BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27086_g1_i1 len=933 path=[911:0-932]

Length=933
                                                                      Score     E

ref|XP_009618873.1|  PREDICTED: uncharacterized protein LOC104110990    146   4e-39   
ref|XP_009804086.1|  PREDICTED: uncharacterized protein LOC104249372    145   8e-39   
ref|XP_011090707.1|  PREDICTED: uncharacterized protein LOC105171332    142   3e-37   
ref|XP_007143266.1|  hypothetical protein PHAVU_007G058000g             141   9e-37   
ref|XP_009784306.1|  PREDICTED: uncharacterized protein LOC104232739    141   1e-36   
gb|EYU41476.1|  hypothetical protein MIMGU_mgv1a020098mg                139   2e-36   
ref|XP_004296753.1|  PREDICTED: uncharacterized protein LOC101305...    139   6e-36   
ref|XP_004296754.1|  PREDICTED: uncharacterized protein LOC101305...    139   1e-35   
ref|XP_009369852.1|  PREDICTED: uncharacterized protein LOC103959230    140   1e-35   
ref|XP_009589247.1|  PREDICTED: uncharacterized protein LOC104086637    138   1e-35   
emb|CCW28815.1|  hypothetical protein ARAX_AHF417E07-004                137   2e-35   
gb|KEH43864.1|  heat shock 22 kDa protein                               136   2e-35   
ref|XP_006360781.1|  PREDICTED: uncharacterized protein LOC102603793    137   3e-35   
ref|XP_009345881.1|  PREDICTED: uncharacterized protein LOC103937657    138   4e-35   
ref|XP_004165791.1|  PREDICTED: uncharacterized LOC101205778            138   5e-35   
ref|XP_004134135.1|  PREDICTED: uncharacterized protein LOC101205778    137   5e-35   
ref|XP_007223548.1|  hypothetical protein PRUPE_ppa012159mg             136   6e-35   
ref|XP_010326672.1|  PREDICTED: uncharacterized protein LOC101246180    136   6e-35   
ref|XP_003556055.1|  PREDICTED: uncharacterized protein LOC100808440    136   8e-35   
ref|XP_009335330.1|  PREDICTED: uncharacterized protein LOC103928045    135   9e-35   
ref|XP_002282665.1|  PREDICTED: uncharacterized protein LOC100256202    135   1e-34   Vitis vinifera
ref|XP_004496716.1|  PREDICTED: uncharacterized protein LOC101514677    135   2e-34   
ref|XP_008340996.1|  PREDICTED: uncharacterized protein LOC103403931    136   2e-34   
ref|XP_008390902.1|  PREDICTED: uncharacterized protein LOC103453131    135   3e-34   
ref|XP_008224301.1|  PREDICTED: uncharacterized protein LOC103324043    135   3e-34   
ref|XP_006356036.1|  PREDICTED: uncharacterized protein LOC102591035    132   5e-34   
emb|CBI26269.3|  unnamed protein product                                134   5e-34   
gb|KFK39542.1|  hypothetical protein AALP_AA3G257800                    133   6e-34   
ref|XP_008438664.1|  PREDICTED: uncharacterized protein LOC103483704    135   7e-34   
ref|XP_010096144.1|  hypothetical protein L484_005423                   134   9e-34   
ref|XP_003536530.1|  PREDICTED: uncharacterized protein LOC100778094    133   9e-34   
emb|CDP03646.1|  unnamed protein product                                132   1e-33   
ref|XP_002885507.1|  hypothetical protein ARALYDRAFT_479772             131   3e-33   
gb|KDP40188.1|  hypothetical protein JCGZ_02186                         131   3e-33   
dbj|BAB01468.1|  unnamed protein product                                130   7e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002862235.1|  predicted protein                                  130   8e-33   
ref|XP_006419957.1|  hypothetical protein CICLE_v10006449mg             130   1e-32   
ref|NP_566710.1|  uncharacterized protein                               130   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002517122.1|  conserved hypothetical protein                     129   2e-32   Ricinus communis
ref|XP_006489409.1|  PREDICTED: uncharacterized protein LOC102610341    131   2e-32   
gb|AAM62556.1|  unknown                                                 129   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KDO74550.1|  hypothetical protein CISIN_1g023450mg                   131   4e-32   
ref|XP_006299138.1|  hypothetical protein CARUB_v10015280mg             129   5e-32   
ref|XP_010466538.1|  PREDICTED: uncharacterized protein LOC104746708    128   5e-32   
ref|XP_010511470.1|  PREDICTED: uncharacterized protein LOC104787563    128   6e-32   
ref|XP_010488283.1|  PREDICTED: uncharacterized protein LOC104766152    128   8e-32   
ref|XP_011026667.1|  PREDICTED: uncharacterized protein LOC105127188    127   1e-31   
ref|XP_002312535.2|  hypothetical protein POPTR_0008s15390g             125   3e-31   Populus trichocarpa [western balsam poplar]
ref|XP_011030681.1|  PREDICTED: uncharacterized protein LOC105130...    126   9e-31   
ref|XP_009108819.1|  PREDICTED: uncharacterized protein LOC103834498    124   9e-31   
ref|XP_011030680.1|  PREDICTED: uncharacterized protein LOC105130...    126   1e-30   
ref|XP_007034782.1|  17.6 kDa class II heat shock protein               127   1e-30   
ref|XP_002314693.2|  hypothetical protein POPTR_0010s09640g             125   1e-30   Populus trichocarpa [western balsam poplar]
ref|XP_011021501.1|  PREDICTED: uncharacterized protein LOC105123...    125   2e-30   
ref|XP_011021500.1|  PREDICTED: uncharacterized protein LOC105123...    125   2e-30   
ref|XP_006406152.1|  hypothetical protein EUTSA_v10021506mg             124   3e-30   
emb|CDO99072.1|  unnamed protein product                                122   4e-30   
ref|NP_193219.1|  uncharacterized protein                               122   5e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435058.1|  PREDICTED: uncharacterized protein LOC104718929    122   5e-30   
emb|CDY34247.1|  BnaA01g24640D                                          121   9e-30   
ref|XP_009788742.1|  PREDICTED: uncharacterized protein LOC104236511    121   9e-30   
ref|XP_010449982.1|  PREDICTED: uncharacterized protein LOC104732148    121   9e-30   
ref|XP_004234233.1|  PREDICTED: uncharacterized protein LOC101268648    120   1e-29   
ref|XP_006286098.1|  hypothetical protein CARUB_v10007641mg             120   1e-29   
ref|XP_009145320.1|  PREDICTED: uncharacterized protein LOC103869031    122   1e-29   
emb|CDX98212.1|  BnaC07g08860D                                          120   2e-29   
emb|CDY10651.1|  BnaA05g17110D                                          121   3e-29   
ref|XP_008447155.1|  PREDICTED: uncharacterized protein LOC103489672    120   3e-29   
ref|XP_002870278.1|  hypothetical protein ARALYDRAFT_915349             119   7e-29   
ref|XP_004159040.1|  PREDICTED: heat shock 22 kDa protein, chloro...    119   1e-28   
ref|XP_009616605.1|  PREDICTED: uncharacterized protein LOC104109107    119   1e-28   
gb|KGN44240.1|  hypothetical protein Csa_7G234120                       118   2e-28   
ref|XP_010256078.1|  PREDICTED: uncharacterized protein LOC104596551    118   2e-28   
ref|XP_004241050.1|  PREDICTED: uncharacterized protein LOC101260945    119   3e-28   
ref|XP_009418945.1|  PREDICTED: uncharacterized protein LOC103999035    117   3e-28   
ref|XP_006350642.1|  PREDICTED: uncharacterized protein LOC102579970    119   3e-28   
ref|XP_004139820.1|  PREDICTED: uncharacterized protein LOC101211410    118   4e-28   
ref|XP_010440384.1|  PREDICTED: uncharacterized protein LOC104723692    116   5e-28   
ref|XP_004242529.1|  PREDICTED: uncharacterized protein LOC101259552    116   6e-28   
ref|XP_010024266.1|  PREDICTED: uncharacterized protein LOC104414790    119   7e-28   
ref|XP_010259067.1|  PREDICTED: uncharacterized protein LOC104598607    118   8e-28   
ref|XP_006349692.1|  PREDICTED: uncharacterized protein LOC102591801    115   1e-27   
gb|KDP21436.1|  hypothetical protein JCGZ_21907                         116   1e-27   
gb|AES93690.2|  heat shock 22 kDa protein                               115   2e-27   
ref|XP_004247176.1|  PREDICTED: uncharacterized protein LOC101259285    115   2e-27   
ref|XP_006368157.1|  PREDICTED: uncharacterized protein LOC102601155    113   3e-27   
emb|CDY10290.1|  BnaC05g29890D                                          115   4e-27   
ref|XP_009767679.1|  PREDICTED: uncharacterized protein LOC104218788    114   4e-27   
ref|XP_008797029.1|  PREDICTED: uncharacterized protein LOC103712319    114   1e-26   
ref|XP_010532557.1|  PREDICTED: uncharacterized protein LOC104808553    115   1e-26   
ref|XP_009629335.1|  PREDICTED: uncharacterized protein LOC104119519    113   1e-26   
ref|XP_010909056.1|  PREDICTED: uncharacterized protein LOC105035254    113   1e-26   
gb|EYU46566.1|  hypothetical protein MIMGU_mgv1a015211mg                112   3e-26   
gb|EYU40912.1|  hypothetical protein MIMGU_mgv1a015318mg                112   3e-26   
ref|XP_010525199.1|  PREDICTED: uncharacterized protein LOC104803032    112   3e-26   
ref|XP_008778997.1|  PREDICTED: 17.4 kDa class I heat shock prote...    111   3e-26   
gb|EYU20967.1|  hypothetical protein MIMGU_mgv1a023261mg                111   4e-26   
ref|XP_006826258.1|  hypothetical protein AMTR_s00004p00027710          114   5e-26   
ref|XP_011026334.1|  PREDICTED: uncharacterized protein LOC105126972    111   8e-26   
ref|XP_011082574.1|  PREDICTED: uncharacterized protein LOC105165302    110   9e-26   
ref|XP_003520205.1|  PREDICTED: uncharacterized protein LOC100783636    110   1e-25   
ref|XP_003610732.1|  hypothetical protein MTR_5g006400                  113   1e-25   
ref|XP_008803410.1|  PREDICTED: uncharacterized protein LOC103716967    110   2e-25   
ref|XP_010551714.1|  PREDICTED: uncharacterized protein LOC104822262    109   2e-25   
ref|XP_010917752.1|  PREDICTED: uncharacterized protein LOC105042302    110   2e-25   
ref|XP_002300835.2|  hypothetical protein POPTR_0002s05200g             109   3e-25   Populus trichocarpa [western balsam poplar]
ref|XP_009417094.1|  PREDICTED: uncharacterized protein LOC103997560    109   3e-25   
ref|XP_010932767.1|  PREDICTED: uncharacterized protein LOC105053360    110   4e-25   
gb|EPS67108.1|  hypothetical protein M569_07669                         108   5e-25   
ref|XP_003632305.1|  PREDICTED: uncharacterized protein LOC100855206    108   9e-25   
gb|KEH42637.1|  heat shock 22 kDa protein, putative                     107   9e-25   
ref|XP_004511367.1|  PREDICTED: uncharacterized protein LOC101512906    107   1e-24   
gb|ABK25897.1|  unknown                                                 108   2e-24   Picea sitchensis
ref|XP_003517574.1|  PREDICTED: uncharacterized protein LOC100807115    104   1e-23   
gb|EAZ38855.1|  hypothetical protein OsJ_23272                          104   1e-23   Oryza sativa Japonica Group [Japonica rice]
gb|KHN14538.1|  hypothetical protein glysoja_027147                     104   2e-23   
ref|XP_004495291.1|  PREDICTED: uncharacterized protein LOC101506081    102   6e-23   
ref|NP_001059002.1|  Os07g0173100                                       102   2e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003557517.1|  PREDICTED: uncharacterized protein LOC100844809  99.4    1e-21   
ref|NP_001143305.1|  hypothetical protein                             99.4    2e-21   Zea mays [maize]
ref|XP_010679063.1|  PREDICTED: uncharacterized protein LOC104894510  98.6    3e-21   
ref|XP_004955593.1|  PREDICTED: uncharacterized protein LOC101777773  98.6    4e-21   
ref|XP_002459399.1|  hypothetical protein SORBIDRAFT_02g004080        98.6    4e-21   Sorghum bicolor [broomcorn]
ref|XP_007144646.1|  hypothetical protein PHAVU_007G173200g           96.7    7e-21   
ref|XP_002524765.1|  conserved hypothetical protein                   96.7    2e-20   Ricinus communis
ref|XP_007157122.1|  hypothetical protein PHAVU_002G044700g           95.1    4e-20   
ref|XP_008386546.1|  PREDICTED: uncharacterized protein LOC103449049  94.4    1e-19   
ref|XP_009367624.1|  PREDICTED: uncharacterized protein LOC103957222  94.4    1e-19   
ref|XP_010684360.1|  PREDICTED: uncharacterized protein LOC104898930  94.7    1e-19   
ref|XP_004985621.1|  PREDICTED: uncharacterized protein LOC101764334  91.7    6e-19   
ref|XP_002466161.1|  hypothetical protein SORBIDRAFT_01g002570        90.9    6e-19   Sorghum bicolor [broomcorn]
gb|ACG42272.1|  hypothetical protein                                  92.0    6e-19   Zea mays [maize]
tpg|DAA42569.1|  TPA: hypothetical protein ZEAMMB73_945784            91.7    8e-19   
ref|NP_001143797.1|  uncharacterized protein LOC100276567             91.7    9e-19   Zea mays [maize]
ref|NP_001142370.1|  uncharacterized protein LOC100274542             90.1    3e-18   Zea mays [maize]
ref|XP_009370841.1|  PREDICTED: uncharacterized protein LOC103960151  89.4    3e-18   
gb|EMT17198.1|  hypothetical protein F775_31080                       89.4    4e-18   
ref|XP_002970016.1|  hypothetical protein SELMODRAFT_92632            89.0    4e-18   
ref|XP_002993310.1|  hypothetical protein SELMODRAFT_136850           89.0    5e-18   
ref|XP_006649433.1|  PREDICTED: uncharacterized protein LOC102713804  87.8    1e-17   
ref|XP_002894195.1|  hypothetical protein ARALYDRAFT_891849           86.3    2e-17   
ref|XP_003558770.1|  PREDICTED: uncharacterized protein LOC100840769  85.5    8e-17   
ref|XP_002465828.1|  hypothetical protein SORBIDRAFT_01g046470        84.7    2e-16   Sorghum bicolor [broomcorn]
dbj|BAJ87103.1|  predicted protein                                    85.5    2e-16   
ref|XP_008355468.1|  PREDICTED: uncharacterized protein LOC103419122  81.6    2e-15   
gb|ABF94093.1|  expressed protein                                     79.3    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049033.1|  Os03g0159900                                     79.3    2e-14   Oryza sativa Japonica Group [Japonica rice]
gb|AAN06850.1|  Hypothetical protein                                  79.0    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010327334.1|  PREDICTED: uncharacterized protein LOC101261074  77.4    4e-14   
ref|XP_006588633.1|  PREDICTED: uncharacterized protein LOC100803421  77.0    6e-14   
gb|AEX12078.1|  hypothetical protein 0_3499_01                        75.9    8e-14   
gb|AEX12066.1|  hypothetical protein 0_3499_01                        75.1    2e-13   
ref|XP_004247294.1|  PREDICTED: uncharacterized protein LOC101243739  73.9    4e-13   
gb|AEX12070.1|  hypothetical protein 0_3499_01                        73.6    7e-13   
gb|AEX12072.1|  hypothetical protein 0_3499_01                        73.2    9e-13   
gb|AEX12068.1|  hypothetical protein 0_3499_01                        73.2    1e-12   
gb|AEX12073.1|  hypothetical protein 0_3499_01                        71.6    4e-12   
gb|AEX12083.1|  hypothetical protein 0_3499_01                        71.2    5e-12   
ref|XP_004247295.1|  PREDICTED: uncharacterized protein LOC101244030  69.7    2e-11   
ref|XP_001763333.1|  predicted protein                                72.0    8e-11   
gb|EMS57859.1|  hypothetical protein TRIUR3_34633                     67.4    4e-10   
ref|XP_001785608.1|  predicted protein                                68.6    7e-10   
gb|EAZ02932.1|  hypothetical protein OsI_25072                        64.7    2e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_010326513.1|  PREDICTED: uncharacterized protein LOC104649318  63.5    5e-09   
ref|XP_006598468.1|  PREDICTED: uncharacterized protein LOC102668767  58.5    9e-07   



>ref|XP_009618873.1| PREDICTED: uncharacterized protein LOC104110990 [Nicotiana tomentosiformis]
Length=147

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 98/149 (66%), Gaps = 16/149 (11%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIG--HVAEHgcggggLRAHAVEI  446
            +LR+LPHVFGKVLELPFRSD DV VEEN E FRF+ EIG             +RA AVEI
Sbjct  8    KLRKLPHVFGKVLELPFRSDADVEVEENPEFFRFLTEIGVHGDVNSTIDISNVRAEAVEI  67

Query  447  HPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTV  626
            HPG+TKIVVRN ++         L LEQ+K+DTWR+RLPA  +PEL  AAFVDG+LIVTV
Sbjct  68   HPGMTKIVVRNGAK----GGKAELLLEQLKVDTWRYRLPASAKPELATAAFVDGELIVTV  123

Query  627  PKggpggggrgELVNGRHAWGWGGSRIIR  713
            PKG           NGR  +G   + ++R
Sbjct  124  PKGD----------NGRRGFGGRDNVLVR  142



>ref|XP_009804086.1| PREDICTED: uncharacterized protein LOC104249372 [Nicotiana sylvestris]
Length=147

 Score =   145 bits (365),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 89/125 (71%), Gaps = 6/125 (5%)
 Frame = +3

Query  264  AAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIG--HVAEHgcggggLRAHA  437
            A  +L++LPHVFGKVLELPFRSD DV VEEN E FRFV EIG           G +RA A
Sbjct  5    AIKKLQKLPHVFGKVLELPFRSDADVEVEENPEFFRFVTEIGVHGDVNSAIDVGNVRAEA  64

Query  438  VEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLI  617
            VEIHPG+TKIVVRN  +         LFLEQ+K+DTWRFRLPA  +PEL  A FVDG+L+
Sbjct  65   VEIHPGVTKIVVRNGDK----GGKAELFLEQLKVDTWRFRLPASAKPELATAVFVDGELV  120

Query  618  VTVPK  632
            VTVPK
Sbjct  121  VTVPK  125



>ref|XP_011090707.1| PREDICTED: uncharacterized protein LOC105171332 [Sesamum indicum]
Length=168

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 113/165 (68%), Gaps = 25/165 (15%)
 Frame = +3

Query  243  SFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEI------GHVAEH  404
            S M+G+A   +LR+LPHVF KVLELPF SD DVIVEE  + FRFVAE+      GHV   
Sbjct  23   SQMEGTARK-KLRKLPHVFSKVLELPFASDADVIVEERPDLFRFVAEVKVDGKAGHV---  78

Query  405  gcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPEL  584
                   +AHAVEIHPG+ KIVVR++ + ++G   V LFL+++++D WRFRLP+  +PEL
Sbjct  79   -------KAHAVEIHPGVIKIVVRDDHK-RKGGGDVDLFLDKLEVDKWRFRLPSSARPEL  130

Query  585  TRAAFVDGKLIVTVPKggpggggrgELVNGRHAWGWGGSRIIRVQ  719
             +AAFV G+LIVTVP+GG G       V+G   WG  GSR++ VQ
Sbjct  131  AKAAFVAGELIVTVPRGGCGR------VDGGEIWG-AGSRLVLVQ  168



>ref|XP_007143266.1| hypothetical protein PHAVU_007G058000g [Phaseolus vulgaris]
 gb|ESW15260.1| hypothetical protein PHAVU_007G058000g [Phaseolus vulgaris]
Length=198

 Score =   141 bits (355),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 101/155 (65%), Gaps = 21/155 (14%)
 Frame = +3

