITWKEYKSMAFTSQVINETVRLANIAPVIFRKALKDI  374



>emb|CAE04091.3| OSJNBa0088I22.12 [Oryza sativa Japonica Group]
Length=492

 Score =   207 bits (526),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 136/175 (78%), Gaps = 9/175 (5%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEER-------RANPRKNQ  345
            LR+SF  F++GLISFPL +PGTAY++C+QGR++AM +L++ +EER       R    +  
Sbjct  206  LRKSFFDFVRGLISFPLYLPGTAYYSCMQGRRRAMVVLEQVLEERKQSTGLQRGGEAQQH  265

Query  344  TDFFDFVLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLT  165
             DF D+V++E+ ++  ++TE +ALDLMFVLLFASF TTSLALTLA+K L+DHPLVLE+LT
Sbjct  266  GDFLDYVIQEITKEKPVMTEKMALDLMFVLLFASFHTTSLALTLAVKLLADHPLVLEELT  325

Query  164  EEHEAIIKNRENPN--SGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
             EHE I+K+RE  +    +TW+EYKSM FT Q I+ETVRLANI P IFRK+L+DI
Sbjct  326  VEHETILKDREAGSELDRITWKEYKSMAFTSQVINETVRLANIAPVIFRKALKDI  380



>ref|XP_010661699.1| PREDICTED: cytochrome P450 87A3-like [Vitis vinifera]
Length=685

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRES+ AF+ GLISFPL+IPGTA+H CL+GR+ A+K++   I ER+++ +K   DF DF+
Sbjct  197  LRESYKAFLDGLISFPLNIPGTAFHACLKGRENAIKVINNVINERKSS-QKLCHDFLDFL  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEE K KDTIL E I +DL+F+LLFAS+ETTS A+TL +KFLSDHP V+ +LT+EHE I+
Sbjct  256  LEEAKSKDTILNEAIIVDLVFLLLFASYETTSEAITLVMKFLSDHPSVVVELTKEHEEIL  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNR+N   G+TW EYKSMTFT   I+ET+RL NIVPGIFR   +DI
Sbjct  316  KNRKNEELGITWTEYKSMTFTHMVINETLRLGNIVPGIFRGVTKDI  361



>gb|EMS59428.1| Cytochrome P450 87A3 [Triticum urartu]
Length=493

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 139/196 (71%), Gaps = 30/196 (15%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++FVAFI+GLISFP++IPGTAYH C++GR+ AM +LK  + ER A+  +   DF D +
Sbjct  186  LRKNFVAFIRGLISFPVNIPGTAYHECMKGRRNAMTVLKRMMRERMADEGRQPEDFLDVM  245

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+R+  +LTE +ALDLMFVLLFASFETT+LALTL I+ ++++P VLE LTEEHEAI+
Sbjct  246  IEELRREKPVLTETVALDLMFVLLFASFETTALALTLGIRLITENPKVLEALTEEHEAIV  305

Query  143  KNRENPNSGLTWQEYKSMTFTFQF-IH-----------------------------ETVR  54
            ++R++ ++GLTW EYKSMTFT Q  +H                             E  R
Sbjct  306  RDRKDLDAGLTWAEYKSMTFTSQLGLHYDSGKISSKNDSGKVDNPDRPNAIVQVTLEIAR  365

Query  53   LANIVPGIFRKSLRDI  6
            +ANIVPGIFRK+L+DI
Sbjct  366  IANIVPGIFRKALQDI  381



>ref|NP_001288455.1| cytochrome P450 87A3-like [Zea mays]
 ref|XP_008669005.1| PREDICTED: cytochrome P450 87A3-like [Zea mays]
 gb|ACG34279.1| cytochrome P450 CYP87A15 [Zea mays]
Length=495

 Score =   202 bits (515),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 136/182 (75%), Gaps = 15/182 (8%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERR-------------A  363
            LR SF  F++GLISFPL +PGTAY++C++GR+ AM++L+E + ER+              
Sbjct  203  LRRSFFDFVRGLISFPLYLPGTAYYSCMKGRQSAMEVLQEVLAERKRLVQVPGAGGGAME  262

Query  362  NPRKNQTDFFDFVLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPL  183
              R++  DF D V++E+ ++  ++T+ +ALDLMFVLLFASF TTSLALTLA+K L+DHP 
Sbjct  263  TIRRHGGDFLDLVIQEVTKEKPLVTDRMALDLMFVLLFASFHTTSLALTLAVKLLADHPR  322

Query  182  VLEKLTEEHEAII--KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            VLE+LT EHEAI+  +N  + + G+TW EYKSMTFT Q I+ETVRLANI PGIFRK+L+D
Sbjct  323  VLEELTVEHEAILNERNARHGSDGITWMEYKSMTFTSQVINETVRLANIAPGIFRKALKD  382

Query  8    IN  3
            I 
Sbjct  383  IQ  384



>ref|XP_002448363.1| hypothetical protein SORBIDRAFT_06g025830 [Sorghum bicolor]
 gb|EES12691.1| hypothetical protein SORBIDRAFT_06g025830 [Sorghum bicolor]
Length=494

 Score =   202 bits (514),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 137/180 (76%), Gaps = 14/180 (8%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPR----------  354
            LR+SF  F++GLISFPL +PGTAY++C++GR+ AM++L+E +EER+ + +          
Sbjct  203  LRKSFFDFVRGLISFPLYLPGTAYYSCMKGRQSAMEVLQEVLEERKRSVQLPGAGGGAME  262

Query  353  --KNQTDFFDFVLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLV  180
              +   DF D V++E+ ++  ++T+ +ALDLMFVLLFASF TTSLALTLA+K L+DHP V
Sbjct  263  TTRRHGDFLDLVIQEMTKEKPLVTDRMALDLMFVLLFASFHTTSLALTLAVKLLADHPRV  322

Query  179  LEKLTEEHEAIIKNRE--NPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            LE+LT EHE I+  R+  + + G+TW EYKSMTFT Q I+ETVRLANI PGIFRK+L+DI
Sbjct  323  LEELTVEHETILSGRKACHGSDGITWMEYKSMTFTSQVINETVRLANIAPGIFRKALKDI  382



>ref|XP_002510826.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF51428.1| cytochrome P450, putative [Ricinus communis]
Length=473

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR+S+ AF+ GLI FPL IP TAY  CLQGRK+AM +LK  +EERR  P++ + DF D +
Sbjct  196  LRKSYAAFLDGLICFPLYIPRTAYWKCLQGRKEAMGILKSMLEERRTAPKREKKDFLDVM  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE K+  + LTE + LDL+F+L FA FE+TS  + LA+KFL ++P  LE LT+EHEAI+
Sbjct  256  VEETKKDGSFLTEKMVLDLLFMLPFAFFESTSSTMVLAVKFLVENPEALEDLTKEHEAIL  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
             NR+  +S +TW+EY+SMTFT   I+ET RLANIVPGIFRK+++D+
Sbjct  316  SNRKTNDSEITWEEYRSMTFTHMVINETTRLANIVPGIFRKAVKDV  361



>emb|CDP19727.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR+S+ AF+ G ISFPL+IPGTA+H CLQGRKKAMK +K   E RR+     +  F D +
Sbjct  196  LRDSYKAFMDGFISFPLNIPGTAFHACLQGRKKAMKAIKNTFEMRRSCNDATKV-FVDHL  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            L+E++++DT L E IA+DL+F+LLFAS ETTS A+TLA++FL+DHP VL +L  EHE I+
Sbjct  255  LKEVEKEDTFLNEEIAMDLVFLLLFASHETTSTAMTLAMRFLNDHPAVLAELKREHENIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K RE  +SG++W+EYKSM FT   I+ETVRLANI PGIFRK ++++
Sbjct  315  KIRETEDSGVSWKEYKSMIFTHMVINETVRLANIAPGIFRKVVKEV  360



>ref|XP_009611047.1| PREDICTED: cytochrome P450 87A3-like [Nicotiana tomentosiformis]
Length=483

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 129/167 (77%), Gaps = 1/167 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEER-RANPRKNQTDFFDF  327
            LRE + AF+ G + FP+++PGTAYH  LQGRK AMK++K+ ++ER R+  ++N+ DF D 
Sbjct  195  LREQYRAFMGGFVCFPINLPGTAYHASLQGRKNAMKMIKDIVKERKRSKEKRNKQDFLDH  254

Query  326  VLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAI  147
            +L E+  K+TILTE  AL+ +F +LFA+FETTS A+ L +KFL+DHP VL +L EEHE I
Sbjct  255  LLCEVANKETILTEENALNTIFAVLFAAFETTSAAIALGLKFLNDHPQVLPQLMEEHENI  314

Query  146  IKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +KNRE+  + ++W EYKSM FT + ++E VRLANIVPGIFRK L+D+
Sbjct  315  VKNREDKEAAISWTEYKSMPFTHKVVNEIVRLANIVPGIFRKVLKDV  361



>dbj|BAJ97704.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   193 bits (491),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -3

Query  422  LQGRKKAMKLLKEKIEERRANPRKNQTDFFDFVLEELKRKDTILTEGIALDLMFVLLFAS  243
            +QGRKKAMK+LK  ++ER A+P +   DFFD V++EL+R+  +LTE IALDLMFVLLFAS
Sbjct  5    VQGRKKAMKVLKGMMKERMADPERKCEDFFDHVIQELRREKPLLTETIALDLMFVLLFAS  64

Query  242  FETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKNRENPNSGLTWQEYKSMTFTFQFIHE  63
            FETT+LALTL +K LS++P V++ LTEEHEAII NRE+P++ +TW EYKSMTFT Q I E
Sbjct  65   FETTALALTLGVKLLSENPRVVDALTEEHEAIISNREDPDAAVTWAEYKSMTFTSQVIME  124

Query  62   TVRLANIVPGIFRKSLRDI  6
             VRLANIVPGIFRK+L+D+
Sbjct  125  IVRLANIVPGIFRKTLQDV  143



>ref|XP_008671137.1| PREDICTED: cytochrome P450 87A3-like [Zea mays]
Length=682

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 136/182 (75%), Gaps = 15/182 (8%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERR-------------A  363
            LR SF  F++GLISFPL +PGTAY++C++GR+ AM++L+E + ER+              
Sbjct  390  LRRSFFDFVRGLISFPLYLPGTAYYSCMKGRQSAMEVLQEVLAERKRLVQVPGAGGGAME  449

Query  362  NPRKNQTDFFDFVLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPL  183
              R++  DF D V++E+ ++  ++T+ +ALDLMFVLLFASF TTSLALTLA+K L+DHP 
Sbjct  450  TIRRHGGDFLDLVIQEVTKEKPLVTDRMALDLMFVLLFASFHTTSLALTLAVKLLADHPR  509

Query  182  VLEKLTEEHEAII--KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            VLE+LT EHEAI+  +N  + + G+TW EYKSMTFT Q I+ETVRLANI PGIFRK+L+D
Sbjct  510  VLEELTVEHEAILNERNARHGSDGITWMEYKSMTFTSQVINETVRLANIAPGIFRKALKD  569

Query  8    IN  3
            I 
Sbjct  570  IQ  571



>emb|CAN64251.1| hypothetical protein VITISV_001277 [Vitis vinifera]
Length=374

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE++ AF+ GLISFPL+IPGT+Y  CL+GR++A K L+ ++ ER A+P +   D  DF+
Sbjct  200  LRENYSAFLSGLISFPLNIPGTSYWKCLKGRERARKTLRNRLLERLASPEREHKDIMDFI  259

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++E+K+ DTILTE IA+DL+F L F + ETTS  L LA+++L  HP  L ++T EHE+I+
Sbjct  260  IQEMKKDDTILTEEIAVDLLFGLPFGANETTSSTLILAVQYLGSHPSALAEITREHESIL  319

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NR+  +SG+TW+EYKSM+FT   ++ETVR+ +I+P IFRK  +DI
Sbjct  320  RNRKQKDSGITWEEYKSMSFTMMVVNETVRMGSILPSIFRKVDKDI  365



>ref|XP_010227227.1| PREDICTED: cytochrome P450 87A3-like [Brachypodium distachyon]
Length=462

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 132/181 (73%), Gaps = 14/181 (8%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERR----------ANPR  354
            LR+SF  F++GLISFPL +PGTAY++C+QGR  AM++L+E ++ER+              
Sbjct  170  LRKSFFDFVRGLISFPLYLPGTAYYSCMQGRMSAMEVLQEVLDERKRSVLDQVLQGGEES  229

Query  353  KNQTDFFDFVLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLE  174
            +   DF D+V++E+ ++  ++TE +ALDLMFVLLFASF TTSL LTLA+K L+DHP VLE
Sbjct  230  RRHGDFLDYVVQEITKEKPVMTERMALDLMFVLLFASFHTTSLVLTLAVKLLADHPGVLE  289

Query  173  KLTEEHEAIIKNR----ENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +L  EHE I+  R    E+ ++G+TW+EYKSMT T Q I ETVRLANI P IFRK+L+D+
Sbjct  290  ELKVEHETILNQREAGGESDSTGVTWKEYKSMTLTSQVISETVRLANIAPCIFRKALKDV  349

Query  5    N  3
             
Sbjct  350  Q  350



>ref|XP_010275621.1| PREDICTED: cytochrome P450 87A3-like [Nelumbo nucifera]
Length=479

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            ++  F  F +GLISFPL+IPGT ++ CL+ R+  +K+L+  I+ERR  P++ + DF D +
Sbjct  203  IKNKFADFWEGLISFPLNIPGTTFYKCLKARENVLKMLRNLIKERRNQPKRIKGDFLDKL  262

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE++++   LTE   + L+F+L FASFETTSL LTLAIKFL+DHP VL  LT+EHEAI+
Sbjct  263  IEEMEKEGAFLTEEAIVQLIFLLTFASFETTSLTLTLAIKFLTDHPQVLMALTDEHEAIL  322

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            ++RE  +S +TW+EYKSMTFT Q I+E +RL+N+ PGIFR++L DI 
Sbjct  323  RSRETADSAITWEEYKSMTFTSQVINEVLRLSNVAPGIFRRALTDIQ  369



>gb|EMS63415.1| Cytochrome P450 87A3 [Triticum urartu]
Length=395

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 131/186 (70%), Gaps = 19/186 (10%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQ--------GRKKAMKLLKEKIEERR------  366
            LR+SF  F++GLISFPL +PGTAY+ C+Q        GR   M++L++ +EER       
Sbjct  154  LRKSFFDFVRGLISFPLYLPGTAYYACMQVINANTKSGRMSVMEVLQQVLEERTRSAEAA  213

Query  365  -ANPRKNQTDFFDFVLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDH  189
                 +   DF D+V++E+ ++  +LTEG+ALDL+FVLLFASF TTSLA+TLA+K L+D+
Sbjct  214  GGGEARCHGDFLDYVVQEITKEKPVLTEGMALDLLFVLLFASFHTTSLAITLAVKLLTDN  273

Query  188  PLVLEKLTEEHEAIIKNR----ENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRK  21
            P VLE+LT EHE I+  R    E     LTW+EYKSMTFT Q I+ETVRLANI PGIFRK
Sbjct  274  PRVLEELTVEHETILNEREAGGETDGDRLTWKEYKSMTFTSQVINETVRLANIAPGIFRK  333

Query  20   SLRDIN  3
            +L+D+ 
Sbjct  334  TLKDVQ  339



>emb|CDP18910.1| unnamed protein product [Coffea canephora]
Length=327

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 126/168 (75%), Gaps = 2/168 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRA--NPRKNQTDFFD  330
            LR+S+ AF+ GLISFPL+IPGT +H CLQGRKKAMK++ +  E++R+  +   N  DF D
Sbjct  48   LRDSYKAFMDGLISFPLNIPGTPFHACLQGRKKAMKVIHDIFEKKRSGNDAAANDYDFAD  107

Query  329  FVLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEA  150
             +LEE+K++DT L E IA DL+F+ LFA+ ETTS ALT+A+++L  H  V+ +L  EHE 
Sbjct  108  HLLEEIKKEDTFLNEEIARDLVFLFLFAAHETTSTALTVALRYLDGHQRVMAELKREHEN  167

Query  149  IIKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            I+K RE   S ++W+EYKSMTFT   I+ETVRLANI PGI RK ++++
Sbjct  168  ILKMRETEGSAVSWKEYKSMTFTHMVINETVRLANIAPGILRKVVKEV  215



>ref|XP_010662510.1| PREDICTED: cytochrome P450 87A3-like [Vitis vinifera]
 emb|CBI31825.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE++ AF+ GLISFPL+IPGT+Y  CL+GR++A K L+ ++ ER A+P +   D  DF+
Sbjct  200  LRENYSAFLSGLISFPLNIPGTSYWKCLKGRERARKTLRNRLLERLASPEREHKDIMDFI  259

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++E+K+ DTILTE IA+DL+F L F + ETTS  L LA+++L  HP  L ++T EHE+I+
Sbjct  260  IQEMKKDDTILTEEIAVDLLFGLPFGANETTSSTLILAVQYLGSHPSALAEITREHESIL  319

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NR+  +SG+TW+EYKSM+FT   ++ETVR+ +I+P IFRK  +DI
Sbjct  320  RNRKQKDSGITWEEYKSMSFTMMVVNETVRMGSILPSIFRKVDKDI  365



>ref|XP_009803784.1| PREDICTED: cytochrome P450 87A3-like [Nicotiana sylvestris]
Length=481

 Score =   194 bits (492),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 129/167 (77%), Gaps = 2/167 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERR-ANPRKNQTDFFDF  327
            LRE + AF+ G + FP+++PGTAYH  LQGRK AMK++K+ ++ER+ +  ++ + DF D 
Sbjct  195  LREQYRAFMGGFVCFPINLPGTAYHASLQGRKNAMKMIKDIVKERKTSKEKRKKQDFLDH  254

Query  326  VLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAI  147
            +L E+  K+TILTE  AL+ +F +LFA+FETTS A+ L +KFL+DHP VL +L EEHE I
Sbjct  255  LLYEVD-KETILTEENALNTIFAVLFAAFETTSAAIALGLKFLNDHPQVLPQLMEEHENI  313

Query  146  IKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +KNRE+  + ++W EYKSMTFT + ++E VRLANIVPGIFRK L+D+
Sbjct  314  VKNREDKEAAISWAEYKSMTFTHKVVNEIVRLANIVPGIFRKVLKDV  360



>gb|EMT25093.1| Cytochrome P450 87A3 [Aegilops tauschii]
Length=428

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 131/186 (70%), Gaps = 19/186 (10%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERR-------ANPRKNQ  345
            LR+SF  F++GLISFPL +PGTAY+ C+QGR  AM++L++ +EER            +  
Sbjct  198  LRKSFFDFVRGLISFPLYLPGTAYYACMQGRMSAMEVLQQVLEERTRSAEAAGGGEARCH  257

Query  344  TDFFDFVLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLT  165
             DF D+V++E+ ++  +LTEG+ALDL+FVLLFASF TTSLA+TLA+K L+D+P VLE+L 
Sbjct  258  GDFLDYVVQEITKEKPVLTEGMALDLLFVLLFASFHTTSLAITLAVKLLTDNPRVLEELM  317

Query  164  EEHEAIIKNRENPNSG----LTWQEYKSMTFTFQF--------IHETVRLANIVPGIFRK  21
             EHE I+  RE         +TW+EYKSMTFT Q         I+ETVRLANI PGIFRK
Sbjct  318  VEHETILNQREAGGESDGDRVTWKEYKSMTFTSQMRMHHVSQVINETVRLANIAPGIFRK  377

Query  20   SLRDIN  3
            +L+D+ 
Sbjct  378  TLKDVQ  383



>emb|CDP18915.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 126/166 (76%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR+S+ AF+ GLISFPL+IPGT +H CLQGRKKAMK++ +  E++R+       DF D +
Sbjct  153  LRDSYKAFMDGLISFPLNIPGTPFHACLQGRKKAMKVIHDIFEKKRSG-NDTSKDFVDHL  211

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LE+++++DTIL E IA DL+F+ LFA+ ETTS ALT+A+++L  HP V+ +L  EHE I+
Sbjct  212  LEQIEKEDTILNEEIARDLVFLFLFAAHETTSTALTVALRYLDGHPRVMAELKREHENIL  271

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K RE   S ++W+EYKSMTFT   I+ET+RLANI PGI RK ++++
Sbjct  272  KMRETEGSAISWKEYKSMTFTHMVINETLRLANITPGILRKVVKEV  317



>ref|XP_002529163.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33222.1| cytochrome P450, putative [Ricinus communis]
Length=472

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 124/166 (75%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            +R+ +  F+ GLISFPL IPGTAY  CLQGRK+AM+++K  +EERR  P+K + DF D +
Sbjct  196  MRKYYADFLDGLISFPLYIPGTAYWKCLQGRKEAMEIIKSTLEERRTAPKKEKKDFLDVM  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEE  +  + LTE  ALD +F+L FA FE+TS  + LA++ LS++P  LE+LT+EHEAI+
Sbjct  256  LEETDKDGSFLTEKTALDFLFMLPFAFFESTSSVMVLALQLLSENPEALEELTKEHEAIL  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
             NRE  +S LTW+EY+SMTFT   I+ET RL NIVP +FRK++ D+
Sbjct  316  SNREKNDSKLTWEEYRSMTFTHLVINETTRLVNIVPRVFRKAVNDV  361



>gb|AFW68203.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=308

 Score =   187 bits (475),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 125/169 (74%), Gaps = 2/169 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQT--DFFD  330
            L   F  +  GL+SFP+ IPGT ++ C+QGRKK M +LK+++ ERR N  + +T  DFFD
Sbjct  24   LWRCFHDWTSGLLSFPVSIPGTTFYRCMQGRKKVMTMLKQQLVERRRNAAERETTEDFFD  83

Query  329  FVLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEA  150
             V++EL + D ++ E  ALDL+F +LFAS ETTS+ LT+ +K+L+D+P  L++LTEEHE 
Sbjct  84   LVIDELNKPDPMMDESTALDLLFTMLFASHETTSMVLTVILKYLTDNPKALQELTEEHER  143

Query  149  IIKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            I+++R NP S LTW+EYKSM FT   IHE++RLANI   +FRK+ +D++
Sbjct  144  ILESRANPGSDLTWEEYKSMKFTSHVIHESLRLANIALAMFRKANQDVH  192



>gb|EMT05251.1| Cytochrome P450 87A3 [Aegilops tauschii]
Length=588

 Score =   193 bits (491),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 121/167 (72%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F AF QGL+SFPL  PGT ++ C+QGRK   K+LK+ ++ER + P K   DF D V
Sbjct  340  LRKNFDAFFQGLVSFPLYFPGTTFYRCIQGRKNVQKVLKDLLKERLSAPEKRHGDFLDEV  399

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            + EL+    ++ E  A+DLM  LLFASF T S +LT+A+KFLS HP V+E L EEHEAI+
Sbjct  400  VNELQSGRGVVDEKFAVDLMAALLFASFATVSSSLTVAMKFLSGHPNVVESLKEEHEAIL  459

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K RE+  SG+TW+EYKSMTFT Q  +E  R++N+ PGIFRK+L D+ 
Sbjct  460  KKREDGRSGITWEEYKSMTFTAQVTNEIARVSNVAPGIFRKTLTDVQ  506



>emb|CDP18909.1| unnamed protein product [Coffea canephora]
Length=472

 Score =   191 bits (485),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 126/166 (76%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR+S+ AF+ GLISFPL+IPGT +H CLQGRKKAMK++ +  E++R+       DF D +
Sbjct  196  LRDSYKAFMDGLISFPLNIPGTPFHACLQGRKKAMKVIHDIFEKKRSG-NDTSKDFVDHL  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LE+++++DTIL E IA DL+F+ LFA+ ETTS ALT+A+++L  HP V+ +L  EHE I+
Sbjct  255  LEQIEKEDTILNEEIARDLVFLFLFAAHETTSTALTVALRYLDGHPRVMAELKREHENIL  314

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K RE   S ++W+EYKSMTFT   I+ET+RLANI PGI RK ++++
Sbjct  315  KMRETEGSAISWKEYKSMTFTHMVINETLRLANITPGILRKVVKEV  360



>ref|XP_002510669.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52856.1| cytochrome P450, putative [Ricinus communis]
Length=479

 Score =   191 bits (485),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            + ES   F+QGL+S PL+IPGTA+H CL+ +K+A+K++ +  EERR+NP  N+ DF D +
Sbjct  203  IGESLSNFLQGLMSIPLNIPGTAFHRCLKNQKRAIKVITKLFEERRSNPEINKGDFLDQI  262

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +E++K  D+  TE  A+ +MF L  ASFET S  L LAIKFL+D+P V+++LTEE+EAI+
Sbjct  263  VEDMK-TDSFWTEEFAIYVMFGLNLASFETISSTLALAIKFLTDNPSVVDRLTEENEAIL  321

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNREN +SGL+W+EYKSMT+T Q ++E++RLA++ PGI R+++ DI
Sbjct  322  KNRENADSGLSWKEYKSMTYTHQVVNESLRLASVAPGILRRAITDI  367



>ref|XP_003581538.1| PREDICTED: cytochrome P450 87A3-like [Brachypodium distachyon]
Length=489

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F AF QGL+SFPL  PGT ++ C+QGRK   K+LK+ ++ER   P K   DF D V
Sbjct  205  LRKNFDAFFQGLVSFPLYFPGTTFYGCIQGRKNMQKVLKDLLKERLRTPEKRHGDFLDEV  264

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            + EL+    ++ E  A+DL+  LLFASF T S +LT+A+KFLS HP V+E L EEHEAI+
Sbjct  265  VNELQSGAGMIEEKFAVDLVAALLFASFATVSSSLTVAMKFLSGHPNVVEALKEEHEAIL  324

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K RE  +SG+TW+EYKSMTFT Q  +E  R++N+ PGIFRK+L D+ 
Sbjct  325  KKREGASSGITWEEYKSMTFTAQVTNEIARVSNVAPGIFRKTLTDVQ  371



>gb|AAO23096.1| putative hydroxylase [Oryza sativa Japonica Group]
 gb|EAY91252.1| hypothetical protein OsI_12867 [Oryza sativa Indica Group]
 gb|EAZ28003.1| hypothetical protein OsJ_11970 [Oryza sativa Japonica Group]
Length=401

 Score =   186 bits (473),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 127/168 (76%), Gaps = 1/168 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERR-ANPRKNQTDFFDF  327
            + + F AFI+GL++FP+ IPGTA++ C+QGRK  MK+LKE I+ER+ A+ R+   DF D 
Sbjct  122  MWKQFDAFIRGLLAFPIGIPGTAFYKCMQGRKNIMKMLKELIDERKEASGRRGSIDFIDV  181

Query  326  VLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAI  147
            +LEEL  +  +++E +ALDL+F+LLFASFETT+ A+T  ++FL+D+P  L++L EEH+ I
Sbjct  182  LLEELNEEKPLISENVALDLIFLLLFASFETTASAITAVVRFLTDNPEALQELAEEHDNI  241

Query  146  IKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
             K R + NS +TW+EYKSM FT   IHE +RLANI P +FRK+  D++
Sbjct  242  QKRRVDLNSEITWEEYKSMKFTSHVIHEALRLANIAPVMFRKATEDVH  289



>ref|NP_001050816.1| Os03g0658800 [Oryza sativa Japonica Group]
 gb|ABF97993.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12730.1| Os03g0658800 [Oryza sativa Japonica Group]
 dbj|BAG89430.1| unnamed protein product [Oryza sativa Japonica Group]
Length=495

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 127/168 (76%), Gaps = 1/168 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERR-ANPRKNQTDFFDF  327
            + + F AFI+GL++FP+ IPGTA++ C+QGRK  MK+LKE I+ER+ A+ R+   DF D 
Sbjct  216  MWKQFDAFIRGLLAFPIGIPGTAFYKCMQGRKNIMKMLKELIDERKEASGRRGSIDFIDV  275

Query  326  VLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAI  147
            +LEEL  +  +++E +ALDL+F+LLFASFETT+ A+T  ++FL+D+P  L++L EEH+ I
Sbjct  276  LLEELNEEKPLISENVALDLIFLLLFASFETTASAITAVVRFLTDNPEALQELAEEHDNI  335

Query  146  IKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
             K R + NS +TW+EYKSM FT   IHE +RLANI P +FRK+  D++
Sbjct  336  QKRRVDLNSEITWEEYKSMKFTSHVIHEALRLANIAPVMFRKATEDVH  383



>ref|XP_009344797.1| PREDICTED: cytochrome P450 87A3-like [Pyrus x bretschneideri]
Length=476

 Score =   186 bits (472),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 121/166 (73%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E +    QGLISFPL++PGTAYHNCL+  KKA  +L+  + ERR++P K + DF D +
Sbjct  200  LGEIYHRVFQGLISFPLNVPGTAYHNCLKIHKKATTMLRAMLRERRSSPEKRRGDFLDQI  259

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +++L  ++  L+E   + L+F  LFA FE+ S  LTL    L+DHP VL++LT EHEA++
Sbjct  260  IDDLD-QEKFLSEDFCIHLIFGGLFAIFESISTVLTLFFSLLADHPAVLQELTAEHEALL  318

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNRE+PNS LTW EYKSMTFT Q I+ET+RLAN  PG+ R++L+DI
Sbjct  319  KNREDPNSALTWDEYKSMTFTLQVINETLRLANTAPGLLRRALKDI  364



>ref|XP_002272031.1| PREDICTED: cytochrome P450 87A3 [Vitis vinifera]
Length=476

 Score =   186 bits (472),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = -3

Query  497  ESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFVLE  318
            E F   I  L+SFPL+IPGT +H CL+ +K+ MKL+ + ++E++A+P+  Q DF D +++
Sbjct  202  EKFTNIIHVLMSFPLNIPGTTFHKCLKDQKEIMKLIHDALKEKKASPKTLQGDFLDQMID  261

Query  317  ELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKN  138
            ++K K+  L++   + +MF +LFASFET S  LTLAIK L +HPLV+++L EEHEAI+KN
Sbjct  262  DMK-KEKFLSDDFVVFVMFGILFASFETISSTLTLAIKLLIEHPLVMQQLIEEHEAILKN  320

Query  137  RENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            RE+PNSG++W+EYKSMTFT Q I+E +RL ++ PGI R++++DI 
Sbjct  321  REDPNSGISWKEYKSMTFTHQVINEVLRLGSVAPGILRRAIKDIQ  365



>ref|XP_002465524.1| hypothetical protein SORBIDRAFT_01g040500 [Sorghum bicolor]
 gb|EER92522.1| hypothetical protein SORBIDRAFT_01g040500 [Sorghum bicolor]
Length=481

 Score =   186 bits (472),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 121/167 (72%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR+++ +F QGLI+FPL +PGT ++ C+QGRKK   +LKE ++ER + P K   D  D V
Sbjct  203  LRKNYESFFQGLIAFPLYVPGTTFYRCMQGRKKVQSVLKELLKERLSAPEKRHGDLLDIV  262

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +++L+ +  + T+  A+D +  LLFASF T +  L++A+KFL+D+P V+E LTEEHE I+
Sbjct  263  VDDLQSEKPVATDKFAIDAIAALLFASFATIASTLSVAMKFLTDNPKVVEALTEEHETIL  322

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K RE  NS +TW EYKSMTFT Q ++E  R+ N+ PGIFRKSL+D+ 
Sbjct  323  KKREGVNSSITWDEYKSMTFTAQVMNEITRVGNVAPGIFRKSLKDVQ  369



>ref|XP_009776354.1| PREDICTED: cytochrome P450 87A3-like isoform X1 [Nicotiana sylvestris]
Length=483

 Score =   186 bits (471),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE + AF  G +SFPL++PGTAYH CLQGRK  +K++K+ +++++++  K   DF D +
Sbjct  196  LREHYKAFFGGFLSFPLNVPGTAYHACLQGRKNIVKVIKDILKKKQSSKEKANQDFLDHM  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            L+E++ ++++LTE I +DL+ +LLFA++ETTS ++TL  K+L+ HP VL +LTEEHE+I+
Sbjct  256  LKEVENEESLLTEEITVDLVLLLLFAAYETTSSSITLLFKYLNSHPEVLTELTEEHESIL  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K R +  + ++W EYKSM+FT   I+ETVRLANI PGIFR +L+D+
Sbjct  316  KRRTDEGALISWLEYKSMSFTNMVINETVRLANIAPGIFRITLKDV  361