Query  255  GSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAH  434
            G A + +LRRLPHVF  VLELPFRSD DV+VEE+ + FRFVAE   + +       +RAH
Sbjct  65   GIAGSKKLRRLPHVFSCVLELPFRSDADVVVEEDPDCFRFVAETEGIGD-------VRAH  117

Query  435  AVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKL  614
             +EIHPG+TKIVVR+         SV L L+Q++LD WRFRLP  T+PEL  A FVDG+L
Sbjct  118  TIEIHPGVTKIVVRDG-------GSVELSLDQLELDMWRFRLPESTRPELASAVFVDGEL  170

Query  615  IVTVPKggpggggrgELVNGRHAWGWGGSRIIRVQ  719
            IVTVPKG     G G+ V        GG R++ VQ
Sbjct  171  IVTVPKGHGEEDGDGDRV-------MGGGRLVLVQ  198



>ref|XP_009784306.1| PREDICTED: uncharacterized protein LOC104232739 [Nicotiana sylvestris]
Length=195

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 112/171 (65%), Gaps = 21/171 (12%)
 Frame = +3

Query  243  SFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEI----GHVAEHgc  410
            + M+G+    +LR+LPHVFGKVLELPFRSD DV VEE  E FRFVAE+    G  +    
Sbjct  34   AVMEGNPTK-KLRKLPHVFGKVLELPFRSDADVAVEEGPEFFRFVAEMEFDDGGESGGAG  92

Query  411  ggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALF--------LEQMKLDTWRFRLPA  566
             GGGLR  AVEIHPGITKIVVRN +    G     +F        LE++K+DTWRFRLPA
Sbjct  93   AGGGLRVQAVEIHPGITKIVVRNGA----GDGGAGVFSGGEDELLLEELKVDTWRFRLPA  148

Query  567  FTQPELTRAAFVDGKLIVTVPKggpggggrgELVNGRHAWGWGGSRIIRVQ  719
             T+PEL  A FVDG+LIVTVPK      G  +  +G++ WG GG R++ VQ
Sbjct  149  TTKPELATAVFVDGELIVTVPK---VDRGGVDFADGKNVWG-GGGRVVLVQ  195



>gb|EYU41476.1| hypothetical protein MIMGU_mgv1a020098mg [Erythranthe guttata]
Length=178

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 110/171 (64%), Gaps = 15/171 (9%)
 Frame = +3

Query  240  ASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEI----GHVAEHg  407
            +S  + + A  +LR+LPHVF KVLELPF SD DV VEE  E FRF AEI        +  
Sbjct  12   SSRTERNYAHKKLRKLPHVFSKVLELPFGSDADVAVEEGPEFFRFSAEIEVDADDDDDVA  71

Query  408  cggggLRAHAVEIHPGITKIVVRNNSRHQ-------EGSSSVALFLEQMKLDTWRFRLPA  566
              G  +RAHAVEIHPG+ KIVVRNNS+++          S + L L+++++DTWRFRLP+
Sbjct  72   AVGDDMRAHAVEIHPGVVKIVVRNNSQNKIKGGGGGGDESKMELLLDKLEVDTWRFRLPS  131

Query  567  FTQPELTRAAFVDGKLIVTVPKggpggggrgELVNGRHAWGWGGSRIIRVQ  719
             ++PEL  A FVDG+L VTVPKGGP  G    +V G   WG G S+++  Q
Sbjct  132  SSRPELATAVFVDGELSVTVPKGGPRRG----VVEGAEIWGCGISKLVLAQ  178



>ref|XP_004296753.1| PREDICTED: uncharacterized protein LOC101305745 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=218

 Score =   139 bits (351),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 87/120 (73%), Gaps = 11/120 (9%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPHVF +VLELPFRSD DVI+EEN + FRFVAE   V      G  +RAH VEIHP
Sbjct  86   KLRRLPHVFSRVLELPFRSDADVIIEENPDCFRFVAETESV-----FGDDVRAHTVEIHP  140

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+TKIVVR      E   +  L L++++LD WRFRLP  T+PEL RA FVDG+LIVTVPK
Sbjct  141  GVTKIVVR------ESGDAAELTLDELELDMWRFRLPESTRPELARAVFVDGELIVTVPK  194



>ref|XP_004296754.1| PREDICTED: uncharacterized protein LOC101305745 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=217

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 87/120 (73%), Gaps = 11/120 (9%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPHVF +VLELPFRSD DVI+EEN + FRFVAE   V      G  +RAH VEIHP
Sbjct  86   KLRRLPHVFSRVLELPFRSDADVIIEENPDCFRFVAETESV-----FGDDVRAHTVEIHP  140

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+TKIVVR      E   +  L L++++LD WRFRLP  T+PEL RA FVDG+LIVTVPK
Sbjct  141  GVTKIVVR------ESGDAAELTLDELELDMWRFRLPESTRPELARAVFVDGELIVTVPK  194



>ref|XP_009369852.1| PREDICTED: uncharacterized protein LOC103959230 [Pyrus x bretschneideri]
Length=245

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 97/144 (67%), Gaps = 20/144 (14%)
 Frame = +3

Query  222  NLTVRSASFMDGSAAAM-------RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVA  380
            N+TV+ +S    S A         +LRRLPHVF +VLELPFRSD DV+V+EN + FRFVA
Sbjct  75   NITVQYSSRNSLSEAQALLGPNHKKLRRLPHVFSRVLELPFRSDADVLVQENPDCFRFVA  134

Query  381  EIGHVAEHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRL  560
            E  ++ +       +RAH VEIHPG+TKIVVR        S SV L L++++LD WRFRL
Sbjct  135  EADNIGDD------VRAHTVEIHPGVTKIVVRE-------SGSVELTLDELELDMWRFRL  181

Query  561  PAFTQPELTRAAFVDGKLIVTVPK  632
            P  T+PEL  A FVDG+LIVTVPK
Sbjct  182  PESTRPELASAVFVDGELIVTVPK  205



>ref|XP_009589247.1| PREDICTED: uncharacterized protein LOC104086637 [Nicotiana tomentosiformis]
Length=193

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 111/165 (67%), Gaps = 11/165 (7%)
 Frame = +3

Query  243  SFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEI--GHVAEHgcgg  416
            + M+G+    +LR+LPHVFGKVLELPFRSD DV VEE  E FRFVAE+      E G  G
Sbjct  34   AVMEGNPTK-KLRKLPHVFGKVLELPFRSDADVAVEEGPEFFRFVAEMEFDDGGEGGGAG  92

Query  417  ggLRAHAVEIHPGITKIVVRNNSRHQEG----SSSVALFLEQMKLDTWRFRLPAFTQPEL  584
            GG+R  AVEIHPGITKIVVRN +          S   L LE++K+DTWRFRLPA T+PEL
Sbjct  93   GGVRVQAVEIHPGITKIVVRNGAGDGGVGAVPGSEDELLLEELKVDTWRFRLPATTKPEL  152

Query  585  TRAAFVDGKLIVTVPKggpggggrgELVNGRHAWGWGGSRIIRVQ  719
              A FVDG+L VTVPK   G  G  +  +GR+ WG GG R++ VQ
Sbjct  153  ATAVFVDGELTVTVPK---GDRGGEDFADGRNVWG-GGGRLVLVQ  193



>emb|CCW28815.1| hypothetical protein ARAX_AHF417E07-004 [Arachis hypogaea]
Length=164

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 95/138 (69%), Gaps = 17/138 (12%)
 Frame = +3

Query  222  NLTVRSASFMDGSAAA-MRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVA  398
            N+T++    +D +AAA  +LRRLPHVF +VLELPFRSD DV +EE  + FRFVAE   + 
Sbjct  12   NITIQFG--VDAAAAAGKKLRRLPHVFSRVLELPFRSDADVAIEEAPDCFRFVAETDGIG  69

Query  399  EHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQP  578
            +       +RAHAVEIHPG+TKIVVR+        S V   L+ ++LD WRFRLP  T+P
Sbjct  70   D-------VRAHAVEIHPGVTKIVVRDG-------SPVEFSLDDLQLDMWRFRLPESTRP  115

Query  579  ELTRAAFVDGKLIVTVPK  632
            EL  A FVDG+LIVTVPK
Sbjct  116  ELASAVFVDGELIVTVPK  133



>gb|KEH43864.1| heat shock 22 kDa protein [Medicago truncatula]
Length=167

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 86/123 (70%), Gaps = 14/123 (11%)
 Frame = +3

Query  264  AAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVE  443
            +  +LRRLPHVF +VLELPFRSD DV VEE A+ FRFVAE   + E       +RAH VE
Sbjct  34   SGKKLRRLPHVFSRVLELPFRSDADVAVEEAADCFRFVAETEGIGE-------VRAHTVE  86

Query  444  IHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVT  623
            IHPG+TKIVVR+         S+ L L+Q++LD WRFRLP  T PEL  A FVDG+LIVT
Sbjct  87   IHPGVTKIVVRDG-------ESLELSLDQLELDMWRFRLPDSTLPELASAVFVDGELIVT  139

Query  624  VPK  632
            VPK
Sbjct  140  VPK  142



>ref|XP_006360781.1| PREDICTED: uncharacterized protein LOC102603793 [Solanum tuberosum]
Length=188

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 100/150 (67%), Gaps = 5/150 (3%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LR+LPHVFGKVLELPFRSD DV VEE  E FRFVA +        G GG+R  AVEIH 
Sbjct  43   KLRKLPHVFGKVLELPFRSDADVAVEEGPEFFRFVAVMEFDDGGSGGAGGVRVQAVEIHT  102

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQM-KLDTWRFRLPAFTQPELTRAAFVDGKLIVTVP  629
            GITKIVVRN +     +  +   L +  K+DTWRFRLPA T PEL  A FVDG+LIVTVP
Sbjct  103  GITKIVVRNGAGDGGVAGGIEELLLEELKVDTWRFRLPATTMPELATAVFVDGELIVTVP  162

Query  630  KggpggggrgELVNGRHAWGWGGSRIIRVQ  719
            K    G G GE  +GR  WG GG R++ VQ
Sbjct  163  K---AGRGGGEFADGRDVWG-GGGRLVLVQ  188



>ref|XP_009345881.1| PREDICTED: uncharacterized protein LOC103937657 [Pyrus x bretschneideri]
Length=242

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 97/144 (67%), Gaps = 20/144 (14%)
 Frame = +3

Query  222  NLTVRSASFMDGSAAAM-------RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVA  380
            N+TV+ +S    S A         +LRRLPHVF +VLELPFRSD DV+V+EN + FRFVA
Sbjct  72   NITVQYSSRNSVSEAQALLGPNHKKLRRLPHVFSRVLELPFRSDADVLVQENPDCFRFVA  131

Query  381  EIGHVAEHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRL  560
            E  ++ +       +RAH VEI+PG+TKIVVR        S SV L L++++LD WRFRL
Sbjct  132  EADNIGDD------VRAHTVEIYPGVTKIVVRE-------SGSVELTLDELELDMWRFRL  178

Query  561  PAFTQPELTRAAFVDGKLIVTVPK  632
            P  T+PEL  A FVDG+LIVTVPK
Sbjct  179  PESTRPELASAVFVDGELIVTVPK  202



>ref|XP_004165791.1| PREDICTED: uncharacterized LOC101205778 [Cucumis sativus]
Length=240

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 92/121 (76%), Gaps = 14/121 (12%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEI-GHVAEHgcggggLRAHAVEIH  449
            +LRRLPH+F +VLELPFRSD DV+VEEN + FRF+AE  G++++      G+RAHAVEIH
Sbjct  106  KLRRLPHIFSRVLELPFRSDADVLVEENPDCFRFIAETDGNISD------GVRAHAVEIH  159

Query  450  PGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVP  629
            PG+ KIVVR N        S+ + +++++LD WRFRLP  T+PEL  AAFVDG+LIVTVP
Sbjct  160  PGVIKIVVREN-------ESLEMSIDELELDMWRFRLPETTRPELASAAFVDGELIVTVP  212

Query  630  K  632
            K
Sbjct  213  K  213



>ref|XP_004134135.1| PREDICTED: uncharacterized protein LOC101205778 [Cucumis sativus]
 gb|KGN56976.1| hypothetical protein Csa_3G146610 [Cucumis sativus]
Length=240

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 92/121 (76%), Gaps = 14/121 (12%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEI-GHVAEHgcggggLRAHAVEIH  449
            +LRRLPH+F +VLELPFRSD DV+VEEN + FRF+AE  G++++      G+RAHAVEIH
Sbjct  106  KLRRLPHIFSRVLELPFRSDADVLVEENPDCFRFIAETDGNISD------GVRAHAVEIH  159

Query  450  PGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVP  629
            PG+ KIVVR N        S+ + +++++LD WRFRLP  T+PEL  AAFVDG+LIVTVP
Sbjct  160  PGVIKIVVREN-------ESLEMSIDELELDMWRFRLPETTRPELASAAFVDGELIVTVP  212

Query  630  K  632
            K
Sbjct  213  K  213



>ref|XP_007223548.1| hypothetical protein PRUPE_ppa012159mg [Prunus persica]
 gb|EMJ24747.1| hypothetical protein PRUPE_ppa012159mg [Prunus persica]
Length=181

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 88/120 (73%), Gaps = 13/120 (11%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPHVF +VLELPFRSD +V+VEEN + FRF+AE  ++ +      G+RAH VEI+P
Sbjct  35   KLRRLPHVFSRVLELPFRSDAEVLVEENPDCFRFIAETDNIGD------GVRAHTVEIYP  88

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+TKIVVR        S S  L L++++LD WRFRLP  T+PEL  A FVDG+LIVTVPK
Sbjct  89   GVTKIVVRE-------SGSAELTLDELELDMWRFRLPESTRPELASAVFVDGELIVTVPK  141



>ref|XP_010326672.1| PREDICTED: uncharacterized protein LOC101246180 [Solanum lycopersicum]
Length=186

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 99/150 (66%), Gaps = 5/150 (3%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LR+LPHVFGKVLELPFRSD DV VEE  E FRFVA +        G GG+R  A+EIH 
Sbjct  41   KLRKLPHVFGKVLELPFRSDADVAVEEGPEFFRFVAVMEFDDGGSGGAGGVRVQAIEIHT  100

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQM-KLDTWRFRLPAFTQPELTRAAFVDGKLIVTVP  629
            G+TKIVVRN +        +   L +  K+DTWRFRLPA T PEL  A FVDG+LIVTVP
Sbjct  101  GVTKIVVRNGAGDGGVDGGIEELLLEELKVDTWRFRLPATTMPELATAVFVDGELIVTVP  160

Query  630  KggpggggrgELVNGRHAWGWGGSRIIRVQ  719
            K    G G GE  +GR  WG GG R++ VQ
Sbjct  161  K---AGRGGGEFADGRDVWG-GGGRLVLVQ  186



>ref|XP_003556055.1| PREDICTED: uncharacterized protein LOC100808440 [Glycine max]
Length=194

 Score =   136 bits (342),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 85/123 (69%), Gaps = 14/123 (11%)
 Frame = +3

Query  264  AAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVE  443
            A  +LRRLPHVF  VLELPFRSD DV VEE  + FRFVAE   + +       +RAH VE
Sbjct  63   AGKKLRRLPHVFSCVLELPFRSDADVAVEEAPDCFRFVAETDGIGD-------VRAHTVE  115

Query  444  IHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVT  623
            IHPG+TKIVVR+         SV L L+Q++LD WRFRLP  T+PEL  A FVDG+LIVT
Sbjct  116  IHPGVTKIVVRDGG-------SVELSLDQLELDMWRFRLPESTRPELASAVFVDGELIVT  168

Query  624  VPK  632
            VPK
Sbjct  169  VPK  171



>ref|XP_009335330.1| PREDICTED: uncharacterized protein LOC103928045 [Pyrus x bretschneideri]
Length=181

 Score =   135 bits (341),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 87/120 (73%), Gaps = 13/120 (11%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPHVF ++LELPFRSD DV+V+EN + FRFVAE  ++ +      G+R H +EIHP
Sbjct  35   KLRRLPHVFSRILELPFRSDADVLVQENPDCFRFVAEADNIGD------GVRTHTIEIHP  88

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+TKIVVR        S S  L L++++LD WRFRLP  T+PEL  A FVDG+LIVTVPK
Sbjct  89   GVTKIVVRE-------SGSAELTLDELELDMWRFRLPESTRPELASAVFVDGELIVTVPK  141



>ref|XP_002282665.1| PREDICTED: uncharacterized protein LOC100256202 [Vitis vinifera]
Length=168

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 95/143 (66%), Gaps = 22/143 (15%)
 Frame = +3

Query  204  LSDPLFNLTVRSASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAE  383
            LSDPL +  + S           +LRRLPH+F +VLELPF+SD DV VEE+++ FRFVA 
Sbjct  22   LSDPLRDRLMGSTQ--------KKLRRLPHIFSRVLELPFKSDADVAVEESSDCFRFVAV  73

Query  384  IGHVAEHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLP  563
               + +       +RAH VEIHPG+TKIV+R       GS  V L +++++LD WRFRLP
Sbjct  74   TDGIGD-------IRAHTVEIHPGVTKIVIR-------GSDVVELTMDELELDMWRFRLP  119

Query  564  AFTQPELTRAAFVDGKLIVTVPK  632
            A T+PEL  A +VDG+L+VTVPK
Sbjct  120  ATTRPELASAVYVDGELVVTVPK  142



>ref|XP_004496716.1| PREDICTED: uncharacterized protein LOC101514677 [Cicer arietinum]
Length=196

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 84/123 (68%), Gaps = 14/123 (11%)
 Frame = +3

Query  264  AAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVE  443
            +  +LRRLPHVF +VLELPFRSD DV VEE  + FRFVAE   + E       +R H VE
Sbjct  64   SGKKLRRLPHVFSRVLELPFRSDADVAVEEAPDCFRFVAETEGIGE-------VRTHTVE  116

Query  444  IHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVT  623
            IHPG+TKIVVR+         S+ L L+Q++LD WRFRLP  T PEL  A FVDG+LIVT
Sbjct  117  IHPGVTKIVVRDGE-------SLELSLDQLELDMWRFRLPDSTMPELASAVFVDGELIVT  169

Query  624  VPK  632
            VPK
Sbjct  170  VPK  172



>ref|XP_008340996.1| PREDICTED: uncharacterized protein LOC103403931 [Malus domestica]
Length=245

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 96/144 (67%), Gaps = 20/144 (14%)
 Frame = +3

Query  222  NLTVRSASFMDGSAAAM-------RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVA  380
            N+TV+ +S    S A         +LRRLPHVF +VLELPFRSD DV+V+EN + FRFVA
Sbjct  75   NITVQYSSRNSLSEAQALLGPNHKKLRRLPHVFSRVLELPFRSDADVLVQENPDCFRFVA  134

Query  381  EIGHVAEHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRL  560
            E  ++ +       +RAH VEIHPG+TKIVVR        S SV L L++++LD WRFRL
Sbjct  135  EADNIXDD------VRAHTVEIHPGVTKIVVRE-------SGSVELTLDELELDMWRFRL  181

Query  561  PAFTQPELTRAAFVDGKLIVTVPK  632
            P  T+PEL  A FV G+LIVTVPK
Sbjct  182  PESTRPELASAVFVGGELIVTVPK  205



>ref|XP_008390902.1| PREDICTED: uncharacterized protein LOC103453131 [Malus domestica]
Length=237

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 88/120 (73%), Gaps = 13/120 (11%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPHVF ++LELPFRSD DV+V+EN + FRFVAE  ++ +      G+RAH +EIHP
Sbjct  98   KLRRLPHVFSRILELPFRSDADVLVQENPDCFRFVAEADNIGD------GVRAHTIEIHP  151

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+TKIVVR        S S  L +++++LD WRFRLP  T+PEL  A FVDG+LIVTVPK
Sbjct  152  GVTKIVVRE-------SGSAELTMDELELDMWRFRLPESTRPELASAVFVDGELIVTVPK  204



>ref|XP_008224301.1| PREDICTED: uncharacterized protein LOC103324043 [Prunus mume]
Length=235

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 88/120 (73%), Gaps = 13/120 (11%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPHVF +VLELPFRSD +V+VEEN + FRF+AE  ++ +      G+RAH VEI+P
Sbjct  89   KLRRLPHVFSRVLELPFRSDAEVLVEENPDCFRFIAETDNIGD------GVRAHTVEIYP  142

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+TKIVVR        S S  L L++++LD WRFRLP  T+PEL  A FVDG+LIVTVPK
Sbjct  143  GVTKIVVRE-------SGSAELTLDELELDMWRFRLPESTRPELASAVFVDGELIVTVPK  195



>ref|XP_006356036.1| PREDICTED: uncharacterized protein LOC102591035 [Solanum tuberosum]
Length=148

 Score =   132 bits (332),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 85/120 (71%), Gaps = 5/120 (4%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LR+LPHVF KVLELP  S+ DV VEEN E FRF+A+I    +HG     +RA  VEIHP
Sbjct  8    KLRKLPHVFSKVLELPIPSNADVEVEENLEFFRFMAKI---EQHGENIRNVRAQTVEIHP  64

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            GITKIVVRN S   +G  +  L L+Q+ +DTWRFRLP   +PEL  A F DG+LIVTVPK
Sbjct  65   GITKIVVRNGS--GDGGEAELLMLDQLNVDTWRFRLPTSAKPELATAVFADGELIVTVPK  122



>emb|CBI26269.3| unnamed protein product [Vitis vinifera]
Length=213

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 95/143 (66%), Gaps = 22/143 (15%)
 Frame = +3

Query  204  LSDPLFNLTVRSASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAE  383
            LSDPL +  + S           +LRRLPH+F +VLELPF+SD DV VEE+++ FRFVA 
Sbjct  74   LSDPLRDRLMGSTQ--------KKLRRLPHIFSRVLELPFKSDADVAVEESSDCFRFVAV  125

Query  384  IGHVAEHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLP  563
               + +       +RAH VEIHPG+TKIV+R       GS  V L +++++LD WRFRLP
Sbjct  126  TDGIGD-------IRAHTVEIHPGVTKIVIR-------GSDVVELTMDELELDMWRFRLP  171

Query  564  AFTQPELTRAAFVDGKLIVTVPK  632
            A T+PEL  A +VDG+L+VTVPK
Sbjct  172  ATTRPELASAVYVDGELVVTVPK  194



>gb|KFK39542.1| hypothetical protein AALP_AA3G257800 [Arabis alpina]
Length=166

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 85/119 (71%), Gaps = 9/119 (8%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPH+F +VLELP RS+ DV VEE  + FRFVAE   V     GG  +RA+ VEIHPG
Sbjct  30   LRRLPHIFNRVLELPLRSEADVTVEEKPDCFRFVAETDGVC----GGDEMRAYMVEIHPG  85

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            ITKIVVR N     GSSS+ L L++++LD WRFRLP  T+PEL   A VDG LIVTVPK
Sbjct  86   ITKIVVRTN-----GSSSLGLSLDELELDVWRFRLPESTRPELVTVACVDGALIVTVPK  139



>ref|XP_008438664.1| PREDICTED: uncharacterized protein LOC103483704 [Cucumis melo]
Length=241

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 91/121 (75%), Gaps = 14/121 (12%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEI-GHVAEHgcggggLRAHAVEIH  449
            +LRRLPH+F +VLELPFRSD DV+VEEN + FRF+A   G++++      G+RAHAVEIH
Sbjct  107  KLRRLPHIFSRVLELPFRSDADVLVEENTDCFRFIAVTDGNISD------GVRAHAVEIH  160

Query  450  PGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVP  629
            PG+ KIVVR N        S+ + +++++LD WRFRLP  T+PEL  AAFVDG+LIVTVP
Sbjct  161  PGVIKIVVREN-------ESLEMAIDELELDMWRFRLPETTRPELASAAFVDGELIVTVP  213

Query  630  K  632
            K
Sbjct  214  K  214



>ref|XP_010096144.1| hypothetical protein L484_005423 [Morus notabilis]
 gb|EXB63460.1| hypothetical protein L484_005423 [Morus notabilis]
Length=215

 Score =   134 bits (336),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 87/123 (71%), Gaps = 12/123 (10%)
 Frame = +3

Query  264  AAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVE  443
            A  +LRRLPH+F +VLELPFRSD DV VEE+A+ FRFVAE   V       G +RAH VE
Sbjct  33   AHKKLRRLPHIFSRVLELPFRSDADVSVEESADFFRFVAETDGVG------GEVRAHTVE  86

Query  444  IHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVT  623
            IHPG+TKIVVR +  H E      L L++++LD WRFRLP  T+PEL  A  VDG+LIVT
Sbjct  87   IHPGVTKIVVRESGSHCE------LTLDELELDVWRFRLPETTRPELASAVLVDGELIVT  140

Query  624  VPK  632
            VPK
Sbjct  141  VPK  143



>ref|XP_003536530.1| PREDICTED: uncharacterized protein LOC100778094 [Glycine max]
Length=194

 Score =   133 bits (334),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 83/123 (67%), Gaps = 14/123 (11%)
 Frame = +3

Query  264  AAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVE  443
            A  +LRRLPHVF  VLELPFRSD DV VEE    FRFVAE   + +       +RAH VE
Sbjct  63   AGKKLRRLPHVFSCVLELPFRSDADVAVEEAPNFFRFVAETDGIGD-------VRAHTVE  115

Query  444  IHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVT  623
            IHPG+TKIVVR          SV L L+Q++LD WRFRLP  T+PEL  A FVDG+LIVT
Sbjct  116  IHPGVTKIVVREGG-------SVELSLDQLELDMWRFRLPESTRPELASAVFVDGELIVT  168

Query  624  VPK  632
            VPK
Sbjct  169  VPK  171



>emb|CDP03646.1| unnamed protein product [Coffea canephora]
Length=167

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 96/143 (67%), Gaps = 17/143 (12%)
 Frame = +3

Query  222  NLTVR---SASFMDGSAAAMR---LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAE  383
            N+T+R   ++S    +A A R   LRRLPH+F KVLELPF SD DV +EE A+ F+FV  
Sbjct  11   NMTLRYDIASSLSQANALACRQKKLRRLPHIFAKVLELPFHSDADVSIEETADYFKFVVP  70

Query  384  IGHVAEHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLP  563
               V +       +RAH +EI+PG+TKI++R N     G     LFL++++LD WRFRLP
Sbjct  71   TDDVGDD------VRAHTLEIYPGVTKILIRENDFVGSG-----LFLDELELDFWRFRLP  119

Query  564  AFTQPELTRAAFVDGKLIVTVPK  632
            A T+PE+  AA+VDG+L+VTVPK
Sbjct  120  AATRPEMATAAYVDGELVVTVPK  142



>ref|XP_002885507.1| hypothetical protein ARALYDRAFT_479772 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61766.1| hypothetical protein ARALYDRAFT_479772 [Arabidopsis lyrata subsp. 
lyrata]
Length=166

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 86/119 (72%), Gaps = 8/119 (7%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPH+F +VLELP RS+ DV VEE  + FRFVAE   + +   G G +RA+ VEIHPG
Sbjct  29   LRRLPHIFNRVLELPLRSEADVTVEERHDCFRFVAETVGLCD---GDGEMRAYMVEIHPG  85

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            ITKIVVR N     GSSS+ L L++++LD WRFRLP  T+PEL   A VDG LIVTVPK
Sbjct  86   ITKIVVRTN-----GSSSLGLSLDELELDVWRFRLPESTRPELVTVACVDGDLIVTVPK  139



>gb|KDP40188.1| hypothetical protein JCGZ_02186 [Jatropha curcas]
Length=185

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 85/120 (71%), Gaps = 13/120 (11%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F +VLELPFRSD DV VEEN + FRFVAE  ++ E       +RAH +EIHP
Sbjct  44   KLRRLPHIFSRVLELPFRSDADVSVEENPDCFRFVAETDNIGE-------VRAHTIEIHP  96

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+TKIV+R N  + E SS     L+ ++LD WRFRLP  T+PEL  A   DG+LIVTVPK
Sbjct  97   GVTKIVIRPNG-YLELSS-----LDDLELDMWRFRLPESTRPELASAVLTDGELIVTVPK  150



>dbj|BAB01468.1| unnamed protein product [Arabidopsis thaliana]
Length=167

 Score =   130 bits (326),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 85/119 (71%), Gaps = 8/119 (7%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPH+F +VLELP RS+ DV VEE  + FRFVAE   +     G G +RA+ VEIHPG
Sbjct  30   LRRLPHIFNRVLELPLRSEADVAVEERHDCFRFVAETVGLCN---GDGEMRAYMVEIHPG  86

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            ITKIVVR N     GSSS+ L L++++LD WRFRLP  T+PEL   A VDG LIVTVPK
Sbjct  87   ITKIVVRTN-----GSSSLGLSLDELELDVWRFRLPESTRPELVTVACVDGDLIVTVPK  140



>ref|XP_002862235.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002885301.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38493.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61560.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=168

 Score =   130 bits (326),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 85/119 (71%), Gaps = 8/119 (7%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPH+F +VLELP RS+ DV VEE  + FRFVAE   +     G G +RA+ VEIHPG
Sbjct  30   LRRLPHIFNRVLELPLRSEADVTVEERHDCFRFVAETVGLC---GGDGEMRAYMVEIHPG  86

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            ITKIVVR N     GSSS+ L L++++LD WRFRLP  T+PEL   A VDG LIVTVPK
Sbjct  87   ITKIVVRTN-----GSSSLGLSLDELELDVWRFRLPESTRPELVTVACVDGDLIVTVPK  140



>ref|XP_006419957.1| hypothetical protein CICLE_v10006449mg [Citrus clementina]
 gb|ESR33197.1| hypothetical protein CICLE_v10006449mg [Citrus clementina]
Length=187

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 90/138 (65%), Gaps = 13/138 (9%)
 Frame = +3

Query  219  FNLTVRSASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVA  398
            FN  +R+   +       +LRRLPH+F +VLELPFRSD DV VEE+ + F+FVAE   + 
Sbjct  26   FNSNLRNPQNLSTGFHNKKLRRLPHIFTRVLELPFRSDADVAVEESPDYFKFVAETDGMG  85

Query  399  EHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQP  578
            E       +RAH VEIHPG+TKIV+R N   +  S      L++++LD WRFRLP  T+P
Sbjct  86   E-------VRAHMVEIHPGVTKIVIRPNGCVELSS------LDELELDMWRFRLPESTRP  132

Query  579  ELTRAAFVDGKLIVTVPK  632
            EL  A F DG+LIVTVPK
Sbjct  133  ELASAVFEDGELIVTVPK  150



>ref|NP_566710.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL62383.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15490.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76650.1| uncharacterized protein AT3G22530 [Arabidopsis thaliana]
Length=198

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 85/119 (71%), Gaps = 8/119 (7%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPH+F +VLELP RS+ DV VEE  + FRFVAE   +     G G +RA+ VEIHPG
Sbjct  61   LRRLPHIFNRVLELPLRSEADVAVEERHDCFRFVAETVGLCN---GDGEMRAYMVEIHPG  117

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            ITKIVVR N     GSSS+ L L++++LD WRFRLP  T+PEL   A VDG LIVTVPK
Sbjct  118  ITKIVVRTN-----GSSSLGLSLDELELDVWRFRLPESTRPELVTVACVDGDLIVTVPK  171



>ref|XP_002517122.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45285.1| conserved hypothetical protein [Ricinus communis]
Length=175

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 86/126 (68%), Gaps = 13/126 (10%)
 Frame = +3

Query  255  GSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAH  434
            G +   +LRRLPH+F +VLELPFRSD DV VEE+ + FRFVAE  ++ E       +RAH
Sbjct  31   GGSHNKKLRRLPHIFSRVLELPFRSDADVSVEESPDCFRFVAETDNIGE-------IRAH  83

Query  435  AVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKL  614
             +EIHPG+TKIV+R N     G   ++ F + ++LD WRFRLP  T+PEL  A   DG+L
Sbjct  84   TIEIHPGVTKIVIRPN-----GYLELSPF-DDLELDMWRFRLPESTRPELASAVLTDGEL  137

Query  615  IVTVPK  632
            IVTVPK
Sbjct  138  IVTVPK  143



>ref|XP_006489409.1| PREDICTED: uncharacterized protein LOC102610341 [Citrus sinensis]
 gb|KDO74551.1| hypothetical protein CISIN_1g023450mg [Citrus sinensis]
Length=244

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 90/138 (65%), Gaps = 13/138 (9%)
 Frame = +3

Query  219  FNLTVRSASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVA  398
            FN  +R+   +       +LRRLPH+F +VLELPFRSD DV VEE+ + F+FVAE   + 
Sbjct  83   FNSNLRNPQNLSTGFHNKKLRRLPHIFTRVLELPFRSDADVAVEESPDYFKFVAETDGMG  142

Query  399  EHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQP  578
            E       +RAH VEIHPG+TKIV+R N   +  S      L++++LD WRFRLP  T+P
Sbjct  143  E-------VRAHMVEIHPGVTKIVIRPNGCVELSS------LDELELDMWRFRLPESTRP  189

Query  579  ELTRAAFVDGKLIVTVPK  632
            EL  A F DG+LIVTVPK
Sbjct  190  ELASAVFEDGELIVTVPK  207



>gb|AAM62556.1| unknown [Arabidopsis thaliana]
Length=198

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 85/119 (71%), Gaps = 8/119 (7%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPH+F +VLELP RS+ DV VEE  + FRFVAE   +     G G +RA+ VEIHPG
Sbjct  61   LRRLPHIFNRVLELPLRSEADVAVEERHDCFRFVAETVGLCN---GDGEMRAYMVEIHPG  117

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            ITKIVVR N     GSSS+ L L++++LD WRFRLP  T+PEL   A VDG LIVTVPK
Sbjct  118  ITKIVVRTN-----GSSSLGLSLDELELDVWRFRLPESTRPELVTVASVDGDLIVTVPK  171



>gb|KDO74550.1| hypothetical protein CISIN_1g023450mg [Citrus sinensis]
Length=282

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 90/138 (65%), Gaps = 13/138 (9%)
 Frame = +3

Query  219  FNLTVRSASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVA  398
            FN  +R+   +       +LRRLPH+F +VLELPFRSD DV VEE+ + F+FVAE   + 
Sbjct  83   FNSNLRNPQNLSTGFHNKKLRRLPHIFTRVLELPFRSDADVAVEESPDYFKFVAETDGMG  142

Query  399  EHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQP  578
            E       +RAH VEIHPG+TKIV+R N   +  S      L++++LD WRFRLP  T+P
Sbjct  143  E-------VRAHMVEIHPGVTKIVIRPNGCVELSS------LDELELDMWRFRLPESTRP  189

Query  579  ELTRAAFVDGKLIVTVPK  632
            EL  A F DG+LIVTVPK
Sbjct  190  ELASAVFEDGELIVTVPK  207



>ref|XP_006299138.1| hypothetical protein CARUB_v10015280mg [Capsella rubella]
 gb|EOA32036.1| hypothetical protein CARUB_v10015280mg [Capsella rubella]
Length=199

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 85/119 (71%), Gaps = 8/119 (7%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPH+F +VLELP RS+ DV VEE  + FRFVAE   + +   G G +RA+ VEIHPG
Sbjct  61   LRRLPHIFNRVLELPLRSEADVSVEERQDCFRFVAETVGLCD---GDGEMRAYMVEIHPG  117

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            ITKIVVR N      SSS+ L L++++LD WRFRLP  T+PEL   A VDG LIVTVPK
Sbjct  118  ITKIVVRTNE-----SSSLGLSLDELELDVWRFRLPESTRPELVTVACVDGALIVTVPK  171



>ref|XP_010466538.1| PREDICTED: uncharacterized protein LOC104746708 [Camelina sativa]
Length=195

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 85/119 (71%), Gaps = 8/119 (7%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPH+F +VLELP RS+ DV VEE  + FRFVAE   + +   G G +RA+ VEIHPG
Sbjct  61   LRRLPHIFNRVLELPLRSEADVSVEERQDCFRFVAETVGLCD---GDGDMRAYMVEIHPG  117

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            ITKIVVR N      SSS+ L L++++LD WRFRLP  T+PEL   A VDG LIVTVPK
Sbjct  118  ITKIVVRTNE-----SSSLGLSLDELELDVWRFRLPESTRPELVTVACVDGALIVTVPK  171



>ref|XP_010511470.1| PREDICTED: uncharacterized protein LOC104787563 [Camelina sativa]
Length=198

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 85/119 (71%), Gaps = 8/119 (7%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPH+F +VLELP  S+ DV VEE  + FRFVAE   + +   G G +RA+ VEIHPG
Sbjct  62   LRRLPHIFNRVLELPLSSEADVSVEERQDCFRFVAETVGLCD---GDGDMRAYMVEIHPG  118

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            ITKIVVR N     GSSS+ L L++++LD WRFRLP  T+PEL   A +DG LIVTVPK
Sbjct  119  ITKIVVRTN-----GSSSLGLSLDELELDVWRFRLPESTRPELVTVACIDGALIVTVPK  172



>ref|XP_010488283.1| PREDICTED: uncharacterized protein LOC104766152 [Camelina sativa]
Length=196

 Score =   128 bits (321),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 84/119 (71%), Gaps = 7/119 (6%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPH+F +VLELP RS+ DV VEE  + FRFVAE   + +     G +RA+ VEIHPG
Sbjct  61   LRRLPHIFNRVLELPLRSEADVSVEERHDCFRFVAETVGLCD--GSDGDMRAYMVEIHPG  118

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            ITKIVVR N      SSS+ L L++++LD WRFRLP  T+PEL   A VDG LIVTVPK
Sbjct  119  ITKIVVRTNE-----SSSLGLSLDELELDVWRFRLPESTRPELVTVACVDGALIVTVPK  172



>ref|XP_011026667.1| PREDICTED: uncharacterized protein LOC105127188 [Populus euphratica]
Length=171

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 84/126 (67%), Gaps = 12/126 (10%)
 Frame = +3

Query  255  GSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAH  434
            G +   +LRRLPH+F ++LELPFRSD DV VEEN + FRFVAE           G +RAH
Sbjct  24   GGSQNKKLRRLPHIFSRILELPFRSDADVSVEENPDCFRFVAETDD------NIGDMRAH  77

Query  435  AVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKL  614
             VEIHPG+ KIV+R N  + E SS     L+ ++LD WRFRLP  T+PEL  A   DG+L
Sbjct  78   TVEIHPGVIKIVIRPNG-YLELSS-----LDDLELDMWRFRLPETTRPELASAVLADGEL  131

Query  615  IVTVPK  632
            IVTVPK
Sbjct  132  IVTVPK  137



>ref|XP_002312535.2| hypothetical protein POPTR_0008s15390g [Populus trichocarpa]
 gb|EEE89902.2| hypothetical protein POPTR_0008s15390g [Populus trichocarpa]
Length=171

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 83/126 (66%), Gaps = 12/126 (10%)
 Frame = +3

Query  255  GSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAH  434
            G     +LRRLPH+F ++LELPFRSD DV VEEN + FRFVAE           G +RAH
Sbjct  24   GGFQNKKLRRLPHIFSRILELPFRSDADVSVEENPDCFRFVAETDD------NIGDMRAH  77

Query  435  AVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKL  614
             VEIHPG+ KIV+R N  + E SS     L+ ++LD WRFRLP  T+PEL  A   DG+L
Sbjct  78   TVEIHPGVIKIVIRPNG-YLELSS-----LDDLELDMWRFRLPETTRPELASAVLADGEL  131

Query  615  IVTVPK  632
            IVTVPK
Sbjct  132  IVTVPK  137



>ref|XP_011030681.1| PREDICTED: uncharacterized protein LOC105130057 isoform X2 [Populus 
euphratica]
Length=229

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 86/127 (68%), Gaps = 14/127 (11%)
 Frame = +3

Query  255  GSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEI-GHVAEHgcggggLRA  431
            G +   +LRRLPH+F +VLELPFRSD DV VEEN + FRFVAE   ++ E       +RA
Sbjct  86   GGSQHKKLRRLPHIFSRVLELPFRSDADVSVEENPDCFRFVAETDNNIGE-------VRA  138

Query  432  HAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGK  611
            H VEI+PG+TKIV+R N  + E S      L+ ++LD WRFRLP  T+PEL  A   DG+
Sbjct  139  HTVEIYPGVTKIVIRPNG-YLELSP-----LDDLELDMWRFRLPETTRPELASAVLADGE  192