>gb|EMT22412.1| Cytochrome P450 87A3 [Aegilops tauschii]
Length=476

 Score =   185 bits (470),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 120/168 (71%), Gaps = 1/168 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++   F QG++SFPL  PGTA++ C+QGRK   K+LK+ ++ER + P+K   DF D V
Sbjct  206  LRKNLDVFFQGMVSFPLYFPGTAFYKCIQGRKNVQKVLKDLLKERLSAPQKRHGDFLDEV  265

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL+    +L E  A+DL+  LLFASF T S +LT+A+KFLSD P V+E L EEHEAI+
Sbjct  266  VDELQSGPGMLNEKFAIDLVGALLFASFATVSSSLTVAMKFLSDQPSVVEALKEEHEAIL  325

Query  143  KNRENPN-SGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K R   N S +TW+EYKSM FT Q  +E VRL+N+ PGIFRK+L D+ 
Sbjct  326  KKRAGANTSAITWEEYKSMAFTAQVTNEIVRLSNVAPGIFRKTLTDVQ  373



>ref|XP_008356324.1| PREDICTED: cytochrome P450 87A3-like [Malus domestica]
Length=373

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 119/166 (72%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E +    QG +SFPL++PGTAYHNC +  +K   +L+  I ERR +P K + DF D V
Sbjct  200  LGEXYHRVTQGFMSFPLNVPGTAYHNCJKVHEKLTTMLRNMIRERRKSPEKXRGDFLDQV  259

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            + ++  ++  L+E   + ++F  LFA+F+  S  LTL    L+DHP+VL++LT EHEA++
Sbjct  260  IXDID-QEKFLSEDFCVHMIFGGLFATFDAISTVLTLFFSLLADHPVVLQELTAEHEALL  318

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNRENPNS LTW EYKSMTFT Q I+ET+RL+N +PG+FR++L+DI
Sbjct  319  KNRENPNSALTWDEYKSMTFTLQVINETLRLSNAIPGLFRRALKDI  364



>ref|XP_002269701.3| PREDICTED: cytochrome P450 87A3-like [Vitis vinifera]
Length=374

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 123/167 (74%), Gaps = 7/167 (4%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQ-GRKKAMKLLKEKIEERRANPRKNQTDFFDF  327
            LRES+ AF+ G+ISFPL+IPGTA+H CL+ G + A+K++ E     R   +K   DF DF
Sbjct  180  LRESYKAFLDGIISFPLNIPGTAFHACLKVGCENAVKVINE-----RKPSKKPCHDFLDF  234

Query  326  VLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAI  147
            +LEE K +DTIL E I +DL FVLLFAS+ETTS  +TLA+KFLSDHP ++ +L +EHE I
Sbjct  235  LLEEAKNEDTILNEAIIVDL-FVLLFASYETTSEVITLAMKFLSDHPSIVVELMKEHERI  293

Query  146  IKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +KNR N   G+TW EYKSMT T   I+ET+RL NIV GIF++  +DI
Sbjct  294  LKNRGNEELGITWTEYKSMTSTHMVINETLRLGNIVSGIFKQVTKDI  340



>emb|CBI40704.3| unnamed protein product [Vitis vinifera]
Length=583

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = -3

Query  497  ESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFVLE  318
            E F   I  L+SFPL+IPGT +H CL+ +K+ MKL+ + ++E++A+P+  Q DF D +++
Sbjct  309  EKFTNIIHVLMSFPLNIPGTTFHKCLKDQKEIMKLIHDALKEKKASPKTLQGDFLDQMID  368

Query  317  ELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKN  138
            ++K K+  L++   + +MF +LFASFET S  LTLAIK L +HPLV+++L EEHEAI+KN
Sbjct  369  DMK-KEKFLSDDFVVFVMFGILFASFETISSTLTLAIKLLIEHPLVMQQLIEEHEAILKN  427

Query  137  RENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            RE+PNSG++W+EYKSMTFT Q I+E +RL ++ PGI R++++DI 
Sbjct  428  REDPNSGISWKEYKSMTFTHQVINEVLRLGSVAPGILRRAIKDIQ  472



>ref|XP_009344155.1| PREDICTED: cytochrome P450 87A3-like [Pyrus x bretschneideri]
 ref|XP_009344166.1| PREDICTED: cytochrome P450 87A3-like [Pyrus x bretschneideri]
Length=476

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 120/166 (72%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E +    QGLISFPL++PGTAYHNCL+  KKA  +L+  + ERR++P K + DF D +
Sbjct  200  LGEIYHRVFQGLISFPLNVPGTAYHNCLKIHKKATTMLRAMLRERRSSPEKRRGDFLDQI  259

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +++L  ++  L+E   + L+F  LFA FE+ S  LTL    L+DHP VL++LT EHEA++
Sbjct  260  IDDLD-QEKFLSEDFCIHLIFGGLFAIFESISTVLTLFFSLLADHPAVLQELTAEHEALL  318

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNRE+PNS LTW EYKSMTFT Q I+ET+RL N  PG+ R++L+DI
Sbjct  319  KNREDPNSALTWDEYKSMTFTLQVINETLRLVNTAPGLLRRALKDI  364



>ref|NP_001140790.1| uncharacterized protein LOC100272865 [Zea mays]
 gb|ACF84628.1| unknown [Zea mays]
Length=489

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 125/169 (74%), Gaps = 2/169 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQT--DFFD  330
            L   F  +  GL+SFP+ IPGT ++ C+QGRKK M +LK+++ ERR N  + +T  DFFD
Sbjct  205  LWRCFHDWTSGLLSFPVSIPGTTFYRCMQGRKKVMTMLKQQLVERRRNAAERETTEDFFD  264

Query  329  FVLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEA  150
             V++EL + D ++ E  ALDL+F +LFAS ETTS+ LT+ +K+L+D+P  L++LTEEHE 
Sbjct  265  LVIDELNKPDPMMDESTALDLLFTMLFASHETTSMVLTVILKYLTDNPKALQELTEEHER  324

Query  149  IIKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            I+++R +P S LTW+EY+SM FT   IHE++RLANI   +FRK+ +D++
Sbjct  325  ILESRADPGSDLTWEEYRSMKFTSHVIHESLRLANIALAMFRKANQDVH  373



>ref|XP_010092748.1| Cytochrome P450 87A3 [Morus notabilis]
 gb|EXB52093.1| Cytochrome P450 87A3 [Morus notabilis]
Length=407

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 124/166 (75%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L+E++ AF++G++S PL+IPGT YH CLQ R    K +K+  EER+A+  K   DF   +
Sbjct  131  LKENYNAFVRGIVSIPLNIPGTGYHACLQARDNIRKAIKDIFEERKASKMK-HGDFLYCL  189

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEE++++D I++E +A D++F +LF ++ET+ LA+T+ +KFLS HP V+ +L +EHEAII
Sbjct  190  LEEMRKEDNIMSEALARDIIFGILFGTYETSRLAMTMLVKFLSQHPEVVAELKKEHEAII  249

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            ++R    S +TW EYKSMTFT   I+ET+RL NI+PGIFRK ++D+
Sbjct  250  ESRGFEKSEITWDEYKSMTFTHMVINETIRLGNILPGIFRKVVKDV  295



>ref|XP_008346328.1| PREDICTED: cytochrome P450 87A3-like [Malus domestica]
Length=474

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 120/166 (72%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E +    QG +SFPL++PGTAYHNC++  +K   +L+  I ERR +P K + DF D V
Sbjct  197  LGEGYHRVTQGFMSFPLNVPGTAYHNCIKVHEKLTTMLRNMIRERRKSPEKRRGDFLDQV  256

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            + ++  ++  L+E   + ++F  LFA+F+  S  LTL    L+DHP+VL++LT EHEA++
Sbjct  257  ITDID-QEKFLSEDFCVHMIFGGLFATFDAISTVLTLFFSLLADHPVVLQELTAEHEALL  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNRENPNS LTW EYKSMTFT Q I+ET+RL+N +PG+FR++L+DI
Sbjct  316  KNRENPNSALTWDEYKSMTFTLQVINETLRLSNAIPGLFRRALKDI  361



>gb|EMS52130.1| Cytochrome P450 87A3 [Triticum urartu]
Length=481

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 117/166 (70%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F AF QG++SFPL  PGT ++ C+QGRKK   +LK+ ++ER + P+    DF D V
Sbjct  203  LRKNFDAFFQGMVSFPLYFPGTTFYGCIQGRKKLQNVLKDLLKERLSTPQMRHGDFLDEV  262

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL+     + E  A+D +  LLF +F T S AL + +K LSDHP V+E L EEHEAI+
Sbjct  263  VDELRSGTGTMNEKFAVDFVAALLFGTFATISSALAVGMKLLSDHPNVVESLKEEHEAIL  322

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K RE+  +G+TW EYKSMTFT Q  +E VR++N+ PGIFRK+L D+
Sbjct  323  KKREDGRTGITWDEYKSMTFTAQVTNEIVRISNVSPGIFRKALTDV  368



>gb|KDO40279.1| hypothetical protein CISIN_1g012100mg [Citrus sinensis]
Length=471

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 133/167 (80%), Gaps = 2/167 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE F  F+ GL+SFPL+IPGTA+H CLQGRK+A K++++  +ER+A+ +    DF D +
Sbjct  196  LREYFKDFMDGLLSFPLNIPGTAFHACLQGRKEATKVIEDIYQERKAS-KIYCDDFMDHL  254

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            + E++++D+ + E  A++L+F+LLFA +ET+S A+TL +K++ D+P VL +LT+EHE I+
Sbjct  255  VAEVEKEDSFMDETNAINLVFLLLFAVYETSSQAITLLVKYIFDNPDVLAELTKEHEGIL  314

Query  143  KNRENPN-SGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            ++R+N N S +TW+EYKSMTF+   I+ETVRLANIVPG+FRK+ +D+
Sbjct  315  RSRKNGNKSEVTWEEYKSMTFSHMVINETVRLANIVPGVFRKASKDV  361



>ref|XP_008364406.1| PREDICTED: cytochrome P450 87A3-like [Malus domestica]
Length=477

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 117/166 (70%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E +    QG +SFPL++PGTAYHNC +  +K   +L+  I ERR +P K + DF D V
Sbjct  200  LGEXYHRVTQGFMSFPLNVPGTAYHNCJKVHEKLTTMLRNMIRERRKSPEKXRGDFLDQV  259

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            + ++  ++  L+E   + ++F  LFA+F T S  LTL    L+DHP VL++LT EHEA++
Sbjct  260  IXDID-QEKFLSEDFCVHMIFGGLFATFGTISTVLTLLFSLLADHPAVLQELTAEHEALL  318

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNRENPNS LTW EYKSMTFT Q I+ET+RL+N +PG+FR +L+DI
Sbjct  319  KNRENPNSALTWDEYKSMTFTLQVINETLRLSNXIPGLFRXALKDI  364



>ref|XP_010237177.1| PREDICTED: cytochrome P450 87A3-like, partial [Brachypodium distachyon]
Length=415

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L + F AF+QGL++FPL IPGTA++ C+QGRK+ MK+L + ++ER+   R+ + DF D +
Sbjct  137  LWKHFDAFLQGLLAFPLYIPGTAFYKCMQGRKEVMKILNKLLDERKKAARQERVDFIDLL  196

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++ L  +   ++E  AL+L+F+LLFA FETTS  +T A+KFL+D+P VL++LT+EH+ I 
Sbjct  197  IDVLTEEKPAMSENFALNLIFLLLFAGFETTSSGITAAVKFLTDNPKVLQELTDEHDNIR  256

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K R +P+S +TW+EYKSM FT   IHE++RLANI P +F+++  D++
Sbjct  257  KRRASPDSEITWEEYKSMKFTSYVIHESLRLANIAPVLFKRAREDVH  303



>emb|CDP18913.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   180 bits (456),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 122/166 (73%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR+S+ AF+ GLISFPL+IPGT +H CLQGRKKAMK++ +  E++R+       DF D +
Sbjct  153  LRDSYKAFMDGLISFPLNIPGTPFHACLQGRKKAMKVIHDIFEKKRSG-NDTSKDFVDHL  211

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LE+++++DTIL E IA DL+F+ +  +   TS ALT+A+++L  HP V+ +L  EHE I+
Sbjct  212  LEQIEKEDTILNEEIARDLVFLFVLCNSSHTSTALTVALRYLDGHPRVMAELKREHENIL  271

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            + RE   S ++W+EYKSMTFT   I+ET+RLANI PGI RK ++++
Sbjct  272  QMRETEGSAISWKEYKSMTFTHMVINETLRLANITPGILRKVVKEV  317



>gb|EMT08723.1| Cytochrome P450 87A3 [Aegilops tauschii]
Length=433

 Score =   179 bits (455),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 126/168 (75%), Gaps = 1/168 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANP-RKNQTDFFDF  327
            L + F AFI+GL++FPL IPGTA++ C+QGRK+ MK+L++  +ER+  P R+ + DF D 
Sbjct  201  LWKQFDAFIRGLLAFPLYIPGTAFYQCMQGRKEVMKILRKLFDERKKAPSRREKVDFIDL  260

Query  326  VLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAI  147
            +++ +K     +++  AL+L+F+LLFA FETTS  +T AIKFL+D+P  L++LT+EHE I
Sbjct  261  LIDTIKEDKLAMSDNFALNLIFLLLFAGFETTSSGITAAIKFLTDNPKALQELTDEHENI  320

Query  146  IKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
             K R +P++ +TW+EYKSM FT   IHE++RLANI P +F+KS  D++
Sbjct  321  RKRRASPDAEITWEEYKSMNFTSCVIHESLRLANIAPLLFKKSKEDVH  368



>ref|XP_008644631.1| PREDICTED: cytochrome P450 87A3-like [Zea mays]
 gb|AFW68082.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=482

 Score =   180 bits (457),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L + F A+ +GL+SFPL +PGTA++ C+QGRK  MK+LK++++ERR    +   DFFD V
Sbjct  205  LWKCFDAWTKGLLSFPLCVPGTAFYKCMQGRKNVMKILKQQLDERRNTAERRTVDFFDLV  264

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL + D I+ E IALDL+F+LLFAS ETTS+ LT  +KFL+D+P  L++LTEEHE I+
Sbjct  265  IDELNKPDPIMNENIALDLLFLLLFASHETTSMGLTAILKFLTDNPKALQELTEEHEKIV  324

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            + R +P+S +TW+EYKSM FT   IHE++RLANI P +FR++ +D+
Sbjct  325  ETRVDPDSDITWEEYKSMRFTSHVIHESLRLANIAPVVFRQANQDV  370



>ref|XP_002514563.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF47669.1| cytochrome P450, putative [Ricinus communis]
Length=475

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L +SF  F++GL+ FPL++PGT+++ C + +K+ +KL+ +++ +RR +P+K + D  D +
Sbjct  199  LAQSFTNFLEGLMKFPLNVPGTSFYKCKKNQKRILKLIADELGKRRESPKKQKEDMLDQI  258

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +E++K K+T  T+  A+ +MF +L ASFET S  L + I FL+D+P +++KLTEEHE ++
Sbjct  259  VEDMK-KETFWTDDFAIYVMFGILLASFETISSTLAVCINFLTDNPSMVQKLTEEHEELV  317

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNREN NSGL+W+EYKSMT+T   + E++RLA++ PGI R++L+DI
Sbjct  318  KNRENKNSGLSWEEYKSMTYTHHVVKESLRLASVAPGILRRALKDI  363



>ref|XP_004290050.1| PREDICTED: cytochrome P450 87A3-like [Fragaria vesca subsp. vesca]
Length=482

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 118/167 (71%), Gaps = 1/167 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E +   I GL+SFPL+IPGTAY+NC + +KK   + ++ ++ER  +P     DF D +
Sbjct  200  LSEKYTKIIDGLMSFPLNIPGTAYYNCTKHQKKVTTMFRDMLKERHDSPETQHGDFLDQI  259