Query  612  LIVTVPK  632
            LIVTVPK
Sbjct  193  LIVTVPK  199



>ref|XP_009108819.1| PREDICTED: uncharacterized protein LOC103834498 [Brassica rapa]
Length=162

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 83/119 (70%), Gaps = 9/119 (8%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPH+F +VLELP RS+ DV VEEN + FRFVAE   V     GGG + A+ VEIHPG
Sbjct  29   LRRLPHIFNRVLELPLRSEADVSVEENPDCFRFVAETDGV---RGGGGEMTAYMVEIHPG  85

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            ITKIVVR N        S+ L L++++LD WRFRLP  T+PEL   A VDG L+VTVPK
Sbjct  86   ITKIVVRTN------GLSLGLSLDELELDVWRFRLPETTRPELVTVACVDGALVVTVPK  138



>ref|XP_011030680.1| PREDICTED: uncharacterized protein LOC105130057 isoform X1 [Populus 
euphratica]
Length=242

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 86/127 (68%), Gaps = 14/127 (11%)
 Frame = +3

Query  255  GSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEI-GHVAEHgcggggLRA  431
            G +   +LRRLPH+F +VLELPFRSD DV VEEN + FRFVAE   ++ E       +RA
Sbjct  86   GGSQHKKLRRLPHIFSRVLELPFRSDADVSVEENPDCFRFVAETDNNIGE-------VRA  138

Query  432  HAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGK  611
            H VEI+PG+TKIV+R N  + E S      L+ ++LD WRFRLP  T+PEL  A   DG+
Sbjct  139  HTVEIYPGVTKIVIRPNG-YLELSP-----LDDLELDMWRFRLPETTRPELASAVLADGE  192

Query  612  LIVTVPK  632
            LIVTVPK
Sbjct  193  LIVTVPK  199



>ref|XP_007034782.1| 17.6 kDa class II heat shock protein [Theobroma cacao]
 gb|EOY05708.1| 17.6 kDa class II heat shock protein [Theobroma cacao]
Length=257

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 91/138 (66%), Gaps = 16/138 (12%)
 Frame = +3

Query  228  TVRSA--SFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEI-GHVA  398
            T RS   S + G  +  +LRRLPH+F +VLELPFRSD DV VEE+ + F+FVAE  G + 
Sbjct  94   TTRSQAESLLSG-GSHKKLRRLPHIFSRVLELPFRSDADVAVEESPDCFKFVAETDGRIG  152

Query  399  EHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQP  578
            +       +RAH VEIHPG+TKIV+R+NS            L+ ++LD WRFRLP  T+P
Sbjct  153  D------VVRAHTVEIHPGVTKIVIRSNSLVDFS------LLDDLELDMWRFRLPETTRP  200

Query  579  ELTRAAFVDGKLIVTVPK  632
            EL  A + DG+LIVTVPK
Sbjct  201  ELASAVYEDGELIVTVPK  218



>ref|XP_002314693.2| hypothetical protein POPTR_0010s09640g [Populus trichocarpa]
 gb|EEF00864.2| hypothetical protein POPTR_0010s09640g [Populus trichocarpa]
Length=236

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 86/127 (68%), Gaps = 14/127 (11%)
 Frame = +3

Query  255  GSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEI-GHVAEHgcggggLRA  431
            G +   +LRRLPH+F +VLELPFRSD DV VEEN + FRFVAE   ++ E       +RA
Sbjct  86   GGSQHKKLRRLPHIFSRVLELPFRSDADVSVEENPDCFRFVAETDNNIGE-------VRA  138

Query  432  HAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGK  611
            H VEI+PG+TKIV+R N     G   ++  L+ ++LD WRFRLP  T+PEL  A   DG+
Sbjct  139  HTVEIYPGVTKIVIRPN-----GYLDISP-LDDLELDMWRFRLPETTRPELASAVLADGE  192

Query  612  LIVTVPK  632
            LIVTVPK
Sbjct  193  LIVTVPK  199



>ref|XP_011021501.1| PREDICTED: uncharacterized protein LOC105123561 isoform X2 [Populus 
euphratica]
Length=229

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 86/127 (68%), Gaps = 14/127 (11%)
 Frame = +3

Query  255  GSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEI-GHVAEHgcggggLRA  431
            G +   +LRRLPH+F +VLELPFRSD DV VEEN + FRFVAE   ++ E       +RA
Sbjct  86   GGSQHKKLRRLPHIFSRVLELPFRSDADVSVEENPDCFRFVAETDNNIGE-------VRA  138

Query  432  HAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGK  611
            H VEI+PG+TKIV+R N  + E S      ++ ++LD WRFRLP  T+PEL  A   DG+
Sbjct  139  HTVEIYPGVTKIVIRPNG-YLELSP-----IDDLELDMWRFRLPETTRPELASAVLADGE  192

Query  612  LIVTVPK  632
            LIVTVPK
Sbjct  193  LIVTVPK  199



>ref|XP_011021500.1| PREDICTED: uncharacterized protein LOC105123561 isoform X1 [Populus 
euphratica]
Length=242

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 84/127 (66%), Gaps = 14/127 (11%)
 Frame = +3

Query  255  GSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEI-GHVAEHgcggggLRA  431
            G +   +LRRLPH+F +VLELPFRSD DV VEEN + FRFVAE   ++ E       +RA
Sbjct  86   GGSQHKKLRRLPHIFSRVLELPFRSDADVSVEENPDCFRFVAETDNNIGE-------VRA  138

Query  432  HAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGK  611
            H VEI+PG+TKIV+R N   +         ++ ++LD WRFRLP  T+PEL  A   DG+
Sbjct  139  HTVEIYPGVTKIVIRPNGYLELSP------IDDLELDMWRFRLPETTRPELASAVLADGE  192

Query  612  LIVTVPK  632
            LIVTVPK
Sbjct  193  LIVTVPK  199



>ref|XP_006406152.1| hypothetical protein EUTSA_v10021506mg [Eutrema salsugineum]
 gb|ESQ47605.1| hypothetical protein EUTSA_v10021506mg [Eutrema salsugineum]
Length=213

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 84/119 (71%), Gaps = 6/119 (5%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPH+F +VLELP RS+ DV VEE  + FRFVAE   +   G GG  +RA+ VEI+PG
Sbjct  71   LRRLPHIFNRVLELPLRSEADVAVEEKPDFFRFVAETDGLCGGGGGGE-MRAYMVEIYPG  129

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            ITKIVVR N      S+S+ L L++++LD WRFRLP  T+PEL     VDG LIVTVPK
Sbjct  130  ITKIVVRTNE-----STSLGLSLDELELDVWRFRLPESTRPELVTVDCVDGALIVTVPK  183



>emb|CDO99072.1| unnamed protein product [Coffea canephora]
Length=163

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 105/167 (63%), Gaps = 15/167 (9%)
 Frame = +3

Query  222  NLTVRSASFMDGSAAAMR-LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVA  398
            N+ +R AS    +  A++ LR+LPHVFGKVLELPF SD DV VE++ E  RF+A++    
Sbjct  11   NMNMRDASDSSVNGHALKKLRKLPHVFGKVLELPFGSDADVDVEDSHETIRFIAKVEIDG  70

Query  399  EHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQP  578
            E       +RAHAVEIHPG+TKIVVR      +    + L L+++ +DTWRFRLP   QP
Sbjct  71   EDVANE--VRAHAVEIHPGVTKIVVR------KDEGDLDLLLDKLNIDTWRFRLPRSAQP  122

Query  579  ELTRAAFVDGKLIVTVPKggpggggrgELVNGRHAWGWGGSRIIRVQ  719
             L  A FVDG+LI+TVPK     G   E  +GR  W  G SR++ VQ
Sbjct  123  ALASAVFVDGELIITVPK-----GNSREFGDGRDVW-LGDSRLVLVQ  163



>ref|NP_193219.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB10262.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78525.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAT06418.1| At4g14830 [Arabidopsis thaliana]
 gb|AAT41810.1| At4g14830 [Arabidopsis thaliana]
 gb|AEE83507.1| uncharacterized protein AT4G14830 [Arabidopsis thaliana]
Length=152

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 87/121 (72%), Gaps = 11/121 (9%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F +VLELP +SD DV VEE+ + FRFVAE          GGG+RA+ VEIHP
Sbjct  29   KLRRLPHIFSRVLELPLKSDADVAVEESHDCFRFVAETDGGG-----GGGVRAYMVEIHP  83

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPEL-TRAAFVDGKLIVTVP  629
            G+TKI+VR N     GSSS+ L L++++LD WRFRLP  T+PEL T     DG+LIVTVP
Sbjct  84   GVTKILVRTN-----GSSSLGLSLDELELDVWRFRLPESTRPELVTVDCDGDGELIVTVP  138

Query  630  K  632
            K
Sbjct  139  K  139



>ref|XP_010435058.1| PREDICTED: uncharacterized protein LOC104718929 [Camelina sativa]
Length=149

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 86/121 (71%), Gaps = 12/121 (10%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F +VLELP +SD DV V+EN + FRFVAE           GG+RA+ VEIHP
Sbjct  24   KLRRLPHIFSRVLELPLKSDADVAVQENPDCFRFVAETNGGG------GGVRAYMVEIHP  77

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPEL-TRAAFVDGKLIVTVP  629
            G+TKI+VR N     GSSS+ L L++++LD WRFRLP  T+P+L T     DG+LIVTVP
Sbjct  78   GVTKILVRTN-----GSSSLGLSLDELELDVWRFRLPESTRPDLVTVDCDGDGELIVTVP  132

Query  630  K  632
            K
Sbjct  133  K  133



>emb|CDY34247.1| BnaA01g24640D [Brassica napus]
Length=162

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 82/119 (69%), Gaps = 9/119 (8%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPH+F +VLELP RS+ DV VEE  + FRFVAE   V     GGG + A+ VEIHPG
Sbjct  29   LRRLPHIFNRVLELPLRSEADVSVEEKPDCFRFVAETDGV---RGGGGEMTAYMVEIHPG  85

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            ITKIVVR N        S+ L L++++LD WRFRLP  T+PEL   A VDG L+VTVPK
Sbjct  86   ITKIVVRTNG------LSLGLSLDELELDVWRFRLPETTRPELVTVACVDGALVVTVPK  138



>ref|XP_009788742.1| PREDICTED: uncharacterized protein LOC104236511 [Nicotiana sylvestris]
Length=163

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 91/137 (66%), Gaps = 8/137 (6%)
 Frame = +3

Query  222  NLTVRSASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAE  401
            N+T+R+   +  + +  +LRRLPH+F KVLELPF SD DV ++E ++ FRFV  I   A+
Sbjct  12   NITLRNDIVL-SAFSQKKLRRLPHIFAKVLELPFHSDADVSIQETSDSFRFV--IPTDAD  68

Query  402  HgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPE  581
                G  + AH VEI+PG+TKIV+R ++     SS     L  ++LD WRFRLPA T PE
Sbjct  69   DVGLGRNIAAHIVEIYPGVTKIVIRGDNVFDTSSS-----LSGLELDLWRFRLPAETLPE  123

Query  582  LTRAAFVDGKLIVTVPK  632
            L  AA+ DG+L+VTVPK
Sbjct  124  LATAAYSDGELVVTVPK  140



>ref|XP_010449982.1| PREDICTED: uncharacterized protein LOC104732148 [Camelina sativa]
Length=151

 Score =   121 bits (303),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 87/121 (72%), Gaps = 12/121 (10%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F +VLELP +SD DV V+EN + FRFVAE         GGGG+RA+ VEIHP
Sbjct  24   KLRRLPHIFSRVLELPLKSDADVAVQENPDCFRFVAETN------GGGGGVRAYMVEIHP  77

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPEL-TRAAFVDGKLIVTVP  629
            G+TKI+VR N     GSSS+ L L +++LD WRFRLP  T+P+L T     DG+LIVTVP
Sbjct  78   GVTKILVRTN-----GSSSLGLSLNELELDVWRFRLPESTRPDLVTVDCDGDGELIVTVP  132

Query  630  K  632
            K
Sbjct  133  K  133



>ref|XP_004234233.1| PREDICTED: uncharacterized protein LOC101268648 [Solanum lycopersicum]
Length=139

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 80/120 (67%), Gaps = 11/120 (9%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LR+LPHVF KVL+LP  SD DV V EN + FRF+A++    +HG     +RA  VEIHP
Sbjct  8    KLRKLPHVFSKVLQLPIPSDADVEVVENPDFFRFMAKMD---QHGENIRNVRAQTVEIHP  64

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            GITKIVV  N             L+Q+ +DTWRFRLP  T+PEL  AAF DG+LIVTVPK
Sbjct  65   GITKIVVVRNGGEA--------MLDQLNVDTWRFRLPTSTKPELATAAFADGELIVTVPK  116



>ref|XP_006286098.1| hypothetical protein CARUB_v10007641mg [Capsella rubella]
 gb|EOA18996.1| hypothetical protein CARUB_v10007641mg [Capsella rubella]
Length=147

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 85/121 (70%), Gaps = 13/121 (11%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F +VLELP RSD DV V+E+ + FRFVAE            G+RA+ VEIHP
Sbjct  26   KLRRLPHIFSRVLELPLRSDADVAVQESRDCFRFVAETNGGG-------GVRAYMVEIHP  78

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPEL-TRAAFVDGKLIVTVP  629
            G+TKI+VR N     GSSS+ L L++++LD WRFRLP  T+P+L T     DG+LIVTVP
Sbjct  79   GVTKILVRTN-----GSSSLGLSLDELELDVWRFRLPESTRPDLVTVDCDGDGELIVTVP  133

Query  630  K  632
            K
Sbjct  134  K  134



>ref|XP_009145320.1| PREDICTED: uncharacterized protein LOC103869031 [Brassica rapa]
Length=192

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 91/148 (61%), Gaps = 16/148 (11%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPH+F +VLELP RS+ DV VEE  + FRFVAE     E  C GG +RA+ V+IHPG
Sbjct  61   LRRLPHIFSRVLELPLRSEADVAVEEKHDCFRFVAE----TEGLCDGGEMRAYVVDIHPG  116

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPKg  635
            ITKIVVR N        S+ L L++++LD WRFRLP  T+PEL     VDG LIVTVPK 
Sbjct  117  ITKIVVRTN------GLSLGLSLDELELDMWRFRLPETTRPELVTVVCVDGILIVTVPK-  169

Query  636  gpggggrgELVNGRHAWGWGGSRIIRVQ  719
                    E  +G    G    R++ VQ
Sbjct  170  -----MVPEEEDGGFGQGMASGRLVLVQ  192



>emb|CDX98212.1| BnaC07g08860D [Brassica napus]
Length=163

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 82/119 (69%), Gaps = 9/119 (8%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPH+F +VLELP RS+ DV VEE  + FRFVAE   +     GGG + A+ VEIHPG
Sbjct  31   LRRLPHIFNRVLELPLRSEADVSVEEKPDCFRFVAETDGL---RGGGGEMTAYMVEIHPG  87

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            ITKIVVR N        S+ L L++++LD WRFRLP  T+PEL   A VDG L+VTVPK
Sbjct  88   ITKIVVRTNGL------SLGLSLDELELDVWRFRLPETTRPELVTVACVDGALVVTVPK  140



>emb|CDY10651.1| BnaA05g17110D [Brassica napus]
Length=196

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 91/148 (61%), Gaps = 16/148 (11%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPH+F +VLELP RS+ DV VEE  + FRFVAE     E  C GG +RA+ V+IHPG
Sbjct  65   LRRLPHIFSRVLELPLRSEADVAVEEKHDCFRFVAE----TEGLCDGGEMRAYVVDIHPG  120

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPKg  635
            ITKIVVR N        S+ L L++++LD WRFRLP  T+PEL     VDG LIVTVPK 
Sbjct  121  ITKIVVRTNG------LSLGLSLDELELDMWRFRLPETTRPELVTVVCVDGVLIVTVPK-  173

Query  636  gpggggrgELVNGRHAWGWGGSRIIRVQ  719
                    E  +G    G    R++ VQ
Sbjct  174  -----MLPEEEDGGFRQGMASGRLVLVQ  196



>ref|XP_008447155.1| PREDICTED: uncharacterized protein LOC103489672 [Cucumis melo]
Length=169

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 80/120 (67%), Gaps = 13/120 (11%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPHVF +VLELPFRSD DV + EN+  FRFVAE   V+E        RAH V+IHP
Sbjct  38   KLRRLPHVFSRVLELPFRSDADVSIVENSNCFRFVAETDGVSEE------FRAHTVQIHP  91

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+ K+VVR     Q G   +   L+++++D WRFRLP  T PEL  A F  GKLIVTVPK
Sbjct  92   GVIKVVVR-----QIG--DLESTLDELEIDMWRFRLPETTLPELATAVFDGGKLIVTVPK  144



>ref|XP_002870278.1| hypothetical protein ARALYDRAFT_915349 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46537.1| hypothetical protein ARALYDRAFT_915349 [Arabidopsis lyrata subsp. 
lyrata]
Length=152

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 85/121 (70%), Gaps = 11/121 (9%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F +VLELP +SD DV VEE+ + FRFVAE           GG+RA+ VEIHP
Sbjct  29   KLRRLPHIFSRVLELPLKSDADVAVEESHDCFRFVAETDGGGG-----GGVRAYMVEIHP  83

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPEL-TRAAFVDGKLIVTVP  629
            G+ KI+VR N     GSSS+ L L++++LD WRFRLP  T+P+L T     DG+LIVTVP
Sbjct  84   GVVKILVRTN-----GSSSLGLSLDELELDVWRFRLPEATRPDLVTVDCDGDGELIVTVP  138

Query  630  K  632
            K
Sbjct  139  K  139



>ref|XP_004159040.1| PREDICTED: heat shock 22 kDa protein, chloroplastic-like [Cucumis 
sativus]
Length=164

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 81/139 (58%), Gaps = 22/139 (16%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPHVF +VLELPFRSD DV + EN   FRFVAE   + E        RAH V+IHP
Sbjct  38   KLRRLPHVFSRVLELPFRSDADVSIVENCNCFRFVAETDGITED------FRAHTVQIHP  91

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+ K+VVR     Q G       L+++++D WRFRLP  T P+L  A F  GKLIVTVPK
Sbjct  92   GVIKVVVR-----QIGDLEST--LDELEIDMWRFRLPETTLPDLATAVFDGGKLIVTVPK  144

Query  633  ggpggggrgELVNGRHAWG  689
                         G  AWG
Sbjct  145  REDA---------GEGAWG  154



>ref|XP_009616605.1| PREDICTED: uncharacterized protein LOC104109107 [Nicotiana tomentosiformis]
Length=163

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 90/137 (66%), Gaps = 8/137 (6%)
 Frame = +3

Query  222  NLTVRSASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAE  401
            N+T+R+   +  + +  +LRRLPH+F KVLELPF SD DV ++E ++ FRFV  I   A+
Sbjct  12   NITLRNDIVL-SAFSQKKLRRLPHIFAKVLELPFHSDADVSIQETSDSFRFV--IPTDAD  68

Query  402  HgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPE  581
                G  + AH VEI+PG+TKIVVR ++         +L L  ++ D WRFRLPA T PE
Sbjct  69   DVGLGRNIAAHIVEIYPGVTKIVVRGDNVFD-----TSLSLSGLEPDLWRFRLPAETSPE  123

Query  582  LTRAAFVDGKLIVTVPK  632
            L  AAF DG+L+VTVPK
Sbjct  124  LATAAFSDGELVVTVPK  140



>gb|KGN44240.1| hypothetical protein Csa_7G234120 [Cucumis sativus]
Length=169

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 87/149 (58%), Gaps = 17/149 (11%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPHVF +VLELPFRSD DV + EN   FRFVAE   + E        RAH V+IHP
Sbjct  38   KLRRLPHVFSRVLELPFRSDADVSIVENCNCFRFVAETDGITED------FRAHTVQIHP  91

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+ K+VVR           +   L+++++D WRFRLP  T P+L  A F  GKLIVTVPK
Sbjct  92   GVIKVVVRQ-------IGDLESTLDELEIDMWRFRLPETTLPDLATAVFDGGKLIVTVPK  144

Query  633  ggpggggrgELVNGRHAWGWGGSRIIRVQ  719
                G G     NG    G+ G  ++ VQ
Sbjct  145  REDAGEGAWGAKNG----GFRGGHLVTVQ  169



>ref|XP_010256078.1| PREDICTED: uncharacterized protein LOC104596551 [Nelumbo nucifera]
Length=166

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 94/149 (63%), Gaps = 16/149 (11%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F +VLELPF SD DV+VEEN++ FRF+     V +       +RAHA+EI+P
Sbjct  34   KLRRLPHIFSRVLELPFHSDADVLVEENSDCFRFIVTTDDVGDD------VRAHAIEIYP  87

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+TKIV+        G + + L L++++LD WRFRLP  T PEL RA +VDG+LIVTVPK
Sbjct  88   GVTKIVI-------SGRNVLELSLDELELDLWRFRLPPTTMPELARAVYVDGELIVTVPK  140

Query  633  ggpggggrgELVNGRHAWGWGGSRIIRVQ  719
            G       G        W  G  R++ VQ
Sbjct  141  GANANNPDG---TNEEVWEEGLGRLVLVQ  166



>ref|XP_004241050.1| PREDICTED: uncharacterized protein LOC101260945 [Solanum lycopersicum]
Length=205

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 83/125 (66%), Gaps = 10/125 (8%)
 Frame = +3

Query  258  SAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHA  437
            ++A  +LRRLPHVF   LELPFRSD DV VEE    FRFVA+I      G   G +RA A
Sbjct  67   NSAMKKLRRLPHVFNYFLELPFRSDADVAVEEKEGFFRFVAKI---ELGGAWNGQVRAQA  123

Query  438  VEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLI  617
            VEI+PG+TKIVVR  +   +         E++ +DTWR+RLPA T PE+  A FVDG+L+
Sbjct  124  VEIYPGVTKIVVRKGNGDGDDD-------EKLNVDTWRYRLPASTMPEMATAVFVDGELV  176

Query  618  VTVPK  632
            VTVPK
Sbjct  177  VTVPK  181



>ref|XP_009418945.1| PREDICTED: uncharacterized protein LOC103999035 [Musa acuminata 
subsp. malaccensis]
Length=161

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 89/142 (63%), Gaps = 19/142 (13%)
 Frame = +3

Query  222  NLTVRSASFMDGSAAAM-----RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEI  386
            N+T R       +AAA+     +LRRLPH+F KVLELPF +D DV +EEN+EGFRFVA  
Sbjct  11   NITFRYDVNPAATAAAVLNRQKKLRRLPHIFSKVLELPFEADADVAIEENSEGFRFVAAT  70

Query  387  GHVAEHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPA  566
              +  +      +RAHA+EIHPG+ K+VVR+          V L  E ++LD WRFRLP 
Sbjct  71   DDLWGN------VRAHAIEIHPGVMKVVVRD-------GGGVDL-EEGLELDRWRFRLPP  116

Query  567  FTQPELTRAAFVDGKLIVTVPK  632
             T+P L  A++  G L+VTVPK
Sbjct  117  STRPALATASYTGGVLVVTVPK  138



>ref|XP_006350642.1| PREDICTED: uncharacterized protein LOC102579970 [Solanum tuberosum]
Length=209

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 83/125 (66%), Gaps = 10/125 (8%)
 Frame = +3

Query  258  SAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHA  437
            ++A  +LRRLPHVF   LELPF SD DV VEE    FRFVA I      G G G +RA A
Sbjct  69   NSAMKKLRRLPHVFNYFLELPFCSDADVAVEEKEGFFRFVARI---ELEGAGNGQVRAQA  125

Query  438  VEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLI  617
            VEIHPG+TKIVVR    + +G        EQ+K+DTWR+RLPA   P+L  A FVDG+LI
Sbjct  126  VEIHPGVTKIVVRKG--NGDGDED-----EQLKVDTWRYRLPASAMPKLATAVFVDGELI  178

Query  618  VTVPK  632
            VTVPK
Sbjct  179  VTVPK  183



>ref|XP_004139820.1| PREDICTED: uncharacterized protein LOC101211410 [Cucumis sativus]
Length=207

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 88/149 (59%), Gaps = 17/149 (11%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPHVF +VLELPFRSD DV + EN   FRFVAE   + E        RAH V+IHP
Sbjct  76   KLRRLPHVFSRVLELPFRSDADVSIVENCNCFRFVAETDGITED------FRAHTVQIHP  129

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+ K+VVR     Q G       L+++++D WRFRLP  T P+L  A F  GKLIVTVPK
Sbjct  130  GVIKVVVR-----QIGDLEST--LDELEIDMWRFRLPETTLPDLATAVFDGGKLIVTVPK  182

Query  633  ggpggggrgELVNGRHAWGWGGSRIIRVQ  719
                G G     NG    G+ G  ++ VQ
Sbjct  183  REDAGEGAWGAKNG----GFRGGHLVTVQ  207



>ref|XP_010440384.1| PREDICTED: uncharacterized protein LOC104723692 [Camelina sativa]
Length=148

 Score =   116 bits (291),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 87/121 (72%), Gaps = 13/121 (11%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F +VLELP RSD DV V+E+ + FRFVAE         GGGG+RA+ VEIHP
Sbjct  24   KLRRLPHIFSRVLELPLRSDADVAVQESPDCFRFVAETN-------GGGGVRAYMVEIHP  76

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPEL-TRAAFVDGKLIVTVP  629
            G+TKI+VR N     GSSS+ L L++++LD WRFRLP  T+ +L T     DG+LIVTVP
Sbjct  77   GVTKILVRTN-----GSSSLGLSLDELELDVWRFRLPESTRLDLVTVDCDGDGELIVTVP  131

Query  630  K  632
            K
Sbjct  132  K  132



>ref|XP_004242529.1| PREDICTED: uncharacterized protein LOC101259552 [Solanum lycopersicum]
Length=145

 Score =   116 bits (290),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 77/120 (64%), Gaps = 16/120 (13%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F KVLELPF SD DV + E ++  RFV     V ++      +RAH VEI+P
Sbjct  23   KLRRLPHIFAKVLELPFHSDSDVSIHETSDSLRFVIPTDDVGDN------IRAHIVEIYP  76

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+TKIV+R ++          +F   + LD WRFRLPA T PEL  A F DG+L+VTVPK
Sbjct  77   GVTKIVIRADN----------VFDSSLDLDLWRFRLPATTLPELASARFSDGELVVTVPK  126



>ref|XP_010024266.1| PREDICTED: uncharacterized protein LOC104414790 [Eucalyptus grandis]
 gb|KCW60722.1| hypothetical protein EUGRSUZ_H03452 [Eucalyptus grandis]
Length=273

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 85/120 (71%), Gaps = 14/120 (12%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEI-GHVAEHgcggggLRAHAVEIHP  452
            LRRLPH+F +VLELPFR+D +V VEE    FRFVAE  G VA       G+RAH VEIHP
Sbjct  129  LRRLPHIFSRVLELPFRADAEVEVEELPGFFRFVAETEGIVA-------GVRAHTVEIHP  181

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+TKIVVR N     GS  + L L+Q++LD WRFRLP  T+PEL  A  V+G+LIVTVPK
Sbjct  182  GVTKIVVRPN-----GSLEL-LSLDQLELDMWRFRLPESTRPELASAVCVNGELIVTVPK  235



>ref|XP_010259067.1| PREDICTED: uncharacterized protein LOC104598607 [Nelumbo nucifera]
Length=225

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 86/120 (72%), Gaps = 13/120 (11%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F +VLELPFRSD DV VEEN++ FRF+     V +       +RAH +EI+P
Sbjct  84   KLRRLPHIFNRVLELPFRSDADVSVEENSDCFRFIVTTDDVGDD------VRAHTIEIYP  137

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+TKIV+R       G++ + L L++++LD WRFRLP  T+PEL  A +VDG+LIVTVPK
Sbjct  138  GVTKIVIR-------GTNVLELSLDELELDLWRFRLPPTTRPELATAVYVDGELIVTVPK  190



>ref|XP_006349692.1| PREDICTED: uncharacterized protein LOC102591801 [Solanum tuberosum]
Length=162

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 77/125 (62%), Gaps = 13/125 (10%)
 Frame = +3

Query  258  SAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHA  437
            S    +LRRLPH+F KVLELPF SD DV +EE ++ FRFV        +      +RA  
Sbjct  29   SGRQKKLRRLPHIFAKVLELPFNSDADVSIEETSDSFRFVIPTDDAGNN------IRADT  82

Query  438  VEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLI  617
            VEI+PG+TKIV+R       G + +   L + +LD WRFRLP  T PEL  A F DG+L+
Sbjct  83   VEIYPGVTKIVIR-------GDNVLDSSLGEFELDLWRFRLPPSTLPELATADFADGELV  135

Query  618  VTVPK  632
            VTVPK
Sbjct  136  VTVPK  140



>gb|KDP21436.1| hypothetical protein JCGZ_21907 [Jatropha curcas]
Length=172

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 79/120 (66%), Gaps = 9/120 (8%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +L+RLPHVF K+L+LPF S+ DV V+E  E FRFVA+ G     G      +AH +EI P
Sbjct  29   KLKRLPHVFAKILDLPFNSNADVFVQETPECFRFVADNG----SGNITDEFKAHVIEIIP  84

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+TKIVVR     +  SS    +LE+  +DTWRFRLPA T P++  A  V G+LIVTVPK
Sbjct  85   GVTKIVVR-----EANSSLNDSWLEEPDIDTWRFRLPATTCPQMASAECVGGQLIVTVPK  139



>gb|AES93690.2| heat shock 22 kDa protein [Medicago truncatula]
Length=171

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 82/149 (55%), Gaps = 20/149 (13%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPHVF ++L+LP RSD DV +EE    FRFVAE      H      +  H + IHP
Sbjct  43   KLRRLPHVFSRILQLPLRSDADVSIEEEPTCFRFVAETDSSLGH------VETHTLHIHP  96

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+TKIVVR        S S+   L+ +  D WRFRLP    PEL  A FVDG+LIVTVPK
Sbjct  97   GVTKIVVR-------ASHSLHFSLDDLHPDIWRFRLPESVVPELATAVFVDGELIVTVPK  149

Query  633  ggpggggrgELVNGRHAWGWGGSRIIRVQ  719
                        N     G GG+ ++ VQ
Sbjct  150  AFDDE-------NTPEPIGGGGATLVFVQ  171



>ref|XP_004247176.1| PREDICTED: uncharacterized protein LOC101259285 [Solanum lycopersicum]
Length=162

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 76/120 (63%), Gaps = 13/120 (11%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F KVLELPF SD DV +EE ++ FRFV        +      +RA  VEI+P
Sbjct  34   KLRRLPHIFAKVLELPFNSDADVSIEETSDSFRFVIPTDDAGNN------IRADTVEIYP  87

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+TKIV+R       G + +   L + +LD WRFRLP  T PEL  A F DG+L+VTVPK
Sbjct  88   GVTKIVIR-------GDNVLDSSLGEFELDLWRFRLPPSTLPELATADFADGELVVTVPK  140



>ref|XP_006368157.1| PREDICTED: uncharacterized protein LOC102601155, partial [Solanum 
tuberosum]
Length=116

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 79/120 (66%), Gaps = 10/120 (8%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRL HVF   LELPF SD DV VEE    F F+A+I      G G G +RA AVEIHP
Sbjct  3    KLRRLSHVFNYFLELPFCSDADVAVEEKLGFFCFMAKI---ELEGSGDGQVRAQAVEIHP  59

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+TKIVVR    + +G        EQ+ +DTWR+RLPA T PEL  A FVDG+LIVTVPK
Sbjct  60   GVTKIVVRKG--NGDGDED-----EQLNVDTWRYRLPASTMPELATAVFVDGELIVTVPK  112



>emb|CDY10290.1| BnaC05g29890D [Brassica napus]
Length=196

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 81/119 (68%), Gaps = 10/119 (8%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPH+F +VLELP RS+ +V VEE  + FRFVAE     E  C GG +RA+ V+IHPG
Sbjct  65   LRRLPHIFNRVLELPLRSEANVSVEEKHDCFRFVAE----TEGLCDGGEMRAYVVDIHPG  120

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            ITKIVVR N        S+ L L++++LD WRFRLP  T+PEL     V G LIVTVPK
Sbjct  121  ITKIVVRTN------GLSLGLSLDELELDMWRFRLPETTRPELVTVVCVGGVLIVTVPK  173



>ref|XP_009767679.1| PREDICTED: uncharacterized protein LOC104218788 [Nicotiana sylvestris]
Length=164

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 79/126 (63%), Gaps = 12/126 (10%)
 Frame = +3

Query  255  GSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAH  434
             S    +LRRLPH+F KVLELPF SD DV ++E+ +  RFV     +      G  +RAH
Sbjct  29   ASGRQKKLRRLPHIFAKVLELPFHSDADVSIQESPDSLRFV-----IPTDDNVGDNIRAH  83

Query  435  AVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKL  614
             VEI+PG+TKIV+R       G + +   L + +LD WRFRLP  T PEL  AAF DG+L
Sbjct  84   TVEIYPGVTKIVIR-------GDNVLDSSLGEFELDLWRFRLPPSTLPELATAAFNDGEL  136

Query  615  IVTVPK  632
            +VTVPK
Sbjct  137  VVTVPK  142



>ref|XP_008797029.1| PREDICTED: uncharacterized protein LOC103712319 [Phoenix dactylifera]
Length=196

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 79/120 (66%), Gaps = 6/120 (5%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F KVLELP  +D DV + E  + FRFVA  G +A     GG  RA+AV IHP
Sbjct  35   KLRRLPHIFSKVLELPLAADADVAIHEGPDDFRFVAAAGDLA-----GGTFRAYAVRIHP  89

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+ K+VVR +     G  +    L+ ++LD WRFRLP  T+P L  A+ VDG+L+VTVPK
Sbjct  90   GVMKVVVRGDGPAGSGGDA-GRDLDDLELDRWRFRLPPCTRPALAIASCVDGELVVTVPK  148



>ref|XP_010532557.1| PREDICTED: uncharacterized protein LOC104808553 [Tarenaya hassleriana]
Length=217

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 82/120 (68%), Gaps = 5/120 (4%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F +VLELPFRSD DV+VEE  + FRF AE         G GG+RAH VEIHP
Sbjct  70   KLRRLPHIFNRVLELPFRSDADVVVEEMPDCFRFSAETDGFP---AGDGGVRAHMVEIHP  126

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+ KIVVR N      SS     L++++LD WRFRLP  T+PEL   A  DG+L+VTVPK
Sbjct  127  GVMKIVVRANG--SSSSSLGPPLLDELELDVWRFRLPETTRPELVMVACEDGELVVTVPK  184



>ref|XP_009629335.1| PREDICTED: uncharacterized protein LOC104119519 [Nicotiana tomentosiformis]
Length=164

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 78/126 (62%), Gaps = 12/126 (10%)
 Frame = +3

Query  255  GSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAH  434
             S    +LRRLPH+F KVLELPF SD DV ++E+ +  RFV     +      G  +RAH
Sbjct  29   ASGRQKKLRRLPHIFAKVLELPFHSDADVSIQESPDSLRFV-----IPTDDNVGDNIRAH  83

Query  435  AVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKL  614
             VEI+PG+TKIV+R       G + +   L + +LD WRFRLP  T PEL  A+F DG L
Sbjct  84   TVEIYPGVTKIVIR-------GDNVLDSSLGEFELDLWRFRLPPSTLPELATASFNDGDL  136

Query  615  IVTVPK  632
            +VTVPK
Sbjct  137  VVTVPK  142



>ref|XP_010909056.1| PREDICTED: uncharacterized protein LOC105035254 [Elaeis guineensis]
 ref|XP_010909057.1| PREDICTED: uncharacterized protein LOC105035254 [Elaeis guineensis]
Length=164

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 81/120 (68%), Gaps = 14/120 (12%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F KVLELP  SD DV VEE  +GFRFVA    + +       +RA+A+EI+P
Sbjct  37   KLRRLPHIFSKVLELPLGSDADVFVEEGPDGFRFVAATDDLWDD------VRANAIEIYP  90

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+ K+V+    RH++G     +  +++ LD WRFRLP  ++P L  AA+ DG+L+VT+PK
Sbjct  91   GVMKVVI----RHEDGE----VEEDELDLDRWRFRLPPSSRPALATAAYADGELVVTIPK  142



>gb|EYU46566.1| hypothetical protein MIMGU_mgv1a015211mg [Erythranthe guttata]
Length=164

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 77/120 (64%), Gaps = 13/120 (11%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F KVLELPF SD DV + +     RF A    ++      G +RA AVEI+P
Sbjct  32   KLRRLPHIFAKVLELPFHSDADVSIHDTPHSIRFTAPTDDIS------GDVRADAVEIYP  85

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+TKIV+R       G+  V L   ++ LD WRFRLPA T PEL  AA+ DG+L+VTVPK
Sbjct  86   GVTKIVIR-------GNGVVDLCGIELDLDLWRFRLPASTLPELASAAYEDGELVVTVPK  138



>gb|EYU40912.1| hypothetical protein MIMGU_mgv1a015318mg [Erythranthe guttata]
Length=161

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 84/141 (60%), Gaps = 17/141 (12%)
 Frame = +3

Query  222  NLTVR----SASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIG  389
            N+T+R    S      S    +LRRLPH+F KVLELPF SD DV V E  +  RF A   
Sbjct  11   NITLRYDVASVLAQANSCRQKKLRRLPHIFAKVLELPFHSDADVTVVETPDFLRFTAATD  70

Query  390  HVAEHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAF  569
             ++        +RA A+EI+PG+TKIV+R       G+  V L   +++LD WRFRLPA 
Sbjct  71   DISGD------VRADAIEIYPGVTKIVIR-------GNGVVDLSGTELELDLWRFRLPAT  117

Query  570  TQPELTRAAFVDGKLIVTVPK  632
             +PEL  A + DG+L+VTVPK
Sbjct  118  MRPELATAVYEDGELVVTVPK  138



>ref|XP_010525199.1| PREDICTED: uncharacterized protein LOC104803032 [Tarenaya hassleriana]
Length=172

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 91/165 (55%), Gaps = 6/165 (4%)
 Frame = +3

Query  225  LTVRSASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEH  404
            LT   A   +      +LRRLPH+F +VLELPFRSD DV VEE  + F+F AE       
Sbjct  14   LTYHGARDSNPRDPVKKLRRLPHIFSRVLELPFRSDADVAVEEMPDCFKFSAETDGFPVG  73

Query  405  gcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPEL  584
              GG    AH VEIHPG+ KIVVR N       SS+    ++++LD WRFRLP  T+PEL
Sbjct  74   VGGGVM--AHMVEIHPGVMKIVVRANGSLSCLGSSLL---DELELDVWRFRLPETTRPEL  128

Query  585  TRAAFVDGKLIVTVPKggpggggrgELVNGRHAWGWGGSRIIRVQ  719
               A  DG+LIVTVPK         E        G G SR+I VQ
Sbjct  129  VTVACEDGELIVTVPKTAENSPEEEEDDGD-FGGGMGSSRLILVQ  172



>ref|XP_008778997.1| PREDICTED: 17.4 kDa class I heat shock protein-like [Phoenix 
dactylifera]
Length=143

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 79/132 (60%), Gaps = 13/132 (10%)
 Frame = +3

Query  237  SASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcgg  416
            SA+         +LRRLPH+F KVLELP  SD DV  EE  +GFRFVA    + +     
Sbjct  23   SAAGAGDGGRQKKLRRLPHIFSKVLELPLGSDADVSFEEGPDGFRFVAATDDLWDD----  78

Query  417  ggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAA  596
              +RAHA+EIHPG+ K+VVR+      G       L+   LD WRFRLP  ++P L  AA
Sbjct  79   --VRAHAIEIHPGVMKVVVRDG----HGKEEEEEELD---LDRWRFRLPPSSRPALATAA  129

Query  597  FVDGKLIVTVPK  632
            + DG+L+VT+PK
Sbjct  130  YTDGELVVTIPK  141



>gb|EYU20967.1| hypothetical protein MIMGU_mgv1a023261mg [Erythranthe guttata]
Length=161