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
              ++  K+  L+E  ++ L+F  LFA+FE+ S  L LA   LSD+P VL++LT EHEAI+
Sbjct  260  ANDMD-KEKFLSEDFSVQLVFGGLFATFESISAVLALAFSLLSDNPSVLQELTAEHEAIV  318

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            KNRE+PNS LTW EYKSMTFT Q I+ET+RL N+ PG+ R+SL+DI+
Sbjct  319  KNREDPNSPLTWDEYKSMTFTLQVINETLRLGNVAPGLLRRSLKDIS  365



>gb|AAL73972.1|AF466201_1 putative cytochrome P450-like protein [Sorghum bicolor]
Length=481

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 132/167 (79%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L + F A+ +GL+SFP+ +PGTA++ C+QGRK  MK+LK++++ERR    +   DFFD V
Sbjct  204  LWKCFDAWTKGLMSFPICVPGTAFYRCMQGRKNVMKVLKQQLDERRNGAERKTVDFFDLV  263

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL + ++I++E IAL+L+F+LLFAS ETTS+ LT+ +KFL+D+P  L++LTEEHE I+
Sbjct  264  IDELDKPNSIMSESIALNLLFLLLFASHETTSMGLTVILKFLTDNPKSLQELTEEHEKIM  323

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            + R +P+S +TW+EYKSM FT   IHE++RLANI P +FR++ +D++
Sbjct  324  ERRVDPDSDITWEEYKSMKFTSHVIHESLRLANIAPVVFRQANQDVH  370



>ref|XP_010111721.1| Cytochrome P450 87A3 [Morus notabilis]
 gb|EXC31560.1| Cytochrome P450 87A3 [Morus notabilis]
Length=475

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 120/166 (72%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E++   IQG +SFPL+IPGTAY+ C++ +KK + +L++ ++ERRA+P  N+ DF D +
Sbjct  200  LSETYTRIIQGFMSFPLNIPGTAYNQCVKDQKKIIAMLRDMLKERRASPETNRGDFLDQI  259

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
             +++  K+  L+E   + L+F  LFA+FE+ S  L L    LS+HP VLE++  EHE I+
Sbjct  260  SKDMD-KEKFLSEDFVVQLIFGGLFATFESVSAVLALGFMLLSEHPSVLEEMIAEHETIL  318

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNRE+PNS L W EYKSMTFT Q I+ET+RL N+ PG+ RK+L+DI
Sbjct  319  KNREHPNSLLAWGEYKSMTFTLQVINETLRLGNVAPGLLRKALKDI  364



>ref|XP_009616055.1| PREDICTED: cytochrome P450 87A3-like isoform X1 [Nicotiana tomentosiformis]
Length=483

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE + AF  G +SFPL++PGTAYH CLQGRK  +K++++ +++R+++  K   DF D +
Sbjct  196  LREHYKAFFGGFLSFPLNVPGTAYHACLQGRKNIVKVIRDILKKRQSSKEKANQDFLDHM  255

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            L+E++ ++++LTE I +DL+ +LLFA++ETTS ++TL  K+L+ HP VL +LTEEHE+I+
Sbjct  256  LKEVENEESLLTEEIIVDLVLLLLFAAYETTSSSITLLFKYLNSHPEVLTELTEEHESIL  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K+R +  + ++W EYKSM+FT   I+ETVRLANI PGIFR +L+D+
Sbjct  316  KSRTDEGALISWLEYKSMSFTNMVINETVRLANIAPGIFRITLKDV  361



>ref|XP_006650369.1| PREDICTED: cytochrome P450 87A3-like [Oryza brachyantha]
Length=495

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 125/169 (74%), Gaps = 2/169 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERR-ANPRKNQT-DFFD  330
            + + + AFI+GL++FPL IPGTA++ C+QGRK  MK+LKE +++R+ A  R+    DF D
Sbjct  215  MWKQYDAFIRGLLAFPLCIPGTAFYKCMQGRKIVMKMLKELLDKRKKATGRQGSNIDFID  274

Query  329  FVLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEA  150
             ++EELK +   ++E  AL+L+F+LLFASFETT+ A+T  +  L+D+P  L++LTEEHE 
Sbjct  275  VMIEELKEEKPTISEKAALNLIFLLLFASFETTASAITAVLTLLTDNPEALQELTEEHEN  334

Query  149  IIKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            I K R +PNS +TW+EYKSM FT   IHE +RLANI P +FRK+  D++
Sbjct  335  IQKRRGDPNSEITWEEYKSMKFTSHVIHEALRLANIAPMVFRKATEDVH  383



>ref|XP_002272143.2| PREDICTED: cytochrome P450 87A3 [Vitis vinifera]
 emb|CBI40705.3| unnamed protein product [Vitis vinifera]
Length=476

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 124/164 (76%), Gaps = 1/164 (1%)
 Frame = -3

Query  497  ESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFVLE  318
            E F   +Q L SFPL+IPGT++H CL+ +K+A +L+++ + ER+      + D  D +++
Sbjct  201  EKFANILQALFSFPLNIPGTSFHECLKNQKEAKRLIRDLLIERKVTLESCKGDLLDKLVD  260

Query  317  ELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKN  138
            + K K+  L++   +  +F +L ASFET S A TLA+KFL++HPL +++L EEHEAI+KN
Sbjct  261  DAK-KEKFLSDDYIVIFVFGILLASFETISTATTLALKFLTEHPLAMQELIEEHEAILKN  319

Query  137  RENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +ENPNSG++W+EYKSMTFT Q I+ET+RLANIVPGI R++++DI
Sbjct  320  KENPNSGISWKEYKSMTFTHQVINETLRLANIVPGILRRAIKDI  363



>ref|XP_002464218.1| hypothetical protein SORBIDRAFT_01g014340 [Sorghum bicolor]
 gb|EER91216.1| hypothetical protein SORBIDRAFT_01g014340 [Sorghum bicolor]
Length=482

 Score =   177 bits (450),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E F  +  GL+SFP+ IPGT ++ C+QGRK  MK+LK+++ ERR    +   DFFD V
Sbjct  205  LWECFHDWTSGLLSFPVPIPGTTFYKCMQGRKNVMKMLKQQLGERRNAAERETVDFFDLV  264

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL + + ++ E  ALDL+F++LF S ETTS+ LT+ +K+L+D+   L++LTEEHE I+
Sbjct  265  IDELNKPNPMMDESTALDLLFMMLFGSHETTSMVLTVILKYLTDNRKALQELTEEHERIL  324

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            + R +P+S +TW+EYKSM FT   IHE++RLANI   +FRK+ +D++
Sbjct  325  ERRVDPDSDITWEEYKSMKFTSHVIHESLRLANIALVMFRKADQDVH  371



>ref|XP_002284844.1| PREDICTED: cytochrome P450 87A3-like [Vitis vinifera]
Length=476

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 124/164 (76%), Gaps = 1/164 (1%)
 Frame = -3

Query  497  ESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFVLE  318
            E F   IQ + SFPL+IPGT +H CL+ +K+ +KL+++ ++ER+ +P   + DF D +++
Sbjct  202  ERFTNIIQAVASFPLNIPGTTFHKCLKNQKEVIKLIRDILKERKVSPESRKGDFLDQIVD  261

Query  317  ELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKN  138
            ++K K+  L++   + +MF +L ASFET S  LTLA+K L ++P V+++L EEHEAI+KN
Sbjct  262  DIK-KEKFLSDDFIVLVMFGILLASFETISATLTLAVKLLIENPSVMQELIEEHEAILKN  320

Query  137  RENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            REN NSG++W+EYKSMTFT Q I+E +RLA++ PGI R++++DI
Sbjct  321  RENSNSGISWKEYKSMTFTHQVINEALRLASVAPGILRRAIKDI  364



>ref|XP_002299955.2| hypothetical protein POPTR_0001s27750g [Populus trichocarpa]
 gb|EEE84760.2| hypothetical protein POPTR_0001s27750g [Populus trichocarpa]
Length=474

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 120/165 (73%), Gaps = 1/165 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E++   +   IS PL+IPGT++H C+Q R+K +KLLK+ + ER  +P K + DF D  
Sbjct  199  LSENYTKILNSFISLPLNIPGTSFHKCMQDREKMLKLLKDTLMERLNDPSKRRGDFLDQA  258

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++++K  +  LTE     LMF +LFASFE+ S  LTL  KFL+++P V+E+L  EHEAI+
Sbjct  259  IDDMK-TEKFLTEDFIPQLMFGILFASFESMSTTLTLTFKFLTENPRVVEELRAEHEAIV  317

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            K RENPNS LTW+EY+SMTFT   ++ET+R++NI PG+FRK+L+D
Sbjct  318  KKRENPNSRLTWEEYRSMTFTQMVVNETLRISNIPPGLFRKALKD  362



>ref|XP_006442982.1| hypothetical protein CICLE_v10019989mg [Citrus clementina]
 ref|XP_006478738.1| PREDICTED: cytochrome P450 87A3-like [Citrus sinensis]
 gb|ESR56222.1| hypothetical protein CICLE_v10019989mg [Citrus clementina]
Length=475

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 123/166 (74%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR+++ AF  G++SFP+  PG A+++C++GRK   K++++  +ER+A       DF D V
Sbjct  198  LRQNYRAFKLGIVSFPMYFPGFAFYDCIKGRKHIRKVIEDIYQERKATKVPGH-DFLDRV  256

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEE+++++ +L +  A+DL+FVLLFA+FET S ++TL  K L+DHP VL +LTEEHE II
Sbjct  257  LEEVEKENAVLNDSNAIDLLFVLLFAAFETVSQSITLITKHLTDHPQVLAELTEEHEGII  316

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
              RE+ NS +TW+EYKSMTFT   I+E VRLANI+P  FRK L+D+
Sbjct  317  SRREDENSEVTWEEYKSMTFTHMVINEIVRLANIIPVTFRKVLKDM  362



>ref|XP_004974765.1| PREDICTED: cytochrome P450 87A3-like [Setaria italica]
Length=437

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 117/167 (70%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F  F +G++SFP+  PGT Y+ C++GR+   ++L + ++ER + P K   D  D +
Sbjct  160  LRKNFEDFFRGMLSFPIYFPGTLYYKCMKGRRNVHRILSDILKERLSTPGKKHGDIVDLL  219

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+ +  ++ E  A+D +  +LF SF T S ALT+  KFL+D+P V+E L EEHE I+
Sbjct  220  VEELRSEKPLIDENFAIDALAAILFGSFVTASAALTIGFKFLTDNPKVVETLKEEHEIIL  279

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K RE+ NSG TW+EYKS+TFT Q ++E  R+ NI PGIFRK+L+D+ 
Sbjct  280  KKREDKNSGFTWEEYKSLTFTTQVMNEITRMGNIAPGIFRKTLKDVQ  326



>ref|XP_008235946.1| PREDICTED: cytochrome P450 87A3-like [Prunus mume]
Length=476

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 119/166 (72%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E +   I GL+SFPL+IPGTAY+NC + +K    +L++ ++ERR +P   + DF D +
Sbjct  200  LSEKYTKIIDGLMSFPLNIPGTAYYNCSKHQKNVTTMLRDMLKERRISPETRRGDFLDQI  259

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
              +++ K+  L+E  ++ L+F  LFA+FE+ S  + LA   L++HP V+E+LT EHEAI+
Sbjct  260  SIDME-KEKFLSEDFSVQLVFGGLFATFESISAIIALAFSLLAEHPSVVEELTAEHEAIL  318

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNRENPNS LTW EYKSMTFT Q I+E +RL N+ PG+ R++L+DI
Sbjct  319  KNRENPNSSLTWDEYKSMTFTLQVINEILRLGNVAPGLLRRALKDI  364



>ref|XP_004974764.1| PREDICTED: cytochrome P450 87A3-like [Setaria italica]
Length=437

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 117/167 (70%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F  F +G++SFP+  PGT Y+ C++GR+   ++L + ++ER + P K   D  D +
Sbjct  160  LRKNFEDFFRGMLSFPIYFPGTLYYKCMKGRRNVHRILSDILKERLSTPGKKHGDLVDLL  219

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+ +  ++ E  A+D +  +LF SF T S ALT+  KFL+D+P V+E L EEHE I+
Sbjct  220  VEELRSEKPLIDENFAIDALAAILFGSFVTASAALTIGFKFLTDNPKVVETLKEEHEIIL  279

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K RE+ NSG TW+EYKS+TFT Q ++E  R+ NI PGIFRK+L+D+ 
Sbjct  280  KKREDKNSGFTWEEYKSLTFTTQVMNEITRMGNIAPGIFRKTLKDVQ  326



>ref|XP_002464219.1| hypothetical protein SORBIDRAFT_01g014350 [Sorghum bicolor]
 gb|EER91217.1| hypothetical protein SORBIDRAFT_01g014350 [Sorghum bicolor]
Length=481

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E F  +  GL+SFP+ IPGT ++ C+QGRK  MK+LK+++ ERR    +   DFFD V
Sbjct  204  LWECFHDWTSGLLSFPVPIPGTTFYRCMQGRKNVMKVLKQQLGERRNAAERETVDFFDLV  263

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL + + ++ +  ALDL+F +LFAS ETTS+ LT+ +K+L+D+P  L++LTEEHE I+
Sbjct  264  IDELNKPNPMMDKSTALDLLFAMLFASHETTSMVLTVILKYLTDNPKALQELTEEHERIL  323

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            + R + +S +TW+EYKSM FT   IHE++RLANI   +FRK+ +D++
Sbjct  324  ERRVDRDSDITWEEYKSMKFTSHVIHESLRLANIALVMFRKADQDVH  370



>ref|XP_007041637.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOX97468.1| Cytochrome P450, putative [Theobroma cacao]
Length=474

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 120/167 (72%), Gaps = 2/167 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANP-RKNQTDFFDF  327
            LR+ F++  +GL+SFP++IPGT Y+ CL+  K A+ +L   ++ RRA+P R  + D  D 
Sbjct  197  LRDMFISLARGLMSFPINIPGTTYNKCLKYHKAALDILSVLVKARRASPDRMLKGDVLDH  256

Query  326  VLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAI  147
            VLE++K  +  LTE     LMF L F SF++ S A TL IK L D+PLVLE+LT EH+AI
Sbjct  257  VLEDMK-SEKFLTEDFIAQLMFGLSFVSFDSISWAATLLIKLLGDNPLVLEELTAEHDAI  315

Query  146  IKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +K RENPNS +TW+EYKSMTFT Q I+ET+RL +I PG+ R++ +DI
Sbjct  316  LKKRENPNSSITWEEYKSMTFTLQVINETLRLGSISPGLLRRARKDI  362



>ref|XP_011093255.1| PREDICTED: cytochrome P450 87A3-like [Sesamum indicum]
Length=473

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 123/167 (74%), Gaps = 3/167 (2%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LRE++  F   LISFPL++PGTA+H  +QGR++A+K+++  ++ RR++      DF D +
Sbjct  196  LRENYKNFKDALISFPLNVPGTAFHEAMQGRERAIKMIRSALDARRSS--NGNHDFLDQI  253

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            + E++ +DTILT  +A D++F+LLFASFETTS  + LA+ FL  HP VL+ L EEHE I+
Sbjct  254  MREVEDEDTILTREVATDVLFLLLFASFETTSTTIALALHFLHRHPNVLQHLKEEHEKIL  313

Query  143  KNRENPNS-GLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
              R+N  + G+TW EYKSMTFT   I+ETVRLA+ VPG+FRK ++++
Sbjct  314  SGRDNKETRGITWTEYKSMTFTHMVINETVRLADNVPGMFRKVMQEV  360



>ref|XP_002489065.1| hypothetical protein SORBIDRAFT_0183s002030 [Sorghum bicolor]
 gb|EES20356.1| hypothetical protein SORBIDRAFT_0183s002030 [Sorghum bicolor]
Length=365

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L + F A+ +GL+SFPL +PGTA++  ++GR+  MK+LK +++ERR+  ++   DFFD V
Sbjct  88   LCKCFDAWTKGLLSFPLCVPGTAFYKSMRGRQNVMKILKRQLDERRSAAKRKTVDFFDLV  147

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL + + I+ E +ALDL+ +LLFAS ETTS+ LT  IKFL+D+P  L++LT+EHE I+
Sbjct  148  IDELNKPNPIMNENVALDLLLLLLFASHETTSIGLTAIIKFLTDNPKALQELTDEHEKIV  207

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            + R +P+S +TW+EYKSM FT   IHE++R+ANI P +FR++  D++
Sbjct  208  ERRVDPDSDITWEEYKSMKFTSHVIHESLRMANIAPVVFRQANHDVH  254



>ref|XP_006369643.1| hypothetical protein POPTR_0001s27720g [Populus trichocarpa]
 gb|ERP66212.1| hypothetical protein POPTR_0001s27720g [Populus trichocarpa]
Length=474

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 120/165 (73%), Gaps = 1/165 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E++   +   IS PL+IPGT++H C+Q R+K +K+LK+ + ER  +P K + DF D  
Sbjct  199  LSENYTKILNSFISLPLNIPGTSFHKCMQDREKMLKMLKDTLMERLNDPSKRRGDFLDQA  258

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++++K  +  LTE     LMF +LFASFE+ S  LTL  KFL+++P V+E+L  EHEAI+
Sbjct  259  IDDMK-TEKFLTEDFIPQLMFGILFASFESMSTTLTLTFKFLTENPRVVEELRAEHEAIV  317

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            K RENPNS LTW+EY+SMTFT   ++ET+R++NI PG+FRK+L+D
Sbjct  318  KKRENPNSRLTWEEYRSMTFTQMVVNETLRISNIPPGLFRKALKD  362



>emb|CBI18863.3| unnamed protein product [Vitis vinifera]
Length=512

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 124/164 (76%), Gaps = 1/164 (1%)
 Frame = -3

Query  497  ESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFVLE  318
            E F   IQ + SFPL+IPGT +H CL+ +K+ +KL+++ ++ER+ +P   + DF D +++
Sbjct  238  ERFTNIIQAVASFPLNIPGTTFHKCLKNQKEVIKLIRDILKERKVSPESRKGDFLDQIVD  297

Query  317  ELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKN  138
            ++K K+  L++   + +MF +L ASFET S  LTLA+K L ++P V+++L EEHEAI+KN
Sbjct  298  DIK-KEKFLSDDFIVLVMFGILLASFETISATLTLAVKLLIENPSVMQELIEEHEAILKN  356

Query  137  RENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            REN NSG++W+EYKSMTFT Q I+E +RLA++ PGI R++++DI
Sbjct  357  RENSNSGISWKEYKSMTFTHQVINEALRLASVAPGILRRAIKDI  400



>ref|XP_006369644.1| hypothetical protein POPTR_0001s27730g [Populus trichocarpa]
 gb|ERP66213.1| hypothetical protein POPTR_0001s27730g [Populus trichocarpa]
Length=474

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 120/165 (73%), Gaps = 1/165 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E++   +   IS PL+IPGT++H C+Q R+K +K+LK+ + ER  +P K + DF D  
Sbjct  199  LSENYTKILNSFISLPLNIPGTSFHKCMQDREKMLKMLKDTLMERLNDPSKRRGDFLDQA  258

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++++K  +  LTE     LMF +LFASFE+ S  LTL  KFL+++P V+E+L  EHEAI+
Sbjct  259  IDDMK-TEKFLTEDFIPQLMFGILFASFESMSTTLTLTFKFLTENPRVVEELRAEHEAIV  317

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            K RENPNS LTW+EY+SMTFT   ++ET+R++NI PG+FRK+L+D
Sbjct  318  KKRENPNSRLTWEEYRSMTFTQMVVNETLRISNIPPGLFRKALKD  362



>ref|NP_001176087.1| Os10g0337100 [Oryza sativa Japonica Group]
 dbj|BAH94815.1| Os10g0337100 [Oryza sativa Japonica Group]
Length=266

 Score =   170 bits (431),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 115/164 (70%), Gaps = 1/164 (1%)
 Frame = -3

Query  491  FVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRA-NPRKNQTDFFDFVLEE  315
            + AF QGLI+ PL IPGTA++ C+QGRK  MK+LKE + ER+    R    DF D ++EE
Sbjct  69   YDAFAQGLITLPLCIPGTAFYKCMQGRKNVMKMLKEILNERKKIEGRHESIDFLDVLIEE  128

Query  314  LKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKNR  135
            +K  +  +TE  AL+L+F LLF SF+TTS  +T  +KFL+D+P  L +LTEEH  I + R
Sbjct  129  VKEDNPSMTENTALNLLFSLLFGSFDTTSSGITGMLKFLTDNPEALRELTEEHNNIRRRR  188

Query  134  ENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
             + NS +TW+EYKSM FT   IHE +RLA+I P +FR+++ D++
Sbjct  189  ADLNSEITWEEYKSMKFTSHVIHEALRLASITPMMFREAIEDVH  232



>ref|XP_003572191.2| PREDICTED: cytochrome P450 87A3-like isoform X1 [Brachypodium 
distachyon]
Length=478

 Score =   175 bits (444),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L + F AF++GL++FPL IPGTA++ C+QGRK  M++L+E +EER+  PR+  TDF D +
Sbjct  200  LWKQFDAFLRGLLAFPLYIPGTAFYKCMQGRKNVMRVLRELLEERKKAPRRESTDFIDLL  259

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +E+LK ++ ++ E +ALDL+F+LLFA FETTS  +T A++FL+D P  L++LTEEH+ I 
Sbjct  260  IEDLKEEEHLMNERVALDLLFLLLFAGFETTSSGITAALRFLTDDPKALQELTEEHDNIR  319

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K R +P+S +TW+EYKSM FT   IHE +RL NI P +FRK+  D++
Sbjct  320  KRRADPDSEITWEEYKSMKFTSHVIHEALRLGNIAPVMFRKAKEDVH  366



>emb|CBI40703.3| unnamed protein product [Vitis vinifera]
Length=439

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 125/164 (76%), Gaps = 1/164 (1%)
 Frame = -3

Query  497  ESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFVLE  318
            E F   +  LI+FPL+IPGT +H CL+ +K+AMKL+++ ++E++A+ +  + DF D +++
Sbjct  165  EKFTNIVHALIAFPLNIPGTTFHKCLKDQKEAMKLIRDVLKEKKASSKTLEGDFLDQMVD  224

Query  317  ELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKN  138
            ++K  +  L++   + ++F  L ASFET S  LTLAIK L +HPLV+++L EEHEAI+KN
Sbjct  225  DMKN-EKFLSDDFVVFVVFGFLLASFETISSTLTLAIKLLIEHPLVMQELIEEHEAILKN  283

Query  137  RENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            RE+PNSG++W+EYKSMTFT Q I+E +RL ++ PGI R++++DI
Sbjct  284  REDPNSGISWKEYKSMTFTHQVINEALRLGSVAPGILRRAIKDI  327



>ref|XP_011025046.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
 ref|XP_011025047.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=474

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E++   +   IS PL+IPGT++H C+Q R+K +K+LK+ + ER  +P K + DF D  
Sbjct  199  LSENYTKILNSFISLPLNIPGTSFHKCMQDREKMLKMLKDTLMERLNDPSKRRGDFLDQA  258

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++++K  +  LT      LMF +LFASFE+ S  LTL  KFL+++P V+E+L  EHEAI+
Sbjct  259  IDDMK-TEKFLTVDFIPQLMFGILFASFESMSTTLTLTFKFLTENPRVVEELRAEHEAIL  317

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
              RENPNSGLTW+EY+SMTFT   ++ET+R++NI PG+FRK+L+D
Sbjct  318  NKRENPNSGLTWEEYRSMTFTQMVVNETLRISNIPPGLFRKALKD  362



>ref|NP_001175197.1| Os07g0482975 [Oryza sativa Japonica Group]
 dbj|BAH93925.1| Os07g0482975 [Oryza sativa Japonica Group]
Length=319

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 115/167 (69%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F  F QG++SFP+  PGT+++ C+QGRK     L + ++ER + P K   D  D +
Sbjct  43   LRKNFQEFFQGMVSFPIYFPGTSFYRCMQGRKNVRNTLTDVMKERLSAPEKKYGDLVDLI  102

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+ +  ++ E  A+D +  LLF SF T S  LT+A+KFL+D+P ++E+L EEH+ I+
Sbjct  103  VEELQSEKPVIDENFAIDALAALLFTSFATLSSTLTVALKFLNDNPKIVEELKEEHDVIL  162

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K RE  NSG TW+EYKS+ FT Q  +E  R++N+ PG+FRK+L D+ 
Sbjct  163  KKREVMNSGFTWEEYKSLKFTTQVTNEITRISNVAPGVFRKTLTDVQ  209



>gb|EAY78080.1| hypothetical protein OsI_33124 [Oryza sativa Indica Group]
Length=224

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 114/164 (70%), Gaps = 1/164 (1%)
 Frame = -3

Query  491  FVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRA-NPRKNQTDFFDFVLEE  315
            + AF QGLI+ PL IPGTA++ C+QGRK  MK+LKE + ER+    R    DF D ++EE
Sbjct  27   YDAFAQGLITLPLCIPGTAFYKCMQGRKNVMKMLKEMLNERKKIEGRHESIDFLDVLIEE  86

Query  314  LKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKNR  135
            +K  +  +TE  AL+L+F LLF SF+TTS  +T  +KFL+D+P  L +LTEE   I + R
Sbjct  87   VKEDNPSMTENTALNLLFSLLFGSFDTTSSGITGMLKFLTDNPEALRELTEERNNIRRKR  146

Query  134  ENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
             + NS +TW+EYKSM FT   IHE +RLA+I P +FR+++ D++
Sbjct  147  ADLNSEITWEEYKSMKFTSHVIHEALRLASITPMMFREAIEDVH  190



>ref|XP_002313286.1| hypothetical protein POPTR_0009s06920g [Populus trichocarpa]
 gb|EEE87241.1| hypothetical protein POPTR_0009s06920g [Populus trichocarpa]
Length=474

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E++   +   IS PL+IPGT++H C+Q R+K +K+LK  + ER  +P K + DF D  
Sbjct  199  LSENYTRILNSFISLPLNIPGTSFHQCMQDREKMLKMLKNTLMERLNDPSKRRGDFLDQA  258

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +++++  +  LT      LMF +LFASFE+ S  LTL  KFLS++P V+E+L  EH+AI+
Sbjct  259  IDDME-TEKFLTVDFIPQLMFGILFASFESMSTTLTLTFKFLSENPRVVEELAAEHDAIV  317

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            KNRENPNS LTW+EY+SMTFT   ++ET+R++NI PG+FRK+L+D
Sbjct  318  KNRENPNSRLTWEEYRSMTFTQMVVNETLRISNIPPGLFRKALKD  362



>ref|XP_011025041.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
 ref|XP_011025043.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=474

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E++   +   IS PL+IPGT++H C+Q R+K +KLLK+ + ER  +P K + DF D  
Sbjct  199  LSENYTKILNSFISLPLNIPGTSFHKCMQDREKMLKLLKDTLMERLNDPSKRRGDFLDQA  258

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++++K  +  LT      LMF +LFASFE+ S  LTL  KFL+++P V+E+L  EHEAI+
Sbjct  259  IDDMK-TEKFLTVDFIPQLMFGILFASFESMSTTLTLTFKFLTENPRVVEELRAEHEAIV  317

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            K RENPNS LTW+EY+SMTFT   ++ET+R++NI PG+FRK+L+D
Sbjct  318  KKRENPNSRLTWEEYRSMTFTQMVVNETLRISNIPPGLFRKALKD  362



>ref|XP_007199625.1| hypothetical protein PRUPE_ppa016466mg [Prunus persica]
 gb|EMJ00824.1| hypothetical protein PRUPE_ppa016466mg [Prunus persica]
Length=492

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 119/166 (72%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E +   I GL+SFPL+IPGTAY+NCL+ +K    +L++ ++ER+ +P   + DF D +
Sbjct  200  LSEKYTKIIDGLMSFPLNIPGTAYYNCLKHQKNVTTMLRDMLKERQISPETRRGDFLDQI  259

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
              +++ K+  L+E  ++ L+F  LFA+FE+ S  L LA   L++HP V+E+LT EHEAI+
Sbjct  260  SIDME-KEKFLSEDFSVQLVFGGLFATFESISAVLALAFSLLAEHPSVVEELTAEHEAIL  318

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNREN NS LTW EYKSMTFT Q I+E +RL N+ PG+ R++L+DI
Sbjct  319  KNRENLNSSLTWDEYKSMTFTLQVINEILRLGNVAPGLLRRALKDI  364



>ref|XP_011025045.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=473

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L +++   +   IS PL+IPGT++H C+Q R+K +KLLK+ + ER  +P K + DF D  
Sbjct  198  LSQNYTKILNSFISLPLNIPGTSFHKCMQEREKMLKLLKDTLMERLNDPSKRRGDFLDQA  257

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++++K K   LT      LMF +LFASFE+ S  LTL  KFL+++P V+E+L  EHEAI+
Sbjct  258  IDDMKTKK-FLTVDFIPQLMFGILFASFESMSTTLTLTFKFLTENPRVVEELRAEHEAIV  316

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            K RENPNS LTW+EY+SMTFT   ++ET+R++NI PG+FRK+L+D
Sbjct  317  KKRENPNSRLTWEEYRSMTFTQMVVNETLRISNIPPGLFRKALKD  361



>ref|XP_002271954.1| PREDICTED: cytochrome P450 87A3 [Vitis vinifera]
Length=476

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 125/164 (76%), Gaps = 1/164 (1%)
 Frame = -3

Query  497  ESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFVLE  318
            E F   +  LI+FPL+IPGT +H CL+ +K+AMKL+++ ++E++A+ +  + DF D +++
Sbjct  202  EKFTNIVHALIAFPLNIPGTTFHKCLKDQKEAMKLIRDVLKEKKASSKTLEGDFLDQMVD  261

Query  317  ELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKN  138
            ++K  +  L++   + ++F  L ASFET S  LTLAIK L +HPLV+++L EEHEAI+KN
Sbjct  262  DMKN-EKFLSDDFVVFVVFGFLLASFETISSTLTLAIKLLIEHPLVMQELIEEHEAILKN  320

Query  137  RENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            RE+PNSG++W+EYKSMTFT Q I+E +RL ++ PGI R++++DI
Sbjct  321  REDPNSGISWKEYKSMTFTHQVINEALRLGSVAPGILRRAIKDI  364



>gb|EEC82033.1| hypothetical protein OsI_26005 [Oryza sativa Indica Group]
Length=390

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 115/166 (69%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F  F QG++SFP+  PGT+++ C+QGRK     L + ++ER + P K   D  D +
Sbjct  197  LRKNFQEFFQGMVSFPIYFPGTSFYRCMQGRKNVRNTLTDVMKERLSAPEKKYGDLVDLI  256

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+ +  ++ E  A+D +  LLF SF T S  LT+A+KFL+D+P ++E+L EEH+ I+
Sbjct  257  VEELQSEKPVIDENFAIDALAALLFTSFATLSSTLTVALKFLNDNPKIVEELKEEHDVIL  316

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K RE  NSG TW+EYKS+ FT Q  +E  R++N+ PG+FRK+L D+
Sbjct  317  KKREVMNSGFTWEEYKSLKFTTQVTNEITRISNVAPGVFRKTLTDV  362



>ref|XP_006369642.1| hypothetical protein POPTR_0001s27700g [Populus trichocarpa]
 gb|ERP66211.1| hypothetical protein POPTR_0001s27700g [Populus trichocarpa]
Length=474

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 118/165 (72%), Gaps = 1/165 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L +++   +   IS PL+IPGT++H C+Q R+K +KLLK+ + ER   P K + DF D  
Sbjct  199  LSKNYTKILNSFISLPLNIPGTSFHKCMQEREKMLKLLKDTLMERLNGPSKRRGDFLDQA  258

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++++K K   LT      LMF +LFASFE+ S  LTL  KFL+++P V+E+L  EHEAI+
Sbjct  259  IDDMKTKK-FLTVDFIPQLMFGILFASFESMSTTLTLTFKFLTENPRVVEELRAEHEAIV  317