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 83/141 (59%), Gaps = 17/141 (12%)
 Frame = +3

Query  222  NLTVR----SASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIG  389
            N+T+R    S      S    +LRRLPH+F KVLELPF SD DV V E  +  RF A   
Sbjct  11   NITLRYDVASVLAQANSCRQKKLRRLPHIFAKVLELPFHSDADVTVVETPDFLRFTAATD  70

Query  390  HVAEHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAF  569
             +         +RA A+EI+PG+TKIV+R       G+  V L   +++LD WRFRLPA 
Sbjct  71   DITGD------VRADAIEIYPGVTKIVIR-------GNGVVDLSGTELELDLWRFRLPAT  117

Query  570  TQPELTRAAFVDGKLIVTVPK  632
             +PEL  A + DG+L+VTVPK
Sbjct  118  MRPELATAVYEDGELVVTVPK  138



>ref|XP_006826258.1| hypothetical protein AMTR_s00004p00027710 [Amborella trichopoda]
 gb|ERM93495.1| hypothetical protein AMTR_s00004p00027710 [Amborella trichopoda]
Length=271

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 85/120 (71%), Gaps = 13/120 (11%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F +VLELPFRS+ +V+V+EN E FRFV     V+E       +RA  +EI P
Sbjct  38   KLRRLPHIFSRVLELPFRSEANVLVQENHEFFRFVTGTNLVSED------VRAQLIEIIP  91

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+TKIV+R       GS+ + L L++++LD WRFRLP   QPEL  AA+VDGKLIVT+PK
Sbjct  92   GVTKIVIR-------GSNMLDLSLDELELDLWRFRLPPCAQPELASAAYVDGKLIVTIPK  144



>ref|XP_011026334.1| PREDICTED: uncharacterized protein LOC105126972 [Populus euphratica]
Length=167

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 86/139 (62%), Gaps = 9/139 (6%)
 Frame = +3

Query  216  LFNLTVRSASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHV  395
            +F      AS +  + +A +L+RLPHVF +VLELPF SD DV+V+E  + F FVA I   
Sbjct  12   IFTTQYNDAS-LTHTPSAKKLKRLPHVFARVLELPFHSDTDVLVQETPDSFCFVANI---  67

Query  396  AEHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQ  575
             E+       +AH VEI PG+TKIVV   +   +   S    ++++++DTW  RLPA   
Sbjct  68   -ENITIPDDYQAHVVEIFPGLTKIVVIKETDSGDHYPS----MDELEIDTWTCRLPATVL  122

Query  576  PELTRAAFVDGKLIVTVPK  632
            PE+T A  ++G+L+VTVPK
Sbjct  123  PEMTSARCIEGQLVVTVPK  141



>ref|XP_011082574.1| PREDICTED: uncharacterized protein LOC105165302 [Sesamum indicum]
Length=164

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 76/125 (61%), Gaps = 13/125 (10%)
 Frame = +3

Query  258  SAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHA  437
            S    +LRRLPH+F KVLELPF SD DV ++E ++  RF A    ++        + A  
Sbjct  27   SCRGKKLRRLPHIFAKVLELPFHSDADVSIDETSDCLRFTAATDDISGE------VWADT  80

Query  438  VEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLI  617
            VEI+PG+TK+VVR       G+  V L    ++LD WRFRLPA   PEL  A + DG+L+
Sbjct  81   VEIYPGVTKVVVR-------GTGVVDLSGTDLELDLWRFRLPAIMLPELASATYEDGELV  133

Query  618  VTVPK  632
            VTVPK
Sbjct  134  VTVPK  138



>ref|XP_003520205.1| PREDICTED: uncharacterized protein LOC100783636 [Glycine max]
Length=139

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 81/127 (64%), Gaps = 13/127 (10%)
 Frame = +3

Query  258  SAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHA  437
            S+ A +L RLPHVF K+LELPF SDDDV+VEE  + FRFVA            GG+RA A
Sbjct  18   SSNAKKLLRLPHVFAKILELPFPSDDDVLVEETPQFFRFVASCN--------AGGVRALA  69

Query  438  VEIHPGITKIVVRNNSRHQEGSSSVALFLEQMK--LDTWRFRLPAFTQPELTRAAFVDGK  611
            +EI PGITKIV++   R   G  +VA   +Q+      WRFRLP  TQPE+  A  + GK
Sbjct  70   IEILPGITKIVIK---RMDGGDVAVAGRHQQVPSGFGLWRFRLPPGTQPEMVTAVSIGGK  126

Query  612  LIVTVPK  632
            L+VTVPK
Sbjct  127  LVVTVPK  133



>ref|XP_003610732.1| hypothetical protein MTR_5g006400 [Medicago truncatula]
Length=274

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 75/124 (60%), Gaps = 21/124 (17%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAE----IGHVAEHgcggggLRAHAV  440
            +LRRLPHVF ++L+LP RSD DV +EE    FRFVAE    +GHV            H +
Sbjct  43   KLRRLPHVFSRILQLPLRSDADVSIEEEPTCFRFVAETDSSLGHV----------ETHTL  92

Query  441  EIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIV  620
             IHPG+TKIVVR        S S+   L+ +  D WRFRLP    PEL  A FVDG+LIV
Sbjct  93   HIHPGVTKIVVR-------ASHSLHFSLDDLHPDIWRFRLPESVVPELATAVFVDGELIV  145

Query  621  TVPK  632
            TVPK
Sbjct  146  TVPK  149



>ref|XP_008803410.1| PREDICTED: uncharacterized protein LOC103716967 [Phoenix dactylifera]
Length=191

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 83/121 (69%), Gaps = 9/121 (7%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F KVLELP  +D DV V E  +GFRFVA     A+ G  GG +RAHAV I+P
Sbjct  35   KLRRLPHIFSKVLELPLAADADVAVHEGPDGFRFVAAAD--ADGGLSGGAVRAHAVRIYP  92

Query  453  GITKIVVRNNSRHQEGSSSVALF-LEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVP  629
            G+ K+VVR       G++ V  + L+ ++L+ WRFRLP  T+P L  A ++DG+L+VT+P
Sbjct  93   GVMKVVVRG------GAAGVDDWDLDGLELNRWRFRLPPCTRPALAAADYIDGELVVTIP  146

Query  630  K  632
            K
Sbjct  147  K  147



>ref|XP_010551714.1| PREDICTED: uncharacterized protein LOC104822262 [Tarenaya hassleriana]
Length=155

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 82/121 (68%), Gaps = 9/121 (7%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEI-GHVAEHgcggggLRAHAVEIH  449
            +L+RLPH+F ++LELPFRSD DV VEE  + F+F A+  G +A     GGG+RAH VEIH
Sbjct  30   KLQRLPHIFDRILELPFRSDADVSVEEMPDCFKFSADTDGFLA---GDGGGVRAHMVEIH  86

Query  450  PGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVP  629
            P + KIVVR N     GSS     L++++LD WR RLP  T+PEL      DG+LIVTVP
Sbjct  87   PSVVKIVVRLN-----GSSLGPSLLDELELDVWRVRLPESTRPELVTVVCDDGELIVTVP  141

Query  630  K  632
            K
Sbjct  142  K  142



>ref|XP_010917752.1| PREDICTED: uncharacterized protein LOC105042302 [Elaeis guineensis]
Length=188

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 87/144 (60%), Gaps = 17/144 (12%)
 Frame = +3

Query  222  NLTVRSASFMDGSAAAM-------RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVA  380
            N+T R       SAA M        LRRLPH+F KVLELP  +D DV V E  +GFRFVA
Sbjct  11   NITFRYDVGAALSAAEMVVLGHQKNLRRLPHIFSKVLELPLAADADVAVHEGPDGFRFVA  70

Query  381  EIGHVAEHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRL  560
              G +A        +RAHAV IHPG+ K+VVR  +     +    L L+ ++L+ WRFRL
Sbjct  71   AAGDLAGE-----AVRAHAVRIHPGVMKVVVRGGA-----AGIDDLDLDGLELNRWRFRL  120

Query  561  PAFTQPELTRAAFVDGKLIVTVPK  632
            P+ T+P L  A +VDG+L+VT+PK
Sbjct  121  PSCTRPALATADYVDGELVVTIPK  144



>ref|XP_002300835.2| hypothetical protein POPTR_0002s05200g [Populus trichocarpa]
 gb|EEE80108.2| hypothetical protein POPTR_0002s05200g [Populus trichocarpa]
Length=161

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 86/139 (62%), Gaps = 12/139 (9%)
 Frame = +3

Query  228  TVRSASFMDGS----AAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHV  395
            ++ +  + D S      A +L+RLPHVF +VLELPF SD DV+V+E  + FRFVA     
Sbjct  11   SITTTQYNDASRTHTPNAKKLKRLPHVFARVLELPFHSDTDVLVQETPDSFRFVAN----  66

Query  396  AEHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQ  575
            +E+       +A  VEI PG+TKIVV   +   +   S    ++++++DTWR RLPA  +
Sbjct  67   SENITIPDDYQARVVEIFPGLTKIVVIKETDSGDHYPS----MDELEIDTWRCRLPATVR  122

Query  576  PELTRAAFVDGKLIVTVPK  632
            PE+  A  ++G+L+VTVPK
Sbjct  123  PEMASARCIEGQLVVTVPK  141



>ref|XP_009417094.1| PREDICTED: uncharacterized protein LOC103997560 [Musa acuminata 
subsp. malaccensis]
Length=175

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 87/142 (61%), Gaps = 18/142 (13%)
 Frame = +3

Query  222  NLTVRSASFMDGSAAAM-----RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEI  386
            N+T R       +A A+     +LRRLPH+F KVLELPF +D DV VEE+A+GFRFVA  
Sbjct  11   NITFRCGVNPAAAATAVHGRQKKLRRLPHIFSKVLELPFAADADVAVEEDADGFRFVAAT  70

Query  387  GHVAEHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPA  566
                      G ++A  V+IHPG+TK+ VR+ S   +  +       +++L+ WRFRLP 
Sbjct  71   D------VLWGDVQAQTVQIHPGMTKVFVRDGSDGDDLDT-------ELELNRWRFRLPP  117

Query  567  FTQPELTRAAFVDGKLIVTVPK  632
             T+P L  AA+  G+L+VT+PK
Sbjct  118  STRPALATAAYTSGELVVTIPK  139



>ref|XP_010932767.1| PREDICTED: uncharacterized protein LOC105053360 [Elaeis guineensis]
Length=192

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 76/120 (63%), Gaps = 6/120 (5%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F KVLELP  ++ DV V E  + FRFVA  G +      GG  RAHAV IHP
Sbjct  35   KLRRLPHIFSKVLELPLAAEADVAVHEGPDDFRFVAAAGDLV-----GGTFRAHAVRIHP  89

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+ K+VVR +     G  +    L+ ++ D WRFRLP  T+P L  A  +DG+L+VTVPK
Sbjct  90   GVMKVVVRGDGPAGSGGDA-GRDLDGLEFDRWRFRLPPSTRPALATANCIDGELVVTVPK  148



>gb|EPS67108.1| hypothetical protein M569_07669 [Genlisea aurea]
Length=144

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 74/119 (62%), Gaps = 13/119 (11%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPH+F KVLELPFRSD DV + E  +  RF A    ++E       +RA A+EI+PG
Sbjct  27   LRRLPHIFTKVLELPFRSDADVAIVETHDSIRFSAATDDISED------VRADAIEIYPG  80

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            +TK+ VR       G+  V L   +  LD WRFRLP+    EL  AA+ DG+L+VTVPK
Sbjct  81   VTKVFVR-------GNGVVDLSATEFDLDIWRFRLPSSMSAELASAAYEDGELVVTVPK  132



>ref|XP_003632305.1| PREDICTED: uncharacterized protein LOC100855206 [Vitis vinifera]
Length=166

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 79/128 (62%), Gaps = 17/128 (13%)
 Frame = +3

Query  261  AAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAV  440
            ++  +LRRLPH+F +VLELPFRSD DV V E  +  RF      V +       +R   +
Sbjct  30   SSQKKLRRLPHIFTRVLELPFRSDADVSVTETPDHLRFAVTTDDVGDD------VRTQTI  83

Query  441  EIHPGITKIVVRNNSRHQEGSSSVALFLE----QMKLDTWRFRLPAFTQPELTRAAFVDG  608
            ++HPG+TK+V+R       G + + L L+    ++ LD WRFRLPA T PE+  AA+ DG
Sbjct  84   QLHPGVTKVVIR-------GRNFLDLSLDGLGVELDLDLWRFRLPASTLPEMASAAYSDG  136

Query  609  KLIVTVPK  632
            +L+VTVPK
Sbjct  137  ELVVTVPK  144



>gb|KEH42637.1| heat shock 22 kDa protein, putative [Medicago truncatula]
Length=153

 Score =   107 bits (268),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 80/123 (65%), Gaps = 8/123 (7%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +L RLPHVF K+LELPF SD DV +EE ++ FRFVA    +  +    GG+RAHA+EI P
Sbjct  32   KLWRLPHVFAKMLELPFPSDADVSIEETSQFFRFVASCNKM--NIFNAGGVRAHAIEILP  89

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQ---MKLDTWRFRLPAFTQPELTRAAFVDGKLIVT  623
            GITKIV++   R   G  +V    E+   + +D WRFRLP +TQPE   A    GKL+VT
Sbjct  90   GITKIVIK---RIDGGDVAVVGQQERRSSLGVDLWRFRLPPWTQPERVTAVCTGGKLVVT  146

Query  624  VPK  632
            VPK
Sbjct  147  VPK  149



>ref|XP_004511367.1| PREDICTED: uncharacterized protein LOC101512906 [Cicer arietinum]
Length=159

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 73/123 (59%), Gaps = 20/123 (16%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAE---IGHVAEHgcggggLRAHAVE  443
            +LRRLPHVF K+L+LP  SD DV VEE+   FRFVAE   +GHV            H + 
Sbjct  35   KLRRLPHVFSKILQLPLPSDADVSVEEHPNCFRFVAETNSLGHV----------ETHTLH  84

Query  444  IHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVT  623
            IHPG+TKI+VR        + S+   L+ +    WR RLP    PEL  A FVDG+L+VT
Sbjct  85   IHPGVTKIIVR-------ATHSLQFSLDDLNPHIWRLRLPESIIPELATAVFVDGELVVT  137

Query  624  VPK  632
            VPK
Sbjct  138  VPK  140



>gb|ABK25897.1| unknown [Picea sitchensis]
Length=185

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 74/120 (62%), Gaps = 10/120 (8%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPHVF +VLELPF S+  V VEEN E FRFV       +        RA  +EI P
Sbjct  33   KLRRLPHVFCRVLELPFNSEVPVAVEENGECFRFVVS----CDEALAFQEARAEIIEIAP  88

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+ K+V+R  SR    S      ++ ++LD WRFRLP+ T PEL+ A + DG+L+V VPK
Sbjct  89   GVIKVVIREASRRLRFS------MDDLELDMWRFRLPSSTLPELSTAIYRDGELVVIVPK  142



>ref|XP_003517574.1| PREDICTED: uncharacterized protein LOC100807115 [Glycine max]
Length=138

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 74/120 (62%), Gaps = 16/120 (13%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +L RLPHVF +VL+LPF +D DV V+E    FRFVAE     +       + AH VEIHP
Sbjct  15   KLGRLPHVFSRVLQLPFPADTDVSVQEAPHCFRFVAESPAAGQ-------VEAHIVEIHP  67

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+TK+VVR     + GS++    L  + LD WR RLP  T+PEL  A    G+L+VTVPK
Sbjct  68   GVTKVVVR-----ETGSTA----LNDLHLDVWRIRLPESTRPELATAVLAAGELVVTVPK  118



>gb|EAZ38855.1| hypothetical protein OsJ_23272 [Oryza sativa Japonica Group]
Length=145

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 77/124 (62%), Gaps = 9/124 (7%)
 Frame = +3

Query  261  AAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAV  440
            A   +LRRLPH+F KVLELPF +D DV VEE+A            A+     GG  AHAV
Sbjct  2    AGGKKLRRLPHIFAKVLELPFAADADVSVEEDAA----ALRFVAAADGFTPSGGASAHAV  57

Query  441  EIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIV  620
            EIHPG+TK+VVR+ S   +G    A+F    +LD WRFRLP  T P +  A + DG+L+V
Sbjct  58   EIHPGVTKVVVRDLSAGLDGDDG-AVF----ELDRWRFRLPPCTLPAMATATYADGELVV  112

Query  621  TVPK  632
            TVPK
Sbjct  113  TVPK  116



>gb|KHN14538.1| hypothetical protein glysoja_027147 [Glycine soja]
Length=141

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 71/110 (65%), Gaps = 14/110 (13%)
 Frame = +3

Query  264  AAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVE  443
            A  +LRRLPHVF  VLELPFR D DV VEE    FRF+AE   + +       +RAH VE
Sbjct  45   ARKKLRRLPHVFSCVLELPFRFDADVAVEEAPNFFRFMAETDGIDD-------VRAHTVE  97

Query  444  IHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRA  593
            IHPG+TKIVVR      EG  SV L L+Q++LD WRFRLP   +PEL  A
Sbjct  98   IHPGVTKIVVR------EG-GSVELSLDQLELDMWRFRLPESMRPELASA  140



>ref|XP_004495291.1| PREDICTED: uncharacterized protein LOC101506081 [Cicer arietinum]
Length=150

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 81/136 (60%), Gaps = 9/136 (7%)
 Frame = +3

Query  234  RSASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcg  413
            RS   +  S  + +L RLPHVF K LELPF SD DV +EE  + FRFVA      +    
Sbjct  17   RSQHSVVSSTPSKKLWRLPHVFAKTLELPFPSDADVSIEETPQFFRFVAS---CYKTNVN  73

Query  414  gggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQ---MKLDTWRFRLPAFTQPEL  584
            GGG+RAHA+EI PGITKIV++   R   G  +V    ++     +D WRFRLP +TQPE 
Sbjct  74   GGGVRAHAIEILPGITKIVIK---RIDGGDVTVVGQKDRRSTYGVDLWRFRLPPWTQPER  130

Query  585  TRAAFVDGKLIVTVPK  632
              A     KL+VTVPK
Sbjct  131  VTAVCTGWKLVVTVPK  146



>ref|NP_001059002.1| Os07g0173100 [Oryza sativa Japonica Group]
 dbj|BAC83626.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF20916.1| Os07g0173100 [Oryza sativa Japonica Group]
Length=171

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 76/120 (63%), Gaps = 9/120 (8%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F KVLELPF +D DV VEE+A            A+     GG  AHAVEIHP
Sbjct  32   KLRRLPHIFAKVLELPFAADADVSVEEDAA----ALRFVAAADGFTPSGGASAHAVEIHP  87

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            G+TK+VVR+ S   +G    A+F    +LD WRFRLP  T P +  A + DG+L+VTVPK
Sbjct  88   GVTKVVVRDLSAGLDGDDG-AVF----ELDRWRFRLPPCTLPAMATATYADGELVVTVPK  142



>ref|XP_003557517.1| PREDICTED: uncharacterized protein LOC100844809 [Brachypodium 
distachyon]
Length=167

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 78/126 (62%), Gaps = 12/126 (10%)
 Frame = +3

Query  264  AAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVE  443
             A +LRRLPH+F +VLELPF +D DV VEE+A   RFVA     +  G      RAHAV+
Sbjct  24   GAKKLRRLPHIFARVLELPFAADADVAVEEDAAALRFVAAADGFSPGGA-----RAHAVQ  78

Query  444  IHPGITKIVVRNNSRHQEG---SSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKL  614
            IHPG+TK+VVR  S    G       A F    +LD WRFRLP  T+P L  A + +G+L
Sbjct  79   IHPGVTKVVVRGLSVAGAGEDDDDGAAAF----ELDRWRFRLPPCTRPTLATATYAEGEL  134

Query  615  IVTVPK  632
            +VTVPK
Sbjct  135  VVTVPK  140



>ref|NP_001143305.1| hypothetical protein [Zea mays]
 gb|ACG30510.1| hypothetical protein [Zea mays]
 gb|ACG44392.1| hypothetical protein [Zea mays]
 tpg|DAA59719.1| TPA: hypothetical protein ZEAMMB73_807873 [Zea mays]
Length=169