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            K RENPNS LTW+EY+SMTFT   ++ET+R++NI PG+FRK+L+D
Sbjct  318  KKRENPNSRLTWEEYRSMTFTQMVVNETLRISNIPPGLFRKALKD  362



>ref|XP_008235945.1| PREDICTED: cytochrome P450 87A3-like [Prunus mume]
Length=478

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 114/166 (69%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E +   I GL+SFPL+IPGTAY+NC + +K    +L++ ++ERR +P   Q   F   
Sbjct  200  LSEKYTKIIDGLMSFPLNIPGTAYYNCSKHQKNVTTMLRDMLKERRISPETTQRGDFLHQ  259

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +     K+ +L+E  ++ L+F   FA+FE+ S  L LA   L++HP V+E+LT EHEAI+
Sbjct  260  INIDMEKEKVLSEDFSVQLVFGGFFATFESISAVLALAFSLLAEHPSVVEELTAEHEAIL  319

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNRENPNS LTW EYKSMTFT Q I+E +RL N+ PG+ R++L+DI
Sbjct  320  KNRENPNSSLTWDEYKSMTFTLQVINEILRLGNVAPGLLRRALKDI  365



>ref|XP_002299954.1| hypothetical protein POPTR_0001s27710g [Populus trichocarpa]
 gb|EEE84759.1| hypothetical protein POPTR_0001s27710g [Populus trichocarpa]
Length=473

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 118/165 (72%), Gaps = 1/165 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E++   +   IS PL+IPGT++H C+Q R+K +K+LK+ + ER  +P K + DF D  
Sbjct  198  LSENYTKILNSFISLPLNIPGTSFHKCMQDREKMLKMLKDTLMERLNDPSKRRGDFLDQA  257

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++++K  +  LT       MF +LFASFE+ S  LTL  KFL+++P V+E+L  EHEAI+
Sbjct  258  IDDMK-TEKFLTVDFIPQQMFGILFASFESMSTTLTLTFKFLTENPRVVEELRAEHEAIV  316

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            K RENPNSGLTW EY++MTFT   ++ET+R++NI PG+FRK+L+D
Sbjct  317  KKRENPNSGLTWDEYRAMTFTQMVVNETLRISNIPPGLFRKALKD  361



>ref|XP_011046283.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=476

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 119/167 (71%), Gaps = 2/167 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQT-DFFDF  327
            + E F   I   +S PL+IPGT YH CL+ +   + +L+  ++ER  +P +++  DF D 
Sbjct  199  ISEKFTKVIDAFMSLPLNIPGTTYHKCLKDKDSTLSILRNTLKERMNSPAESRGGDFLDQ  258

Query  326  VLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAI  147
            ++ ++  K+  LTE   ++L+F +LFASFE+ S ALTL++K + DHP VLE+LT EHEAI
Sbjct  259  IIADMD-KEKFLTEDFTVNLIFGILFASFESISAALTLSLKLIGDHPSVLEELTVEHEAI  317

Query  146  IKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +KNRENP+S LTW EY SMTF+ Q I+ET+RL N+ PG+ R++L+D+
Sbjct  318  LKNRENPDSPLTWAEYNSMTFSLQVINETLRLGNVAPGLLRRALQDM  364



>ref|XP_006651656.1| PREDICTED: cytochrome P450 87A3-like [Oryza brachyantha]
Length=504

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 114/163 (70%), Gaps = 3/163 (2%)
 Frame = -3

Query  482  FIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQT---DFFDFVLEEL  312
            F   LI+FPL IPGTA+H C+QGRK  MK+LKE  +ERR    +      DF D +LEEL
Sbjct  230  FFGNLITFPLCIPGTAFHKCMQGRKNVMKMLKELFDERRGKTARRPAESIDFIDVLLEEL  289

Query  311  KRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKNRE  132
            K++   L+E  AL+L+F+LLFASFET + A T  + FL+D+P  L++LTEEH+ I K R 
Sbjct  290  KQEKPALSESTALELIFLLLFASFETIASATTAVLTFLTDNPEALQELTEEHDYIQKRRA  349

Query  131  NPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            + +S +TW+EYKSM FT   IHE +RLAN+ PG+FR +  D++
Sbjct  350  DRSSKITWEEYKSMKFTSHVIHEALRLANVAPGMFRTATEDVH  392



>ref|XP_003631906.1| PREDICTED: cytochrome P450 87A3-like [Vitis vinifera]
Length=485

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 119/166 (72%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            + ++F+ F++GL+S PL+IPGT +H CL+ +KK MK+L+E +EER A+P +   D  D+ 
Sbjct  198  MSDAFINFLKGLVSIPLNIPGTTFHKCLKNQKKVMKMLREIVEERCASPERRHGDVLDYF  257

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEE+K K T +T+   + +MF LLFA+FE+     TL  K + +HPLV ++L +EHEAI+
Sbjct  258  LEEMKSK-TFITKDFIVYIMFGLLFATFESIPTMFTLVFKLIMEHPLVWQELKDEHEAIL  316

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +N +  NS +TW++YKSMTFTF  I+E +R+ NI  G FR+++ D+
Sbjct  317  RNSQTSNSTITWEDYKSMTFTFDVINEALRMGNISLGSFRRAVEDV  362



>gb|EAZ39816.1| hypothetical protein OsJ_24256 [Oryza sativa Japonica Group]
Length=404

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 115/167 (69%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F  F QG++SFP+  PGT+++ C+QGRK     L + ++ER + P K   D  D +
Sbjct  141  LRKNFQEFFQGMVSFPIYFPGTSFYRCMQGRKNVRNTLTDVMKERLSAPEKKYGDLVDLI  200

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+ +  ++ E  A+D +  LLF SF T S  LT+A+KFL+D+P ++E+L EEH+ I+
Sbjct  201  VEELQSEKPVIDENFAIDALAALLFTSFATLSSTLTVALKFLNDNPKIVEELKEEHDVIL  260

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K RE  NSG TW+EYKS+ FT Q  +E  R++N+ PG+FRK+L D+ 
Sbjct  261  KKREVMNSGFTWEEYKSLKFTTQVTNEITRISNVAPGVFRKTLTDVQ  307



>emb|CBI38410.3| unnamed protein product [Vitis vinifera]
Length=496

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 119/166 (72%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            + ++F+ F++GL+S PL+IPGT +H CL+ +KK MK+L+E +EER A+P +   D  D+ 
Sbjct  209  MSDAFINFLKGLVSIPLNIPGTTFHKCLKNQKKVMKMLREIVEERCASPERRHGDVLDYF  268

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LEE+K K T +T+   + +MF LLFA+FE+     TL  K + +HPLV ++L +EHEAI+
Sbjct  269  LEEMKSK-TFITKDFIVYIMFGLLFATFESIPTMFTLVFKLIMEHPLVWQELKDEHEAIL  327

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +N +  NS +TW++YKSMTFTF  I+E +R+ NI  G FR+++ D+
Sbjct  328  RNSQTSNSTITWEDYKSMTFTFDVINEALRMGNISLGSFRRAVEDV  373



>dbj|BAC57807.1| putative cytochrome P450 [Oryza sativa Japonica Group]
Length=414

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 115/166 (69%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F  F QG++SFP+  PGT+++ C+QGRK     L + ++ER + P K   D  D +
Sbjct  152  LRKNFQEFFQGMVSFPIYFPGTSFYRCMQGRKNVRNTLTDVMKERLSAPEKKYGDLVDLI  211

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+ +  ++ E  A+D +  LLF SF T S  LT+A+KFL+D+P ++E+L EEH+ I+
Sbjct  212  VEELQSEKPVIDENFAIDALAALLFTSFATLSSTLTVALKFLNDNPKIVEELKEEHDVIL  271

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K RE  NSG TW+EYKS+ FT Q  +E  R++N+ PG+FRK+L D+
Sbjct  272  KKREVMNSGFTWEEYKSLKFTTQVTNEITRISNVAPGVFRKTLTDV  317



>emb|CDP16077.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 113/164 (69%), Gaps = 1/164 (1%)
 Frame = -3

Query  497  ESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFVLE  318
            E F   ++GL+S PL+IPGTA+H+C++ +KK    +K K+ E+RA  R ++ DF D  ++
Sbjct  165  EKFNKILEGLMSLPLNIPGTAFHDCMKSKKKITGFIKSKLNEKRAGLRTSKEDFLDQAID  224

Query  317  ELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKN  138
            ++   +  L E   + +MF LLFASFE+ S  LTLA+  LS HP  LE LT EHE I++N
Sbjct  225  DMA-TEKFLGEDFIVQVMFGLLFASFESNSSTLTLALLKLSQHPSALEMLTSEHETILRN  283

Query  137  RENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            R+   S  TW EYKSMTFT Q IHET+RLAN+ PG+ RK+L+DI
Sbjct  284  RKRVKSSPTWDEYKSMTFTLQVIHETLRLANVSPGLLRKALKDI  327



>gb|EMT26562.1| Cytochrome P450 87A3 [Aegilops tauschii]
Length=480

 Score =   170 bits (430),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 123/167 (74%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L + F AF+QGL++FPL +PGTA++ C+QGRK  MK+L+E + ER+    +   DF D +
Sbjct  202  LWKQFDAFLQGLLAFPLYVPGTAFYKCMQGRKNVMKILQEMLNERKKETHRESVDFIDLL  261

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            + ++K K+TI+ E IALDL+F+LLFA FETTS  +T A+KFL+D P  L++L EEH  I 
Sbjct  262  INDMKEKNTIMNEKIALDLLFLLLFAGFETTSSGITAALKFLADDPKALQELIEEHNNIR  321

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K R +P+S +TW+EYKSM FT   IHE +RLANI P +FRK++ +++
Sbjct  322  KRRIDPDSEITWEEYKSMKFTSHVIHEALRLANIAPLMFRKAIEEVH  368



>gb|KDP43049.1| hypothetical protein JCGZ_25235 [Jatropha curcas]
Length=466

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 122/167 (73%), Gaps = 2/167 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E+F +FIQGL SFPL+IPGTA+H C+Q +KK +K +++ IEERRA P   + DF   +
Sbjct  186  LSETFASFIQGLFSFPLNIPGTAFHKCMQNQKKILKTIRKTIEERRACPGTRREDFLGRL  245

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EE+K ++ +L + +   ++F LL A+ ET    LTLAIK L++HPLV+++L +E+E II
Sbjct  246  IEEMKAEN-LLNDDLVSFVIFALLLATSETVPSTLTLAIKLLTEHPLVMQELVKENEEII  304

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
             NREN  +GLTW+EYKSMTFT   I+E +R++  V GI R+++ DI+
Sbjct  305  CNRENKETGLTWKEYKSMTFTMHVINEALRMSGSV-GILRRTIEDID  350



>ref|XP_011025042.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=476

 Score =   169 bits (429),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 116/165 (70%), Gaps = 1/165 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E++       +S PL IPGT +H C+Q  KK MK+LK+ + ER  +P K + DF D  
Sbjct  200  LSENYTRLADSFLSLPLKIPGTIFHKCMQDHKKMMKILKDTLIERLNDPSKRRGDFLDQA  259

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +++L+ K   LT      L+F +LFAS+E+ S  LTLAIKFLS++P V+EKLT EH+ I+
Sbjct  260  IDDLETKK-FLTVDFIPQLIFGILFASYESISSTLTLAIKFLSENPQVVEKLTAEHQTIL  318

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            KNRENPNS L W+EY+SMTFT   ++ET+R++N+ PGI R++L+D
Sbjct  319  KNRENPNSSLAWEEYRSMTFTQMVVNETLRISNLPPGIIRRALKD  363



>ref|XP_002299957.1| hypothetical protein POPTR_0001s27770g [Populus trichocarpa]
 gb|EEE84762.1| hypothetical protein POPTR_0001s27770g [Populus trichocarpa]
Length=479

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -3

Query  497  ESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFVLE  318
            E+   FI+ L+SFPL+IPGT +H C++ ++K   +++  I+ER  +P K   DF D  L 
Sbjct  205  ENLPNFIKSLMSFPLNIPGTTFHKCMKDKEKMSNMVRHIIKERFNSPDKRPGDFLDQALN  264

Query  317  ELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKN  138
            ++   +  LTE    +L F +LFA+FE+ S  LTLAIKFL+++PLVLE+LT E+EA++K 
Sbjct  265  DMA-SEKFLTEDFIAELSFGILFAAFESVSTTLTLAIKFLAENPLVLEELTAENEAVLKQ  323

Query  137  RENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            RENP+S LTW+EYK+M FT   ++ET+RL NI PG+ RK+L+DIN
Sbjct  324  RENPDSQLTWEEYKTMAFTQSVVNETLRLMNIPPGLLRKALKDIN  368



>ref|XP_011101634.1| PREDICTED: cytochrome P450 87A3-like [Sesamum indicum]
Length=483

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 115/166 (69%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            + + F   ++GL+SFP+++PGTA+H CLQ  KK  ++++E + +R A   +   D  D +
Sbjct  207  ISDMFNDLVEGLMSFPINLPGTAHHKCLQIHKKVREMMREVVRKRVAESERRHGDLLDHI  266

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +E+ K  ++ L E   + LMF LLF + ++ S  L LA KFL++HPLVLE+LT EHE I+
Sbjct  267  IED-KNTESFLNEDFIVQLMFGLLFVTSDSISTTLALAFKFLAEHPLVLEELTAEHETIL  325

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNR + +S LTW EYKSMTFT Q I+E +RL NI PG FR++L+DI
Sbjct  326  KNRADSDSTLTWNEYKSMTFTLQVINEVLRLGNIAPGFFRRALKDI  371



>ref|XP_002265422.2| PREDICTED: cytochrome P450 87A3-like [Vitis vinifera]
Length=492

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 120/166 (72%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            + ++F+ F+  L S PL+IPGT +H CL+ +KK MK+L+E ++ER A+P   + DF D+ 
Sbjct  199  MGDAFIDFLDSLASVPLNIPGTTFHKCLKNQKKTMKILREIVDERCASPEIRRGDFLDYF  258

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LE +K++  I  + IA  +MF LLFASFE+  + L+LA+K + +HPLVL++L  EHEAI+
Sbjct  259  LEGMKKEAFITKDFIAF-VMFGLLFASFESIPIMLSLALKLIMEHPLVLQELKNEHEAIL  317

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +N++  N  LTW++YKSMTFT   I ET+R+AN+  G FRK+L DI
Sbjct  318  RNKDTSNFTLTWEDYKSMTFTLHVIDETLRMANVGLGNFRKALEDI  363



>ref|XP_011007350.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=474

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 117/165 (71%), Gaps = 1/165 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E++   +   IS PL+IPGT++H C+Q R+K +K+LK  + ER  +P K + DF D  
Sbjct  199  LSENYTRILNSFISLPLNIPGTSFHQCMQDREKMLKMLKNTLMERLNDPSKRRGDFLDQT  258

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +++++  +  LT      LMF +LFASFE+ S  LTL  KFLS++P V+E+L  EH+AI+
Sbjct  259  IDDME-TEKFLTVDFIPQLMFGILFASFESMSTTLTLTFKFLSENPRVVEELAAEHDAIV  317

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            K RENP S LTW+EY+SMTFT   ++ET+R++NI PG+FRK+L+D
Sbjct  318  KKRENPTSRLTWEEYRSMTFTQMVVNETLRISNIPPGLFRKALKD  362



>emb|CBI38409.3| unnamed protein product [Vitis vinifera]
Length=504

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 120/166 (72%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            + ++F+ F+  L S PL+IPGT +H CL+ +KK MK+L+E ++ER A+P   + DF D+ 
Sbjct  211  MGDAFIDFLDSLASVPLNIPGTTFHKCLKNQKKTMKILREIVDERCASPEIRRGDFLDYF  270

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            LE +K++  I  + IA  +MF LLFASFE+  + L+LA+K + +HPLVL++L  EHEAI+
Sbjct  271  LEGMKKEAFITKDFIAF-VMFGLLFASFESIPIMLSLALKLIMEHPLVLQELKNEHEAIL  329

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +N++  N  LTW++YKSMTFT   I ET+R+AN+  G FRK+L DI
Sbjct  330  RNKDTSNFTLTWEDYKSMTFTLHVIDETLRMANVGLGNFRKALEDI  375