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 73/121 (60%), Gaps = 6/121 (5%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEEN-AEGFRFVAEIGHVAEHgcggggLRAHAVEIH  449
            +LRRLPH+F KVLELPF +D DV VEE+ A      A +  V+  G      RAHAVEIH
Sbjct  33   KLRRLPHIFAKVLELPFAADADVSVEEDAAALRFVAAAVDGVSPDGA-----RAHAVEIH  87

Query  450  PGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVP  629
            PG+TK+VVR  S    G           +LD WRFRLP  T+P +  A +  G+L+VTVP
Sbjct  88   PGVTKVVVRGLSPADGGGGVDDDGAAAFELDRWRFRLPPCTRPAMATATYSQGELVVTVP  147

Query  630  K  632
            K
Sbjct  148  K  148



>ref|XP_010679063.1| PREDICTED: uncharacterized protein LOC104894510 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010679064.1| PREDICTED: uncharacterized protein LOC104894510 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010679065.1| PREDICTED: uncharacterized protein LOC104894510 [Beta vulgaris 
subsp. vulgaris]
Length=163

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 70/114 (61%), Gaps = 13/114 (11%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F KVLELPF SD DV +EE+ + F+F      V         + A  VEI+P
Sbjct  35   KLRRLPHIFAKVLELPFCSDADVAIEESVDSFKFTVFDTDVGSD------VVADTVEIYP  88

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKL  614
            G+TKIVVR++S          + + +++LD WRFRLPA T+PEL  A +  G L
Sbjct  89   GVTKIVVRSHSIAD-------VSMTELELDLWRFRLPACTKPELATATYDGGDL  135



>ref|XP_004955593.1| PREDICTED: uncharacterized protein LOC101777773 [Setaria italica]
Length=172

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 74/121 (61%), Gaps = 8/121 (7%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F KVLELPF +D DV VEE+A            A  G    G RAHAVEIHP
Sbjct  34   KLRRLPHIFAKVLELPFAADADVSVEEDAA----ALRFVAAAVDGFSPAGARAHAVEIHP  89

Query  453  GITKIVVRN-NSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVP  629
            G+TK+VVR+ +S    G    A   E   LD WRFRLP  T P +  A + +G+L+VTVP
Sbjct  90   GVTKVVVRDLSSGGAHGDDDGAAAFE---LDRWRFRLPPCTLPAMATATYAEGELVVTVP  146

Query  630  K  632
            K
Sbjct  147  K  147



>ref|XP_002459399.1| hypothetical protein SORBIDRAFT_02g004080 [Sorghum bicolor]
 gb|EER95920.1| hypothetical protein SORBIDRAFT_02g004080 [Sorghum bicolor]
Length=177

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 71/133 (53%), Gaps = 25/133 (19%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEE-------------NAEGFRFVAEIGHVAEHgcg  413
            +LRRLPH+F KVLELPF +D DV VEE             + +GF F    G        
Sbjct  31   KLRRLPHIFAKVLELPFAADADVSVEEDAAALRFVAAAVVDVDGFSFSPAGGP-------  83

Query  414  gggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRA  593
                RAHAVEIHPG+TK+VVR  S                +LD WRFRLP  T+P +  A
Sbjct  84   ----RAHAVEIHPGVTKVVVRGLS-SGAHDDDDDGAAAAFELDRWRFRLPPCTRPAMATA  138

Query  594  AFVDGKLIVTVPK  632
             +  G+L+VTVPK
Sbjct  139  TYAQGELVVTVPK  151



>ref|XP_007144646.1| hypothetical protein PHAVU_007G173200g [Phaseolus vulgaris]
 gb|ESW16640.1| hypothetical protein PHAVU_007G173200g [Phaseolus vulgaris]
Length=137

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 71/127 (56%), Gaps = 13/127 (10%)
 Frame = +3

Query  258  SAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHA  437
            S    +L RLPHVF K+LELP  SD DV VEE    FRFVA              +RA A
Sbjct  16   SPVPNKLLRLPHVFSKILELPCLSDHDVFVEETPHFFRFVAPCNAAG--------VRALA  67

Query  438  VEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDT--WRFRLPAFTQPELTRAAFVDGK  611
            +EI PGITKIV++   R      +VA     + L    WRFRLP +TQPE+  A    GK
Sbjct  68   IEILPGITKIVIK---RMDGTDVAVAGQPHHVSLGVGLWRFRLPPWTQPEMVTAVCSGGK  124

Query  612  LIVTVPK  632
            L+VTVPK
Sbjct  125  LMVTVPK  131



>ref|XP_002524765.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37608.1| conserved hypothetical protein [Ricinus communis]
Length=176

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 76/138 (55%), Gaps = 6/138 (4%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAE--IGHVAEHgcggggLRAHAVEI  446
            +L+RLPHVF KVLELPF S+ DV +EE  + F F+A+   G   E        RAH ++I
Sbjct  32   KLKRLPHVFAKVLELPFNSNADVFLEETQDSFLFIADNASGDDGEE-TAADDFRAHVIKI  90

Query  447  HPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTV  626
             PG+TKI V   +      S      E++ +DTWRFRLP+    E T A  + G+L+VTV
Sbjct  91   LPGVTKISVLKVAHSGNVGSCED---EEVNIDTWRFRLPSTACAEKTSAMCIGGQLVVTV  147

Query  627  PKggpggggrgELVNGRH  680
            PK         +L +  H
Sbjct  148  PKVMNVENMVRDLEDDGH  165



>ref|XP_007157122.1| hypothetical protein PHAVU_002G044700g [Phaseolus vulgaris]
 gb|ESW29116.1| hypothetical protein PHAVU_002G044700g [Phaseolus vulgaris]
Length=153

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 78/125 (62%), Gaps = 14/125 (11%)
 Frame = +3

Query  258  SAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHA  437
            +AAA +LRRLPHVF +VL+LP  +D DV + E    FRFVAE   +A        + AH 
Sbjct  21   TAAAKKLRRLPHVFTRVLQLPIPADTDVSLHEAPNCFRFVAETPELAH-------VEAHI  73

Query  438  VEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLI  617
            V+IHPG+TK+VVR        + S+    E ++LD WR RLP  T+P+LT A  V G L+
Sbjct  74   VQIHPGMTKVVVRE-------TVSLRFPFEDLRLDVWRIRLPDSTRPDLTTAVVVGGTLV  126

Query  618  VTVPK  632
            VTVPK
Sbjct  127  VTVPK  131



>ref|XP_008386546.1| PREDICTED: uncharacterized protein LOC103449049 [Malus domestica]
Length=182

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 80/151 (53%), Gaps = 25/151 (17%)
 Frame = +3

Query  216  LFNLTVRSASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRF-VAEIGH  392
            L+++   S+S         +LRRLPHVF  VLELPF S+ DV V+E ++ F F VA   H
Sbjct  15   LYDVVASSSSM-----PPKKLRRLPHVFASVLELPFHSNADVSVQETSDSFIFSVAMPVH  69

Query  393  VAEHgcggggL------RAHAVEIHPGITKIVVRNNS-----RHQEGSSSVALFLEQMKL  539
            V         +      +AH +EI+PG+TK V+R        R  EG            L
Sbjct  70   VTTPTTARPVIGDRVAVQAHTIEIYPGVTKTVIRKTEGGDLWRLDEGVVD--------DL  121

Query  540  DTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            D WR+RLPA T+PEL RA     +L+VTVPK
Sbjct  122  DLWRYRLPASTRPELARATCTREELVVTVPK  152



>ref|XP_009367624.1| PREDICTED: uncharacterized protein LOC103957222 [Pyrus x bretschneideri]
Length=181

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 75/134 (56%), Gaps = 12/134 (9%)
 Frame = +3

Query  255  GSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRF-VAEIGHVAEHgcggggL--  425
             S    +LRRLPHVF  VLELP+ S+ DV V+E ++ F F VA   HV         +  
Sbjct  22   SSMPPRKLRRLPHVFASVLELPYHSNADVSVQETSDSFIFSVAMPVHVTTPTTTRQVIGD  81

Query  426  ----RAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQM-KLDTWRFRLPAFTQPELTR  590
                RAH VEI+PG+TK V+R      EG     L  E +  LD WR+RLPA  +PEL R
Sbjct  82   RVAVRAHTVEIYPGVTKTVIRKT----EGGDLWRLDGEVVDDLDLWRYRLPASARPELGR  137

Query  591  AAFVDGKLIVTVPK  632
            A     +L+VTVPK
Sbjct  138  ATCTREELVVTVPK  151



>ref|XP_010684360.1| PREDICTED: uncharacterized protein LOC104898930 [Beta vulgaris 
subsp. vulgaris]
Length=211

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 80/141 (57%), Gaps = 14/141 (10%)
 Frame = +3

Query  210  DPLFNLTVRSASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIG  389
            + +  ++V S SF +      +LRRLPHVF K LELPF  D DV VEE+ + F+F  ++ 
Sbjct  57   ESIMGISVTSNSFPNNK----KLRRLPHVFSKSLELPFDLDADVRVEEHHDCFKFSVKV-  111

Query  390  HVAEHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAF  569
               +HG    G  AH VE+HPGITK+V+R      +      L ++ ++ D W+ RLP  
Sbjct  112  ---DHGEIIDGFTAHVVEVHPGITKVVIRRRENLAQ------LIVDDLRFDVWQVRLPPC  162

Query  570  TQPELTRAAFVDGKLIVTVPK  632
             + EL    +  G+L+V VPK
Sbjct  163  ARAELATVDYDCGELVVKVPK  183



>ref|XP_004985621.1| PREDICTED: uncharacterized protein LOC101764334 [Setaria italica]
Length=157

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 67/119 (56%), Gaps = 10/119 (8%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPHV+ KVLELP  +D DV V E  + F F      VA    G G ++   V IHPG
Sbjct  16   LRRLPHVYSKVLELPLPADTDVEVFEGPDAFHF------VAAGARGTGMVQVRTVRIHPG  69

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            +TK+VVR                + M+LD WR RLP  + P +  A +VDG+L+VTVPK
Sbjct  70   VTKVVVRAGGTGGGDEPGA----DDMELDRWRSRLPEASCPAMAVAGYVDGQLVVTVPK  124



>ref|XP_002466161.1| hypothetical protein SORBIDRAFT_01g002570 [Sorghum bicolor]
 gb|EER93159.1| hypothetical protein SORBIDRAFT_01g002570 [Sorghum bicolor]
Length=131

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 69/111 (62%), Gaps = 9/111 (8%)
 Frame = +3

Query  306  VLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPGITKIVVRNNS  485
            VLELPF ++ DV VEE+A   RFV ++   +    G    RAHAVEIHPG+TK+V+R  S
Sbjct  2    VLELPFAAEVDVSVEEDAAALRFVVDVNGFSSPAGGP---RAHAVEIHPGVTKVVLRGLS  58

Query  486  --RHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
               H +   + A F    +LD WRFRLP  T+P +  A +  G+L+VTVPK
Sbjct  59   FGAHDDDDGAGAAF----ELDRWRFRLPPCTRPAVATATYAQGELVVTVPK  105



>gb|ACG42272.1| hypothetical protein [Zea mays]
Length=170

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 79/137 (58%), Gaps = 9/137 (7%)
 Frame = +3

Query  234  RSASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcg  413
            R AS   G+    +LRRLPH+F KVLELPF +D DV VEE+A   RFVA     +     
Sbjct  16   RCASAAAGALGGKKLRRLPHIFDKVLELPFAADADVSVEEDAAALRFVAAADEFS-----  70

Query  414  gggLRAHAVEIHPGITKIVVR----NNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPE  581
              G RAHAVEIHPG+TK+VVR    ++                 +LD WRFRLP  T+P 
Sbjct  71   LAGARAHAVEIHPGVTKVVVRGLSSSSLGGDGDDDDDGAAAAAFELDRWRFRLPPCTRPA  130

Query  582  LTRAAFVDGKLIVTVPK  632
            +  A +  G+L+VTVPK
Sbjct  131  MATATYAAGELVVTVPK  147



>tpg|DAA42569.1| TPA: hypothetical protein ZEAMMB73_945784 [Zea mays]
Length=170

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 79/137 (58%), Gaps = 9/137 (7%)
 Frame = +3

Query  234  RSASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcg  413
            R AS   G+    +LRRLPH+F KVLELPF +D DV VEE+A   RFVA     +     
Sbjct  16   RCASAAAGALGGKKLRRLPHIFDKVLELPFAADADVSVEEDAAALRFVAAADEFS-----  70

Query  414  gggLRAHAVEIHPGITKIVVR----NNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPE  581
              G RAHAVEIHPG+TK+VVR    ++                 +LD WRFRLP  T+P 
Sbjct  71   LAGARAHAVEIHPGVTKVVVRGLSSSSLGGDGDDDDDGAAAAAFELDRWRFRLPPCTRPA  130

Query  582  LTRAAFVDGKLIVTVPK  632
            +  A +  G+L+VTVPK
Sbjct  131  MATATYAAGELVVTVPK  147



>ref|NP_001143797.1| uncharacterized protein LOC100276567 [Zea mays]
 gb|ACG35423.1| hypothetical protein [Zea mays]
Length=170

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 79/137 (58%), Gaps = 9/137 (7%)
 Frame = +3

Query  234  RSASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcg  413
            R AS   G+    +LRRLPH+F KVLELPF +D DV VEE+A   RFVA     +     
Sbjct  16   RCASAAAGALGGKKLRRLPHIFDKVLELPFAADADVSVEEDAAALRFVAAADEFS-----  70

Query  414  gggLRAHAVEIHPGITKIVVR----NNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPE  581
              G RAHAVEIHPG+TK+VVR    ++                 +LD WRFRLP  T+P 
Sbjct  71   LAGARAHAVEIHPGVTKVVVRGLSSSSLGGDGDDDDDGAAAAXFELDRWRFRLPPCTRPA  130

Query  582  LTRAAFVDGKLIVTVPK  632
            +  A +  G+L+VTVPK
Sbjct  131  MATATYAAGELVVTVPK  147



>ref|NP_001142370.1| uncharacterized protein LOC100274542 [Zea mays]
 gb|ACF88329.1| unknown [Zea mays]
 gb|ACG40601.1| hypothetical protein [Zea mays]
 tpg|DAA43459.1| TPA: hypothetical protein ZEAMMB73_745813 [Zea mays]
Length=162

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 70/119 (59%), Gaps = 5/119 (4%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPHV+ KVLELP  +D DV V E  + F FVA     A        +R   V IHPG
Sbjct  16   LRRLPHVYSKVLELPLPADTDVQVFEGPDAFHFVAAP---AAGARAAATVRVRTVRIHPG  72

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            +TK+VV+  +  +  ++      + M+LD WR RLP  T P +  A +VDG+L+VTVPK
Sbjct  73   VTKVVVQAGAAER--AADDDAASDSMELDRWRSRLPEPTCPAMAVAGYVDGQLVVTVPK  129



>ref|XP_009370841.1| PREDICTED: uncharacterized protein LOC103960151 [Pyrus x bretschneideri]
Length=143

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 73/135 (54%), Gaps = 15/135 (11%)
 Frame = +3

Query  255  GSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRF-VAEIGHVAEHgcgggg---  422
             S    +LRRLPH+F  VLELPF S+ DV ++E ++ F F V+   HV            
Sbjct  8    SSTPPKKLRRLPHLFASVLELPFHSNADVSIQETSDSFIFSVSMPTHVPSPTTQRITGDH  67

Query  423  --LRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQM---KLDTWRFRLPAFTQPELT  587
              +RAH  EI+ G+TK V+R      +G      +L+      LD WR+RLPA T+PEL 
Sbjct  68   VAVRAHTTEIYSGVTKTVIRKT----DGGD--LWWLDGGVVDDLDLWRYRLPASTRPELA  121

Query  588  RAAFVDGKLIVTVPK  632
            R      KL+VTVPK
Sbjct  122  RTTCTGEKLVVTVPK  136



>gb|EMT17198.1| hypothetical protein F775_31080 [Aegilops tauschii]
Length=152

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 69/126 (55%), Gaps = 13/126 (10%)
 Frame = +3

Query  255  GSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAH  434
            G  A   LRRLPHV+ KVLELP  +D DV   E      F A  G + E       +RA 
Sbjct  12   GDGAKRALRRLPHVYSKVLELPLPADADVRAFEGTTALHFFAACGPMGE-------VRAR  64

Query  435  AVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKL  614
             V I+PG+ K+VV +     +       + + M+LD WR+RLP    PEL  A +VDG+L
Sbjct  65   LVRIYPGVVKVVVVHAGTGDD------EYGDDMELDRWRYRLPEDCCPELAMAGYVDGQL  118

Query  615  IVTVPK  632
            IVTVPK
Sbjct  119  IVTVPK  124



>ref|XP_002970016.1| hypothetical protein SELMODRAFT_92632 [Selaginella moellendorffii]
 gb|EFJ29140.1| hypothetical protein SELMODRAFT_92632 [Selaginella moellendorffii]
Length=137

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 78/140 (56%), Gaps = 17/140 (12%)
 Frame = +3

Query  216  LFNLTVRSASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRF-VAEIGH  392
            ++++   +++      ++  L+R+PH+F KVL+LPFRSD DV V E  E + F +   G 
Sbjct  4    VYDIEAAASAVPSTVTSSKPLKRMPHLFAKVLQLPFRSDKDVEVHETPECYMFAIQHSGL  63

Query  393  VAEHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFT  572
             AE       +R   +EI PG  K+VV   S     SSS     ++ ++D WRFRLP  T
Sbjct  64   AAED------VRVQVLEIVPGAVKVVVGLLS-----SSS-----DENQVDCWRFRLPPTT  107

Query  573  QPELTRAAFVDGKLIVTVPK  632
             PE TR  + D  L+VTVPK
Sbjct  108  SPEATRVEYSDEVLLVTVPK  127



>ref|XP_002993310.1| hypothetical protein SELMODRAFT_136850 [Selaginella moellendorffii]
 gb|EFJ05635.1| hypothetical protein SELMODRAFT_136850 [Selaginella moellendorffii]
Length=140

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 78/140 (56%), Gaps = 17/140 (12%)
 Frame = +3

Query  216  LFNLTVRSASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRF-VAEIGH  392
            ++++   +++      ++  L+R+PH+F KVL+LPFRSD DV V E  E + F +   G 
Sbjct  4    VYDIEAAASAVPSTVTSSKPLKRMPHLFAKVLQLPFRSDKDVEVHETPECYMFAIQHSGL  63

Query  393  VAEHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFT  572
             AE       +R   +EI PG  K+VV   S     SSS     ++ ++D WRFRLP  T
Sbjct  64   AAED------VRVQVLEIVPGAVKVVVGLLS-----SSS-----DENQVDCWRFRLPPTT  107

Query  573  QPELTRAAFVDGKLIVTVPK  632
             PE TR  + D  L+VTVPK
Sbjct  108  SPEATRVEYSDEVLLVTVPK  127



>ref|XP_006649433.1| PREDICTED: uncharacterized protein LOC102713804 [Oryza brachyantha]
Length=156

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 83/153 (54%), Gaps = 18/153 (12%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPHV+ KVLELP  +D DV V E  + F FVA     A      G +R   V IHPG
Sbjct  17   LRRLPHVYSKVLELPLPADTDVRVLEGPDAFHFVAA----AAGMGAAGEVRVRTVRIHPG  72

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPKg  635
            + ++VV      Q G+  V    + M+LD WR RLP  + P +  A +V+G+L+VTVPKG
Sbjct  73   VVRVVV------QAGAGGVE-DDDDMELDKWRSRLPEGSCPAMAVAGYVNGQLVVTVPKG  125

Query  636  gpggggrgELVNGRHAW-----GWGGSRIIRVQ  719
              G  G  E   G  AW     G   SR++ VQ
Sbjct  126  RDGSEGDNE--GGDEAWRCCNGGKISSRLVVVQ  156



>ref|XP_002894195.1| hypothetical protein ARALYDRAFT_891849 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70454.1| hypothetical protein ARALYDRAFT_891849 [Arabidopsis lyrata subsp. 
lyrata]
Length=120

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 66/103 (64%), Gaps = 11/103 (11%)
 Frame = +3

Query  327  SDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSS  506
            S+ DV VEE+ + FRFVAE       G       A+ VEIHPG+ KI+VR N     GSS
Sbjct  15   SEADVAVEESHDCFRFVAETDGGGGGGV-----GAYMVEIHPGVVKILVRTN-----GSS  64

Query  507  SVALFLEQMKLDTWRFRLPAFTQPEL-TRAAFVDGKLIVTVPK  632
            S+ L L++++LD WRFRLP  T+P+L T     DG+LI+TVPK
Sbjct  65   SLGLSLDELELDVWRFRLPESTRPDLVTVDCDGDGELIITVPK  107



>ref|XP_003558770.1| PREDICTED: uncharacterized protein LOC100840769 [Brachypodium 
distachyon]
Length=154

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 64/119 (54%), Gaps = 12/119 (10%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPHV+ KVLELP  +D  V   E+   F FVA     A        + A  V IHPG
Sbjct  18   LRRLPHVYSKVLELPLPADAHVAAFESPAAFHFVAPGSGAASE------VWARTVRIHPG  71

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            + K+VV      Q   +      + M+LD WR RLP  + P +  A FVDG+L+VTVPK
Sbjct  72   VVKVVV------QAAGAGDEDDDDGMELDRWRSRLPEESCPAMAVAGFVDGRLVVTVPK  124



>ref|XP_002465828.1| hypothetical protein SORBIDRAFT_01g046470 [Sorghum bicolor]
 gb|EER92826.1| hypothetical protein SORBIDRAFT_01g046470 [Sorghum bicolor]
Length=169

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 70/119 (59%), Gaps = 2/119 (2%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPG  455
            LRRLPHV+ KVLELP  +D DV V E  + F FVA          G G +R   V IHPG
Sbjct  20   LRRLPHVYSKVLELPLPADTDVEVFEGPDAFHFVAAP-PAGGGARGAGVVRVRTVRIHPG  78

Query  456  ITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
            +TK+VV+      EG +      + M+LD WR RLP  + P +  A +VDG+L+VTVPK
Sbjct  79   VTKVVVQAGDA-AEGVADDDDAGDSMELDRWRSRLPEPSCPAMAVAGYVDGQLVVTVPK  136



>dbj|BAJ87103.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=223

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 72/138 (52%), Gaps = 12/138 (9%)
 Frame = +3

Query  219  FNLTVRSASFMDGSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVA  398
            + + +  ++   G      LRRLPHV+ KVLELP  +D DV   E      F A  G + 
Sbjct  70   YRMGMHQSTTTHGDGPKKVLRRLPHVYSKVLELPLPADADVRAFEGTTALHFFAACGAMG  129

Query  399  EHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQP  578
            E       +RA  V I+PG+ K+VV +       +       + M+LD WR+RLP    P
Sbjct  130  E-------VRARLVRIYPGVVKVVVVHAG-----TGDGGEDGDDMELDRWRYRLPEDCCP  177

Query  579  ELTRAAFVDGKLIVTVPK  632
            EL  A +VDG+LIVTVPK
Sbjct  178  ELAMAGYVDGQLIVTVPK  195



>ref|XP_008355468.1| PREDICTED: uncharacterized protein LOC103419122 [Malus domestica]
Length=162

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 69/126 (55%), Gaps = 15/126 (12%)
 Frame = +3

Query  279  RRLPHVFGKVLELPFRSDDDVIVEENAEGFRF-VAEIGHVAEHgcgggg-----LRAHAV  440
            RRLPH+F  VLELPF S+ DV +++ ++ F F V+   HV              +RA  +
Sbjct  31   RRLPHLFASVLELPFHSNADVSIQKTSDSFIFSVSMPTHVPSPATQRITGDHVAVRAXTI  90

Query  441  EIHPGITKIVVRNNSRHQEGSSSVALFLEQM---KLDTWRFRLPAFTQPELTRAAFVDGK  611
            EI+PG+TK V+R      +GS     +L+      LD WR+RLPA T+P L R       
Sbjct  91   EIYPGVTKTVIRKT----DGSD--LWWLDGGVVDDLDLWRYRLPASTRPXLARTTCTGEX  144

Query  612  LIVTVP  629
            L+VTVP
Sbjct  145  LVVTVP  150



>gb|ABF94093.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAY88629.1| hypothetical protein OsI_10106 [Oryza sativa Indica Group]
 dbj|BAG94109.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58358.1| hypothetical protein OsJ_09490 [Oryza sativa Japonica Group]
Length=162

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 72/132 (55%), Gaps = 10/132 (8%)
 Frame = +3

Query  240  ASFMDGSAAAMR-LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcgg  416
            A+   GS    + LRRLPHV+ KVLELPF +D DV V E  + F FV     V+      
Sbjct  8    ATTAGGSCGGKKDLRRLPHVYSKVLELPFPADTDVAVFEGPDAFHFV-----VSAAAALA  62

Query  417  ggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAA  596
            G +R   V IHPG+ ++VV+                + M+LD WR RLP  + P +  A 
Sbjct  63   GEVRVRTVRIHPGVVRVVVQAGGG----GVHDDGDDDDMELDKWRSRLPEASCPAMAVAG  118

Query  597  FVDGKLIVTVPK  632
            +V+G+L+VTVPK
Sbjct  119  YVNGQLVVTVPK  130



>ref|NP_001049033.1| Os03g0159900 [Oryza sativa Japonica Group]
 dbj|BAF10947.1| Os03g0159900 [Oryza sativa Japonica Group]
Length=160

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 72/132 (55%), Gaps = 10/132 (8%)
 Frame = +3

Query  240  ASFMDGSAAAMR-LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcgg  416
            A+   GS    + LRRLPHV+ KVLELPF +D DV V E  + F FV     V+      
Sbjct  8    ATTAGGSCGGKKDLRRLPHVYSKVLELPFPADTDVAVFEGPDAFHFV-----VSAAAALA  62

Query  417  ggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAA  596
            G +R   V IHPG+ ++VV+                + M+LD WR RLP  + P +  A 
Sbjct  63   GEVRVRTVRIHPGVVRVVVQAGGG----GVHDDGDDDDMELDKWRSRLPEASCPAMAVAG  118

Query  597  FVDGKLIVTVPK  632
            +V+G+L+VTVPK
Sbjct  119  YVNGQLVVTVPK  130



>gb|AAN06850.1| Hypothetical protein [Oryza sativa Japonica Group]
Length=176

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 72/132 (55%), Gaps = 10/132 (8%)
 Frame = +3

Query  240  ASFMDGSAAAMR-LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcgg  416
            A+   GS    + LRRLPHV+ KVLELPF +D DV V E  + F FV     V+      
Sbjct  8    ATTAGGSCGGKKDLRRLPHVYSKVLELPFPADTDVAVFEGPDAFHFV-----VSAAAALA  62

Query  417  ggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAA  596
            G +R   V IHPG+ ++VV+                + M+LD WR RLP  + P +  A 
Sbjct  63   GEVRVRTVRIHPGVVRVVVQAGGG----GVHDDGDDDDMELDKWRSRLPEASCPAMAVAG  118

Query  597  FVDGKLIVTVPK  632
            +V+G+L+VTVPK
Sbjct  119  YVNGQLVVTVPK  130



>ref|XP_010327334.1| PREDICTED: uncharacterized protein LOC101261074 [Solanum lycopersicum]
Length=126

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 50/80 (63%), Gaps = 8/80 (10%)
 Frame = +3

Query  393  VAEHgcggggLRAHAVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFT  572
            VAE   G   +RAHAVEIHPG+TKIVVR  +   E         EQ+ +DTWR++LPA T
Sbjct  30   VAEREVGDRQVRAHAVEIHPGVTKIVVRKGNGDGED--------EQLNVDTWRYKLPALT  81

Query  573  QPELTRAAFVDGKLIVTVPK  632
             PEL    F +G L +T+PK
Sbjct  82   IPELATTVFANGDLKMTMPK  101



>ref|XP_006588633.1| PREDICTED: uncharacterized protein LOC100803421 [Glycine max]
Length=128

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 56/102 (55%), Gaps = 7/102 (7%)
 Frame = +3

Query  258  SAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHA  437
            S+ A +L RLPHVF K+LELPF S+DDV VEE  + FRFVA            GG+RA A
Sbjct  18   SSNAKKLLRLPHVFAKILELPFPSEDDVSVEETPQFFRFVASCN-------ADGGVRALA  70

Query  438  VEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLP  563
            ++I PGITKIV++                       WRFRLP
Sbjct  71   IDIFPGITKIVIKRMDGGDVAVPGQQQQQVPSGFGLWRFRLP  112



>gb|AEX12078.1| hypothetical protein 0_3499_01 [Pinus taeda]
Length=108

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 61/109 (56%), Gaps = 13/109 (12%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +L+R+PH+F +VLELPF SD  V  EE    FRFV +   +       G ++A  + I P
Sbjct  13   KLKRMPHIFSQVLELPFPSDFPVNCEETETAFRFVIKDPEMV----IDGAVKAEVLRIVP  68

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAF  599
            G  K+V+R  SR     S         +L+TWRFRLP +T P+ T A++
Sbjct  69   GAKKVVLRGVSRTGSALS---------ELETWRFRLPPYTNPDATSASY  108



>gb|AEX12066.1| hypothetical protein 0_3499_01 [Pinus taeda]
 gb|AEX12067.1| hypothetical protein 0_3499_01 [Pinus taeda]
 gb|AEX12069.1| hypothetical protein 0_3499_01 [Pinus taeda]
 gb|AEX12075.1| hypothetical protein 0_3499_01 [Pinus taeda]
 gb|AEX12076.1| hypothetical protein 0_3499_01 [Pinus taeda]
 gb|AEX12077.1| hypothetical protein 0_3499_01 [Pinus taeda]
 gb|AEX12079.1| hypothetical protein 0_3499_01 [Pinus taeda]
Length=108

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 61/109 (56%), Gaps = 13/109 (12%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +L+R+PH+F +VLELPF SD  V  EE    FRFV +   +       G ++A  + I P
Sbjct  13   KLKRMPHIFSQVLELPFPSDFPVNSEETETAFRFVIKDPEMV----IDGAVKAEVLRIVP  68

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAF  599
            G  K+V+R  SR     S         +L+TWRFRLP +T P+ T A++
Sbjct  69   GAKKVVLRGVSRTGSALS---------ELETWRFRLPPYTNPDATSASY  108



>ref|XP_004247294.1| PREDICTED: uncharacterized protein LOC101243739 [Solanum lycopersicum]
Length=109

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 66/116 (57%), Gaps = 12/116 (10%)
 Frame = +3

Query  276  LRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP-  452
            L RLPH+F    ELPFRS++DV VEE    FRF+ +I      G G G +R   VEIHP 
Sbjct  4    LSRLPHIFNYFQELPFRSNEDVAVEEKEVFFRFMEKIKL---EGSGDGQVRTLEVEIHPA  60

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDT-WRFRLPAFTQPELTRAAFVDGKLI  617
            G+ KIVV+  +   E  +       ++ +DT WR+ L A T PEL    FVDG L+
Sbjct  61   GLRKIVVKKGNAAGEDEN-------ELNVDTYWRYILTASTMPELAAVVFVDGDLM  109



>gb|AEX12070.1| hypothetical protein 0_3499_01 [Pinus taeda]
 gb|AEX12071.1| hypothetical protein 0_3499_01 [Pinus taeda]
 gb|AEX12080.1| hypothetical protein 0_3499_01 [Pinus taeda]
 gb|AEX12081.1| hypothetical protein 0_3499_01 [Pinus taeda]
Length=108

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 13/109 (12%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +L+R+PH+F +VLELPF SD  V  EE    FRFV +   +       G ++A  + I P
Sbjct  13   KLKRMPHIFSQVLELPFPSDFPVNSEETETAFRFVIKDPEMV----IDGTVKAEVLRIVP  68

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAF  599
            G  K+V+R  SR     S         +L+TWRFRLP  T P+ T A++
Sbjct  69   GAKKVVLRGVSRTGSALS---------ELETWRFRLPPCTNPDATSASY  108



>gb|AEX12072.1| hypothetical protein 0_3499_01 [Pinus taeda]
 gb|AEX12074.1| hypothetical protein 0_3499_01 [Pinus taeda]
Length=108

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 13/109 (12%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +L+R+PH+F +VLELPF SD  V  EE    FRFV +   +       G ++A  + I P
Sbjct  13   KLKRMPHIFSQVLELPFPSDFPVNSEETETAFRFVIKDPEMV----IDGAVKAEVLRIVP  68

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAF  599
            G  K+V+R  SR     S         +L+TWRFRLP  T P+ T A++
Sbjct  69   GAKKVVLRGVSRPGSALS---------ELETWRFRLPPCTNPDATSASY  108



>gb|AEX12068.1| hypothetical protein 0_3499_01 [Pinus taeda]
 gb|AEX12082.1| hypothetical protein 0_3499_01 [Pinus taeda]
Length=108

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 60/109 (55%), Gaps = 13/109 (12%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +L+R+PH+F +VLELP  SD  V  EE    FRFV +   +       G ++A  + I P
Sbjct  13   KLKRMPHIFSQVLELPLPSDFPVNSEETETAFRFVIKDPEMV----IDGTVKAEVLRIVP  68

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAF  599
            G  K+V+R  SR     S         +L+TWRFRLP +T P+ T A++
Sbjct  69   GAKKVVLRGVSRTGSALS---------ELETWRFRLPPYTNPDATSASY  108



>gb|AEX12073.1| hypothetical protein 0_3499_01 [Pinus taeda]
Length=108

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 59/109 (54%), Gaps = 13/109 (12%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +L+R+PH+F +VLELP  SD  V  EE    FRFV +   +       G ++A  + I P
Sbjct  13   KLKRMPHIFSQVLELPLPSDFPVNSEETETAFRFVIKDPEMV----IDGAVKAEVLRIVP  68

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAF  599
            G  K+V+R  SR     S         +L+TWRFRLP  T P+ T A++
Sbjct  69   GAKKVVLRGVSRTGSALS---------ELETWRFRLPPCTNPDATSASY  108



>gb|AEX12083.1| hypothetical protein 0_3499_01 [Pinus radiata]
Length=108

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 59/109 (54%), Gaps = 13/109 (12%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +L+R+PH+F +VLELP  SD  V  EE    FRFV +   +       G ++A  + I P
Sbjct  13   KLKRMPHIFSQVLELPLPSDFPVNSEETETAFRFVIKDPEMV----IDGAVKAEVLRIVP  68

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAF  599
            G  K+V+R  SR     S         +L+TWRFRLP  T P+ T A++
Sbjct  69   GAKKVVLRGVSRTGSALS---------ELETWRFRLPPCTNPDATSASY  108



>ref|XP_004247295.1| PREDICTED: uncharacterized protein LOC101244030 [Solanum lycopersicum]
Length=113

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 57/121 (47%), Gaps = 36/121 (30%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F   +ELPFRS+ DV VEE    FR                           
Sbjct  3    KLRRLPHIFNYFIELPFRSNADVAVEEKEGFFR---------------------------  35

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQMKLDT-WRFRLPAFTQPELTRAAFVDGKLIVTVP  629
             I KIVVR      E          ++ +DT WR+RL A T PEL    FVDG+LIV VP
Sbjct  36   -IRKIVVRKGIADGEDEH-------ELNVDTYWRYRLTASTMPELAMVVFVDGELIVMVP  87

Query  630  K  632
            K
Sbjct  88   K  88



>ref|XP_001763333.1| predicted protein [Physcomitrella patens]
 gb|EDQ71863.1| predicted protein [Physcomitrella patens]
Length=360

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 69/125 (55%), Gaps = 14/125 (11%)
 Frame = +3

Query  261  AAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRF-VAEIGHVAEHgcggggLRAHA  437
            +A  +L+R+PH+F ++LELP  ++  V V E+ + F+F + + G   ++      ++   
Sbjct  33   SATGKLKRMPHLFTRILELPLHAETPVKVVESRDSFQFEMQQPGSAVDN------VKVEV  86

Query  438  VEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLI  617
            +EI PG TK++VR   R           ++   +D WRFRLP  T PE + A +  G L 
Sbjct  87   LEIVPGATKVLVRGVERSSPD-------VDISDVDLWRFRLPPTTLPEKSFARYDHGTLF  139

Query  618  VTVPK  632
            +T+PK
Sbjct  140  ITIPK  144



>gb|EMS57859.1| hypothetical protein TRIUR3_34633 [Triticum urartu]
Length=180

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 57/114 (50%), Gaps = 13/114 (11%)
 Frame = +3

Query  255  GSAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAH  434
            G  A   LRRLPHV+ KVLELP  +D DV   E      F A  G + E       +RA 
Sbjct  12   GDGAKRALRRLPHVYSKVLELPLPADADVRAFEGTTALHFFAACGPMGE-------VRAR  64

Query  435  AVEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAA  596
             V I+PG+ K+VV +     +       + + M+LD WR+RLP    PEL  A 
Sbjct  65   LVRIYPGVVKVVVVHAGTGDDE------YGDDMELDRWRYRLPEDCCPELAMAG  112



>ref|XP_001785608.1| predicted protein [Physcomitrella patens]
 gb|EDQ49576.1| predicted protein [Physcomitrella patens]
Length=288

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 68/125 (54%), Gaps = 17/125 (14%)
 Frame = +3

Query  258  SAAAMRLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHA  437
            S +  +L+R+PH+F +VLELP  ++  V V E  + F F  ++  +A      G ++   
Sbjct  31   SLSLTKLKRMPHLFTRVLELPLHAETPVKVFELRDFFLFEVQLSELA-----VGDVKVEV  85

Query  438  VEIHPGITKIVVRNNSRHQEGSSSVALFLEQMKLDTWRFRLPAFTQPELTRAAFVDGKLI  617
            +EI PG TK++VR      E +S V  F        WRFRLP  T PE + A++  G L 
Sbjct  86   LEIVPGATKVLVRG----VEPTSPVVEF--------WRFRLPPTTLPEKSAASYDRGTLS  133

Query  618  VTVPK  632
            VT+PK
Sbjct  134  VTIPK  138



>gb|EAZ02932.1| hypothetical protein OsI_25072 [Oryza sativa Indica Group]
Length=115

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 4/86 (5%)
 Frame = +3

Query  273  RLRRLPHVFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP  452
            +LRRLPH+F KVLELPF +D DV VEE+A            A+     GG  AHAVEIHP
Sbjct  32   KLRRLPHIFAKVLELPFAADADVSVEEDAA----ALRFVAAADGFTPSGGASAHAVEIHP  87

Query  453  GITKIVVRNNSRHQEGSSSVALFLEQ  530
            G+TK+V+R+ S   +G       L++
Sbjct  88   GVTKVVLRDLSAGLDGDDGAVFELDR  113



>ref|XP_010326513.1| PREDICTED: uncharacterized protein LOC104649318 [Solanum lycopersicum]
Length=124

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 55/101 (54%), Gaps = 12/101 (12%)
 Frame = +3

Query  336  DVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHP-GITKIVVRNNSRHQEGSSSV  512
            DV VEE    FRF+ +I      G   G  R  AVEIHP G+  IVVR  + H E     
Sbjct  2    DVAVEEKEGFFRFLEKI---ELDGAADGQERTLAVEIHPEGVRNIVVRKGNAHGEDEH--  56

Query  513  ALFLEQMKLDT-WRFRLPAFTQPELTRAAFVDGKLIVTVPK  632
                 ++ +DT WR+RL A T PEL    FVDG+L+V VPK
Sbjct  57   -----ELNVDTYWRYRLTALTMPELGTVVFVDGELLVMVPK  92



>ref|XP_006598468.1| PREDICTED: uncharacterized protein LOC102668767 [Glycine max]
Length=219

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 38/61 (62%), Gaps = 7/61 (11%)
 Frame = +3

Query  294  VFGKVLELPFRSDDDVIVEENAEGFRFVAEIGHVAEHgcggggLRAHAVEIHPGITKIVV  473
            VF  VLELPF SD D+ VEE    FRF+AE   +         +RAH VEIHPG+ KI+V
Sbjct  156  VFSCVLELPFCSDTDMAVEEAPNFFRFMAETDGIGN-------VRAHTVEIHPGMKKIMV  208

Query  474  R  476
            +
Sbjct  209  K  209



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1985022489692