>ref|XP_002299956.1| hypothetical protein POPTR_0001s27760g [Populus trichocarpa]
 gb|EEE84761.1| hypothetical protein POPTR_0001s27760g [Populus trichocarpa]
Length=476

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 116/165 (70%), Gaps = 1/165 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E++       +S PL IPGT +H C+Q  KK MK+LK+ + ER  +P K + DF D  
Sbjct  200  LSENYTRLADSFLSLPLKIPGTIFHKCMQDHKKMMKILKDTLIERLNDPSKRRGDFLDQA  259

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +++L+ K   LT      L+F +LFAS+E+ S  LTLAIKFLS++P V+EKLT EHE I+
Sbjct  260  IDDLETKK-FLTVDFIPQLIFGILFASYESISSTLTLAIKFLSENPQVVEKLTAEHETIL  318

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRD  9
            KNRENPNS L W+EY+S+T+T   ++ET+R++N+ PGI R++L+D
Sbjct  319  KNRENPNSSLAWEEYRSLTYTQMVVNETLRISNLPPGIIRRALKD  363



>ref|XP_004292300.1| PREDICTED: cytochrome P450 87A3-like [Fragaria vesca subsp. vesca]
Length=476

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 118/166 (71%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L + +   I+GL+SFP++ PGTAY+ CL+  K+ + +LK+ ++ERR +P   + DF D +
Sbjct  200  LSQKYTRVIEGLMSFPINFPGTAYYKCLKEHKEVVTMLKDMLKERRVSPETRRGDFLDHL  259

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            + +++ K+  +T+  A+ L+F  LFA++E+ S  L L +  L+ HPLVL++LT EHE I+
Sbjct  260  IVDME-KEEFMTDDFAVQLVFGGLFANYESVSPVLALCLSLLAKHPLVLQQLTAEHETIL  318

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
             NR N +S LTW EYKSMTFT Q ++ET+RLAN+ PG+ R+ L+DI
Sbjct  319  NNRTNLDSPLTWDEYKSMTFTLQVVNETLRLANVAPGLLRRVLKDI  364



>ref|XP_004955876.1| PREDICTED: cytochrome P450 87A3-like isoform X1 [Setaria italica]
Length=477

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L +++ AF+QGLISFPL +PGT ++ C+QGRK   K++ + + +R   P     DF D +
Sbjct  192  LTKNYSAFLQGLISFPLYVPGTTFYRCMQGRKNMQKIMSDLLSKRLTRPDVKHGDFLDLI  251

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+     + E  A D +  LLF SF T +  L LA KFL ++P VL+ L EEHEAI+
Sbjct  252  VEELQSGKPTIDEKFATDALVALLFTSFVTLAPILILAFKFLGNNPKVLKALKEEHEAIV  311

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NR + NSG TW+EYKS+TFT   ++E  R++N  PG+FRK++ D+
Sbjct  312  RNRGDANSGFTWEEYKSLTFTTMVVNELTRMSNATPGVFRKTVTDV  357



>gb|EMT08489.1| Cytochrome P450 87A3 [Aegilops tauschii]
Length=498

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L + F AF+QGL++FPL IPGTA++ C+QGRK  MK+LKE + ER+        DF D +
Sbjct  249  LWKQFDAFLQGLLAFPLYIPGTAFYKCMQGRKNVMKILKELLNERKKATCWESVDFIDIL  308

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +++LK K T++ E IALDL+F+LLFA FETTS  +T  +KFL+  P  L++LTEEH  I 
Sbjct  309  IDDLKDKKTLMNEKIALDLLFLLLFAGFETTSSGITATLKFLTGDPKALQELTEEHNNIR  368

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K R NP+S +TW+EYKSM FT   IHE +RLANI P +FRK+  +++
Sbjct  369  KRRANPDSEITWEEYKSMKFTSHVIHEALRLANIAPVMFRKATEEVH  415



>ref|XP_011025040.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=479

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -3

Query  497  ESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFVLE  318
            E+   FI+ L+SFPL+IPGT +H C++ ++K   +++  I+ER  +P K   DF D  L 
Sbjct  205  ENLPNFIKSLMSFPLNIPGTTFHKCMKDKEKMSNMVRHIIKERFNSPDKRPGDFLDQALN  264

Query  317  ELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKN  138
            ++   +  LTE    +L F +LFA+FE+ S  LTLAIKFL+++PLVLE+LT E+EA++K 
Sbjct  265  DMA-SEKFLTEDFIAELSFGILFAAFESVSTTLTLAIKFLAENPLVLEELTAENEAVLKK  323

Query  137  RENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            RENP++ L+W+EYK+M FT   ++ET+RL NI PG+ RK+L+DIN
Sbjct  324  RENPDAPLSWEEYKTMAFTQSVVNETLRLMNIPPGLLRKALKDIN  368



>ref|XP_011007351.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=479

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 120/165 (73%), Gaps = 1/165 (1%)
 Frame = -3

Query  497  ESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFVLE  318
            E+   FI+ L+SFPL+IPGT +H C++ ++K   +++  I+ER  +P K   DF D  + 
Sbjct  205  ENLPNFIKSLMSFPLNIPGTTFHKCMKDKEKMSNMVRHIIKERFNSPDKRPGDFLDQAIN  264

Query  317  ELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKN  138
            ++  +  +  + IA +L F +LFA+FE+ S  LTLAIKFL+++PLVLE+LT E+EA++K 
Sbjct  265  DMASEKFLTVDFIA-ELAFGILFAAFESVSTTLTLAIKFLAENPLVLEELTAENEAVLKK  323

Query  137  RENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            RENP+S LTW+EYK MTFT   ++ET+RL NI PG+ RK+L+DIN
Sbjct  324  RENPDSLLTWEEYKEMTFTQSVVNETLRLMNIPPGLLRKALKDIN  368



>ref|XP_002313285.2| hypothetical protein POPTR_0009s06930g [Populus trichocarpa]
 gb|EEE87240.2| hypothetical protein POPTR_0009s06930g [Populus trichocarpa]
Length=481

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 120/165 (73%), Gaps = 1/165 (1%)
 Frame = -3

Query  497  ESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFVLE  318
            E+   FI+ L+SFPL+IPGT +H C++ ++K   +++  I+ER  +P K   DF D  + 
Sbjct  207  ENLPNFIKSLMSFPLNIPGTTFHKCMKDKEKMSNMVRHIIKERFDSPDKRPGDFLDQAIN  266

Query  317  ELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKN  138
            ++  +  +  + IA +L F +LFA+FE+ S  LTLAIKFL+++PLVLE+LT E+EA++K 
Sbjct  267  DMASEKFLTVDFIA-ELAFGILFAAFESVSTTLTLAIKFLAENPLVLEELTAENEAVLKK  325

Query  137  RENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            RENP+S LTW+EYK MTFT   ++ET+RL NI PG+ RK+L+DIN
Sbjct  326  RENPDSLLTWEEYKEMTFTQSVVNETLRLMNIPPGLLRKALKDIN  370



>gb|EEE68447.1| hypothetical protein OsJ_26826 [Oryza sativa Japonica Group]
Length=504

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 115/166 (69%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F  F QG++SFP+  PGT+++ C+QGR+   K L + ++ER + P +   D  D +
Sbjct  206  LRKNFQEFFQGMVSFPIYFPGTSFYRCMQGRRNVHKTLTDLLKERLSAPGEKYNDLIDQI  265

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+ ++ ++    A+D++  LLFASF T S  L++  KFL+D+P V+++L EEH  I+
Sbjct  266  IEELQSENPVIDVNFAVDVLSALLFASFATLSSTLSVGFKFLTDNPKVVKELKEEHTTIL  325

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
              R + NSG TW+EYKS+ FT Q +HE  R++N+ PGIFRK+L D+
Sbjct  326  NKRGSLNSGFTWEEYKSLMFTSQVVHEITRISNVAPGIFRKTLADV  371



>ref|XP_006657536.1| PREDICTED: cytochrome P450 87A3-like [Oryza brachyantha]
Length=482

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 114/166 (69%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F  F QG++SFP+  PGT+++ C+QGR+     L   ++ER + P K   D  D +
Sbjct  206  LRKNFNEFFQGMVSFPIYFPGTSFYRCMQGRRNVRNTLANLMKERLSAPGKKHGDLVDLI  265

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +++L+ +  ++ E  A+D +  +LF S+ T S  LT+A+KFL+D+P ++E+L EEHE I+
Sbjct  266  VQDLQGEKPVIDENFAIDALAAILFTSYATLSSTLTVALKFLTDNPKIVEELKEEHETIL  325

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K RE   SG TW+EYKS+ FT Q ++E  R++N+ PG+FRK+L D+
Sbjct  326  KKREGVTSGFTWEEYKSLKFTTQVMNEITRISNVAPGVFRKTLTDV  371



>ref|XP_002526166.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF36242.1| cytochrome P450, putative [Ricinus communis]
Length=406

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 121/166 (73%), Gaps = 2/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E+F +FIQGL SFPL+IPGT++  C+Q +KK + +++  + ERRA P  ++ DF D +
Sbjct  129  LSETFSSFIQGLFSFPLNIPGTSFRKCMQNQKKILNMIRVTLVERRAFPETSRGDFLDSL  188

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
             E++K  D++ T+ +   ++FVLL A+ ET    LTLAIK L++HPLV+++L +E+E II
Sbjct  189  AEDMK-ADSLFTDDLVTLVIFVLLLATSETIPSTLTLAIKLLTEHPLVMQELVKENEEII  247

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            ++REN  +GLTW+EYKSMTFT   I+E +R++  V GI R+++ D+
Sbjct  248  RSRENKETGLTWKEYKSMTFTMHVINEALRMSGSV-GILRRTMEDV  292



>ref|XP_010111726.1| Cytochrome P450 87A3 [Morus notabilis]
 gb|EXC31565.1| Cytochrome P450 87A3 [Morus notabilis]
Length=412

 Score =   163 bits (413),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 111/156 (71%), Gaps = 1/156 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E++   +QG +SFPL+IPGTAY+ CL+G+KK + +L++ I+ERRA+P  N+ DF D +
Sbjct  200  LSETYTGIVQGFMSFPLNIPGTAYNQCLKGQKKILAMLRDMIKERRASPETNRGDFLDQI  259

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
             +++  K+  L+E   + L+F  LFA+FE+ S  + LA + LS+HP VL+++  EHEAI+
Sbjct  260  CKDMN-KEKFLSEDFIVQLIFGGLFATFESVSAIMALAFELLSEHPSVLKEMMAEHEAIL  318

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVP  36
            KNRE+PNS LTW EYKSMTFT Q +   V   N +P
Sbjct  319  KNREDPNSSLTWDEYKSMTFTLQELDSRVVSKNFLP  354



>ref|XP_007201108.1| hypothetical protein PRUPE_ppa024382mg [Prunus persica]
 gb|EMJ02307.1| hypothetical protein PRUPE_ppa024382mg [Prunus persica]
Length=473

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 113/166 (68%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L + F   +   +S PL++PGTAYHNCL+ R+K   +L++ +++RR +P  ++ DF D +
Sbjct  197  LSDKFSKILSTFLSIPLNVPGTAYHNCLKDREKITTMLRDMLKKRRTSPDTHRGDFLDQI  256

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
              ++  K+  L+E   +  +F  LFA F   S  ++LA   L++HP  LE+LT E+EA++
Sbjct  257  SSDMD-KEKFLSEDFVVYALFGALFAGFHPISAIMSLAFSLLAEHPAALEELTAENEALL  315

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNRENPNS LTW EYKSMTFT Q ++ET+RL N+ P +FR+ L+DI
Sbjct  316  KNRENPNSSLTWDEYKSMTFTRQVVNETLRLGNVAPALFRRVLKDI  361



>gb|EEE61528.1| hypothetical protein OsJ_15832 [Oryza sativa Japonica Group]
Length=392

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 113/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F  F QG++SFP+  PGT+++  +QGR+     L + ++ER + P K   D  D +
Sbjct  206  LRKNFQDFFQGMVSFPIYFPGTSFYRSMQGRRNVRNTLTDIMKERLSAPGKKYGDLVDLI  265

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+ +  ++ E  A+D +  LLF SF T S  LT+A K+L+D+P V+E+L EEH  I+
Sbjct  266  VEELQSEKPMIDENFAIDALAALLFTSFATLSSTLTVAFKYLTDNPKVVEELKEEHGTIL  325

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K RE  NSG TW+EY+S+ F+ Q ++E  R++N+ PG+FRK+L D+ 
Sbjct  326  KKREGVNSGFTWEEYRSLKFSTQVMNEITRISNVTPGVFRKTLTDVQ  372



>ref|XP_006653690.1| PREDICTED: cytochrome P450 87A3-like [Oryza brachyantha]
Length=482

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 112/167 (67%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR +F  F  G++SFP+  PGT ++ C++GR+     L   ++ R + P K   D  D +
Sbjct  206  LRNNFQEFFMGMVSFPIYFPGTLFYRCMKGRRNVHSALTNVMKVRLSAPEKKFGDLLDLI  265

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++EL+ +  ++ E  A+D++ +LLF S  T S  LT+AIKFL+D+P ++E+L EEHE I+
Sbjct  266  IDELRSEKPMIDENFAIDVLVILLFTSIATLSPTLTVAIKFLTDNPKIVEELKEEHETIM  325

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K RE  NSG TW+EYKS+ FT Q ++E  R++N+ PGIFRK+L D+ 
Sbjct  326  KKREGVNSGFTWEEYKSLKFTIQVMNEIGRISNVAPGIFRKTLTDVQ  372



>emb|CAD41581.3| OSJNBa0088I22.13 [Oryza sativa Japonica Group]
Length=448

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 113/166 (68%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F  F QG++SFP+  PGT+++  +QGR+     L + ++ER + P K   D  D +
Sbjct  206  LRKNFQDFFQGMVSFPIYFPGTSFYRSMQGRRNVRNTLTDIMKERLSAPGKKYGDLVDLI  265

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+ +  ++ E  A+D +  LLF SF T S  LT+A K+L+D+P V+E+L EEH  I+
Sbjct  266  VEELQSEKPMIDENFAIDALAALLFTSFATLSSTLTVAFKYLTDNPKVVEELKEEHGTIL  325

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K RE  NSG TW+EY+S+ F+ Q ++E  R++N+ PG+FRK+L D+
Sbjct  326  KKREGVNSGFTWEEYRSLKFSTQVMNEITRISNVTPGVFRKTLTDV  371



>gb|AGT17443.1| cytochrome P450 [Saccharum hybrid cultivar R570]
Length=439

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 116/166 (70%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR+++ +F+QGLISFP+  PGT ++ C+QG+   + L+   + +R + P K+  D  D +
Sbjct  175  LRKNYSSFLQGLISFPIYFPGTTFYQCMQGKNNMLNLMSNLLRKRLSMPEKHG-DILDLM  233

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+ ++  + +  A D +  +LF SF T S  LTLA KFLSD+P VL+ L EEH+ I+
Sbjct  234  VEELQSENPTIDDKFATDTLSAILFTSFVTLSPNLTLAFKFLSDNPAVLDALKEEHDTIL  293

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +NR++ +SG TW+EYKS+TFT   I+E +R++N  PGIFRK+L D+
Sbjct  294  RNRKDSSSGFTWEEYKSLTFTTMVINELMRMSNPTPGIFRKTLTDV  339



>ref|XP_007016259.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY33878.1| Cytochrome P450, putative [Theobroma cacao]
Length=478

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 119/169 (70%), Gaps = 3/169 (2%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRK--NQTDFFD  330
            L E   +F+QGL++FPL IPGTA++ C++ ++K  K+L E +EERR +  +  N  DF  
Sbjct  198  LSEYLCSFLQGLMTFPLYIPGTAFYKCIKTQRKVEKILSELLEERRKSYSQGCNNGDFLG  257

Query  329  FVLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEA  150
             ++E++  K+  LT+  A+ LMF LL AS ET S   TLAIK+L D+P  L++LTEEHE 
Sbjct  258  QIVEDMG-KEAFLTKEFAVSLMFGLLLASVETISSTATLAIKYLLDNPSALQQLTEEHEE  316

Query  149  IIKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            I+K RE+ + GL+W+EYKSMTFT   I+ET+R+ ++ PGI R+ + DI+
Sbjct  317  ILKKREDTSLGLSWEEYKSMTFTHYVINETLRIGSVAPGILRRVIADIH  365



>ref|XP_002527850.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF34553.1| cytochrome P450, putative [Ricinus communis]
Length=444

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 116/167 (69%), Gaps = 2/167 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E F  F +GL+SFPL++PGT Y+ CL+ ++KA+ +LK+ ++ERR +  K+  DF    
Sbjct  199  LSECFTTFAEGLMSFPLNLPGTTYYQCLKNQQKAINILKKMVKERRTSAEKHVEDFLSTA  258

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            L +++ K+  LT+     L+F LLFASFET S  +TL +  LS HP VL+ L  EHE+I+
Sbjct  259  LNDME-KEKFLTDDFITTLLFGLLFASFETISTTMTLMLNLLSSHPSVLQDLMAEHESIL  317

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            +N+   +S + W EYKSMTFT Q I+ET+RL N+ PG+ RK+++D++
Sbjct  318  QNKP-LDSSIKWDEYKSMTFTHQVINETLRLGNVAPGLLRKAIKDVH  363



>ref|XP_010027150.1| PREDICTED: cytochrome P450 87A3-like [Eucalyptus grandis]
 gb|KCW61506.1| hypothetical protein EUGRSUZ_H04234 [Eucalyptus grandis]
Length=474

 Score =   162 bits (409),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 118/166 (71%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L + + +FIQGL+S PL+IPGT YH CL+ R+KA+ +++  +++R ++  +   DF   V
Sbjct  198  LGDLYSSFIQGLLSIPLNIPGTIYHKCLKDRRKALSIIRRTVKDRLSSHGRLHDDFLCHV  257

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++++  K+  LTE   + L+F LLF +F++ S  LTLA+ FL ++P  L+++T+EHE+II
Sbjct  258  MQDMS-KEEFLTEDFLVQLIFGLLFVTFDSVSTTLTLALMFLEENPRALQEITDEHESII  316

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K RE   S +TW+EYKSM FT Q IHE++RL NI PG+FR++  D+
Sbjct  317  KQREISKSPITWKEYKSMPFTLQVIHESLRLGNISPGLFRRTKTDV  362



>gb|EEC76682.1| hypothetical protein OsI_14666 [Oryza sativa Indica Group]
Length=375

 Score =   160 bits (404),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 113/166 (68%), Gaps = 0/166 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F  F  G++SFP+  PGT+++ C+QGR+   K L + ++ER + P +   D  D +
Sbjct  34   LRKNFQEFFHGMVSFPIYFPGTSFYRCMQGRRNVQKTLTDLLKERLSAPGEKYNDLIDQI  93

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+ ++ ++    A+D++  LLFASF T S  L +  KFL+D+P V+++L EEH  I+
Sbjct  94   IEELQSENPVIDVNFAIDVLSALLFASFATLSSTLAVGFKFLTDNPKVVKELKEEHTTIL  153

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
              R + NSG TW+EYKS+ FT Q ++E  R++N+ PGIFR++L D+
Sbjct  154  NKRGSLNSGFTWEEYKSLMFTSQVVNEITRISNVAPGIFRRTLADV  199



>ref|NP_001053600.1| Os04g0570500 [Oryza sativa Japonica Group]
 emb|CAC81901.1| cytochrome P450 [Oryza sativa]
 dbj|BAF15514.1| Os04g0570500 [Oryza sativa Japonica Group]
 dbj|BAG96026.1| unnamed protein product [Oryza sativa Japonica Group]
Length=482

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 113/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F  F QG++SFP+  PGT+++  +QGR+     L + ++ER + P K   D  D +
Sbjct  206  LRKNFQDFFQGMVSFPIYFPGTSFYRSMQGRRNVRNTLTDIMKERLSAPGKKYGDLVDLI  265

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+ +  ++ E  A+D +  LLF SF T S  LT+A K+L+D+P V+E+L EEH  I+
Sbjct  266  VEELQSEKPMIDENFAIDALAALLFTSFATLSSTLTVAFKYLTDNPKVVEELKEEHGTIL  325

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K RE  NSG TW+EY+S+ F+ Q ++E  R++N+ PG+FRK+L D+ 
Sbjct  326  KKREGVNSGFTWEEYRSLKFSTQVMNEITRISNVTPGVFRKTLTDVQ  372



>emb|CAH67277.1| OSIGBa0111L12.4 [Oryza sativa Indica Group]
 gb|EEC77824.1| hypothetical protein OsI_17034 [Oryza sativa Indica Group]
Length=482

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 113/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            LR++F  F QG++SFP+  PGT+++  +QGR+     L + ++ER + P K   D  D +
Sbjct  206  LRKNFQDFFQGMVSFPIYFPGTSFYRSMQGRRNVRNTLTDIMKERLSAPGKKYGDLVDLI  265

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +EEL+ +  ++ E  A+D +  LLF SF T S  LT+A K+L+D+P V+E+L EEH  I+
Sbjct  266  VEELQSEKPMIDENFAIDALAALLFTSFATLSSTLTVAFKYLTDNPKVVEELKEEHGTIL  325

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            K RE  NSG TW+EY+S+ F+ Q ++E  R++N+ PG+FRK+L D+ 
Sbjct  326  KKREGVNSGFTWEEYRSLKFSTQVMNEITRISNVTPGVFRKTLTDVQ  372



>ref|XP_010690665.1| PREDICTED: cytochrome P450 87A3-like [Beta vulgaris subsp. vulgaris]
Length=477

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 119/167 (71%), Gaps = 2/167 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERR-ANPRKNQTDFFDF  327
            L E F    QGL+SFPL+IPGT Y++CL+ +++ M +++  ++ERR A+P   + DF D 
Sbjct  201  LGEKFSHISQGLLSFPLNIPGTTYYSCLKSQREVMNMMRTTLKERRHASPETFRGDFLDH  260

Query  326  VLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAI  147
             L++L   +  L+E   L +MF LLFAS E++S  L L +KFLS++P VL++L  EHE I
Sbjct  261  ALKDLN-TEKFLSEDFILQIMFGLLFASSESSSTTLALVLKFLSENPHVLQELEAEHERI  319

Query  146  IKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            +K+RE+P+S LTW E KSMTFT Q I+E++RL N+  G+ R++L+DI
Sbjct  320  LKSRESPDSPLTWDEVKSMTFTLQVINESLRLGNVSLGLLRRTLKDI  366



>gb|EYU19885.1| hypothetical protein MIMGU_mgv1a020752mg [Erythranthe guttata]
Length=481

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 112/166 (67%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            + + F   ++GL+SFP+++PGT++H CLQ  KK  +++++ + +R +   +   D  D +
Sbjct  205  MSDMFRDLVEGLMSFPINLPGTSHHKCLQTHKKVREMMRDVVTKRLSETERKNGDLLDHI  264

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            +E+ K+ ++ + E   + LMF L F + ++ S  L LA K L++HPLVLE+LT EHEAI+
Sbjct  265  IED-KKTESFINEDFIVQLMFGLFFVTSDSISTTLALAFKLLAEHPLVLEELTAEHEAIL  323

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K RE  +S L W EYKSMTFT Q I+E +RL NI PG FR++L DI
Sbjct  324  KKREKSDSNLMWNEYKSMTFTLQVINEVLRLGNIAPGFFRRALTDI  369



>gb|KCW61505.1| hypothetical protein EUGRSUZ_H04233, partial [Eucalyptus grandis]
Length=401

 Score =   158 bits (400),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 116/166 (70%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L + F + +QGL+S PL+IPGT YH CL+ R+KA+ +++  +++R ++  +   DF   V
Sbjct  198  LGDLFSSLVQGLLSIPLNIPGTIYHKCLKDRRKALSMIRRTVKDRLSSHGRLHDDFLCQV  257

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++++  K+  LTE   + L+F LLF +F++ S   TLA+ FL ++P  L+++T+EHE+II
Sbjct  258  MQDMS-KEKFLTEDFLVQLIFTLLFVTFDSVSTTSTLALMFLEENPRALQEITDEHESII  316

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K RE   S +TW+EYKSM FT Q IHE++RL NI PG+FR++  D+
Sbjct  317  KEREISKSSITWKEYKSMPFTLQVIHESLRLGNISPGLFRRTKTDV  362



>dbj|BAG97817.1| unnamed protein product [Oryza sativa Japonica Group]
Length=253

 Score =   154 bits (390),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 105/141 (74%), Gaps = 9/141 (6%)
 Frame = -3

Query  401  MKLLKEKIEER-------RANPRKNQTDFFDFVLEELKRKDTILTEGIALDLMFVLLFAS  243
            M +L++ +EER       R    +   DF D+V++E+ ++  ++TE +ALDLMFVLLFAS
Sbjct  1    MVVLEQVLEERKQSTGLQRGGEAQQHGDFLDYVIQEITKEKPVMTEKMALDLMFVLLFAS  60

Query  242  FETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKNRENPN--SGLTWQEYKSMTFTFQFI  69
            F TTSLALTLA+K L+DHPLVLE+LT EHE I+K+RE  +    +TW+EYKSM FT Q I
Sbjct  61   FHTTSLALTLAVKLLADHPLVLEELTVEHETILKDREAGSELDRITWKEYKSMAFTSQVI  120

Query  68   HETVRLANIVPGIFRKSLRDI  6
            +ETVRLANI P IFRK+L+DI
Sbjct  121  NETVRLANIAPVIFRKALKDI  141



>gb|AHF22090.1| CYP87D16 [Maesa lanceolata]
Length=475

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 108/159 (68%), Gaps = 1/159 (1%)
 Frame = -3

Query  482  FIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFVLEELKRK  303
            F+QGL++FPL++PGT +H C++ +K+   ++  K++ER A+P   Q DF D  +++L   
Sbjct  206  FVQGLLAFPLNVPGTKFHKCMKDKKRLESMITNKLKERIADPNSGQGDFLDQAVKDL-NS  264

Query  302  DTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKNRENPN  123
            +  +TE   + +    LFA+ E+ S A+ LA KF ++HP VL+ L  EHEA++  RE+ N
Sbjct  265  EFFITETFIVSVTMGALFATVESVSTAIGLAFKFFAEHPWVLDDLKAEHEAVLSKREDRN  324

Query  122  SGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            S LTW EY+SMT T  FI+E VRL N+ PGI RK+L+DI
Sbjct  325  SPLTWDEYRSMTHTMHFINEVVRLGNVFPGILRKALKDI  363



>ref|XP_008235944.1| PREDICTED: cytochrome P450 87A3-like [Prunus mume]
Length=475

 Score =   159 bits (401),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 114/166 (69%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L   F   ++  +SFPL++PGTAYHN L+ R K + +L++ +++RR +P K++ DF D +
Sbjct  199  LSNKFSEIMKSFLSFPLNVPGTAYHNGLKDRDKIITMLRDMLKKRRMSPDKHRGDFLDQI  258

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
              ++  K+  L+E   +  +F +L A FE  S  + LA   L++HP  L++LT E+EA++
Sbjct  259  SSDMD-KEKFLSEESVVYAIFGVLLAGFEPVSSIMALAFSLLAEHPAALKELTAENEALL  317

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            KNRENPNS LTW EYKSMTFT Q ++ET+RL N+ P + R++++DI
Sbjct  318  KNRENPNSSLTWDEYKSMTFTRQVVNETLRLGNVAPALLRRAVKDI  363



>ref|XP_004955877.1| PREDICTED: cytochrome P450 87A3-like isoform X2 [Setaria italica]
Length=456

 Score =   158 bits (400),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 103/156 (66%), Gaps = 0/156 (0%)
 Frame = -3

Query  473  GLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFVLEELKRKDTI  294
            GLISFPL +PGT ++ C+QGRK   K++ + + +R   P     DF D ++EEL+     
Sbjct  181  GLISFPLYVPGTTFYRCMQGRKNMQKIMSDLLSKRLTRPDVKHGDFLDLIVEELQSGKPT  240

Query  293  LTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAIIKNRENPNSGL  114
            + E  A D +  LLF SF T +  L LA KFL ++P VL+ L EEHEAI++NR + NSG 
Sbjct  241  IDEKFATDALVALLFTSFVTLAPILILAFKFLGNNPKVLKALKEEHEAIVRNRGDANSGF  300

Query  113  TWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            TW+EYKS+TFT   ++E  R++N  PG+FRK++ D+
Sbjct  301  TWEEYKSLTFTTMVVNELTRMSNATPGVFRKTVTDV  336



>ref|XP_010111725.1| Cytochrome P450 87A3 [Morus notabilis]
 gb|EXC31564.1| Cytochrome P450 87A3 [Morus notabilis]
Length=415

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 114/169 (67%), Gaps = 2/169 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L E +   ++GL++ PL+IPGT Y+ C + ++  + +L+  ++ERRA+   +QT   DF+
Sbjct  136  LGEKYTRIMEGLMTIPLNIPGTTYYKCRKEQESVVNMLRGMLKERRASLASDQTHEGDFL  195

Query  323  LEELKR--KDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEA  150
             E  K   K+  LTE     + F +L A+FET S  +TLA K L+DHP VLE+LT EHEA
Sbjct  196  YEISKDMDKEKFLTEDFVAHMTFGVLLATFETLSATMTLAFKLLADHPSVLEELTAEHEA  255

Query  149  IIKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDIN  3
            I+K REN NS +TW+EYKSM FT Q I+ET+RL N +PG+ R + +D++
Sbjct  256  ILKKRENSNSPITWEEYKSMAFTHQVINETLRLGNTLPGLLRLAKKDVS  304



>ref|XP_010092091.1| Cytochrome P450 87A3 [Morus notabilis]
 gb|EXB50104.1| Cytochrome P450 87A3 [Morus notabilis]
Length=241

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 118/167 (71%), Gaps = 22/167 (13%)
 Frame = -3

Query  503  LRESFV-AFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDF  327
            L+E++  AF+ GLISFPL IPGTAYH CLQG+K A+K++++  E+R+A+   NQ D+ D 
Sbjct  52   LKENYNDAFLDGLISFPLHIPGTAYHACLQGQKNAIKVIRDIFEKRKASD-ANQGDYLDH  110

Query  326  VLEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAI  147
            +LEELK++ TIL E +A+DL+F+LLFA++E+TS                    T+EHE I
Sbjct  111  LLEELKKEKTILNEKMAIDLLFLLLFAAYESTS--------------------TKEHEEI  150

Query  146  IKNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            I  R+  +  +TWQEYKSMTFT   I+ETVRLANIVP +FR++ +D+
Sbjct  151  INKRDKKDVEITWQEYKSMTFTHMVINETVRLANIVPAVFRRAAKDV  197



>ref|XP_010027149.1| PREDICTED: cytochrome P450 87A3-like [Eucalyptus grandis]
Length=505

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 116/166 (70%), Gaps = 1/166 (1%)
 Frame = -3

Query  503  LRESFVAFIQGLISFPLDIPGTAYHNCLQGRKKAMKLLKEKIEERRANPRKNQTDFFDFV  324
            L + F + +QGL+S PL+IPGT YH CL+ R+KA+ +++  +++R ++  +   DF   V
Sbjct  198  LGDLFSSLVQGLLSIPLNIPGTIYHKCLKDRRKALSMIRRTVKDRLSSHGRLHDDFLCQV  257

Query  323  LEELKRKDTILTEGIALDLMFVLLFASFETTSLALTLAIKFLSDHPLVLEKLTEEHEAII  144
            ++++  K+  LTE   + L+F LLF +F++ S   TLA+ FL ++P  L+++T+EHE+II
Sbjct  258  MQDMS-KEKFLTEDFLVQLIFTLLFVTFDSVSTTSTLALMFLEENPRALQEITDEHESII  316

Query  143  KNRENPNSGLTWQEYKSMTFTFQFIHETVRLANIVPGIFRKSLRDI  6
            K RE   S +TW+EYKSM FT Q IHE++RL NI PG+FR++  D+
Sbjct  317  KEREISKSSITWKEYKSMPFTLQVIHESLRLGNISPGLFRRTKTDV  362



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517811659326